Pellino

Overview
NamePellino
Smed IDSMED30028571
Length (bp)1535
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Pellino (SMED30028571) t-SNE clustered cells

Violin plots show distribution of expression levels for Pellino (SMED30028571) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Pellino (SMED30028571) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Pellino (SMED30028571) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30028571

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30028571SMESG000081434.1 SMESG000029869.1 dd_Smed_v4_6534_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30028571SMESG000081434.1 SMESG000029869.1 dd_Smed_v4_6534_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30028571SMESG000081434.1 SMESG000029869.1 dd_Smed_v4_6534_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30028571SMESG000081434.1 SMESG000029869.1 dd_Smed_v4_6534_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30028571SMESG000029869.1 Contig48016uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30028571SMESG000029869.1 Contig48016newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
epidermisSMED30028571SMESG000081434.1 SMESG000029869.1 dd_Smed_v4_6534_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Pellino vs. Ensembl Human
Match: PELI2 (pellino E3 ubiquitin protein ligase family member 2 [Source:HGNC Symbol;Acc:HGNC:8828])

HSP 1 Score: 290.812 bits (743), Expect = 5.615e-93
Identity = 164/456 (35.96%), Postives = 238/456 (52.19%), Query Frame = 1
Query:  136 IVYGYLIVLGTNGRKSWRYSNNKKETNKLKVVQRSQANGIKQIKIGRFKEAKSSQAVQSKFRHAVSYTLSQDEAIVVEYGNDPETDMYQIGRCTEDQIDFVVNSVPLDKEYKNPKSPGPETVSRFACRIFISRQAPHVARIFAAGFDGNKNIFLGENAIKWEADKKIYDGFTTNGVMICHPLVDFDPDIRCPDALSKIKECQSSFANSSWREVSVSGAVYSCLSKRGVPQ-GKSRLDEDNILRDGTLIDLCGVTIIWRSE--YTDTEIEDNIISLCSKLNETHIQCPIGYQTLRISPDFSVWQIDDENKRKFLKAGSDXXXXXXXXXXXXXXXXXXXXLFNKDSCRPYVYLKCGHVHGFHEWKTVEDNNQC-RTCPLCKQRSPFVALVMGQETGFFLDLELPTYCFNPCGHMGSEATVKYWYSVALPNRKNSELSPRCPFCYVECTDKP--VRLIF 1485
            + YG L+VLG NG  +    +  +  ++  + +R +ANG+K   +      ++S+A+  K +H++SYTLS+++ +VVEY +D +TDM+Q+GR TE  IDFVV       +  +       T+SRFACRI   R  P+ ARIFAAGFD +KNIFLGE A KW+      DG TTNGV++ HP   F             +E Q       WRE+SV G VY+    R   Q GK    E N+L+DG+LIDLCG T++WR+      T  + +I +L  ++N    QCP+G  TL   P  +  ++ +E +                                     P+ YL CGHVHG+H W    D     R CP+C+   P+V L +G E GF++D   PT+ F PCGH+ SE + KYW  + LP+  ++     CPFC  +   +   ++LIF
Sbjct:   17 VKYGELVVLGYNG--ALPNGDRGRRKSRFALYKRPKANGVKPSTVHVISTPQASKAISCKGQHSISYTLSRNQTVVVEYTHDKDTDMFQVGRSTESPIDFVVTDTISGSQNTDEAQITQSTISRFACRIVCDRNEPYTARIFAAGFDSSKNIFLGEKAAKWKNPDGHMDGLTTNGVLVMHPRGGF------------TEESQPGV----WREISVCGDVYTLRETRSAQQRGKLVESETNVLQDGSLIDLCGATLLWRTADGLFHTPTQKHIEALRQEINAARPQCPVGLNTLAF-PSINRKEVVEEKQ-------------------------------------PWAYLSCGHVHGYHNWGHRSDTEANERECPMCRTVGPYVPLWLGCEAGFYVDAGPPTHAFTPCGHVCSEKSAKYWSQIPLPHGTHA-FHAACPFCATQLVGEQNCIKLIF 415          
BLAST of Pellino vs. Ensembl Human
Match: PELI1 (pellino E3 ubiquitin protein ligase 1 [Source:HGNC Symbol;Acc:HGNC:8827])

HSP 1 Score: 290.041 bits (741), Expect = 1.183e-92
Identity = 169/457 (36.98%), Postives = 243/457 (53.17%), Query Frame = 1
Query:  136 IVYGYLIVLGTNGRKSWRYSNNKKETNKLKVVQRSQANGIKQIKIGRFKEAKSSQAVQSKFRHAVSYTLSQDEAIVVEYGNDPETDMYQIGRCTEDQIDFVV-NSVPLDKEYKNPKSPGPETVSRFACRIFISRQAPHVARIFAAGFDGNKNIFLGENAIKWEADKKIYDGFTTNGVMICHPLVDFDPDIRCPDALSKIKECQSSFANSSWREVSVSGAVYSCLSKRGVPQ-GKSRLDEDNILRDGTLIDLCGVTIIWRSE--YTDTEIEDNIISLCSKLNETHIQCPIGYQTLRISPDFSVWQIDDENKRKFLKAGSDXXXXXXXXXXXXXXXXXXXXLFNKDSCRPYVYLKCGHVHGFHEWKTVED-NNQCRTCPLCKQRSPFVALVMGQETGFFLDLELPTYCFNPCGHMGSEATVKYWYSVALPNRKNSELSPRCPFCYVECTDKP--VRLIF 1485
            + YG LIVLG NG  S    +  +  ++  + +R +ANG+K   +      ++++A+ +K +H++SYTLS+ + +VVEY +D  TDM+QIGR TE  IDFVV ++VP  +   + +S    T+SRFACRI   R  P  ARI+AAGFD +KNIFLGE A KW+      DG TTNGV++ HP   F  D +                   WRE+SV G V+S    R   Q GK    E N L+DG+LIDLCG T++WR+    + T    ++ +L  ++N    QCP+G+ TL   P      + DE +                                     P+VYL CGHVHG+H W   E+ + + R CP+C+   P+V L +G E GF++D   PT+ F+PCGH+ SE T  YW  + LP+  ++     CPFC  +   +   +RLIF
Sbjct:   15 VKYGELIVLGYNG--SLPNGDRGRRKSRFALFKRPKANGVKPSTVHIACTPQAAKAISNKDQHSISYTLSRAQTVVVEYTHDSNTDMFQIGRSTESPIDFVVTDTVPGSQSNSDTQSVQ-STISRFACRIICERNPPFTARIYAAGFDSSKNIFLGEKAAKWKTSDGQMDGLTTNGVLVMHPRNGFTEDSK----------------PGIWREISVCGNVFSLRETRSAQQRGKMVEIETNQLQDGSLIDLCGATLLWRTAEGLSHTPTVKHLEALRQEINAARPQCPVGFNTLAF-PSMKRKDVVDEKQ-------------------------------------PWVYLNCGHVHGYHNWGNKEERDGKDRECPMCRSVGPYVPLWLGCEAGFYVDAGPPTHAFSPCGHVCSEKTTAYWSQIPLPHGTHT-FHAACPFCAHQLAGEQGYIRLIF 413          
BLAST of Pellino vs. Ensembl Human
Match: PELI3 (pellino E3 ubiquitin protein ligase family member 3 [Source:HGNC Symbol;Acc:HGNC:30010])

HSP 1 Score: 275.018 bits (702), Expect = 1.723e-86
Identity = 167/457 (36.54%), Postives = 233/457 (50.98%), Query Frame = 1
Query:  136 IVYGYLIVLGTNGRKSWRYSNNKKETNKLKVVQRSQANGIKQIKIGRFKEAKSSQAVQSKFRHAVSYTLSQDEAIVVEYGNDPETDMYQIGRCTEDQIDFVV-NSVPLDKEYKNPKSPGPETVSRFACRIFISRQAPHVARIFAAGFDGNKNIFLGENAIKWEADKKIYDGFTTNGVMICHPLVDFDPDIRCPDALSKIKECQSSFANSSWREVSVSGAVYSCLSKRGVPQ-GKSRLDEDNILRDGTLIDLCGVTIIWRSE--YTDTEIEDNIISLCSKLNETHIQCPIGYQTLRISPDFSVWQIDDENKRKFLKAGSDXXXXXXXXXXXXXXXXXXXXLFNKDSCRPYVYLKCGHVHGFHEWKT-VEDNNQCRTCPLCKQRSPFVALVMGQETGFFLDLELPTYCFNPCGHMGSEATVKYWYSVALPNRKNSELSPRCPFCYVECTDKP--VRLIF 1485
            I YG LIVLG NG       +  +  ++L + +RS ANG+K   +        S+A+ ++ +H++SYTLS+  +++VEY +D +TDM+QIGR TE+ IDFVV ++ P     + P +    T+SR+ACRI   R+ P+ ARI+AAGFD + NIFLGE A KW     + DG TTNGV++ HP   F  D                 A   WRE+SV G VY+    R   Q GK   +E N+L+DG+LIDLCG T++WR+            + +   + N    QCP+G  TL            D+ +                                     P+VY++CGHVHG+H W    E   Q R CPLC+   P+V L +GQE G  LD   P++ F PCGH+ SE T +YW    LP+  ++     CPFC    T +   VRLIF
Sbjct:   42 IKYGELIVLGYNG--CLASGDKGRRRSRLALSRRSHANGVKPDVMHHISTPLVSKALSNRGQHSISYTLSRSHSVIVEYTHDSDTDMFQIGRSTENMIDFVVTDTSPGGGAAEGPSAQ--STISRYACRILCDRRPPYTARIYAAGFDASSNIFLGERAAKWRTPDGLMDGLTTNGVLVMHPAGGFSED----------------SAPGVWREISVCGNVYTLRDSRSAQQRGKLVENESNVLQDGSLIDLCGATLLWRTPAGLLRAPTLKQLEAQRQEANAARPQCPVGLSTLAFPSPARGRTAPDKQQ-------------------------------------PWVYVRCGHVHGYHGWGCRRERGPQERECPLCRLVGPYVPLWLGQEAGLCLDPGPPSHAFAPCGHVCSEKTARYWAQTPLPHGTHA-FHAACPFCGAWLTGEHGCVRLIF 440          
BLAST of Pellino vs. Ensembl Human
Match: PELI3 (pellino E3 ubiquitin protein ligase family member 3 [Source:HGNC Symbol;Acc:HGNC:30010])

HSP 1 Score: 267.7 bits (683), Expect = 2.232e-83
Identity = 154/422 (36.49%), Postives = 214/422 (50.71%), Query Frame = 1
Query:  241 QANGIKQIKIGRFKEAKSSQAVQSKFRHAVSYTLSQDEAIVVEYGNDPETDMYQIGRCTEDQIDFVV-NSVPLDKEYKNPKSPGPETVSRFACRIFISRQAPHVARIFAAGFDGNKNIFLGENAIKWEADKKIYDGFTTNGVMICHPLVDFDPDIRCPDALSKIKECQSSFANSSWREVSVSGAVYSCLSKRGVPQ-GKSRLDEDNILRDGTLIDLCGVTIIWRSE--YTDTEIEDNIISLCSKLNETHIQCPIGYQTLRISPDFSVWQIDDENKRKFLKAGSDXXXXXXXXXXXXXXXXXXXXLFNKDSCRPYVYLKCGHVHGFHEWKT-VEDNNQCRTCPLCKQRSPFVALVMGQETGFFLDLELPTYCFNPCGHMGSEATVKYWYSVALPNRKNSELSPRCPFCYVECTDKP--VRLIF 1485
             ANG+K   +        S+A+ ++ +H++SYTLS+  +++VEY +D +TDM+QIGR TE+ IDFVV ++ P     + P +    T+SR+ACRI   R+ P+ ARI+AAGFD + NIFLGE A KW     + DG TTNGV++ HP   F  D                 A   WRE+SV G VY+    R   Q GK   +E N+L+DG+LIDLCG T++WR+            + +   + N    QCP+G  TL            D+ +                                     P+VY++CGHVHG+H W    E   Q R CPLC+   P+V L +GQE G  LD   P++ F PCGH+ SE T +YW    LP+  ++     CPFC    T +   VRLIF
Sbjct:   99 HANGVKPDVMHHISTPLVSKALSNRGQHSISYTLSRSHSVIVEYTHDSDTDMFQIGRSTENMIDFVVTDTSPGGGAAEGPSAQ--STISRYACRILCDRRPPYTARIYAAGFDASSNIFLGERAAKWRTPDGLMDGLTTNGVLVMHPAGGFSED----------------SAPGVWREISVCGNVYTLRDSRSAQQRGKLVENESNVLQDGSLIDLCGATLLWRTPAGLLRAPTLKQLEAQRQEANAARPQCPVGLSTLAFPSPARGRTAPDKQQ-------------------------------------PWVYVRCGHVHGYHGWGCRRERGPQERECPLCRLVGPYVPLWLGQEAGLCLDPGPPSHAFAPCGHVCSEKTARYWAQTPLPHGTHA-FHAACPFCGAWLTGEHGCVRLIF 464          
BLAST of Pellino vs. Ensembl Human
Match: PELI3 (pellino E3 ubiquitin protein ligase family member 3 [Source:HGNC Symbol;Acc:HGNC:30010])

HSP 1 Score: 264.233 bits (674), Expect = 7.137e-83
Identity = 162/457 (35.45%), Postives = 226/457 (49.45%), Query Frame = 1
Query:  151 LIVLGTNGRKSWRYSNNKKETNKLKVVQRSQAN----GIKQIKIGRFKEAK-SSQAVQSKFRHAVSYTLSQDEAIVVEYGNDPETDMYQIGRCTEDQIDFVV-NSVPLDKEYKNPKSPGPETVSRFACRIFISRQAPHVARIFAAGFDGNKNIFLGENAIKWEADKKIYDGFTTNGVMICHPLVDFDPDIRCPDALSKIKECQSSFANSSWREVSVSGAVYSCLSKRGVPQ-GKSRLDEDNILRDGTLIDLCGVTIIWRSE--YTDTEIEDNIISLCSKLNETHIQCPIGYQTLRISPDFSVWQIDDENKRKFLKAGSDXXXXXXXXXXXXXXXXXXXXLFNKDSCRPYVYLKCGHVHGFHEWKT-VEDNNQCRTCPLCKQRSPFVALVMGQETGFFLDLELPTYCFNPCGHMGSEATVKYWYSVALPNRKNSELSPRCPFCYVECTDKP--VRLIF 1485
            +++ G     S R S+ +   NK   V  S       G + IK G        S+A+ ++ +H++SYTLS+  +++VEY +D +TDM+QIGR TE+ IDFVV ++ P     + P +    T+SR+ACRI   R+ P+ ARI+AAGFD + NIFLGE A KW     + DG TTNGV++ HP   F  D                 A   WRE+SV G VY+    R   Q GK   +E N+L+DG+LIDLCG T++WR+            + +   + N    QCP+G  TL            D+ +                                     P+VY++CGHVHG+H W    E   Q R CPLC+   P+V L +GQE G  LD   P++ F PCGH+ SE T +YW    LP+  ++     CPFC    T +   VRLIF
Sbjct:    1 MVLEGNPEVGSPRTSDLQHRGNKGSCVLSSPGEDAQPGEEPIKYGELISTPLVSKALSNRGQHSISYTLSRSHSVIVEYTHDSDTDMFQIGRSTENMIDFVVTDTSPGGGAAEGPSAQ--STISRYACRILCDRRPPYTARIYAAGFDASSNIFLGERAAKWRTPDGLMDGLTTNGVLVMHPAGGFSED----------------SAPGVWREISVCGNVYTLRDSRSAQQRGKLVENESNVLQDGSLIDLCGATLLWRTPAGLLRAPTLKQLEAQRQEANAARPQCPVGLSTLAFPSPARGRTAPDKQQ-------------------------------------PWVYVRCGHVHGYHGWGCRRERGPQERECPLCRLVGPYVPLWLGQEAGLCLDPGPPSHAFAPCGHVCSEKTARYWAQTPLPHGTHA-FHAACPFCGAWLTGEHGCVRLIF 401          
BLAST of Pellino vs. Ensembl Celegans
Match: peli-1 (PELI1 and PELI2 related [Source:UniProtKB/TrEMBL;Acc:Q22967])

HSP 1 Score: 250.751 bits (639), Expect = 1.916e-77
Identity = 165/470 (35.11%), Postives = 239/470 (50.85%), Query Frame = 1
Query:  139 VYGYLIVLGTNGRKSWRYSNNKKETNKLKVVQRSQANGIKQIKIGRFKEAKSSQAVQSKFRHAVSYTLSQDEAIVVEYGNDPETDMYQIGRCTEDQIDFVVNS----VPLDKEYKNPKSPGPE---------TVSRFACRIFISRQAPHVARIFAAGFDGNKNIFLGENAIKWEADKKIYDGFTTNGVMICHPLVDFDPDIRCPDALSKIKECQSSFANSSWREVSVSGAVYSC-LSKRGVPQGKSRLDEDNILRDGTLIDLCGVTIIWRSE---YTDTEIEDNIISLCSKLNETHIQCPIGYQTLRISPDFSVWQIDDENKRKFLKAGSDXXXXXXXXXXXXXXXXXXXXLFNKDSCRPYVYLKCGHVHGFHEWKTVEDNNQ-CRTCPLCKQRSP-FVALVMGQETGFFLDLELPTYCFNPCGHMGSEATVKYWYSVALPNRKNSELSPRCPFCY-VECTDKP-VRLIF 1485
            +YG LI+LG NG+   R ++ +  T K+ + +R  ANGIK+  +     +  ++  + K RH VS+    ++++V+EY  DP  DM+QIGR ++DQIDF V      +P   +   P  P  +         T+SRFACRI I R+  + A ++AAGFD ++NI + + ++KW       DG TTNGV++ HP  D   D      + K            WREVS++G VY   +++    +G    +  N+L+DGTLIDLCG TI+WR+        ++ +  ++L  +LN    QCP+   TL I    +  QI   N+R+                                   PYVYL+CGHV G HEW   E++ Q    CP+C   S   V L MG E  F LD  +  + FNPCGHM S+ TV YW  + LP +      P CPFCY +  T++P VRLIF
Sbjct:   27 IYGELILLGFNGQAENRATSKRYLTKKV-LRRRDSANGIKKCTVHNVSTS-DTKLTKDKARHTVSFHSDSNKSVVIEYAADPSKDMFQIGRASDDQIDFTVIDTWMFLPEHSDAAVPARPQIDVLEKGDRTSTISRFACRILIDRENSNKAYLYAAGFDAHQNISINKKSLKWTKSNGEVDGLTTNGVLLLHPNKDDLLDDTVDKPMYK------------WREVSINGDVYEPRVTRSSSAKGVFVPEWTNMLQDGTLIDLCGATILWRTADGLERSPKMRELEMAL-DRLNAGRPQCPVNLNTLVIPKKRNGRQI---NRRQ-----------------------------------PYVYLQCGHVQGRHEWGVQENSGQRSGKCPICLVESERIVQLSMGMEPSFHLDSGVLDHTFNPCGHMASKQTVLYWSRIPLP-QGTCRYDPVCPFCYQLLATERPFVRLIF 442          
BLAST of Pellino vs. Ensembl Fly
Match: Pli (gene:FBgn0025574 transcript:FBtr0084527)

HSP 1 Score: 297.36 bits (760), Expect = 1.009e-95
Identity = 174/454 (38.33%), Postives = 246/454 (54.19%), Query Frame = 1
Query:  142 YGYLIVLGTNGRKSWRYSNNKKETNKLKVVQRSQANGIKQIKIGRFKEAKSSQAVQSKFRHAVSYTLSQDEAIVVEYGNDPETDMYQIGRCTEDQIDFVV-NSVPLDKEYKNPKSPGPETVSRFACRIFISRQAPHVARIFAAGFDGNKNIFLGENAIKWEADKKIYDGFTTNGVMICHPLVDFDPDIRCPDALSKIKECQSSFANSSWREVSVSGAVYSCLSKRGVPQ-GKSRLDEDNILRDGTLIDLCGVTIIWRSE--YTDTEIEDNIISLCSKLNETHIQCPIGYQTLRISPDFSVWQIDDENKRKFLKAGSDXXXXXXXXXXXXXXXXXXXXLFNKDSCRPYVYLKCGHVHGFHEWKTVEDNNQCRTCPLCKQRSPFVALVMGQETGFFLDLELPTYCFNPCGHMGSEATVKYWYSVALPNRKNSELSPRCPFCY--VECTDKPVRLIF 1485
            YG L++LG NG       +  +  +K  + +R++A+G+K+ K    +  ++S+A+    +H++SYTLS+++A++VEY  D ETDM+Q+GR +E  IDFVV +++P DK+          T+SRFACRI ++R  P  ARIFAAGFD ++NIFLGE A KW+ + +I DG TTNGV+I HP   F               C  +     WRE SV G V+S    R   Q G+   DE NIL+DGTLIDLCG T++WRS      +  + ++  L   +N    QCP+G  TL I    ++   D  N+                                     PYVYL CGHV G H+W   ++N   R CP+C +  P V L MG E  F++D+  PTY FNPCGHM +E TVKYW +V +P+  N      CPFC   ++     ++LIF
Sbjct:   28 YGELVILGYNGY--LPQGDRGRRRSKFVLHKRTEASGVKRSKHYIVQSPQTSKAILDANQHSISYTLSRNQAVIVEYKEDTETDMFQVGRSSESPIDFVVMDTLPGDKKDAKVMQ---STISRFACRILVNRCEPAKARIFAAGFDSSRNIFLGEKATKWQDNVEI-DGLTTNGVLIMHPKGSF---------------CGGNAKCGLWRECSVGGDVFSLRESRSAQQKGQPIYDECNILQDGTLIDLCGATLLWRSAEGLQHSPTKHDLEKLIDAINAGRPQCPVGLNTLVIPRKVNIG--DQVNQ-------------------------------------PYVYLNCGHVQGHHDWGQ-DENTGARRCPMCLELGPVVTLCMGLEPAFYVDVGAPTYAFNPCGHMATEKTVKYWANVEIPHGTNG-FQAVCPFCATPLDGATGYIKLIF 419          
BLAST of Pellino vs. Ensembl Fly
Match: Pli (gene:FBgn0025574 transcript:FBtr0112907)

HSP 1 Score: 297.36 bits (760), Expect = 1.009e-95
Identity = 174/454 (38.33%), Postives = 246/454 (54.19%), Query Frame = 1
Query:  142 YGYLIVLGTNGRKSWRYSNNKKETNKLKVVQRSQANGIKQIKIGRFKEAKSSQAVQSKFRHAVSYTLSQDEAIVVEYGNDPETDMYQIGRCTEDQIDFVV-NSVPLDKEYKNPKSPGPETVSRFACRIFISRQAPHVARIFAAGFDGNKNIFLGENAIKWEADKKIYDGFTTNGVMICHPLVDFDPDIRCPDALSKIKECQSSFANSSWREVSVSGAVYSCLSKRGVPQ-GKSRLDEDNILRDGTLIDLCGVTIIWRSE--YTDTEIEDNIISLCSKLNETHIQCPIGYQTLRISPDFSVWQIDDENKRKFLKAGSDXXXXXXXXXXXXXXXXXXXXLFNKDSCRPYVYLKCGHVHGFHEWKTVEDNNQCRTCPLCKQRSPFVALVMGQETGFFLDLELPTYCFNPCGHMGSEATVKYWYSVALPNRKNSELSPRCPFCY--VECTDKPVRLIF 1485
            YG L++LG NG       +  +  +K  + +R++A+G+K+ K    +  ++S+A+    +H++SYTLS+++A++VEY  D ETDM+Q+GR +E  IDFVV +++P DK+          T+SRFACRI ++R  P  ARIFAAGFD ++NIFLGE A KW+ + +I DG TTNGV+I HP   F               C  +     WRE SV G V+S    R   Q G+   DE NIL+DGTLIDLCG T++WRS      +  + ++  L   +N    QCP+G  TL I    ++   D  N+                                     PYVYL CGHV G H+W   ++N   R CP+C +  P V L MG E  F++D+  PTY FNPCGHM +E TVKYW +V +P+  N      CPFC   ++     ++LIF
Sbjct:   28 YGELVILGYNGY--LPQGDRGRRRSKFVLHKRTEASGVKRSKHYIVQSPQTSKAILDANQHSISYTLSRNQAVIVEYKEDTETDMFQVGRSSESPIDFVVMDTLPGDKKDAKVMQ---STISRFACRILVNRCEPAKARIFAAGFDSSRNIFLGEKATKWQDNVEI-DGLTTNGVLIMHPKGSF---------------CGGNAKCGLWRECSVGGDVFSLRESRSAQQKGQPIYDECNILQDGTLIDLCGATLLWRSAEGLQHSPTKHDLEKLIDAINAGRPQCPVGLNTLVIPRKVNIG--DQVNQ-------------------------------------PYVYLNCGHVQGHHDWGQ-DENTGARRCPMCLELGPVVTLCMGLEPAFYVDVGAPTYAFNPCGHMATEKTVKYWANVEIPHGTNG-FQAVCPFCATPLDGATGYIKLIF 419          
BLAST of Pellino vs. Ensembl Zebrafish
Match: peli2 (pellino E3 ubiquitin protein ligase family member 2 [Source:ZFIN;Acc:ZDB-GENE-040718-360])

HSP 1 Score: 290.812 bits (743), Expect = 5.274e-93
Identity = 163/457 (35.67%), Postives = 244/457 (53.39%), Query Frame = 1
Query:  136 IVYGYLIVLGTNGRKSWRYSNNKKETNKLKVVQRSQANGIKQIKIGRFKEAKSSQAVQSKFRHAVSYTLSQDEAIVVEYGNDPETDMYQIGRCTEDQIDFVVNSVPLDKEYKNPKSPGPETVSRFACRIFISRQAPHVARIFAAGFDGNKNIFLGENAIKWEADKKIYDGFTTNGVMICHPLVDFDPDIRCPDALSKIKECQSSFANSSWREVSVSGAVYSCLSKRGV-PQGKSRLDEDNILRDGTLIDLCGVTIIWRSE--YTDTEIEDNIISLCSKLNETHIQCPIGYQTLRISPDFSVWQIDDENKRKFLKAGSDXXXXXXXXXXXXXXXXXXXXLFNKDSCRPYVYLKCGHVHGFHEW--KTVEDNNQCRTCPLCKQRSPFVALVMGQETGFFLDLELPTYCFNPCGHMGSEATVKYWYSVALPNRKNSELSPRCPFCYVE--CTDKPVRLIF 1485
            + YG L+VLG NG  S    +  +  ++  + +R++ANG+K   +      ++S+AV  K +H++SYTLS+++ +VVEY +D +TDM+QIGR TE  IDFVV                  T+SRFACR+   R  P+ ARIFAAGFD +KNIFLGE A KW+      DG TTNGV++ HP   F  + +                   WRE+SV G VY+    R    +GK    E N+L+DG+L+DLCG T++WR+      T  + ++ +L  +LN    QCP+G  TL              + ++  +A S+                       ++  +P+VYL CGHVHG+H+W  ++  ++N  R CP+C+   P+V L +G E  F++D   PT+ F PCGH+ SE + +YW  + LP+  ++     CPFC  +   T K  +LIF
Sbjct:   17 VKYGELVVLGYNG--SLPNGDRGRRKSRFALYKRAKANGVKPSTVHILNTPQASKAVNCKGQHSISYTLSRNQTVVVEYSHDKDTDMFQIGRSTEGPIDFVVTDTVSGGGESEETPITQSTISRFACRVVCERNPPYTARIFAAGFDSSKNIFLGEKAAKWKNPDGHMDGLTTNGVLVMHPRGGFTEESK----------------PGVWREISVCGDVYTLRETRSAQTRGKLVESESNVLQDGSLVDLCGATLLWRTADGLFHTPTQKHLEALRQELNAARPQCPVGLNTLAFP-----------SMQRCSRALSNVPA--------------------QEDKQPWVYLACGHVHGYHDWGHRSERESNAQRECPMCRAVGPYVPLWLGCEPAFYVDTGAPTHVFVPCGHVCSEKSTRYWAEIPLPHGTHA-FHAACPFCATQLNLTQKWAKLIF 423          
BLAST of Pellino vs. Ensembl Zebrafish
Match: peli1b (pellino E3 ubiquitin protein ligase 1b [Source:ZFIN;Acc:ZDB-GENE-061027-372])

HSP 1 Score: 286.574 bits (732), Expect = 2.088e-91
Identity = 169/461 (36.66%), Postives = 241/461 (52.28%), Query Frame = 1
Query:  136 IVYGYLIVLGTNGRKSWRYSNNKKETNKLKVVQRSQANGIKQIKIGRFKEAKSSQAVQSKFRHAVSYTLSQDEAIVVEYGNDPETDMYQIGRCTEDQIDFVV-NSVPLDKEYKNPKSPGPETVSRFACRIFISRQAPHVARIFAAGFDGNKNIFLGENAIKWEADKKIYDGFTTNGVMICHPLVDFDPDIRCPDALSKIKECQSSFANSSWREVSVSGAVYSCLSKRGVPQ-GKSRLDEDNILRDGTLIDLCGVTIIWRSE--YTDTEIEDNIISLCSKLNETHIQCPIGYQTLRISPDFSVWQIDDENKRKFLKAGSDXXXXXXXXXXXXXXXXXXXXLFNKDSCRPYVYLKCGHVHGFHEWKTVED-----NNQCRTCPLCKQRSPFVALVMGQETGFFLDLELPTYCFNPCGHMGSEATVKYWYSVALPNRKNSELSPRCPFCYVECTDKP--VRLIF 1485
            + YG LIVLG NG  S    +  +  ++  + +R ++NG+K   +      ++++A+ +K +H++SYTLS+ + +VVEY  D  TDM+QIGR TE  IDFVV ++VP  +   + +S    T+SRFACRI   R  P+ ARI+AAGFD +KNIFLGE A KW+      DG TTNGV++ HP   F  D +                   WRE+SV G V++    R   Q GK   +E   L DG+LIDLCG T++WR+    + T    ++ +L  +LN    QCP+G+ TL   P      I DE +                                     P+VYL CGHVHG+H W   +        + R CP+C+ R P+V L +G E GF+LD   PT+ F+PCGH+ SE T  YW  + LP+  ++     CPFC  +   +   +RLIF
Sbjct:   18 VKYGELIVLGYNG--SLPNGDRGRRKSRFALFKRPKSNGVKPSTVHVACTPQAAKAISNKDQHSISYTLSRVQTVVVEYTQDSNTDMFQIGRSTESPIDFVVTDTVPGSQSNSDTQSVQ-STISRFACRIMCQRTPPYNARIYAAGFDSSKNIFLGEKAAKWKTSDGQMDGLTTNGVLVMHPRHGFTEDSK----------------PGVWREISVCGNVFTLRETRSAQQRGKMVENETQELVDGSLIDLCGATLLWRTAEGLSRTPTIKHLEALRQELNAARPQCPVGFNTLAF-PSMRRKDIVDEKQ-------------------------------------PWVYLNCGHVHGYHNWGNRDAERDGREGRERECPMCRARGPYVPLWLGCEAGFYLDAAPPTHAFSPCGHVCSEKTAAYWSQIPLPHGTHT-FHAACPFCAQQLNGEQGYIRLIF 420          
BLAST of Pellino vs. Ensembl Zebrafish
Match: peli1b (pellino E3 ubiquitin protein ligase 1b [Source:ZFIN;Acc:ZDB-GENE-061027-372])

HSP 1 Score: 286.574 bits (732), Expect = 2.088e-91
Identity = 169/461 (36.66%), Postives = 241/461 (52.28%), Query Frame = 1
Query:  136 IVYGYLIVLGTNGRKSWRYSNNKKETNKLKVVQRSQANGIKQIKIGRFKEAKSSQAVQSKFRHAVSYTLSQDEAIVVEYGNDPETDMYQIGRCTEDQIDFVV-NSVPLDKEYKNPKSPGPETVSRFACRIFISRQAPHVARIFAAGFDGNKNIFLGENAIKWEADKKIYDGFTTNGVMICHPLVDFDPDIRCPDALSKIKECQSSFANSSWREVSVSGAVYSCLSKRGVPQ-GKSRLDEDNILRDGTLIDLCGVTIIWRSE--YTDTEIEDNIISLCSKLNETHIQCPIGYQTLRISPDFSVWQIDDENKRKFLKAGSDXXXXXXXXXXXXXXXXXXXXLFNKDSCRPYVYLKCGHVHGFHEWKTVED-----NNQCRTCPLCKQRSPFVALVMGQETGFFLDLELPTYCFNPCGHMGSEATVKYWYSVALPNRKNSELSPRCPFCYVECTDKP--VRLIF 1485
            + YG LIVLG NG  S    +  +  ++  + +R ++NG+K   +      ++++A+ +K +H++SYTLS+ + +VVEY  D  TDM+QIGR TE  IDFVV ++VP  +   + +S    T+SRFACRI   R  P+ ARI+AAGFD +KNIFLGE A KW+      DG TTNGV++ HP   F  D +                   WRE+SV G V++    R   Q GK   +E   L DG+LIDLCG T++WR+    + T    ++ +L  +LN    QCP+G+ TL   P      I DE +                                     P+VYL CGHVHG+H W   +        + R CP+C+ R P+V L +G E GF+LD   PT+ F+PCGH+ SE T  YW  + LP+  ++     CPFC  +   +   +RLIF
Sbjct:   18 VKYGELIVLGYNG--SLPNGDRGRRKSRFALFKRPKSNGVKPSTVHVACTPQAAKAISNKDQHSISYTLSRVQTVVVEYTQDSNTDMFQIGRSTESPIDFVVTDTVPGSQSNSDTQSVQ-STISRFACRIMCQRTPPYNARIYAAGFDSSKNIFLGEKAAKWKTSDGQMDGLTTNGVLVMHPRHGFTEDSK----------------PGVWREISVCGNVFTLRETRSAQQRGKMVENETQELVDGSLIDLCGATLLWRTAEGLSRTPTIKHLEALRQELNAARPQCPVGFNTLAF-PSMRRKDIVDEKQ-------------------------------------PWVYLNCGHVHGYHNWGNRDAERDGREGRERECPMCRARGPYVPLWLGCEAGFYLDAAPPTHAFSPCGHVCSEKTAAYWSQIPLPHGTHT-FHAACPFCAQQLNGEQGYIRLIF 420          
BLAST of Pellino vs. Ensembl Zebrafish
Match: peli3 (pellino E3 ubiquitin protein ligase family member 3 [Source:ZFIN;Acc:ZDB-GENE-110304-4])

HSP 1 Score: 281.952 bits (720), Expect = 6.045e-89
Identity = 171/481 (35.55%), Postives = 234/481 (48.65%), Query Frame = 1
Query:  136 IVYGYLIVLGTNGRKSWRYSNNKKETNKLKVVQRSQANGIKQIKIGRFKEAKSSQAVQSKFRHAVSYTLSQDEAIVVEYGNDPETDMYQIGRCTEDQIDFVVNSVPLDKEYKNPKSPGP--------ETVSRFACRIFISRQAPHVARIFAAGFDGNKNIFLGENAIKWEADKKIYDGFTTNGVMICHPLVDFDPDIRCPDALSKIKECQSSFANSSWREVSVSGAVYSCLSKRGVPQ-GKSRLDEDNILRDGTLIDLCGVTIIWR--SEYTDTEIEDNIISLCSKLNETHIQCPIGYQTLRISPDFSVWQIDDENKRKFLKAGSDXXXXXXXXXXXXXXXXXXXXLFNKDSCRPYVYLKCGHVHGFHEW------------------KTVEDNNQCRTCPLCKQRSPFVALVMGQETGFFLDLELPTYCFNPCGHMGSEATVKYWYSVALPNRKNSELSPRCPFCYVECTDKP--VRLIF 1485
            I YG LIVLG NG  S    +  +  ++L + +R +ANG+K   I        S+A+ +K +H++SYTLS+  +++VEY +DP TDM+QIGR TE  IDFVV            +             T+SR+ACRI   R AP+ ARI+AAGFD +KNIFLGE A KW     + DG TTNGV++ HP  +F                 S  A   WRE+SV G V++    R   Q GK   +E N+L+DG+LIDLCG T++WR  S    T     + SL  +LN    QCP+G+ TL          ID +                                      +P+VY+ CGHVHG+H W                   T       R CP+C+   P+V L +G E G +LD   PT+ F PCGH+ SE TV+ W  + LP+  ++     CPFC    T +   ++LIF
Sbjct:   49 IKYGELIVLGHNG--SLASGDKGRRRSRLALYKRPKANGVKPDVIHNVSTPLVSKALSNKSQHSISYTLSRSHSVIVEYTHDPNTDMFQIGRSTESMIDFVVTDTASSGGGGQGQGGAGGEGGQSAQSTISRYACRIMCERSAPYTARIYAAGFDSSKNIFLGERAAKWRTSDGLMDGLTTNGVLVMHPAGEF----------------VSEPAPGVWREISVCGNVFALRETRSAQQRGKLVENESNMLQDGSLIDLCGATLLWRTPSGLRHTPTLKQLESLRQELNAARPQCPVGFNTLAFPSLAQRATIDKK--------------------------------------QPWVYMNCGHVHGYHNWGFRKEKAGVAAVALTGGGGTAPATTGERECPMCRGVGPYVPLWLGCEGGLYLDAGPPTHAFCPCGHVCSEKTVQGWSQIPLPHGTHA-FHAACPFCGTWLTGEQGYIKLIF 472          
BLAST of Pellino vs. Ensembl Zebrafish
Match: peli3 (pellino E3 ubiquitin protein ligase family member 3 [Source:ZFIN;Acc:ZDB-GENE-110304-4])

HSP 1 Score: 281.952 bits (720), Expect = 6.045e-89
Identity = 171/481 (35.55%), Postives = 234/481 (48.65%), Query Frame = 1
Query:  136 IVYGYLIVLGTNGRKSWRYSNNKKETNKLKVVQRSQANGIKQIKIGRFKEAKSSQAVQSKFRHAVSYTLSQDEAIVVEYGNDPETDMYQIGRCTEDQIDFVVNSVPLDKEYKNPKSPGP--------ETVSRFACRIFISRQAPHVARIFAAGFDGNKNIFLGENAIKWEADKKIYDGFTTNGVMICHPLVDFDPDIRCPDALSKIKECQSSFANSSWREVSVSGAVYSCLSKRGVPQ-GKSRLDEDNILRDGTLIDLCGVTIIWR--SEYTDTEIEDNIISLCSKLNETHIQCPIGYQTLRISPDFSVWQIDDENKRKFLKAGSDXXXXXXXXXXXXXXXXXXXXLFNKDSCRPYVYLKCGHVHGFHEW------------------KTVEDNNQCRTCPLCKQRSPFVALVMGQETGFFLDLELPTYCFNPCGHMGSEATVKYWYSVALPNRKNSELSPRCPFCYVECTDKP--VRLIF 1485
            I YG LIVLG NG  S    +  +  ++L + +R +ANG+K   I        S+A+ +K +H++SYTLS+  +++VEY +DP TDM+QIGR TE  IDFVV            +             T+SR+ACRI   R AP+ ARI+AAGFD +KNIFLGE A KW     + DG TTNGV++ HP  +F                 S  A   WRE+SV G V++    R   Q GK   +E N+L+DG+LIDLCG T++WR  S    T     + SL  +LN    QCP+G+ TL          ID +                                      +P+VY+ CGHVHG+H W                   T       R CP+C+   P+V L +G E G +LD   PT+ F PCGH+ SE TV+ W  + LP+  ++     CPFC    T +   ++LIF
Sbjct:   49 IKYGELIVLGHNG--SLASGDKGRRRSRLALYKRPKANGVKPDVIHNVSTPLVSKALSNKSQHSISYTLSRSHSVIVEYTHDPNTDMFQIGRSTESMIDFVVTDTASSGGGGQGQGGAGGEGGQSAQSTISRYACRIMCERSAPYTARIYAAGFDSSKNIFLGERAAKWRTSDGLMDGLTTNGVLVMHPAGEF----------------VSEPAPGVWREISVCGNVFALRETRSAQQRGKLVENESNMLQDGSLIDLCGATLLWRTPSGLRHTPTLKQLESLRQELNAARPQCPVGFNTLAFPSLAQRATIDKK--------------------------------------QPWVYMNCGHVHGYHNWGFRKEKAGVAAVALTGGGGTAPATTGERECPMCRGVGPYVPLWLGCEGGLYLDAGPPTHAFCPCGHVCSEKTVQGWSQIPLPHGTHA-FHAACPFCGTWLTGEQGYIKLIF 472          
BLAST of Pellino vs. Ensembl Xenopus
Match: mid1ip1 (MID1 interacting protein 1 [Source:Xenbase;Acc:XB-GENE-976463])

HSP 1 Score: 289.271 bits (739), Expect = 1.912e-92
Identity = 163/456 (35.75%), Postives = 238/456 (52.19%), Query Frame = 1
Query:  136 IVYGYLIVLGTNGRKSWRYSNNKKETNKLKVVQRSQANGIKQIKIGRFKEAKSSQAVQSKFRHAVSYTLSQDEAIVVEYGNDPETDMYQIGRCTEDQIDFVVNSVPLDKEYKNPKSPGPETVSRFACRIFISRQAPHVARIFAAGFDGNKNIFLGENAIKWEADKKIYDGFTTNGVMICHPLVDFDPDIRCPDALSKIKECQSSFANSSWREVSVSGAVYSCLSKRGVPQ-GKSRLDEDNILRDGTLIDLCGVTIIWRSE--YTDTEIEDNIISLCSKLNETHIQCPIGYQTLRISPDFSVWQIDDENKRKFLKAGSDXXXXXXXXXXXXXXXXXXXXLFNKDSCRPYVYLKCGHVHGFHEWKTVEDNN-QCRTCPLCKQRSPFVALVMGQETGFFLDLELPTYCFNPCGHMGSEATVKYWYSVALPNRKNSELSPRCPFCYVECTDKP--VRLIF 1485
            + YG L+VLG NG       +  +  ++  + +R ++NG++   +      ++S+A+ S+ +H++S+TLS+ + +VVEY +D +TDM+QIGR TE  IDFVV    +     +       T+SRFACRI   R  P+ ARIFAAGFD +KNIFLGE A KW+      DG TTNGV++ HP   F  + R                   WRE+SV G VY+    R   Q GK   +E NIL+DG+L+DLCG T++WR+      T  + +I +L  ++N    QCP+G  TL   P  +   + +E +                                     P+ YL CGHVHG+H W    D     R CP+C+   P+V L +G E GF++D   PT+ F PCGH+ SE + KYW  + LP+  ++     CPFC ++ T +   V+LIF
Sbjct:   17 VKYGELVVLGYNG--CLPNGDRGRRKSRFALFKRPKSNGVRASSVHVISTPQASKAISSRGQHSISFTLSRSQTVVVEYTHDKDTDMFQIGRSTESPIDFVVTDT-VSGNQNDETQITQSTISRFACRIVCDRNPPYTARIFAAGFDSSKNIFLGEKAAKWKNPDGHMDGLTTNGVLVMHPKGGFTEESR----------------PGVWREISVCGDVYTLRETRSAQQRGKLVENETNILQDGSLVDLCGATLLWRTADGLLHTPTQKHIEALRLEINAARPQCPVGLNTLAF-PSINRKDVVEEKQ-------------------------------------PWAYLTCGHVHGYHNWGHRSDTEVNERECPMCRTVGPYVPLWLGCEAGFYVDAGPPTHAFKPCGHVSSEKSAKYWSQIPLPHGTHA-FHAACPFCAIQLTGEESCVKLIF 414          
BLAST of Pellino vs. Ensembl Xenopus
Match: phf5a (PHD finger protein 5A [Source:Xenbase;Acc:XB-GENE-976801])

HSP 1 Score: 289.271 bits (739), Expect = 2.000e-92
Identity = 168/457 (36.76%), Postives = 244/457 (53.39%), Query Frame = 1
Query:  136 IVYGYLIVLGTNGRKSWRYSNNKKETNKLKVVQRSQANGIKQIKIGRFKEAKSSQAVQSKFRHAVSYTLSQDEAIVVEYGNDPETDMYQIGRCTEDQIDFVV-NSVPLDKEYKNPKSPGPETVSRFACRIFISRQAPHVARIFAAGFDGNKNIFLGENAIKWEADKKIYDGFTTNGVMICHPLVDFDPDIRCPDALSKIKECQSSFANSSWREVSVSGAVYSCLSKRGVPQ-GKSRLDEDNILRDGTLIDLCGVTIIWRSE--YTDTEIEDNIISLCSKLNETHIQCPIGYQTLRISPDFSVWQIDDENKRKFLKAGSDXXXXXXXXXXXXXXXXXXXXLFNKDSCRPYVYLKCGHVHGFHEWKTVED-NNQCRTCPLCKQRSPFVALVMGQETGFFLDLELPTYCFNPCGHMGSEATVKYWYSVALPNRKNSELSPRCPFCYVECTDKP--VRLIF 1485
            + YG LIVLG NG  S    +  +  ++  +++R +ANG+K   +      ++++A+ +K +H++SYTLS+ + +VVEY +D  TDM+QIGR TE  IDFVV ++VP  +   + +S    T+SRFACRI   R  P  A+I+AAGFD +KNIFLGE A KW+      DG TTNGV++ HP   F  D +                   WRE+SV G V+S    R   Q GK   +E N L+DG+LIDLCG T++WR+      T    ++ +L  ++N    QCP+G+ TL   P      + DE +                                     P+VYL CGHVHG+H W   E+ + + R CP+C+   P+V L +G E GF++D   PT+ F+PCGH+ SE T  YW  + LP+  ++     CPFC  +   +   +RLIF
Sbjct:   15 VKYGELIVLGYNG--SLPNGDRGRRKSRFALLKRLKANGVKPSTVHIACTPQAAKAISNKDQHSISYTLSRAQTVVVEYTHDSNTDMFQIGRSTESPIDFVVTDTVPGSQSNSDTQSVQ-STISRFACRIICERNPPFTAKIYAAGFDSSKNIFLGEKAAKWKTLDGQMDGLTTNGVLVMHPRNGFTEDSK----------------PGVWREISVCGNVFSLRETRSAQQRGKMVENESNELQDGSLIDLCGATLLWRTAEGLARTPTVKHLEALRQEINAARPQCPVGFNTLAF-PSMKRKDVVDEKQ-------------------------------------PWVYLNCGHVHGYHNWGNKEERDGKDRECPMCRSVGPYVPLWLGCEAGFYVDAGPPTHAFSPCGHVCSEKTTSYWSQIPLPHGTHT-FHAACPFCAHQLAGEQGYIRLIF 413          
BLAST of Pellino vs. Ensembl Mouse
Match: Peli1 (pellino 1 [Source:MGI Symbol;Acc:MGI:1914495])

HSP 1 Score: 289.656 bits (740), Expect = 9.546e-93
Identity = 169/457 (36.98%), Postives = 243/457 (53.17%), Query Frame = 1
Query:  136 IVYGYLIVLGTNGRKSWRYSNNKKETNKLKVVQRSQANGIKQIKIGRFKEAKSSQAVQSKFRHAVSYTLSQDEAIVVEYGNDPETDMYQIGRCTEDQIDFVV-NSVPLDKEYKNPKSPGPETVSRFACRIFISRQAPHVARIFAAGFDGNKNIFLGENAIKWEADKKIYDGFTTNGVMICHPLVDFDPDIRCPDALSKIKECQSSFANSSWREVSVSGAVYSCLSKRGVPQ-GKSRLDEDNILRDGTLIDLCGVTIIWRSE--YTDTEIEDNIISLCSKLNETHIQCPIGYQTLRISPDFSVWQIDDENKRKFLKAGSDXXXXXXXXXXXXXXXXXXXXLFNKDSCRPYVYLKCGHVHGFHEWKTVED-NNQCRTCPLCKQRSPFVALVMGQETGFFLDLELPTYCFNPCGHMGSEATVKYWYSVALPNRKNSELSPRCPFCYVECTDKP--VRLIF 1485
            + YG LIVLG NG  S    +  +  ++  + +R +ANG+K   +      ++++A+ +K +H++SYTLS+ + +VVEY +D  TDM+QIGR TE  IDFVV ++VP  +   + +S    T+SRFACRI   R  P  ARI+AAGFD +KNIFLGE A KW+      DG TTNGV++ HP   F  D +                   WRE+SV G V+S    R   Q GK    E N L+DG+LIDLCG T++WR+    + T    ++ +L  ++N    QCP+G+ TL   P      + DE +                                     P+VYL CGHVHG+H W   E+ + + R CP+C+   P+V L +G E GF++D   PT+ F+PCGH+ SE T  YW  + LP+  ++     CPFC  +   +   +RLIF
Sbjct:   15 VKYGELIVLGYNG--SLPNGDRGRRKSRFALFKRPKANGVKPSTVHIACTPQAAKAISNKDQHSISYTLSRAQTVVVEYTHDSNTDMFQIGRSTESPIDFVVTDTVPGSQSNSDTQSVQ-STISRFACRIICERSPPFTARIYAAGFDSSKNIFLGEKAAKWKTSDGQMDGLTTNGVLVMHPRNGFTEDSK----------------PGIWREISVCGNVFSLRETRSAQQRGKMVEIETNQLQDGSLIDLCGATLLWRTAEGLSHTPTVKHLEALRQEINAARPQCPVGFNTLAF-PSMKRKDVVDEKQ-------------------------------------PWVYLNCGHVHGYHNWGNKEERDGKDRECPMCRSVGPYVPLWLGCEAGFYVDAGPPTHAFSPCGHVCSEKTTAYWSQIPLPHGTHT-FHAACPFCAHQLAGEQGYIRLIF 413          
BLAST of Pellino vs. Ensembl Mouse
Match: Peli1 (pellino 1 [Source:MGI Symbol;Acc:MGI:1914495])

HSP 1 Score: 289.656 bits (740), Expect = 9.546e-93
Identity = 169/457 (36.98%), Postives = 243/457 (53.17%), Query Frame = 1
Query:  136 IVYGYLIVLGTNGRKSWRYSNNKKETNKLKVVQRSQANGIKQIKIGRFKEAKSSQAVQSKFRHAVSYTLSQDEAIVVEYGNDPETDMYQIGRCTEDQIDFVV-NSVPLDKEYKNPKSPGPETVSRFACRIFISRQAPHVARIFAAGFDGNKNIFLGENAIKWEADKKIYDGFTTNGVMICHPLVDFDPDIRCPDALSKIKECQSSFANSSWREVSVSGAVYSCLSKRGVPQ-GKSRLDEDNILRDGTLIDLCGVTIIWRSE--YTDTEIEDNIISLCSKLNETHIQCPIGYQTLRISPDFSVWQIDDENKRKFLKAGSDXXXXXXXXXXXXXXXXXXXXLFNKDSCRPYVYLKCGHVHGFHEWKTVED-NNQCRTCPLCKQRSPFVALVMGQETGFFLDLELPTYCFNPCGHMGSEATVKYWYSVALPNRKNSELSPRCPFCYVECTDKP--VRLIF 1485
            + YG LIVLG NG  S    +  +  ++  + +R +ANG+K   +      ++++A+ +K +H++SYTLS+ + +VVEY +D  TDM+QIGR TE  IDFVV ++VP  +   + +S    T+SRFACRI   R  P  ARI+AAGFD +KNIFLGE A KW+      DG TTNGV++ HP   F  D +                   WRE+SV G V+S    R   Q GK    E N L+DG+LIDLCG T++WR+    + T    ++ +L  ++N    QCP+G+ TL   P      + DE +                                     P+VYL CGHVHG+H W   E+ + + R CP+C+   P+V L +G E GF++D   PT+ F+PCGH+ SE T  YW  + LP+  ++     CPFC  +   +   +RLIF
Sbjct:   15 VKYGELIVLGYNG--SLPNGDRGRRKSRFALFKRPKANGVKPSTVHIACTPQAAKAISNKDQHSISYTLSRAQTVVVEYTHDSNTDMFQIGRSTESPIDFVVTDTVPGSQSNSDTQSVQ-STISRFACRIICERSPPFTARIYAAGFDSSKNIFLGEKAAKWKTSDGQMDGLTTNGVLVMHPRNGFTEDSK----------------PGIWREISVCGNVFSLRETRSAQQRGKMVEIETNQLQDGSLIDLCGATLLWRTAEGLSHTPTVKHLEALRQEINAARPQCPVGFNTLAF-PSMKRKDVVDEKQ-------------------------------------PWVYLNCGHVHGYHNWGNKEERDGKDRECPMCRSVGPYVPLWLGCEAGFYVDAGPPTHAFSPCGHVCSEKTTAYWSQIPLPHGTHT-FHAACPFCAHQLAGEQGYIRLIF 413          
BLAST of Pellino vs. Ensembl Mouse
Match: Peli2 (pellino 2 [Source:MGI Symbol;Acc:MGI:1891445])

HSP 1 Score: 285.804 bits (730), Expect = 3.087e-91
Identity = 163/456 (35.75%), Postives = 238/456 (52.19%), Query Frame = 1
Query:  136 IVYGYLIVLGTNGRKSWRYSNNKKETNKLKVVQRSQANGIKQIKIGRFKEAKSSQAVQSKFRHAVSYTLSQDEAIVVEYGNDPETDMYQIGRCTEDQIDFVVNSVPLDKEYKNPKSPGPETVSRFACRIFISRQAPHVARIFAAGFDGNKNIFLGENAIKWEADKKIYDGFTTNGVMICHPLVDFDPDIRCPDALSKIKECQSSFANSSWREVSVSGAVYSCLSKRGVPQ-GKSRLDEDNILRDGTLIDLCGVTIIWRSE--YTDTEIEDNIISLCSKLNETHIQCPIGYQTLRISPDFSVWQIDDENKRKFLKAGSDXXXXXXXXXXXXXXXXXXXXLFNKDSCRPYVYLKCGHVHGFHEWKTVEDNNQC-RTCPLCKQRSPFVALVMGQETGFFLDLELPTYCFNPCGHMGSEATVKYWYSVALPNRKNSELSPRCPFCYVECTDKP--VRLIF 1485
            + YG L+VLG NG  +    +  +  ++  + +R+ A+G+K   I      ++S+A+ S+  H++SYTLS+ + +VVEY +D +TDM+Q+GR TE  IDFVV       + ++ +     T+SRFACRI   R  P+ ARIFAAGFD +KNIFLGE A KW+      DG TTNGV++ HP   F             +E Q       WRE+SV G VY+    R   Q GK    E N+L+DG+LIDLCG T++WR+         + +I +L  ++N    QCP+G  TL   P  +  ++ +E +                                     P+ YL CGHVHG+H W    D     R CP+C+   P+V L +G E GF++D   PT+ F PCGH+ SE + KYW  + LP+  ++     CPFC  +   +   ++LIF
Sbjct:   17 VKYGELVVLGYNG--ALPNGDRGRRKSRFALYKRTYASGVKPSTIHMVSTPQASKAISSRGHHSISYTLSRSQTVVVEYTHDKDTDMFQVGRSTESPIDFVVTDTVSGGQNEDAQIT-QSTISRFACRIVCDRNEPYTARIFAAGFDSSKNIFLGEKAAKWKNPDGHMDGLTTNGVLVMHPQGGF------------TEESQPGV----WREISVCGDVYTLRETRSAQQRGKLVESETNVLQDGSLIDLCGATLLWRTADGLFHAPTQKHIEALRQEINAARPQCPVGLNTLAF-PSINRKEVVEEKQ-------------------------------------PWAYLSCGHVHGYHSWGHRSDTEANERECPMCRTVGPYVPLWLGCEAGFYVDAGPPTHAFTPCGHVCSEKSAKYWSQIPLPHGTHA-FHAACPFCATQLVGEQNCIKLIF 414          
BLAST of Pellino vs. Ensembl Mouse
Match: Peli3 (pellino 3 [Source:MGI Symbol;Acc:MGI:1924963])

HSP 1 Score: 271.166 bits (692), Expect = 3.738e-85
Identity = 164/457 (35.89%), Postives = 231/457 (50.55%), Query Frame = 1
Query:  136 IVYGYLIVLGTNGRKSWRYSNNKKETNKLKVVQRSQANGIKQIKIGRFKEAKSSQAVQSKFRHAVSYTLSQDEAIVVEYGNDPETDMYQIGRCTEDQIDFVV-NSVPLDKEYKNPKSPGPETVSRFACRIFISRQAPHVARIFAAGFDGNKNIFLGENAIKWEADKKIYDGFTTNGVMICHPLVDFDPDIRCPDALSKIKECQSSFANSSWREVSVSGAVYSCLSKRGVPQ-GKSRLDEDNILRDGTLIDLCGVTIIWRSE--YTDTEIEDNIISLCSKLNETHIQCPIGYQTLRISPDFSVWQIDDENKRKFLKAGSDXXXXXXXXXXXXXXXXXXXXLFNKDSCRPYVYLKCGHVHGFHEWKT-VEDNNQCRTCPLCKQRSPFVALVMGQETGFFLDLELPTYCFNPCGHMGSEATVKYWYSVALPNRKNSELSPRCPFCYVECTDKP--VRLIF 1485
            I YG LIVLG NG       +  +  ++L + +R  ANG+K   +        S+A+ ++ +H++S+TLS+  +++VEY +D + DM+QIGR TE+ IDFVV ++ P     + P +    T+SR+ACRI   R+ P+ ARI+AAGFD + NIFLGE A KW     + DG TTNGV++ HP   F  D                 A   WRE+SV G VY+    R   Q GK   +E N+L+DG+LIDLCG T++WR+            + +   + N    QCP+G  TL            D+ +                                     P+VY++CGHVHG+H W    E   Q R CPLC+   P+V L +GQE G  LD   P++ F PCGH+ SE T +YW    LP+  ++     CPFC    T +   VRLIF
Sbjct:   42 IKYGELIVLGYNG--CLASGDKGRRRSRLALSRRPHANGVKPDVMHHISTPLVSKALSNRGQHSISFTLSRSHSVIVEYTHDSDKDMFQIGRSTENMIDFVVTDTSPGGGATEGPSAQ--STISRYACRILCDRRPPYTARIYAAGFDASSNIFLGERAAKWRTPDGLMDGLTTNGVLVMHPAGGFSED----------------SAPGVWREISVCGNVYTLRDSRSAQQRGKLVENESNVLQDGSLIDLCGATLLWRTPAGLLRAPTLKQLEAQRQEANAARPQCPVGLSTLAFPSPARGRTAPDKQQ-------------------------------------PWVYVRCGHVHGYHGWGCRREQGPQERECPLCRLVGPYVPLWLGQEAGLCLDPGPPSHAFAPCGHVCSEKTARYWAQTPLPHGTHA-FHAACPFCGAWLTGELGCVRLIF 440          
BLAST of Pellino vs. Ensembl Mouse
Match: Peli3 (pellino 3 [Source:MGI Symbol;Acc:MGI:1924963])

HSP 1 Score: 224.172 bits (570), Expect = 1.552e-67
Identity = 153/457 (33.48%), Postives = 207/457 (45.30%), Query Frame = 1
Query:  136 IVYGYLIVLGTNGRKSWRYSNNKKETNKLKVVQRSQANGIKQIKIGRFKEAKSSQAVQSKFRHAVSYTLSQDEAIVVEYGNDPETDMYQIGRCTEDQIDFVV-NSVPLDKEYKNPKSPGPETVSRFACRIFISRQAPHVARIFAAGFDGNKNIFLGENAIKWEADKKIYDGFTTNGVMICHPLVDFDPDIRCPDALSKIKECQSSFANSSWREVSVSGAVYSCLSKRGVPQ-GKSRLDEDNILRDGTLIDLCGVTIIWRSE--YTDTEIEDNIISLCSKLNETHIQCPIGYQTLRISPDFSVWQIDDENKRKFLKAGSDXXXXXXXXXXXXXXXXXXXXLFNKDSCRPYVYLKCGHVHGFHEWKT-VEDNNQCRTCPLCKQRSPFVALVMGQETGFFLDLELPTYCFNPCGHMGSEATVKYWYSVALPNRKNSELSPRCPFCYVECTDKP--VRLIF 1485
            I YG LIVLG NG       +  +  ++L + +R  ANG+K                     H +S  L                 + +IGR TE+ IDFVV ++ P     + P +    T+SR+ACRI   R+ P+ ARI+AAGFD + NIFLGE A KW     + DG TTNGV++ HP   F  D                 A   WRE+SV G VY+    R   Q GK   +E N+L+DG+LIDLCG T++WR+            + +   + N    QCP+G  TL            D+ +                                     P+VY++CGHVHG+H W    E   Q R CPLC+   P+V L +GQE G  LD   P++ F PCGH+ SE T +YW    LP+  ++     CPFC    T +   VRLIF
Sbjct:   42 IKYGELIVLGYNG--CLASGDKGRRRSRLALSRRPHANGVK-----------------PDVMHHISTPL-----------------VSKIGRSTENMIDFVVTDTSPGGGATEGPSAQ--STISRYACRILCDRRPPYTARIYAAGFDASSNIFLGERAAKWRTPDGLMDGLTTNGVLVMHPAGGFSED----------------SAPGVWREISVCGNVYTLRDSRSAQQRGKLVENESNVLQDGSLIDLCGATLLWRTPAGLLRAPTLKQLEAQRQEANAARPQCPVGLSTLAFPSPARGRTAPDKQQ-------------------------------------PWVYVRCGHVHGYHGWGCRREQGPQERECPLCRLVGPYVPLWLGQEAGLCLDPGPPSHAFAPCGHVCSEKTARYWAQTPLPHGTHA-FHAACPFCGAWLTGELGCVRLIF 406          
BLAST of Pellino vs. UniProt/SwissProt
Match: sp|O77237|PELI_DROME (Protein pellino OS=Drosophila melanogaster OX=7227 GN=Pli PE=1 SV=1)

HSP 1 Score: 297.36 bits (760), Expect = 1.012e-94
Identity = 174/454 (38.33%), Postives = 246/454 (54.19%), Query Frame = 1
Query:  142 YGYLIVLGTNGRKSWRYSNNKKETNKLKVVQRSQANGIKQIKIGRFKEAKSSQAVQSKFRHAVSYTLSQDEAIVVEYGNDPETDMYQIGRCTEDQIDFVV-NSVPLDKEYKNPKSPGPETVSRFACRIFISRQAPHVARIFAAGFDGNKNIFLGENAIKWEADKKIYDGFTTNGVMICHPLVDFDPDIRCPDALSKIKECQSSFANSSWREVSVSGAVYSCLSKRGVPQ-GKSRLDEDNILRDGTLIDLCGVTIIWRSE--YTDTEIEDNIISLCSKLNETHIQCPIGYQTLRISPDFSVWQIDDENKRKFLKAGSDXXXXXXXXXXXXXXXXXXXXLFNKDSCRPYVYLKCGHVHGFHEWKTVEDNNQCRTCPLCKQRSPFVALVMGQETGFFLDLELPTYCFNPCGHMGSEATVKYWYSVALPNRKNSELSPRCPFCY--VECTDKPVRLIF 1485
            YG L++LG NG       +  +  +K  + +R++A+G+K+ K    +  ++S+A+    +H++SYTLS+++A++VEY  D ETDM+Q+GR +E  IDFVV +++P DK+          T+SRFACRI ++R  P  ARIFAAGFD ++NIFLGE A KW+ + +I DG TTNGV+I HP   F               C  +     WRE SV G V+S    R   Q G+   DE NIL+DGTLIDLCG T++WRS      +  + ++  L   +N    QCP+G  TL I    ++   D  N+                                     PYVYL CGHV G H+W   ++N   R CP+C +  P V L MG E  F++D+  PTY FNPCGHM +E TVKYW +V +P+  N      CPFC   ++     ++LIF
Sbjct:   28 YGELVILGYNGY--LPQGDRGRRRSKFVLHKRTEASGVKRSKHYIVQSPQTSKAILDANQHSISYTLSRNQAVIVEYKEDTETDMFQVGRSSESPIDFVVMDTLPGDKKDAKVMQ---STISRFACRILVNRCEPAKARIFAAGFDSSRNIFLGEKATKWQDNVEI-DGLTTNGVLIMHPKGSF---------------CGGNAKCGLWRECSVGGDVFSLRESRSAQQKGQPIYDECNILQDGTLIDLCGATLLWRSAEGLQHSPTKHDLEKLIDAINAGRPQCPVGLNTLVIPRKVNIG--DQVNQ-------------------------------------PYVYLNCGHVQGHHDWGQ-DENTGARRCPMCLELGPVVTLCMGLEPAFYVDVGAPTYAFNPCGHMATEKTVKYWANVEIPHGTNG-FQAVCPFCATPLDGATGYIKLIF 419          
BLAST of Pellino vs. UniProt/SwissProt
Match: sp|Q9HAT8|PELI2_HUMAN (E3 ubiquitin-protein ligase pellino homolog 2 OS=Homo sapiens OX=9606 GN=PELI2 PE=1 SV=1)

HSP 1 Score: 290.812 bits (743), Expect = 2.697e-92
Identity = 164/456 (35.96%), Postives = 238/456 (52.19%), Query Frame = 1
Query:  136 IVYGYLIVLGTNGRKSWRYSNNKKETNKLKVVQRSQANGIKQIKIGRFKEAKSSQAVQSKFRHAVSYTLSQDEAIVVEYGNDPETDMYQIGRCTEDQIDFVVNSVPLDKEYKNPKSPGPETVSRFACRIFISRQAPHVARIFAAGFDGNKNIFLGENAIKWEADKKIYDGFTTNGVMICHPLVDFDPDIRCPDALSKIKECQSSFANSSWREVSVSGAVYSCLSKRGVPQ-GKSRLDEDNILRDGTLIDLCGVTIIWRSE--YTDTEIEDNIISLCSKLNETHIQCPIGYQTLRISPDFSVWQIDDENKRKFLKAGSDXXXXXXXXXXXXXXXXXXXXLFNKDSCRPYVYLKCGHVHGFHEWKTVEDNNQC-RTCPLCKQRSPFVALVMGQETGFFLDLELPTYCFNPCGHMGSEATVKYWYSVALPNRKNSELSPRCPFCYVECTDKP--VRLIF 1485
            + YG L+VLG NG  +    +  +  ++  + +R +ANG+K   +      ++S+A+  K +H++SYTLS+++ +VVEY +D +TDM+Q+GR TE  IDFVV       +  +       T+SRFACRI   R  P+ ARIFAAGFD +KNIFLGE A KW+      DG TTNGV++ HP   F             +E Q       WRE+SV G VY+    R   Q GK    E N+L+DG+LIDLCG T++WR+      T  + +I +L  ++N    QCP+G  TL   P  +  ++ +E +                                     P+ YL CGHVHG+H W    D     R CP+C+   P+V L +G E GF++D   PT+ F PCGH+ SE + KYW  + LP+  ++     CPFC  +   +   ++LIF
Sbjct:   17 VKYGELVVLGYNG--ALPNGDRGRRKSRFALYKRPKANGVKPSTVHVISTPQASKAISCKGQHSISYTLSRNQTVVVEYTHDKDTDMFQVGRSTESPIDFVVTDTISGSQNTDEAQITQSTISRFACRIVCDRNEPYTARIFAAGFDSSKNIFLGEKAAKWKNPDGHMDGLTTNGVLVMHPRGGF------------TEESQPGV----WREISVCGDVYTLRETRSAQQRGKLVESETNVLQDGSLIDLCGATLLWRTADGLFHTPTQKHIEALRQEINAARPQCPVGLNTLAF-PSINRKEVVEEKQ-------------------------------------PWAYLSCGHVHGYHNWGHRSDTEANERECPMCRTVGPYVPLWLGCEAGFYVDAGPPTHAFTPCGHVCSEKSAKYWSQIPLPHGTHA-FHAACPFCATQLVGEQNCIKLIF 415          
BLAST of Pellino vs. UniProt/SwissProt
Match: sp|Q96FA3|PELI1_HUMAN (E3 ubiquitin-protein ligase pellino homolog 1 OS=Homo sapiens OX=9606 GN=PELI1 PE=1 SV=2)

HSP 1 Score: 290.041 bits (741), Expect = 5.684e-92
Identity = 169/457 (36.98%), Postives = 243/457 (53.17%), Query Frame = 1
Query:  136 IVYGYLIVLGTNGRKSWRYSNNKKETNKLKVVQRSQANGIKQIKIGRFKEAKSSQAVQSKFRHAVSYTLSQDEAIVVEYGNDPETDMYQIGRCTEDQIDFVV-NSVPLDKEYKNPKSPGPETVSRFACRIFISRQAPHVARIFAAGFDGNKNIFLGENAIKWEADKKIYDGFTTNGVMICHPLVDFDPDIRCPDALSKIKECQSSFANSSWREVSVSGAVYSCLSKRGVPQ-GKSRLDEDNILRDGTLIDLCGVTIIWRSE--YTDTEIEDNIISLCSKLNETHIQCPIGYQTLRISPDFSVWQIDDENKRKFLKAGSDXXXXXXXXXXXXXXXXXXXXLFNKDSCRPYVYLKCGHVHGFHEWKTVED-NNQCRTCPLCKQRSPFVALVMGQETGFFLDLELPTYCFNPCGHMGSEATVKYWYSVALPNRKNSELSPRCPFCYVECTDKP--VRLIF 1485
            + YG LIVLG NG  S    +  +  ++  + +R +ANG+K   +      ++++A+ +K +H++SYTLS+ + +VVEY +D  TDM+QIGR TE  IDFVV ++VP  +   + +S    T+SRFACRI   R  P  ARI+AAGFD +KNIFLGE A KW+      DG TTNGV++ HP   F  D +                   WRE+SV G V+S    R   Q GK    E N L+DG+LIDLCG T++WR+    + T    ++ +L  ++N    QCP+G+ TL   P      + DE +                                     P+VYL CGHVHG+H W   E+ + + R CP+C+   P+V L +G E GF++D   PT+ F+PCGH+ SE T  YW  + LP+  ++     CPFC  +   +   +RLIF
Sbjct:   15 VKYGELIVLGYNG--SLPNGDRGRRKSRFALFKRPKANGVKPSTVHIACTPQAAKAISNKDQHSISYTLSRAQTVVVEYTHDSNTDMFQIGRSTESPIDFVVTDTVPGSQSNSDTQSVQ-STISRFACRIICERNPPFTARIYAAGFDSSKNIFLGEKAAKWKTSDGQMDGLTTNGVLVMHPRNGFTEDSK----------------PGIWREISVCGNVFSLRETRSAQQRGKMVEIETNQLQDGSLIDLCGATLLWRTAEGLSHTPTVKHLEALRQEINAARPQCPVGFNTLAF-PSMKRKDVVDEKQ-------------------------------------PWVYLNCGHVHGYHNWGNKEERDGKDRECPMCRSVGPYVPLWLGCEAGFYVDAGPPTHAFSPCGHVCSEKTTAYWSQIPLPHGTHT-FHAACPFCAHQLAGEQGYIRLIF 413          
BLAST of Pellino vs. UniProt/SwissProt
Match: sp|Q8C669|PELI1_MOUSE (E3 ubiquitin-protein ligase pellino homolog 1 OS=Mus musculus OX=10090 GN=Peli1 PE=1 SV=2)

HSP 1 Score: 289.656 bits (740), Expect = 6.677e-92
Identity = 169/457 (36.98%), Postives = 243/457 (53.17%), Query Frame = 1
Query:  136 IVYGYLIVLGTNGRKSWRYSNNKKETNKLKVVQRSQANGIKQIKIGRFKEAKSSQAVQSKFRHAVSYTLSQDEAIVVEYGNDPETDMYQIGRCTEDQIDFVV-NSVPLDKEYKNPKSPGPETVSRFACRIFISRQAPHVARIFAAGFDGNKNIFLGENAIKWEADKKIYDGFTTNGVMICHPLVDFDPDIRCPDALSKIKECQSSFANSSWREVSVSGAVYSCLSKRGVPQ-GKSRLDEDNILRDGTLIDLCGVTIIWRSE--YTDTEIEDNIISLCSKLNETHIQCPIGYQTLRISPDFSVWQIDDENKRKFLKAGSDXXXXXXXXXXXXXXXXXXXXLFNKDSCRPYVYLKCGHVHGFHEWKTVED-NNQCRTCPLCKQRSPFVALVMGQETGFFLDLELPTYCFNPCGHMGSEATVKYWYSVALPNRKNSELSPRCPFCYVECTDKP--VRLIF 1485
            + YG LIVLG NG  S    +  +  ++  + +R +ANG+K   +      ++++A+ +K +H++SYTLS+ + +VVEY +D  TDM+QIGR TE  IDFVV ++VP  +   + +S    T+SRFACRI   R  P  ARI+AAGFD +KNIFLGE A KW+      DG TTNGV++ HP   F  D +                   WRE+SV G V+S    R   Q GK    E N L+DG+LIDLCG T++WR+    + T    ++ +L  ++N    QCP+G+ TL   P      + DE +                                     P+VYL CGHVHG+H W   E+ + + R CP+C+   P+V L +G E GF++D   PT+ F+PCGH+ SE T  YW  + LP+  ++     CPFC  +   +   +RLIF
Sbjct:   15 VKYGELIVLGYNG--SLPNGDRGRRKSRFALFKRPKANGVKPSTVHIACTPQAAKAISNKDQHSISYTLSRAQTVVVEYTHDSNTDMFQIGRSTESPIDFVVTDTVPGSQSNSDTQSVQ-STISRFACRIICERSPPFTARIYAAGFDSSKNIFLGEKAAKWKTSDGQMDGLTTNGVLVMHPRNGFTEDSK----------------PGIWREISVCGNVFSLRETRSAQQRGKMVEIETNQLQDGSLIDLCGATLLWRTAEGLSHTPTVKHLEALRQEINAARPQCPVGFNTLAF-PSMKRKDVVDEKQ-------------------------------------PWVYLNCGHVHGYHNWGNKEERDGKDRECPMCRSVGPYVPLWLGCEAGFYVDAGPPTHAFSPCGHVCSEKTTAYWSQIPLPHGTHT-FHAACPFCAHQLAGEQGYIRLIF 413          
BLAST of Pellino vs. UniProt/SwissProt
Match: sp|Q8BST6|PELI2_MOUSE (E3 ubiquitin-protein ligase pellino homolog 2 OS=Mus musculus OX=10090 GN=Peli2 PE=1 SV=2)

HSP 1 Score: 282.337 bits (721), Expect = 4.696e-89
Identity = 162/456 (35.53%), Postives = 237/456 (51.97%), Query Frame = 1
Query:  136 IVYGYLIVLGTNGRKSWRYSNNKKETNKLKVVQRSQANGIKQIKIGRFKEAKSSQAVQSKFRHAVSYTLSQDEAIVVEYGNDPETDMYQIGRCTEDQIDFVVNSVPLDKEYKNPKSPGPETVSRFACRIFISRQAPHVARIFAAGFDGNKNIFLGENAIKWEADKKIYDGFTTNGVMICHPLVDFDPDIRCPDALSKIKECQSSFANSSWREVSVSGAVYSCLSKRGVPQ-GKSRLDEDNILRDGTLIDLCGVTIIWRSE--YTDTEIEDNIISLCSKLNETHIQCPIGYQTLRISPDFSVWQIDDENKRKFLKAGSDXXXXXXXXXXXXXXXXXXXXLFNKDSCRPYVYLKCGHVHGFHEWKTVEDNNQC-RTCPLCKQRSPFVALVMGQETGFFLDLELPTYCFNPCGHMGSEATVKYWYSVALPNRKNSELSPRCPFCYVECTDKP--VRLIF 1485
            + Y  L+VLG NG  +    +  +  ++  + +R+ A+G+K   I      ++S+A+ S+  H++SYTLS+ + +VVEY +D +TDM+Q+GR TE  IDFVV       + ++ +     T+SRFACRI   R  P+ ARIFAAGFD +KNIFLGE A KW+      DG TTNGV++ HP   F             +E Q       WRE+SV G VY+    R   Q GK    E N+L+DG+LIDLCG T++WR+         + +I +L  ++N    QCP+G  TL   P  +  ++ +E +                                     P+ YL CGHVHG+H W    D     R CP+C+   P+V L +G E GF++D   PT+ F PCGH+ SE + KYW  + LP+  ++     CPFC  +   +   ++LIF
Sbjct:   17 VKYRELVVLGYNG--ALPNGDRGRRKSRFALYKRTYASGVKPSTIHMVSTPQASKAISSRGHHSISYTLSRSQTVVVEYTHDKDTDMFQVGRSTESPIDFVVTDTVSGGQNEDAQI-TQSTISRFACRIVCDRNEPYTARIFAAGFDSSKNIFLGEKAAKWKNPDGHMDGLTTNGVLVMHPQGGF------------TEESQPGV----WREISVCGDVYTLRETRSAQQRGKLVESETNVLQDGSLIDLCGATLLWRTADGLFHAPTQKHIEALRQEINAARPQCPVGLNTLAF-PSINRKEVVEEKQ-------------------------------------PWAYLSCGHVHGYHSWGHRSDTEANERECPMCRTVGPYVPLWLGCEAGFYVDAGPPTHAFTPCGHVCSEKSAKYWSQIPLPHGTHA-FHAACPFCATQLVGEQNCIKLIF 414          
BLAST of Pellino vs. TrEMBL
Match: A0A4S2LGM1 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_007373 PE=4 SV=1)

HSP 1 Score: 368.622 bits (945), Expect = 4.469e-119
Identity = 209/487 (42.92%), Postives = 271/487 (55.65%), Query Frame = 1
Query:  127 MTEIVYGYLIVLGTNGRKSWRYSNNKKETNKLKVVQRSQANGIKQIKIGRFKEAKSSQAVQSKFRHAVSYTLSQDEAIVVEYGNDPETDMYQIGRCTEDQIDFVV------------------------------NSVPLD-KEYKNPKSPGPETVSRFACRIFISRQAPHVARIFAAGFDGNKNIFLGENAIKWEADKKIYDGFTTNGVMICHPLVDFDPDIRCPDALSKIKECQSSFANSSWREVSVSGAVYSCLSKRGVPQGKSRLDEDNILRDGTLIDLCGVTIIWR--SEYTDTEIEDNIISLCSKLNETHIQCPIGYQTLRISPDFSVWQIDDENKRKFLKAGSDXXXXXXXXXXXXXXXXXXXXLFNKDSCRPYVYLKCGHVHGFHEWKTVEDNNQC-RTCPLCKQRSPFVALVMGQETGFFLDLELPTYCFNPCGHMGSEATVKYWYSVALPNRKNSELSPRCPFCYVECTDKPVRLIF 1485
            M E +YG L ++G NG + +   + ++++ K+ + +R  ANG++   + R  E   S AV+S  RH+VSYTLS+ E +VVEY  DP+TDM+QIGR T   IDFVV                              +++P++ K  ++  SP    VSRFACRI I R+ PH ARI+AAGFD  KNI LGE A+KW +   + DG TTNGVM+ H     DPD    D+L      Q + A + WREVS+ G +Y    KR +P  ++R+DEDN+LRD TLIDLCGVT+ WR  S  + T   D++  +   LN    QCPI Y+TLR+S   SV+     N      A +                        +    PYVYL CGHVHG+H W    + +   RTCPLC Q SPFV L MG E  F++D  L T+CFNPCGHM SE TV YW SV+LPN  N EL PRCPFC      KPVRL F
Sbjct:    1 MNETLYGELAIVGFNGTRKFSDRDPRRQS-KIALYKRPVANGVRPGPVNRVLEPGDSCAVRSHSRHSVSYTLSRHETVVVEYIPDPKTDMFQIGRSTNSHIDFVVQEPRPSGSSRKRHDRRLTVPQKPVDASTVPDAIPVNGKSLQDCPSPPESAVSRFACRIHIDREPPHTARIYAAGFDAAKNIVLGELAVKWRSQGHM-DGLTTNGVMVFH----ADPDSITSDSLHDNDNDQLT-AQAHWREVSIGGVLYEMRDKRCIPTMENRVDEDNVLRDKTLIDLCGVTLFWRSASSLSQTANTDDLRMMIDGLNLARFQCPIMYRTLRLS--LSVFPSKSNNSLFADDAPTQ----------------------TETPSEPYVYLNCGHVHGWHTWVGEANKDTVDRTCPLCLQPSPFVPLRMGLEPAFYIDRALATHCFNPCGHMASEKTVLYWCSVSLPNMHNFELRPRCPFCLTLIESKPVRLRF 456          
BLAST of Pellino vs. TrEMBL
Match: G7YGN4 (Pellino protein OS=Clonorchis sinensis OX=79923 GN=CLF_107366 PE=4 SV=1)

HSP 1 Score: 357.451 bits (916), Expect = 1.087e-113
Identity = 208/489 (42.54%), Postives = 267/489 (54.60%), Query Frame = 1
Query:  148 YLIVLGTNGRKSWRYSNNKKETNKLKVVQRSQANGIKQIKIGRFKEAKSSQAVQSKFRHAVSYTLSQDEAIVVEYGNDPETDMYQIGRCTEDQIDFVV------------------------------NSVPLD-KEYKNPKSPGPETVSRFACRIFISRQAPHVARIFAAGFDGNKNIFLGENAIKWEADKKIYDGFTTNGVMICHPLVDFDPDIRCPDALSKIKECQSSF---------ANSSWREVSVSGAVYSCLSKRGVPQGKSRLDEDNILRDGTLIDLCGVTIIWR--SEYTDTEIEDNIISLCSKLNETHIQCPIGYQTLRISPDFSVWQIDDENKRKFLKAGSDXXXXXXXXXXXXXXXXXXXXLFNKDSCRPYVYLKCGHVHGFHEWKTVEDNNQC-RTCPLCKQRSPFVALVMGQETGFFLDLELPTYCFNPCGHMGSEATVKYWYSVALPNRKNSELSPRCPFCYVECTDKPVRLIF 1485
            +L+VL  NG + +   + ++++ K+ + +R  ANG++   + R  E   S AV+S  RH+VSYTLS+ E +VVEY  DP+TDM+QIGR T   IDFVV                              +++P + K  ++  SP    VSRFACRI I R+ PH ARI+AAGFD  KNI LGE A+KW +   + DG TTNGVM+ H     DPD    D+L    +  S F         A + WREVS+ G +Y    KR +P  ++R+DEDN+LRD TLIDLCGVT+ WR  S  + T   D++  +   LN    QCPI Y+TLR+S   SV+     N      A S                        +    PYVYL CGHVHG+H W    + +   RTCPLC Q SPFV L MG E  F++D  L T+CFNPCGHM SE TV YW SV+LPN  N EL PRCPFC      KPVRL F
Sbjct:   78 FLVVLSFNGTRKFSDRDPRRQS-KIALYKRPVANGVRPGPVNRVLEPGDSCAVRSHSRHSVSYTLSRHETVVVEYIPDPKTDMFQIGRSTNSHIDFVVQEPRPSGSSRKRHDRRATVPQKPVDASTVPDAIPTNGKPLQDCPSPPESAVSRFACRIHIDREPPHTARIYAAGFDAAKNIVLGELAVKWRSQGHM-DGLTTNGVMVFH----ADPDSITSDSL---HDNDSKFLHLFGWWLTAQAHWREVSIGGVLYEMRDKRCIPTMENRVDEDNVLRDKTLIDLCGVTLFWRSASSLSQTANTDDLRMMIDGLNLARFQCPIMYRTLRLS--LSVFPSKSNNSLFADDAPSQ----------------------TETPSEPYVYLNCGHVHGWHTWVGEANKDTVDRTCPLCLQPSPFVPLRMGLEPAFYIDRALATHCFNPCGHMASEKTVVYWCSVSLPNMHNFELRPRCPFCLTLIDSKPVRLRF 533          
BLAST of Pellino vs. TrEMBL
Match: A0A5K4F1L3 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 344.354 bits (882), Expect = 1.425e-109
Identity = 194/482 (40.25%), Postives = 273/482 (56.64%), Query Frame = 1
Query:  133 EIVYGYLIVLGTNGRKSWRYSNNKKETNKLKVVQRSQANGIKQIKIGRFKEAKSSQAVQSKFRHAVSYTLSQDEAIVVEYGNDPETDMYQIGRCTEDQIDFVV------------------NSVPLDKEYKNPKSPGPETVSRFACRIFISRQAPHVARIFAAGFDGNKNIFLGENAIKWEADKKIYDGFTTNGVMICHPLVDFDPDIRCPDA--LSKIKECQSSFAN--SSWREVSVSGAVYSCLSKRGVPQGKSRLDEDNILRDGTLIDLCGVTIIWRSE--YTDTEIEDNIISLCSKLNETHIQCPIGYQTLRI-----SPDFSVWQ--IDDENKRKFLKAGSDXXXXXXXXXXXXXXXXXXXXLFNKDSCRPYVYLKCGHVHGFHEWKTVEDNNQCRTCPLCKQRSPFVALVMGQETGFFLDLELPTYCFNPCGHMGSEATVKYWYSVALPNRKNSELSPRCPFCYVECTDKPVRLIF 1485
            ++ YG L +LG NG  +  + N  + T+K+ + +R +ANG++   + +  +A++S AV ++   A+S+TLS++  +VVEY  DP+ DM+QIGR T++ IDFVV                  N    D    + +      VSRFACRI I R  P+ AR++AAGFD + NIFLGE AIKW+ D  + DG TTNGVM+          +R P A  + +  +     +N  S WREVSV G+VY   S R VP   + + EDNIL D T+IDLCGVT++WRS      T   ++++ + + LN+ HIQCP+ Y+TL++     S  FS     ++ EN    L   S   + +                       PYVY+ CGHVHG+H W+ V D N  RTCPLC Q S F+ L MG E+ F++D  L T+CFNPCGH+ SE TV+YW ++ L NR N EL  RCPFC  +   KPV+L+F
Sbjct:    4 QVFYGELAILGLNGALA-EFGNTARHTSKISLFKRREANGVRPGPVNKVPKARNSVAVTNRNTPAISFTLSRNVTVVVEYVPDPKVDMFQIGRSTDNHIDFVVSEPKPSVSENDQQHINNNNKQCKDNSKDSSRGNYESAVSRFACRIHIDRDPPYTARLYAAGFDASNNIFLGERAIKWKCDNSM-DGLTTNGVMM----------LRIPPAKIIEQTNQASDRDSNIRSQWREVSVCGSVYEMRSNRCVP--TNLVKEDNILTDMTIIDLCGVTLLWRSRSGLKYTACPEDLMKMINGLNQAHIQCPVLYRTLKLPLLPQSTHFSPHSDIVNIENNNGILNDDSALSKLESDQISPDQM--------------PYVYVSCGHVHGWHNWRAVGDVNSRRTCPLCLQTSLFIPLRMGIESAFYVDRSLATHCFNPCGHIASENTVRYWCNLQLLNRYNFELHARCPFCLTQIHSKPVKLLF 457          
BLAST of Pellino vs. TrEMBL
Match: A0A3S3P333 (Protein pellino-like protein OS=Dinothrombium tinctorium OX=1965070 GN=B4U79_04043 PE=4 SV=1)

HSP 1 Score: 323.939 bits (829), Expect = 3.606e-102
Identity = 180/459 (39.22%), Postives = 249/459 (54.25%), Query Frame = 1
Query:  136 IVYGYLIVLGTNGRKSWRYSNNKKETNKLKVVQRSQANGIKQIKIGRFKEAKSSQAVQSKFRHAVSYTLSQDEAIVVEYGNDPETDMYQIGRCTEDQIDFVVNSVPLDKEYKNPKSPGPETVSRFACRIFISRQAPHVARIFAAGFDGNKNIFLGENAIKWEADKKIYDGFTTNGVMICHPLVDFDPDIR-CPDALSKIKECQSSFANSSWREVSVSGAVYSCLSKRGVPQGKSRLD-EDNILRDGTLIDLCGVTIIWRSE--YTDTEIEDNIISLCSKLNETHIQCPIGYQTLRISPDFSVWQIDDENKRKFLKAGSDXXXXXXXXXXXXXXXXXXXXLFNKDSCRPYVYLKCGHVHGFHEWKTVEDNNQCRTCPLCKQRSPFVALVMGQETGFFLDLELPTYCFNPCGHMGSEATVKYWYSVALPNRKNSELSPRCPFCYVECTDKP--VRLIFS*H 1494
            +++G L++LG NG          +  +K  + +RS ANGIK+ K    K+ + ++A+Q K +H++SYTLS+++A++VEY  D ETDM+QIGR +E  IDFVV   P   + +N +     T+SRFACRI I R  P+ ARIFAAGFD ++NIFLGE A KW+ + +I DG TTNG++I HP   F  ++   PD+L   ++      N  WREVSV G VY+    R   Q  ++++ E N+L DGTLIDLCG T++WRS      +  +  +  +   LN    QCP+G  TL I    +     D+                                      +PYVYL CGHV G H+W   +  N  RTCP+C    P V L MG E  F++D   P + FNPCGHM SE TV++W S+A+P+  N      CPFC          VRLIF  H
Sbjct:   47 VIFGELVILGYNG--CLPQGEKGRRKSKYILYRRSHANGIKKSKHYTVKQPQQTKAIQDKGQHSISYTLSRNQAVIVEYTPDEETDMFQIGRSSESPIDFVVIDTPTPDKTENDRMSQQSTISRFACRILIERSPPYTARIFAAGFDSSRNIFLGEKATKWQHNGEI-DGLTTNGILIMHPKGSFCGNVAYVPDSLKGQEK------NCLWREVSVCGGVYAIRETRSASQKGAKIENETNVLLDGTLIDLCGATLLWRSAEGLKHSPTKKQLEEMIDDLNAARPQCPVGLNTLVIPRKTATLSESDK--------------------------------------QPYVYLNCGHVQGLHDWGQNKTTN-ARTCPMCLSVGPIVKLSMGMEPSFYVDCASPEFAFNPCGHMASERTVRFWSSIAIPHGTNG-FHSMCPFCATPLQGDLGFVRLIFQDH 456          
BLAST of Pellino vs. TrEMBL
Match: A0A210PQ55 (Protein pellino OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT09929 PE=4 SV=1)

HSP 1 Score: 320.087 bits (819), Expect = 5.406e-101
Identity = 185/459 (40.31%), Postives = 248/459 (54.03%), Query Frame = 1
Query:  136 IVYGYLIVLGTNGRKSWRYSNNKKETNKLKVVQRSQANGIKQIKIGRFKEAKSSQAVQSKFRHAVSYTLSQDEAIVVEYGNDPETDMYQIGRCTEDQIDFVV-NSVPLDKEYKNPKSPGPETVSRFACRIFISRQAPHVARIFAAGFDGNKNIFLGENAIKWEADKKIYDGFTTNGVMICHPLVDFDPDIRCPDALSKIKECQSSFANSSWREVSVSGAVYSCLSKRGVPQGKSR-LDEDNILRDGTLIDLCGVTIIWRSE--YTDTEIEDNIISLCSKLNETHIQCPIGYQTLRISPDFSVWQIDDENKRKFLKAGSDXXXXXXXXXXXXXXXXXXXXLFNKDSCRPYVYLKCGHVHGFHEWKTVEDNNQCRTCPLCKQRSPFVALVMGQETGFFLDLELPTYCFNPCGHMGSEATVKYWYSVALPNRKNSELSPRCPFCYVECTDKP--VRLIFS*H 1494
            I +G L++LG NG       +  +  +K  + ++   NG+K  +    K  +SS+AVQ   +H+VSYTLS+++A++VEY  DP TDMYQIGR +E  ID+VV +++P ++   N  S    T+SRFACRI + R  P+ ARIFAAGFD  +NIFLGE A+KW + ++I DG TTNGV I  P   F+P                +     WREVSV GA+Y     R  P   ++ LDEDNIL DGT+IDLCG T++WRS      +  E    +L  ++N    QCP+G  TL + P     ++ D+                                      +PYVYL CGHVHG H+W   E  N  RTCPLC +  PFV L MG E   ++D E PT+CFNPCGH+ SEATV+YW  V +P+         CPFC       P  V+LIF  H
Sbjct:   32 IKFGELVILGYNGH--LPNGDKGRRKSKFILAKKIAGNGVKPYRKHIVKNPQSSKAVQDTHQHSVSYTLSRNQAVIVEYKQDPNTDMYQIGRSSEVPIDYVVMDTIPGNQRTAN-DSITQSTISRFACRILLERDPPYTARIFAAGFDSGRNIFLGEKAVKWYSGEEI-DGLTTNGVFIMQPQGGFNP----------------TGKPGVWREVSVGGAIYPLRESRSAPLKSNQILDEDNILHDGTVIDLCGATLLWRSALGLITSPSEHEFQTLVEEINAGRPQCPVGLMTL-VLPSKGTLELSDK--------------------------------------QPYVYLSCGHVHGQHQWGQKE--NDSRTCPLCIKDGPFVKLKMGCELSVYVDSEPPTHCFNPCGHIASEATVRYWSLVPVPHGCQG-FQAVCPFCATPLHADPGYVKLIFQDH 428          
BLAST of Pellino vs. Ensembl Cavefish
Match: peli1b (pellino E3 ubiquitin protein ligase 1 [Source:NCBI gene;Acc:103032233])

HSP 1 Score: 286.96 bits (733), Expect = 1.134e-91
Identity = 168/462 (36.36%), Postives = 234/462 (50.65%), Query Frame = 1
Query:  136 IVYGYLIVLGTNGRKSWRYSNNKKETNKLKVVQRSQANGIKQIKIGRFKEAKSSQAVQSKFRHAVSYTLSQDEAIVVEYGNDPETDMYQIGRCTEDQIDFVVNSVPLDKEYKNPKSPGPETVSRFACRIFISRQAPHVARIFAAGFDGNKNIFLGENAIKWEADKKIYDGFTTNGVMICHPLVDFDPDIRCPDALSKIKECQSSFANSSWREVSVSGAVYSCLSKRGVPQ-GKSRLDEDNILRDGTLIDLCGVTIIWRSE--YTDTEIEDNIISLCSKLNETHIQCPIGYQTLRISPDFSVWQIDDENKRKFLKAGSDXXXXXXXXXXXXXXXXXXXXLFNKDSCRPYVYLKCGHVHGFHEWKTVED-------NNQCRTCPLCKQRSPFVALVMGQETGFFLDLELPTYCFNPCGHMGSEATVKYWYSVALPNRKNSELSPRCPFCYVECTDKP--VRLIF 1485
            I YG LIVLG NG  S    +  +  ++  + +R +ANG+K   +      ++++A+ +K +H++SYTLS+ + +VVEY +D  TDM+QIGR TE  IDFVV       +  +       T+SRFACRI   R  P+ ARI+AAGFD +KNIFLGE A KW       DG TTNGV++ HP   F  D +                   WRE+SV G V++    R   Q GK    E   L DG+LIDLCG T++WR+      T    ++ +L  +LN    QCP+G+ TL   P        DE +                                     P+ YL CGHVHG+H W T +        + + R CP+C+ R P+V L +G E GF+LD   PT+ F PCGH+ SE TV +W  + LP+  ++     CPFC  + + +   VRLIF
Sbjct:   18 IKYGELIVLGYNG--SLPNGDRGRRKSRFALSKRPKANGVKPSTVHVACTPQAAKAISNKDQHSISYTLSRAQTVVVEYTHDSNTDMFQIGRSTETPIDFVVTDTIPGSQSNSDTQTVQSTISRFACRIMCQRTPPYTARIYAAGFDSSKNIFLGEKAAKWRTSDGQMDGLTTNGVLVMHPRHGFTEDSK----------------PGVWREISVCGNVFTLRETRSAQQRGKMVESETQELVDGSLIDLCGATLLWRTAEGLQRTPTLKHLEALRQELNAARPQCPVGFNTLAF-PSMRRKDTVDEKQ-------------------------------------PWAYLHCGHVHGYHSWGTRDSGERDGSRDGRERECPMCRARGPYVPLWLGCEAGFYLDAAPPTHAFIPCGHVCSEKTVAFWSQIPLPHGTHT-FHAACPFCAQQLSGEQGYVRLIF 422          
BLAST of Pellino vs. Ensembl Cavefish
Match: peli2 (E3 ubiquitin-protein ligase pellino homolog 2 [Source:NCBI gene;Acc:103028664])

HSP 1 Score: 286.574 bits (732), Expect = 1.976e-91
Identity = 162/457 (35.45%), Postives = 243/457 (53.17%), Query Frame = 1
Query:  136 IVYGYLIVLGTNGRKSWRYSNNKKETNKLKVVQRSQANGIKQIKIGRFKEAKSSQAVQSKFRHAVSYTLSQDEAIVVEYGNDPETDMYQIGRCTEDQIDFVVNSVPLDKEYKNPKSPGPETVSRFACRIFISRQAPHVARIFAAGFDGNKNIFLGENAIKWEADKKIYDGFTTNGVMICHPLVDFDPDIRCPDALSKIKECQSSFANSSWREVSVSGAVYSCLSKRGV-PQGKSRLDEDNILRDGTLIDLCGVTIIWRSE--YTDTEIEDNIISLCSKLNETHIQCPIGYQTLRISPDFSVWQIDDENKRKFLKAGSDXXXXXXXXXXXXXXXXXXXXLFNKDSCRPYVYLKCGHVHGFHEW--KTVEDNNQCRTCPLCKQRSPFVALVMGQETGFFLDLELPTYCFNPCGHMGSEATVKYWYSVALPNRKNSELSPRCPFCYVE--CTDKPVRLIF 1485
            + YG L+VLG NG  S    +  +  ++  + +R++ANG+K   +      +SS+AV  K +H++SYTLS+++ +VVEY +D +TDM+QIGR TE+ IDFVV                  T+SRFACR+   R  P+ ARIFAAGFD +KNIFLGE A KW+      DG TTNGV++ HP   F  + +                   WRE+SV G VY+    R    +GK    E N+L+DG+L+DLCG T++WR+      T  + ++ +L  +LN    QCP+G  TL              + ++  +A                       +  ++  +P+VYL CGHVHG+H+W  ++  ++N  R CP+C+   P+V L +G E  F++D   PT+ F PCGH+ SE + +YW  + LP+  ++     CPFC  +   T    +LIF
Sbjct:   17 VKYGELVVLGYNG--SLPNGDRGRRRSRFALHKRAKANGVKPSTVHILNNPQSSKAVNCKGQHSISYTLSRNQTVVVEYSHDKDTDMFQIGRSTENPIDFVVTDTVSGGGDSEDALITQSTISRFACRVVCERNPPYTARIFAAGFDSSKNIFLGEKAAKWKNPDGQMDGLTTNGVLVMHPRGGFTEESK----------------PGVWREISVCGDVYTLRETRSAQTRGKLVDSESNVLQDGSLVDLCGATLLWRTAEGLFHTPTQKHLEALRQELNAARPQCPVGLNTLAFP-----------SMQRCSRA--------------------MPSVAPQEDKQPWVYLACGHVHGYHDWGHRSERESNAQRECPMCRAVGPYVPLWLGCEPAFYVDTGAPTHAFVPCGHVCSEKSARYWSEIPLPHGTHA-FHAACPFCATQLSLTQGCSKLIF 423          
BLAST of Pellino vs. Ensembl Cavefish
Match: ENSAMXT00000048958.1 (pellino E3 ubiquitin protein ligase family member 2 [Source:NCBI gene;Acc:103047193])

HSP 1 Score: 282.722 bits (722), Expect = 5.418e-90
Identity = 161/467 (34.48%), Postives = 232/467 (49.68%), Query Frame = 1
Query:  136 IVYGYLIVLGTNGRKSWRYSNNKKETNKLKVVQRSQANGIKQIKIGRFKEAKSSQAVQSKFRHAVSYTLSQDEAIVVEYGNDPETDMYQIGRCTEDQIDFVVNSVPLDKEYKNPKSPGPETVSRFACRIFISRQAPHVARIFAAGFDGNKNIFLGENAIKWEADKKIYDGFTTNGVMICHPLVDFDPDIRCPDALSKIKECQSSFANSSWREVSVSGAVYSCLSKRGVP-QGKSRLDEDNILRDGTLIDLCGVTIIWRSE--YTDTEIEDNIISLCSKLNETHIQCPIGYQTLRISPDFSVWQIDDENKRKFLKAGSDXXXXXXXXXXXXXXXXXXXXLFNKDSCRPYVYLKCGHVHGFHEWKTVEDNNQ------------CRTCPLCKQRSPFVALVMGQETGFFLDLELPTYCFNPCGHMGSEATVKYWYSVALPNRKNSELSPRCPFCYVECTDKP--VRLIF 1485
            + YG L++LG NG  S    +  ++ ++  + +R++ANG+K   +      + S+AV S+ +H++S+TLS+++ +VVEY +D +TDM+QIGR TE  IDFVV   P   +     S  P T+SRFACR+   R  P+ ARI+AAGFD +KNIFLGE A KW+      DG TTNGV++ HP                 +          WRE+SV G VY+    R  P +G+    E + L+DG+L+DLCG T++WR+           ++ +L  +LN    QCP+G  TL   P        +E +                                     P+ YL CGHVHG H+W    +  +             R CPLC+   P+V L +G E  F++D   PT+ F PCGH+ SE T +YW    LP+  ++   P CPFC       P   RLIF
Sbjct:   16 VKYGELVILGYNG--SLPGGDKGRKRSRFALYRRAKANGVKPSTVHILSNPQDSKAVNSRGQHSISFTLSRNQTVVVEYCHDNDTDMFQIGRSTESPIDFVVTDTPGGSKESEDSSVAPSTISRFACRVVCERNPPYTARIYAAGFDSSKNIFLGEKATKWKNPDGHMDGLTTNGVLVMHP-----------------QGFPEESKQGMWREISVCGDVYTLRETRSGPIRGQMAQGESSALQDGSLVDLCGATLLWRTAEGLLKAPTLRHLDALRLELNAARPQCPVGLSTLAF-PSLPRSHSLEERQ-------------------------------------PWAYLACGHVHGRHDWGQRPERTRDREEGASGGTGGRRECPLCRTVGPYVPLWLGCEPAFYMDAGAPTHAFVPCGHVCSERTARYWAETPLPHGTHA-FRPTCPFCSAPLMGTPGFTRLIF 424          
BLAST of Pellino vs. Ensembl Cavefish
Match: peli3 (E3 ubiquitin-protein ligase pellino homolog 1-like [Source:NCBI gene;Acc:103027529])

HSP 1 Score: 278.485 bits (711), Expect = 1.122e-87
Identity = 171/489 (34.97%), Postives = 239/489 (48.88%), Query Frame = 1
Query:  136 IVYGYLIVLGTNGRKSWRYSNNKKETNKLKVVQRSQANGIKQIKIGRFKEAKSSQAVQSKFRHAVSYTLSQDEAIVVEYGNDPETDMYQIGRCTEDQIDFVVNSVPLDKEYKNPKSP--------------GPETVSRFACRIFISRQAPHVARIFAAGFDGNKNIFLGENAIKWEADKKIYDGFTTNGVMICHPLVDFDPDIRCPDALSKIKECQSSFANSSWREVSVSGAVYSCLSKRGVPQ-GKSRLDEDNILRDGTLIDLCGVTIIWRSE--YTDTEIEDNIISLCSKLNETHIQCPIGYQTLRISPDFSVWQIDDENKRKFLKAGSDXXXXXXXXXXXXXXXXXXXXLFNKDSCRPYVYLKCGHVHGFHEW--------------------KTVEDNNQCRTCPLCKQRSPFVALVMGQETGFFLDLELPTYCFNPCGHMGSEATVKYWYSVALPNRKNSELSPRCPFCYVECTDK--PVRLIF 1485
            I YG LIVLG NG  S    +  +  ++L + +R ++NG+K   I        S+A+ +K +H++SYTLS+  +++VEY +DP TDM+QIGR TE  IDFVV            +                   T+SR+ACRI   R AP+ ARI+AAGFD +KNIFLGE A KW     + DG TTNGV++ HP  +F                 S  A   WRE+SV G V++    R   Q GK   +E N+L+DG+LIDLCG T++WR+      T     + SL  +LN    QCP+G+ TL      S+ Q    +K++                                   P+VY+ CGHVHG+H W                     T   +   R CP+C++  P+V L +G E G +LD   PT+ F PCGH+ SE TV+ W  + LP+  ++     CPFC    T +   V+LIF
Sbjct:   49 IKYGELIVLGHNG--SLASGDKGRRRSRLALYKRPKSNGVKPDVIHNVSTPLVSKALSNKSQHSISYTLSRSHSVIVEYTHDPNTDMFQIGRSTESMIDFVVTDTAGSGGGSGGQGQGQGQGGSGGDGGQSAQSTISRYACRIMCDRSAPYTARIYAAGFDSSKNIFLGERAAKWRTSDGLMDGLTTNGVLVMHPAGEF----------------VSEPAPGVWREISVCGNVFALRETRSAQQRGKLVENESNMLQDGSLIDLCGATLLWRTPGGLRRTPTLKQLESLRQELNAARPQCPVGFNTLAFP---SLAQRATVDKKQ-----------------------------------PWVYMNCGHVHGYHNWGFRKEKGAGSSAVGGGAGSGGTAPASTGDRECPMCRRVGPYVPLWLGCEGGLYLDAGPPTHAFCPCGHVCSEKTVQGWSQIPLPHGTHA-FHAACPFCGTWLTGEHGHVKLIF 480          
BLAST of Pellino vs. Ensembl Cavefish
Match: peli1a (pellino E3 ubiquitin protein ligase 1a [Source:ZFIN;Acc:ZDB-GENE-110310-6])

HSP 1 Score: 273.478 bits (698), Expect = 1.214e-86
Identity = 167/455 (36.70%), Postives = 224/455 (49.23%), Query Frame = 1
Query:  142 YGYLIVLGTNGRKSWRYSNNKKETNKLKVVQRSQANGIKQIKIGRFKEAKSSQAVQSKFRHAVSYTLSQDEAIVVEYGNDPETDMYQIGRCTEDQIDFVVNSVPLDKEYKNPKSPGPETVSRFACRIFISRQAPHVARIFAAGFDGNKNIFLGENAIKWEADKKIYDGFTTNGVMICHPLVDFDPDIRCPDALSKIKECQSSFANSSWREVSVSGAVYSCLSKRGVPQ--GKSRLDEDNILRDGTLIDLCGVTIIWRS--EYTDTEIEDNIISLCSKLNETHIQCPIGYQTLRISPDFSVWQIDDENKRKFLKAGSDXXXXXXXXXXXXXXXXXXXXLFNKDSCRPYVYLKCGHVHGFHEWKTVEDNNQC-RTCPLCKQRSPFVALVMGQETGFFLDLELPTYCFNPCGHMGSEATVKYWYSVALPNRKNSELSPRCPFCYVEC-TDKP-VRLIF 1485
            YG LIVLG NG  S       +  ++  +V+R  ANG    K+       +   + +  +H+VSYTLS  E +VVEY +D ETDMYQIGR TE  ID VV +         P      T+SRFACRI   R  P+ AR++AAGFD ++NIFLGE A KW       DG TTNGV++  P     P +                    WRE+SV G V++ L     PQ  GK   DE  IL DG+LIDLCGVT++WRS     ++    ++ +L  +LN    QCP+   TL          +D    R                                   RP+ Y+ CGHVHG+H W+  E+ +   R CPLC+ R P+V L +G+ +G + D E P++ F PCGH+ S+ T ++W    L  R      P CPFC  +   D+P VRLIF
Sbjct:   14 YGELIVLGCNG--SLPGGERGRRWSRFGLVKRPTANGAA--KVHTHTHTHTHAVISNTSQHSVSYTLSWAETVVVEYTDDNETDMYQIGRSTERPIDIVVTNTGSGGHGNGPVRSLQSTISRFACRIVCDRTPPYTARLYAAGFDCSRNIFLGEKAAKWHTFGGQMDGLTTNGVLLMQPARGSRPAV--------------------WREISVCGNVFT-LRDPASPQNRGKQVKDESPILLDGSLIDLCGVTLLWRSVEGLANSPTSSHLEALRLRLNAARPQCPVLLSTLAFP------SLDGPRPR-----------------------------------RPWAYMTCGHVHGYHPWQGREERDGGRRECPLCRSRGPYVPLTLGRVSGVYTDAETPSHAFVPCGHVCSKGTAEHWSKTPL-KRGTHSFHPACPFCLRQLRRDRPFVRLIF 401          
BLAST of Pellino vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010741.1 (pep scaffold:Pmarinus_7.0:GL480794:158419:164193:-1 gene:ENSPMAG00000009728.1 transcript:ENSPMAT00000010741.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 280.026 bits (715), Expect = 8.686e-89
Identity = 168/490 (34.29%), Postives = 239/490 (48.78%), Query Frame = 1
Query:  136 IVYGYLIVLGTNGRKSWRYSNNKKETNKLKVVQRSQANGIKQIKIGRFKEAKSSQAVQSKFRHAVSYTLSQDEAIVVEYGNDPETDMYQIGRCTEDQIDFVVNSVPLDKEY-------------------KNPKSPGPETVSRFACRIFISRQAPHVARIFAAGFDGNKNIFLGENAIKWEADKKIYDGFTTNGVMICHPLVDFDPDIRCPDALSKIKECQSSFANSSWREVSVSGAVYSCLSKRGVPQGKSRLD-EDNILRDGTLIDLCGVTIIWRSE--YTDTEIEDNIISLCSKLNETHIQCPIGYQTLRISPDFSVWQIDDENKRKFLKAGSDXXXXXXXXXXXXXXXXXXXXLFNKDSCRPYVYLKCGHVHGFHEW-----------KTVEDNNQC----RTCPLCKQRSPFVALVMGQETGFFLDLELPTYCFNPCGHMGSEATVKYWYSVALPNRKNSELSPRCPFCYVECTD---KPVRLIF 1485
            ++YG LIVLG NG       +  +  ++  + +RS+ANG+K   +      ++++AV SK  H+VSYTLS+ + +VVEY +D +TDM+QIGR TE  IDFVV   P                        ++       T+SRFACR+  +R APH ARI+AAGFD ++NIFLGE A KW++     DG TTNGV++  P     P    P+   +           +WRE+SV G VYS    R        +D E N+LRDG+L+DLCG T++WR+           +I +L  ++N    QCP+G  TL   P F     D++ +                                     P+ YL CGHVHG HEW                N       R CP+C+   P+VAL +G+E  F++D   P +  +PCGH+ SE T +YW  V+LP+  ++     CPFC    ++     VRLIF
Sbjct:   50 VLYGQLIVLGHNG--CLPLGDKGRRRSRFNLYRRSKANGVKPSTMHVTPTPQAAKAVSSKELHSVSYTLSRSQTVVVEYAHDKDTDMFQIGRSTEGPIDFVVTDTPAGNGGGGVGAGGPSTGGGPGGGGGEDAHLAAQSTISRFACRMVCARTAPHSARIYAAGFDSSRNIFLGEKAAKWKSVAGQMDGLTTNGVLVMTPR-QSPPHTGAPEGAGEPSP-------GTWREISVCGNVYSLRETRSAQLRGHLVDSETNVLRDGSLVDLCGATLLWRTAEGLARAPTLRDIDALRQEINAARPQCPVGLNTLAF-PSFRRRPGDEDRQ-------------------------------------PWAYLACGHVHGRHEWGLRGGGIGNVTGGAGSNGGAMEAGRECPMCRAVGPYVALSLGREPAFYVDAGRPAHALSPCGHVCSEKTARYWARVSLPHGTHA-FHAACPFCGTALSEGERASVRLIF 490          
BLAST of Pellino vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010060.1 (pep scaffold:Pmarinus_7.0:GL485699:150812:160856:1 gene:ENSPMAG00000009102.1 transcript:ENSPMAT00000010060.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 150.599 bits (379), Expect = 1.775e-43
Identity = 83/184 (45.11%), Postives = 107/184 (58.15%), Query Frame = 1
Query:  298 QAVQSKFRHAVSYTLSQDEAIVVEYGNDPETDMYQIGRCTEDQIDFVVNSVPLDKEYKNPKSPGPETVSRFACRIFISRQAPHVARIFAAGFDGNKNIFLGENAIKWEADKKIYDGFTTNGVMICHPLVDFDPDIRCPDALSKIKECQSSFANSSWREVSVSGAVYSCLSKRGVPQGKSRLDED 849
            QAV SK +H++SYTLS++  +VVEY +D +TDM+QIGR TE  IDFVV       +  +       T+SRFACRI   R AP+ ARIFAAGFD +KNIFLGE A KW+      DG TTNG+++ HP   F  + R P                 WRE+SV G VY+    R   Q + +L E+
Sbjct:    1 QAVSSKEQHSISYTLSRNHTVVVEYTHDADTDMFQIGRSTESPIDFVVMDTVPGSQSSDETQITQSTISRFACRIKCQRTAPYTARIFAAGFDTSKNIFLGEKAAKWKNPDGHMDGLTTNGILVMHPRGGFTDESR-PGV---------------WREISVCGNVYTLRETR-CAQQRGKLGEE 167          
BLAST of Pellino vs. Ensembl Nematostella
Match: EDO33726 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRC6])

HSP 1 Score: 279.641 bits (714), Expect = 2.217e-89
Identity = 168/460 (36.52%), Postives = 243/460 (52.83%), Query Frame = 1
Query:  136 IVYGYLIVLGTNGRKSWRYSNNKKETNKLKVVQRSQANGIKQIKIGRFKEAKSSQAVQSKFRHAVSYTLSQDEAIVVEYGNDPETDMYQIGRCTEDQIDFVV-NSVPLDKEYKNPKSPGPETVSRFACRIFISRQAPHVARIFAAGFDGNKNIFLGENAIKWEADKKIYDGFTTNGVMICHPLVDFDPDIRCPDALSKIKECQSSFANSSWREVSVSGAVYSCLSKRGVPQ-GKSRLDEDNILRDGTLIDLCGVTIIWRS--EYTDTEIEDNIISLCSKLNETHIQCPIGYQTLRISPDFSVWQIDDENKRKFLKAGSDXXXXXXXXXXXXXXXXXXXXLFNKDSCRPYVYLKCGHVHGFHEWK---TVEDNNQCRTCPLCKQRSPFVALVMGQETGFFLDLELPTYCFNPCGHMGSEATVKYWYSVALPNRKNSELSPRCPFCY--VECTDKPVRLIFS 1488
            + YG L+VLG NG         +K +  L+  ++S A+G+K  K          Q V S   H+VSYTL++  ++VVEY  D +TDM+QIGR ++ +IDFVV ++VP  K+     +P   T+SR+ACRI + R  P+ AR+FAAGFD + NIFLGE A KW+ +  + DG TTNGV++ +P     P+  CP  +              WRE+SV G VY     R  P+ GK+  +E N+L DG+LIDLCG  ++WRS         E  I ++  +LN   +QCP+G  TL  S    V  +                                     + S +P+VY+KCGHVHG H W    +  D  + RTCP+C Q   +V L +G+E  FF+   + ++ F PCGH+ SE TV++W  + +P+  ++     CPFC   +E  D  V+LIFS
Sbjct:    7 LTYGMLVVLGYNGAPPQGNQERRKSSYLLQ--KKSLASGVKPFKQHLASSQTGMQVVHSNQAHSVSYTLARGPSVVVEYCRDNKTDMFQIGRSSDSKIDFVVMDTVPGVKDGAVQPNPQKSTISRYACRITVDRHPPYTARVFAAGFDKSNNIFLGEKAPKWKNEDDMMDGLTTNGVLLMNP--RGGPN--CPPGI--------------WREISVCGHVYGLRDTRSAPEKGKTVQNESNVLFDGSLIDLCGAVLMWRSADAIPTMPTEGMIDAMRRRLNMMRLQCPVGLNTLVFSGASQVISL-------------------------------------RASRQPHVYIKCGHVHGLHGWHGPDSSTDVTESRTCPICLQVYNYVPLQIGKERAFFVGEIVSSHAFVPCGHVCSEETVRFWSKIPIPHGCDA-FQAICPFCSLPLEGEDGFVKLIFS 408          
BLAST of Pellino vs. Ensembl Nematostella
Match: EDO29349 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T3W4])

HSP 1 Score: 154.836 bits (390), Expect = 2.880e-43
Identity = 117/376 (31.12%), Postives = 168/376 (44.68%), Query Frame = 1
Query:  400 QIGRCTEDQIDFVV-NSVPLDKEYKNPKSPGPETVSRFACRIFISRQAPHVARIFAAGFDGNKNIFLGENAIKWEADKKIYDGFTTNGVMICHPLVDFDPDIRCPDALSKIKECQSSFANSSWREVSVSGAVYSCLSKRGVPQ-GKSRLDEDNILRDGTLIDLC------GVTIIWRSEYTDTEIEDNIISLCSKLNETHIQCPIGYQTLRISPDFSVWQIDDENKRKFLKAGSDXXXXXXXXXXXXXXXXXXXXLFNKDSCRPYVYLKCGHVHGFHEWK---TVEDNNQCRTCPLCKQRSPFVALVMGQETGFFLDLELPTYCFNPCGHMGSEATVKYWYSVALPNRKNSELSPRCPFCY--VECTDKPVRLIFS 1488
             IGR ++ +IDFVV ++VP  K+     +P   T+SR+ACRI + R  P+ AR+FAAGFD + NIFLGE A KW+ +  + DG TTNGV++ +P    +    CP  +              WRE+SV G VY     R  P+ GK+   E        L + C       + +I RS  T+  I+    ++  +LN   +QCP+G  TL  S    V  +                                     + S +P+VY+KCGHVHG H W    +  D  + RTCP+C Q S          T FFL     T               ++W  + +P+  ++     CPFC   +E  D  V+LIFS
Sbjct:    1 MIGRSSDSKIDFVVMDTVPGVKDGAVQPNPQKSTISRYACRITVDRHPPYTARVFAAGFDKSNNIFLGEKAPKWKNEDDMMDGLTTNGVLLMNPRGGPN----CPPGI--------------WREISVCGHVYGLRDTRSAPEKGKTLYSEGGGFLSRPLAEPCVTMFQHDLPLIERSCSTEGMID----AMRRRLNMMRLQCPVGLNTLVFSGASQVISL-------------------------------------RASRQPHVYIKCGHVHGLHGWHGPDSSTDVTESRTCPICLQDS---------YTPFFLSFSCITMAIG----------FRFWSKIPIPHGCDA-FQAICPFCSLPLEGEDGFVKLIFS 297          
BLAST of Pellino vs. Ensembl Nematostella
Match: EDO33725 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRC5])

HSP 1 Score: 58.9214 bits (141), Expect = 4.257e-11
Identity = 32/90 (35.56%), Postives = 50/90 (55.56%), Query Frame = 1
Query:  136 IVYGYLIVLGTNGRKSWRYSNNKKETNKLKVVQRSQANGIKQIKIGRFKEAKSSQAVQSKFRHAVSYTLSQDEAIVVEYGNDPETDMYQI 405
            + YG L+VLG NG       N ++  +   + ++S A+G+K  K          Q V S   H+VSYTL++  ++VVEY  D +TDM+Q+
Sbjct:    3 LTYGMLVVLGYNGAPP--QGNQERRKSSYLLQKKSLASGVKPFKQHLASSQTGMQVVHSNQAHSVSYTLARGPSVVVEYCRDNKTDMFQV 90          
BLAST of Pellino vs. Ensembl Medaka
Match: peli2 (E3 ubiquitin-protein ligase pellino homolog 2 [Source:NCBI gene;Acc:101160520])

HSP 1 Score: 290.041 bits (741), Expect = 7.838e-93
Identity = 160/445 (35.96%), Postives = 235/445 (52.81%), Query Frame = 1
Query:  136 IVYGYLIVLGTNGRKSWRYSNNKKETNKLKVVQRSQANGIKQIKIGRFKEAKSSQAVQSKFRHAVSYTLSQDEAIVVEYGNDPETDMYQIGRCTEDQIDFVVNSVPLDKEYKNPKSPGPETVSRFACRIFISRQAPHVARIFAAGFDGNKNIFLGENAIKWEADKKIYDGFTTNGVMICHPLVDFDPDIRCPDALSKIKECQSSFANSSWREVSVSGAVYSCLSKRGV-PQGKSRLDEDNILRDGTLIDLCGVTIIWRSE--YTDTEIEDNIISLCSKLNETHIQCPIGYQTLRISPDFSVWQIDDENKRKFLKAGSDXXXXXXXXXXXXXXXXXXXXLFNKDSCRPYVYLKCGHVHGFHEW--KTVEDNNQCRTCPLCKQRSPFVALVMGQETGFFLDLELPTYCFNPCGHMGSEATVKYWYSVALPNRKNSELSPRCPFCYVE 1455
            + YG L+VLG NG       +  +  ++  +++R++ANG+K   +      + S+AV SK +H++SYTLS++  +VVEY +D +TDM+QIGR TE  IDFVV       +          T+SRFACR+F  R  P+ ARI+AAGFD +KNIFLGE A KW+      DG TTNGV++ HP   F            ++E +       WRE+SV G VY+    R     GK   +E NIL+DG+L+DLCG T++WR+      T  + ++ +L  ++N    QCP+G  TL               + + L +  D                           +P+VYL CGHVHG+H W  ++ +     R CP+C+   P+V L +G E  F++D   PT+ F PCGH+ SE +VKYW  + LP+  ++     CPFC  +
Sbjct:   17 VKYGELVVLGYNG--CLPNGDRGRRKSRFALLKRTKANGVKPSSVHILNTPQDSKAVNSKGQHSISYTLSRNHTVVVEYSHDKDTDMFQIGRSTESPIDFVVTDTIAGSQEGEETPITQSTISRFACRVFCERNPPYTARIYAAGFDSSKNIFLGEKAAKWKNPDGHMDGLTTNGVLVMHPKGGF------------VEESKPGV----WREISVCGDVYTLRETRSAQTPGKLVENESNILQDGSLVDLCGATLLWRTAEGLFHTPTQKHLEALRQEINAARPQCPVGLNTL---------AFPSMQRSRALSSHEDK--------------------------QPWVYLACGHVHGYHNWGHRSEQGPGPQRECPMCRMVGPYVPLWLGCEPAFYVDTGAPTHAFVPCGHVCSEKSVKYWSEIPLPHGTHA-FHAACPFCATQ 407          
BLAST of Pellino vs. Ensembl Medaka
Match: ENSORLT00000018940.2 (E3 ubiquitin-protein ligase pellino homolog 2 [Source:NCBI gene;Acc:101167088])

HSP 1 Score: 286.96 bits (733), Expect = 1.082e-91
Identity = 171/463 (36.93%), Postives = 240/463 (51.84%), Query Frame = 1
Query:  136 IVYGYLIVLGTNGRKSWRYSNNKKETNKLKVVQRSQANGIKQIKIGRFKEAKSSQAVQSKFRHAVSYTLSQDEAIVVEYGNDPETDMYQIGRCTEDQIDFVV-NSVPLDKEYKNPKSPGPETVSRFACRIFISRQAPHVARIFAAGFDGNKNIFLGENAIKWEADKKIYDGFTTNGVMICHPLVDFDPDIRCPDALSKIKECQSSFANSSWREVSVSGAVYSCLSKRGVP-QGKSRLDEDNILRDGTLIDLCGVTIIWRS--EYTDTEIEDNIISLCSKLNETHIQCPIGYQTLRISPDFSVWQIDDENKRKFLKAGSDXXXXXXXXXXXXXXXXXXXXLFNKDSCRPYVYLKCGHVHGFHEWKTVEDNNQ--------CRTCPLCKQRSPFVALVMGQETGFFLDLELPTYCFNPCGHMGSEATVKYWYSVALPNRKNSELSPRCPFCYVE-CTDKPVRLIF 1485
            + YG L+VLG NG  S    +  +  ++  + +R++ANG+K   +      + S+AV S+ +H++S+TLS+++ +VVEY +D  TDM+QIGR TE  IDFVV ++    KE ++P S  P T+SRFACR+   R  P+ ARI+AAGFD +KNIFLGE A KW+      DG TTNGV++ HP   F  D +                   WRE+SV G VY+    R  P +GK    E + LRDG+L+DLCG T++WR+    T      ++ +L  +LN +  QCP+G  TL   P        +E +                                     P+VYL CGHVHG H+W    +  Q         R CPLC+   P+V L +G E   +LD   PT+ F PCGH+ SE T +YW   +LP+  ++   P CPFC     T    RLIF
Sbjct:   18 VKYGELVVLGYNG--SLPNGDRGRRKSRFALFRRAKANGVKPSAVHILNTPQDSKAVHSRGQHSISFTLSRNQTVVVEYCHDDNTDMFQIGRSTESPIDFVVTDNSGGSKEVEDP-SIAPSTISRFACRVVCERSPPYTARIYAAGFDSSKNIFLGEKATKWKNPDGHMDGLTTNGVLVMHP-EGFPDDPK----------------QGLWREISVCGDVYALRETRSGPTRGKLAEGESSALRDGSLVDLCGATLLWRTGEGLTRAPTLRHLEALRQELNASRPQCPVGLSTLAF-PSLPRSHSLEERQ-------------------------------------PWVYLSCGHVHGRHDWGQRSEGEQRKGEGAAPQRECPLCRSEGPYVPLWLGSEPAVYLDAGPPTHAFVPCGHVCSERTARYWAETSLPHGTHA-FRPVCPFCSAALSTPGWTRLIF 421          
BLAST of Pellino vs. Ensembl Medaka
Match: peli1b (E3 ubiquitin-protein ligase pellino homolog 1 [Source:NCBI gene;Acc:101167979])

HSP 1 Score: 282.722 bits (722), Expect = 4.476e-90
Identity = 164/460 (35.65%), Postives = 236/460 (51.30%), Query Frame = 1
Query:  136 IVYGYLIVLGTNGRKSWRYSNNKKETNKLKVVQRSQANGIKQIKIGRFKEAKSSQAVQSKFRHAVSYTLSQDEAIVVEYGNDPETDMYQIGRCTEDQIDFVVNSVPLDKEYKNPKSPGPETVSRFACRIFISRQAPHVARIFAAGFDGNKNIFLGENAIKWEADKKIYDGFTTNGVMICHPLVDFDPDIRCPDALSKIKECQSSFANSSWREVSVSGAVYSCLSKRGVPQ-GKSRLDEDNILRDGTLIDLCGVTIIWRSE--YTDTEIEDNIISLCSKLNETHIQCPIGYQTLRISPDFSVWQIDDENKRKFLKAGSDXXXXXXXXXXXXXXXXXXXXLFNKDSCRPYVYLKCGHVHGFHEW-----KTVEDNNQCRTCPLCKQRSPFVALVMGQETGFFLDLELPTYCFNPCGHMGSEATVKYWYSVALPNRKNSELSPRCPFCYVECTDKP--VRLIF 1485
            + YG LIVLG NG  S    +  +  ++  + +R +ANG+K   +      ++++A+ +K  H++SYTLS+ + +VVEY ++  TDM+QIGR TE  IDFVV       +          T+SRFACRI   R  P+ ARI+AAGFD +KNIFLGE A KWE      DG TTNGV++ HP   F  D +                   WRE+SV G V++    R   Q GK    E + L DG+LIDLCG T++WR+    + T    ++ +L  ++N    QCP+G+ TL   P        DE +                                     P+VYL+CGHVHG+H+W     +      + R CP+C+ + P+V L +G E GF++D   PT+ FNPCGH+ SE T  +W  + LP+  ++     CPFC  + + +   VRLIF
Sbjct:   19 VKYGELIVLGYNG--SLPNGDRGRRKSRFALYKRPKANGVKPSTVHISCSPQAAKAISNKDLHSISYTLSRVQTVVVEYTHESNTDMFQIGRSTESPIDFVVTDTVAGSQSNADTQSVQSTISRFACRILCQRTPPYTARIYAAGFDSSKNIFLGEKAAKWETSDGQMDGLTTNGVLVMHPRNGFTQDSK----------------PGVWREISVCGNVFTLRETRSAQQRGKMVETESHELVDGSLIDLCGATLLWRTAEGLSRTPTLKHLEALRQEINAARPQCPVGFNTLAF-PSMRRKDTPDEKQ-------------------------------------PWVYLQCGHVHGYHDWGNHREEREGREGRLRECPMCRAKGPYVPLWLGCEAGFYVDAAPPTHAFNPCGHVCSEKTAAFWSQIPLPHGTHT-FHAACPFCAQQLSGEHGFVRLIF 421          
BLAST of Pellino vs. Ensembl Medaka
Match: peli1a (E3 ubiquitin-protein ligase pellino homolog 1 [Source:NCBI gene;Acc:101169661])

HSP 1 Score: 278.485 bits (711), Expect = 3.539e-88
Identity = 167/460 (36.30%), Postives = 232/460 (50.43%), Query Frame = 1
Query:  136 IVYGYLIVLGTNGRKSWRYSNNKKETNKLKVVQRSQANGIKQIKIGRFKEAKSSQAVQSKFRHAVSYTLSQDEAIVVEYGNDPETDMYQIGRCTEDQIDFVVNSVPLDKEYKNPKSPGPETVSRFACRIFISRQAPHVARIFAAGFDGNKNIFLGENAIKWEADKKIYDGFTTNGVMICHPLVDFDPDIRCPDALSKIKECQSSFANSSWREVSVSGAVYSCLSKRGVPQGKSRLD-EDNILRDGTLIDLCGVTIIWRSE--YTDTEIEDNIISLCSKLNETHIQCPIGYQTLRISPDFSVWQIDDENKRKFLKAGSDXXXXXXXXXXXXXXXXXXXXLFNKDSCRPYVYLKCGHVHGFHEWK-----TVEDNNQCRTCPLCKQRSPFVALVMGQETGFFLDLELPTYCFNPCGHMGSEATVKYWYSVALPNRKNSELSPRCPFCYVECT-DKP-VRLIF 1485
            + YG LIVLG NG  S       ++ ++  + +R++ANG+K   +      ++ +AV +K +H++SYTLS+ + +VVEY +D  TDM+QIGR TE  IDFVV       +          T+SRFACRI   R  P  ARI+AAGFD +KNIFLGE A KW       DG TTNGV++ HP   F  D +                   WRE+SV G V++    R     +  ++ E N L DG+LIDLCG T++WR+      T    ++ +L  +LN    QCP+G+ TL   P      +  E +                                     P+VYL+CGHVHG+H W        E  +Q   CP+C+ R P+V L +G E GF++D E PT+ F PCGH+ SE T  YW  + LP+   +     CPFC    + D P +RLIF
Sbjct:   38 VKYGELIVLGCNG--SLPGGEKGRQKSRFALCRRTKANGVKPSTVHTSSTPQAVKAVSNKEQHSISYTLSRVQTVVVEYTHDSNTDMFQIGRSTESPIDFVVIDTLPGGQILTDNQTTQSTISRFACRIICQRNPPFSARIYAAGFDSSKNIFLGEKAAKWRMRDGQMDGLTTNGVLVMHPHNGFSQDSK----------------PGLWREISVCGNVFALRETRSSQHREKMVESESNELVDGSLIDLCGATLLWRTAEGLALTPTIKHLEALRQELNAGRPQCPVGFNTLAF-PSLRHKAVVVEKQ-------------------------------------PWVYLRCGHVHGYHGWAGRRSPADEAEHQDWECPMCRARGPYVPLWLGCEPGFYVDAEPPTHAFVPCGHVCSEKTAAYWSQIPLPHGTQA-----CPFCIQPLSADTPCIRLIF 436          
BLAST of Pellino vs. Planmine SMEST
Match: SMESG000029869.1 (SMESG000029869.1)

HSP 1 Score: 899.042 bits (2322), Expect = 0.000e+0
Identity = 454/454 (100.00%), Postives = 454/454 (100.00%), Query Frame = 1
Query:  127 MTEIVYGYLIVLGTNGRKSWRYSNNKKETNKLKVVQRSQANGIKQIKIGRFKEAKSSQAVQSKFRHAVSYTLSQDEAIVVEYGNDPETDMYQIGRCTEDQIDFVVNSVPLDKEYKNPKSPGPETVSRFACRIFISRQAPHVARIFAAGFDGNKNIFLGENAIKWEADKKIYDGFTTNGVMICHPLVDFDPDIRCPDALSKIKECQSSFANSSWREVSVSGAVYSCLSKRGVPQGKSRLDEDNILRDGTLIDLCGVTIIWRSEYTDTEIEDNIISLCSKLNETHIQCPIGYQTLRISPDFSVWQIDDENKRKFLKAGSDXXXXXXXXXXXXXXXXXXXXLFNKDSCRPYVYLKCGHVHGFHEWKTVEDNNQCRTCPLCKQRSPFVALVMGQETGFFLDLELPTYCFNPCGHMGSEATVKYWYSVALPNRKNSELSPRCPFCYVECTDKPVRLIFS 1488
            MTEIVYGYLIVLGTNGRKSWRYSNNKKETNKLKVVQRSQANGIKQIKIGRFKEAKSSQAVQSKFRHAVSYTLSQDEAIVVEYGNDPETDMYQIGRCTEDQIDFVVNSVPLDKEYKNPKSPGPETVSRFACRIFISRQAPHVARIFAAGFDGNKNIFLGENAIKWEADKKIYDGFTTNGVMICHPLVDFDPDIRCPDALSKIKECQSSFANSSWREVSVSGAVYSCLSKRGVPQGKSRLDEDNILRDGTLIDLCGVTIIWRSEYTDTEIEDNIISLCSKLNETHIQCPIGYQTLRISPDFSVWQIDDENKRKFLKAGSDSKQQQVQNKQQQSNNSCYQQLFNKDSCRPYVYLKCGHVHGFHEWKTVEDNNQCRTCPLCKQRSPFVALVMGQETGFFLDLELPTYCFNPCGHMGSEATVKYWYSVALPNRKNSELSPRCPFCYVECTDKPVRLIFS
Sbjct:    1 MTEIVYGYLIVLGTNGRKSWRYSNNKKETNKLKVVQRSQANGIKQIKIGRFKEAKSSQAVQSKFRHAVSYTLSQDEAIVVEYGNDPETDMYQIGRCTEDQIDFVVNSVPLDKEYKNPKSPGPETVSRFACRIFISRQAPHVARIFAAGFDGNKNIFLGENAIKWEADKKIYDGFTTNGVMICHPLVDFDPDIRCPDALSKIKECQSSFANSSWREVSVSGAVYSCLSKRGVPQGKSRLDEDNILRDGTLIDLCGVTIIWRSEYTDTEIEDNIISLCSKLNETHIQCPIGYQTLRISPDFSVWQIDDENKRKFLKAGSDSKQQQVQNKQQQSNNSCYQQLFNKDSCRPYVYLKCGHVHGFHEWKTVEDNNQCRTCPLCKQRSPFVALVMGQETGFFLDLELPTYCFNPCGHMGSEATVKYWYSVALPNRKNSELSPRCPFCYVECTDKPVRLIFS 454          
The following BLAST results are available for this feature:
BLAST of Pellino vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PELI25.615e-9335.96pellino E3 ubiquitin protein ligase family member ... [more]
PELI11.183e-9236.98pellino E3 ubiquitin protein ligase 1 [Source:HGNC... [more]
PELI31.723e-8636.54pellino E3 ubiquitin protein ligase family member ... [more]
PELI32.232e-8336.49pellino E3 ubiquitin protein ligase family member ... [more]
PELI37.137e-8335.45pellino E3 ubiquitin protein ligase family member ... [more]
back to top
BLAST of Pellino vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
peli-11.916e-7735.11PELI1 and PELI2 related [Source:UniProtKB/TrEMBL;... [more]
back to top
BLAST of Pellino vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Pli1.009e-9538.33gene:FBgn0025574 transcript:FBtr0084527[more]
Pli1.009e-9538.33gene:FBgn0025574 transcript:FBtr0112907[more]
back to top
BLAST of Pellino vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
peli25.274e-9335.67pellino E3 ubiquitin protein ligase family member ... [more]
peli1b2.088e-9136.66pellino E3 ubiquitin protein ligase 1b [Source:ZFI... [more]
peli1b2.088e-9136.66pellino E3 ubiquitin protein ligase 1b [Source:ZFI... [more]
peli36.045e-8935.55pellino E3 ubiquitin protein ligase family member ... [more]
peli36.045e-8935.55pellino E3 ubiquitin protein ligase family member ... [more]
back to top
BLAST of Pellino vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
mid1ip11.912e-9235.75MID1 interacting protein 1 [Source:Xenbase;Acc:XB-... [more]
phf5a2.000e-9236.76PHD finger protein 5A [Source:Xenbase;Acc:XB-GENE-... [more]
back to top
BLAST of Pellino vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Peli19.546e-9336.98pellino 1 [Source:MGI Symbol;Acc:MGI:1914495][more]
Peli19.546e-9336.98pellino 1 [Source:MGI Symbol;Acc:MGI:1914495][more]
Peli23.087e-9135.75pellino 2 [Source:MGI Symbol;Acc:MGI:1891445][more]
Peli33.738e-8535.89pellino 3 [Source:MGI Symbol;Acc:MGI:1924963][more]
Peli31.552e-6733.48pellino 3 [Source:MGI Symbol;Acc:MGI:1924963][more]
back to top
BLAST of Pellino vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O77237|PELI_DROME1.012e-9438.33Protein pellino OS=Drosophila melanogaster OX=7227... [more]
sp|Q9HAT8|PELI2_HUMAN2.697e-9235.96E3 ubiquitin-protein ligase pellino homolog 2 OS=H... [more]
sp|Q96FA3|PELI1_HUMAN5.684e-9236.98E3 ubiquitin-protein ligase pellino homolog 1 OS=H... [more]
sp|Q8C669|PELI1_MOUSE6.677e-9236.98E3 ubiquitin-protein ligase pellino homolog 1 OS=M... [more]
sp|Q8BST6|PELI2_MOUSE4.696e-8935.53E3 ubiquitin-protein ligase pellino homolog 2 OS=M... [more]
back to top
BLAST of Pellino vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4S2LGM14.469e-11942.92Uncharacterized protein OS=Opisthorchis felineus O... [more]
G7YGN41.087e-11342.54Pellino protein OS=Clonorchis sinensis OX=79923 GN... [more]
A0A5K4F1L31.425e-10940.25Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
A0A3S3P3333.606e-10239.22Protein pellino-like protein OS=Dinothrombium tinc... [more]
A0A210PQ555.406e-10140.31Protein pellino OS=Mizuhopecten yessoensis OX=6573... [more]
back to top
BLAST of Pellino vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
peli1b1.134e-9136.36pellino E3 ubiquitin protein ligase 1 [Source:NCBI... [more]
peli21.976e-9135.45E3 ubiquitin-protein ligase pellino homolog 2 [Sou... [more]
ENSAMXT00000048958.15.418e-9034.48pellino E3 ubiquitin protein ligase family member ... [more]
peli31.122e-8734.97E3 ubiquitin-protein ligase pellino homolog 1-like... [more]
peli1a1.214e-8636.70pellino E3 ubiquitin protein ligase 1a [Source:ZFI... [more]
back to top
BLAST of Pellino vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000010741.18.686e-8934.29pep scaffold:Pmarinus_7.0:GL480794:158419:164193:-... [more]
ENSPMAT00000010060.11.775e-4345.11pep scaffold:Pmarinus_7.0:GL485699:150812:160856:1... [more]
back to top
BLAST of Pellino vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Pellino vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO337262.217e-8936.52Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO293492.880e-4331.12Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO337254.257e-1135.56Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Pellino vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
peli27.838e-9335.96E3 ubiquitin-protein ligase pellino homolog 2 [Sou... [more]
ENSORLT00000018940.21.082e-9136.93E3 ubiquitin-protein ligase pellino homolog 2 [Sou... [more]
peli1b4.476e-9035.65E3 ubiquitin-protein ligase pellino homolog 1 [Sou... [more]
peli1a3.539e-8836.30E3 ubiquitin-protein ligase pellino homolog 1 [Sou... [more]
back to top
BLAST of Pellino vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000029869.10.000e+0100.00SMESG000029869.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30028571 ID=SMED30028571|Name=Pellino|organism=Schmidtea mediterranea sexual|type=transcript|length=1535bp
CTTTTGCAATTTGAATAATTTAAGAATAATAAATTTTATTTATAATTTTT
GAATTTTTTTATTTTTTCCTTTTTTACTCTTACGAAAAAAATATTTTAAA
ACATAGAGATTTTTCGTATTTTTTAAATGACTGAAATTGTTTATGGTTAT
TTAATTGTACTCGGAACAAACGGTAGAAAATCATGGCGTTATTCAAATAA
TAAGAAAGAAACAAATAAACTTAAAGTTGTTCAAAGATCTCAGGCAAATG
GAATAAAGCAAATAAAAATCGGTAGATTTAAAGAAGCTAAAAGTAGCCAG
GCAGTTCAAAGTAAATTTCGACATGCTGTAAGTTACACTTTATCTCAAGA
CGAAGCAATTGTAGTTGAATATGGAAACGACCCAGAAACAGATATGTATC
AAATTGGTCGTTGTACTGAAGATCAAATCGATTTCGTTGTCAATTCAGTT
CCCTTAGACAAAGAATACAAAAACCCCAAATCTCCCGGTCCTGAAACGGT
TTCTCGATTCGCTTGCCGAATCTTCATCAGTCGTCAAGCTCCTCATGTCG
CCAGAATATTTGCAGCCGGCTTCGATGGAAATAAGAATATTTTTCTTGGA
GAAAACGCAATCAAATGGGAAGCAGATAAAAAGATCTATGACGGTTTCAC
CACGAACGGAGTGATGATTTGTCATCCGCTTGTCGATTTCGATCCAGATA
TTCGCTGTCCAGATGCCTTATCGAAAATTAAAGAATGCCAGTCATCCTTT
GCAAATTCGTCGTGGCGAGAAGTCAGTGTATCTGGTGCTGTTTATAGTTG
CTTGTCAAAAAGGGGTGTGCCACAGGGTAAATCACGATTAGACGAAGACA
ATATTTTACGTGACGGAACGTTGATTGATCTTTGTGGAGTAACAATAATA
TGGAGGTCCGAATACACCGATACAGAAATAGAAGATAACATTATTTCCTT
GTGTTCAAAACTCAACGAGACTCACATTCAATGTCCCATAGGATATCAGA
CGCTCCGGATCAGTCCAGATTTTTCAGTCTGGCAGATAGATGATGAGAAC
AAAAGGAAATTCCTCAAAGCTGGGAGCGATTCTAAGCAACAGCAAGTGCA
GAACAAACAGCAGCAATCGAACAATAGTTGTTATCAGCAATTGTTCAACA
AGGATTCCTGTCGTCCCTATGTCTATTTGAAATGTGGACACGTGCACGGA
TTCCATGAATGGAAGACCGTCGAGGATAACAATCAATGCCGCACTTGCCC
GCTGTGCAAACAGAGAAGTCCATTTGTCGCGCTGGTAATGGGTCAGGAGA
CCGGTTTCTTCCTCGACCTAGAACTGCCCACCTACTGTTTCAATCCATGT
GGACACATGGGATCAGAAGCCACAGTCAAATATTGGTACAGCGTGGCGCT
GCCGAATCGCAAGAACTCTGAGCTCAGTCCCAGGTGCCCATTTTGTTATG
TTGAATGTACAGATAAACCAGTCAGATTGATTTTTTCTTGACATTTCATT
GTGATAATATAATAATAATAATAATATTATTAATA
back to top

protein sequence of SMED30028571-orf-1

>SMED30028571-orf-1 ID=SMED30028571-orf-1|Name=SMED30028571-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=455bp
MTEIVYGYLIVLGTNGRKSWRYSNNKKETNKLKVVQRSQANGIKQIKIGR
FKEAKSSQAVQSKFRHAVSYTLSQDEAIVVEYGNDPETDMYQIGRCTEDQ
IDFVVNSVPLDKEYKNPKSPGPETVSRFACRIFISRQAPHVARIFAAGFD
GNKNIFLGENAIKWEADKKIYDGFTTNGVMICHPLVDFDPDIRCPDALSK
IKECQSSFANSSWREVSVSGAVYSCLSKRGVPQGKSRLDEDNILRDGTLI
DLCGVTIIWRSEYTDTEIEDNIISLCSKLNETHIQCPIGYQTLRISPDFS
VWQIDDENKRKFLKAGSDSKQQQVQNKQQQSNNSCYQQLFNKDSCRPYVY
LKCGHVHGFHEWKTVEDNNQCRTCPLCKQRSPFVALVMGQETGFFLDLEL
PTYCFNPCGHMGSEATVKYWYSVALPNRKNSELSPRCPFCYVECTDKPVR
LIFS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0000209protein polyubiquitination
GO:0008592regulation of Toll signaling pathway
GO:0008063Toll signaling pathway
Vocabulary: molecular function
TermDefinition
GO:0061630ubiquitin protein ligase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000101muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR006800Pellino_fam
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006800Pellino familyPFAMPF04710Pellinocoord: 3..335
e-value: 9.9E-87
score: 291.3
coord: 342..453
e-value: 7.5E-38
score: 130.3
IPR006800Pellino familyPANTHERPTHR12098E3 ubiquitin-protein ligase pellino-relatedcoord: 344..453
IPR006800Pellino familyPANTHERPTHR12098E3 ubiquitin-protein ligase pellino-relatedcoord: 3..336
NoneNo IPR availablePANTHERPTHR12098:SF2PROTEIN PELLINOcoord: 3..336
NoneNo IPR availablePANTHERPTHR12098:SF2PROTEIN PELLINOcoord: 344..453