zinc finger BED domain-containing protein 4-like

Overview
Namezinc finger BED domain-containing protein 4-like
Smed IDSMED30028553
Length (bp)2602
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of zinc finger BED domain-containing protein 4-like (SMED30028553) t-SNE clustered cells

Violin plots show distribution of expression levels for zinc finger BED domain-containing protein 4-like (SMED30028553) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of zinc finger BED domain-containing protein 4-like (SMED30028553) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for zinc finger BED domain-containing protein 4-like (SMED30028553) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30028553

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 18

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30028553h1SMcG0003578 SMED30028553smed_20140614PMID:27502555
Solana et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30028553h1SMcG0003578 SMED30028553smed_20140614PMID:27502555
Solana et al., 2016
whole organism asexual adult single-cell RNA-sequencing evidence
gutSMED30028553h1SMcG0003579 SMED30028553smed_20140614PMID:27502555
Solana et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30028553h1SMcG0003579 SMED30028553smed_20140614PMID:27502555
Solana et al., 2016
whole organism asexual adult single-cell RNA-sequencing evidence
gutSMED30028553h1SMcG0003578 SMED30028553smed_20140614PMID:27502555
Solana et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30028553h1SMcG0003578 SMED30028553smed_20140614PMID:27502555
Solana et al., 2016
whole organism asexual adult single-cell RNA-sequencing evidence
gutSMED30028553h1SMcG0003579 SMED30028553smed_20140614PMID:27502555
Solana et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30028553h1SMcG0003579 SMED30028553smed_20140614PMID:27502555
Solana et al., 2016
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30028553h1SMcG0003578 Contig20816uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30028553h1SMcG0003578 Contig20816newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30028553h1SMcG0003579 Contig20816uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30028553h1SMcG0003579 Contig20816newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30028553h1SMcG0003578 Contig20816uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30028553h1SMcG0003578 Contig20816newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30028553h1SMcG0003579 Contig20816uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30028553h1SMcG0003579 Contig20816newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30028553h1SMcG0003578 dd_Smed_v4_4169_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30028553h1SMcG0003578 dd_Smed_v4_4169_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of zinc finger BED domain-containing protein 4-like vs. Ensembl Human
Match: ZBED4 (zinc finger BED-type containing 4 [Source:HGNC Symbol;Acc:HGNC:20721])

HSP 1 Score: 233.032 bits (593), Expect = 4.153e-63
Identity = 182/643 (28.30%), Postives = 311/643 (48.37%), Query Frame = 1
Query:  598 TSSIWNYFTVSPLINSKAICNLCNVSLSRGGNESKSFTTSNLVQHLRSKHVVAFADFXXXXXXXXXXXXXXXTASIPRPATIEA---LLDRRQPFEFNDKRALDWNKTIAEFMALDVQPFSVVDNVGFRRIIAKAEPRYTIPSSRYFSSTLIPAMHEKIQNKVREMVSSQPSTSL--TSDAWSDPSISVALLSLTAHWVT--------EDFQRKQAILAASPIEESHTGDYLGGMLLKILGDY-----TIEKSAVHVLLRDSGANMIKASRVADIDSISCFAHTLQLVINDSIMSQRSVKDILAISRSNVGKFRHSVLAQQHLSDLQGSLGVPKKKLVQDVQTRWNATLAMLRSLVEQKQVLGAYATEHKLTNL-DAHQWTLISHIIDTLSPFKDATKEVSDSQTSISVFLP-------------KHTMSEGIMTMRQDILTSLNKRFAHTKENRKMVLATILDPRFKNFAYDDRELASTAKQWLKNECLILASAERSEEVVEPPSKRPRVETDQAHPGSSTS---RLWDLFSDVVSEPALQTNSSIIGNVNDAVDAMIALYLSSAALPRTENPYVWWNSNKLLFPYLATLSRRYLSAPASSVPSEQLFSGAWQIFSDRRGSLTAGKGEMLLLLKYNLPQFSF 2421
            TS +WN+F++    ++K +C  C  ++SRG  +  +  TS L++HL+  H         +++  + A        +PR   +       D  + F  +   A      IAE +ALD+QP+S VDNVGF R++   +P+Y++P+  YFS T IP M++ ++  +   +    S  +  TS  W   + +   L+LTAHWV+         D     A+L  S ++     DY G  + K L  +     T     V + + D+ A++ K     +  S+ CF+HT+ L+++++I SQR V+++L+++R    +   S  A++ L++LQ    +P+  L+QDV ++W+ +  ML  L+EQK+ +   + E     L    QW ++  +   L PF+ A++E+S   +++S  +P             + TM  GI TM + +  ++  R + T  + + V AT+LDPR+K   + + E A   KQ L  E  ++ S   SE+V    S R     D   P   ++    LW L + V  +   +             +AM+  YL    L  + +P  +WN  K  +P L+ L+ R+L  P S VPSE+LF+   +  S  +  L     E L+ LK NLP   F
Sbjct:  560 TSKLWNHFSICSADSTKVVCLHCGRTISRG-KKPTNLGTSCLLRHLQRFHSNVL-----KTEVSETARPSSPDTRVPRGTELSGASSFDDTNEKFYDSHPVAKKITSLIAEMIALDLQPYSFVDNVGFNRLLEYLKPQYSLPAPSYFSRTAIPGMYDNVKQIIMSHLKEAESGVIHFTSGIWMS-NQTREYLTLTAHWVSFESPARPRCDDHHCSALLDVSQVD----CDYSGNSIQKQLECWWEAWVTSTGLQVGITVTDN-ASIGKTLNEGEHSSVQCFSHTVNLIVSEAIKSQRMVQNLLSLARKICERVHRSPKAKEKLAELQREYALPQHHLIQDVPSKWSTSFHMLERLIEQKRAINEMSVECNFRELISCDQWEVMQSVCRALKPFEAASREMSTQMSTLSQVIPMVHILNRKVEMLFEETM--GIDTMLRSLKEAMVSRLSATLHDPRYVFATLLDPRYKASLFTEEE-AEQYKQDLIRELELMNST--SEDVAA--SHR----CDAGSPSKDSAAEENLWSLVAKVKKKDPREK----------LPEAMVLAYLEEEVLEHSCDPLTYWNLKKASWPGLSALAVRFLGCPPSIVPSEKLFNTPTENGSLGQSRLMMEHFEKLIFLKVNLPLIYF 1169          
BLAST of zinc finger BED domain-containing protein 4-like vs. Ensembl Human
Match: ZBED6 (zinc finger BED-type containing 6 [Source:HGNC Symbol;Acc:HGNC:33273])

HSP 1 Score: 159.458 bits (402), Expect = 2.118e-39
Identity = 149/564 (26.42%), Postives = 249/564 (44.15%), Query Frame = 1
Query:  904 NKTIAEFMALDVQPFSVVDNVGFRRIIAKAEPRYTIPSSRYFSSTLIPAMHEKIQNKV---REMVSSQPSTSLTSDAWS-DPSISVALLSLTAHWVT------------EDFQRKQAILAASPIEESHTGDYLGGMLLKILGDYTIEKSAVHVLL-----RDSGANMIKASRVADIDSISCFAHTLQLVINDSIMSQRSVKDILAISRSNVGKFRHSVLAQQHLSDLQGSLGVPKKKLVQDVQTRWNATLAMLRSLVEQKQVLGAYATEHKLTN-----LDAHQWTLISHIIDTLSPFKDATKEVSDSQTSISVFLPK-HTMSEGIMTMRQD-----ILTSLN------------KRFAHTKENRKMVLATILDPRFKNFAYD------DRELASTAKQWLKNECLILASAERSEEVVEPPSKRPRVETDQAHPGSSTSRLWD-------LFSDVVSEPALQTNSSIIGNVNDAVDAMIALYLSSAALPRTENPYVWWNSNKLLFPYLATLSRRYLSAPASSVPSEQLFSGAWQIFSDRRGSLTAGKGEMLLLLKYNLPQFSFN 2424
            ++ I + +  D+ P++      F+R +    P Y +PS  YF +  +P +++ ++ K+    E V SQ    LT D W+ DPS    ++  T HWV+             DF RK A+L  + + +    D L   +L+ L D      + + L+      D+ +N++ A +      + CF H L +VI D     +S++++L  +R     F HSV A+Q L + Q    +P K L QD    W +T  ML+ L+E       Y+  H L       L + QWTL++++ D L PF++AT++VS     ++  LP  H +   +  +R+D     I  +LN               +   +++  +LAT+LDP FKN   D      D E   T KQ+L  E  +    E S E+ + P+      +      S TS L +       + S  V   AL + S +  +    VD       S       ++P ++W     ++P L  ++ +YLS P  S  SE +F+        +  SL     E L+ LK NL   +++
Sbjct:  411 SQAIIQMIVEDMHPYNYFSTPAFQRFMQIVAPDYRLPSETYFFTKAVPQLYDCVREKIFLTLENVQSQ-KIHLTVDIWTHDPSTDYFIV--TVHWVSLETASFLNNGRIPDF-RKWAVLCVTGLAK----DCLITNILQELNDQIGLWLSPNFLIPSFIVSDNSSNVVHAIKDGGFTHVPCFLHCLNMVIQDFFCEHKSIENMLVAARKTCHHFSHSVKARQILQEFQNDHQLPWKNLKQDETGHWISTFYMLKWLLEH-----CYSVHHSLGRASGVVLTSLQWTLMTYVCDILKPFEEATQKVSVKTAGLNQVLPLIHHLLLSLQKLREDFQVRGITQALNLVDSLSLKLETDTLLSAMLKSKPCILATLLDPCFKNSLEDFFPQGADLE---TYKQFLAEE--VCNYMESSPEICQIPTSEASCPSVTVGADSFTSSLKEGTSSSGSVDSSAVDNVALGSKSFMFPSAVAVVDEYFKEKYSE--FSGGDDPLIYWQRKISIWPALTQVAIQYLSCPMCSWQSECIFTKNSHFHPKQIMSLDFDNIEQLMFLKMNLKNVNYD 954          
BLAST of zinc finger BED domain-containing protein 4-like vs. Ensembl Human
Match: ZBED1 (zinc finger BED-type containing 1 [Source:HGNC Symbol;Acc:HGNC:447])

HSP 1 Score: 148.288 bits (373), Expect = 2.984e-36
Identity = 147/631 (23.30%), Postives = 270/631 (42.79%), Query Frame = 1
Query:  601 SSIWNYFTVSP------LINSKAICNLCNVSLSRGGNESKSFTTSNLVQHLRSKHVVAFADFXXXXXXXXXXXXXXXTASIPRPATIEALLDR---RQPFEFNDKRALDWNKTIAEFMALDVQPFSVVDNVGFRRIIAKAEPRYTIPSSRYFSSTLIPAMHEKIQNKVREMVSSQPSTSLTSDAWSDPSISVALLSLTAHWVT----EDFQRKQAILAASPIEESHTGDYLGGMLLKILGDYTIEKSAVHVLLRDSGANMIKASRVADID-SISCFAHTLQLVINDSIMSQRSVKDILAISRSNVGKFRHSVLAQQHLSDLQGSLGVPKKKLVQDVQTRWNATLAMLRSLVEQKQVLGAYATE----HKLTNLDAHQWTLISHIIDTLSPFKDATKEVSDSQ-TSISVFLP------------KHTMSEGIMTMRQDILTSLNKRFAHTKE-NRKMVLATILDPRFKNFAYDDRELASTAKQWLKNECLILASAERSEEVVEPPSKRPRVETDQAHPGSSTSRLWDLFSDVVSEPALQTNSSI------IGNVND------AVDAMIALYLSSAALPRTENPYVWWNSNKLLFPYLATLSRRYLSAPASSVPSEQLFSGAWQIFSDRRGSL 2361
            S +W YF          L   K  C +C   ++  GN      TSNL  HL   H   F +F K + E+       + + +   ++ +   D    +    ++ K+  +    +   +   + P S+VD   F+ ++  A+PRY +PS +Y S+  IP  +  ++  + + ++      +++D W   + + A ++L AH++              L    + E +T + +  +L ++  ++ I  + V     + G +++KA  + D+   + C  HT    I  +    + +  +L+  R  V  F+ S +A   L + Q    V    LV +  + W +TLAML+ L EQ+ V+     E    H L  L+A +W  I  +++ L PFK   + +S S+  +IS+  P            K T S+ +   ++ I   L+K +  T E +  + +AT LDPR+K   +    L++  +Q ++N   ++  A+   + V+    RP    D+  P      +  L       PA   N+ +       G V D       V   ++ + S   L   E+P  WW+    LFP L  + ++Y    A+ V  E+LF  A  + S +R  L
Sbjct:   23 SKVWKYFGFDTNAEGCILQWKKIYCRICMAQIAYSGN------TSNLSYHLEKNHPEEFCEFVKSNTEQMREAFATAFSKLKPESSQQPGQDALAVKAGHGYDSKKQQELTAAVLGLICEGLYPASIVDEPTFKVLLKTADPRYELPSRKYISTKAIPEKYGAVREVILKELAEATWCGISTDMWRSENQNRAYVTLAAHFLGLGAPNCLSMGSRCLKTFEVPEENTAETITRVLYEVFIEWGI-SAKVFGATTNYGKDIVKACSLLDVAVHMPCLGHTFNAGIQQAFQLPK-LGALLSRCRKLVEYFQQSAVAMYMLYEKQKQQNVAHCMLVSNRVSWWGSTLAMLQRLKEQQFVIAGVLVEDSNNHHLM-LEASEWATIEGLVELLQPFKQVAEMLSASRYPTISMVKPLLHMLLNTTLNIKETDSKELSMAKEVIAKELSKTYQETPEIDMFLNVATFLDPRYKRLPF----LSAFERQQVENR--VVEEAKGLLDKVKDGGYRPA--EDKIFPVPEEPPVKKLMRTSTPPPASVINNMLAEIFCQTGGVEDQEEWHAQVVEELSNFKSQKVLGLNEDPLKWWSDRLALFPLLPKVLQKYWCVTATRVAPERLFGSAANVVSAKRNRL 636          
BLAST of zinc finger BED domain-containing protein 4-like vs. Ensembl Human
Match: ZBED1 (zinc finger BED-type containing 1 [Source:HGNC Symbol;Acc:HGNC:447])

HSP 1 Score: 148.288 bits (373), Expect = 2.984e-36
Identity = 147/631 (23.30%), Postives = 270/631 (42.79%), Query Frame = 1
Query:  601 SSIWNYFTVSP------LINSKAICNLCNVSLSRGGNESKSFTTSNLVQHLRSKHVVAFADFXXXXXXXXXXXXXXXTASIPRPATIEALLDR---RQPFEFNDKRALDWNKTIAEFMALDVQPFSVVDNVGFRRIIAKAEPRYTIPSSRYFSSTLIPAMHEKIQNKVREMVSSQPSTSLTSDAWSDPSISVALLSLTAHWVT----EDFQRKQAILAASPIEESHTGDYLGGMLLKILGDYTIEKSAVHVLLRDSGANMIKASRVADID-SISCFAHTLQLVINDSIMSQRSVKDILAISRSNVGKFRHSVLAQQHLSDLQGSLGVPKKKLVQDVQTRWNATLAMLRSLVEQKQVLGAYATE----HKLTNLDAHQWTLISHIIDTLSPFKDATKEVSDSQ-TSISVFLP------------KHTMSEGIMTMRQDILTSLNKRFAHTKE-NRKMVLATILDPRFKNFAYDDRELASTAKQWLKNECLILASAERSEEVVEPPSKRPRVETDQAHPGSSTSRLWDLFSDVVSEPALQTNSSI------IGNVND------AVDAMIALYLSSAALPRTENPYVWWNSNKLLFPYLATLSRRYLSAPASSVPSEQLFSGAWQIFSDRRGSL 2361
            S +W YF          L   K  C +C   ++  GN      TSNL  HL   H   F +F K + E+       + + +   ++ +   D    +    ++ K+  +    +   +   + P S+VD   F+ ++  A+PRY +PS +Y S+  IP  +  ++  + + ++      +++D W   + + A ++L AH++              L    + E +T + +  +L ++  ++ I  + V     + G +++KA  + D+   + C  HT    I  +    + +  +L+  R  V  F+ S +A   L + Q    V    LV +  + W +TLAML+ L EQ+ V+     E    H L  L+A +W  I  +++ L PFK   + +S S+  +IS+  P            K T S+ +   ++ I   L+K +  T E +  + +AT LDPR+K   +    L++  +Q ++N   ++  A+   + V+    RP    D+  P      +  L       PA   N+ +       G V D       V   ++ + S   L   E+P  WW+    LFP L  + ++Y    A+ V  E+LF  A  + S +R  L
Sbjct:   23 SKVWKYFGFDTNAEGCILQWKKIYCRICMAQIAYSGN------TSNLSYHLEKNHPEEFCEFVKSNTEQMREAFATAFSKLKPESSQQPGQDALAVKAGHGYDSKKQQELTAAVLGLICEGLYPASIVDEPTFKVLLKTADPRYELPSRKYISTKAIPEKYGAVREVILKELAEATWCGISTDMWRSENQNRAYVTLAAHFLGLGAPNCLSMGSRCLKTFEVPEENTAETITRVLYEVFIEWGI-SAKVFGATTNYGKDIVKACSLLDVAVHMPCLGHTFNAGIQQAFQLPK-LGALLSRCRKLVEYFQQSAVAMYMLYEKQKQQNVAHCMLVSNRVSWWGSTLAMLQRLKEQQFVIAGVLVEDSNNHHLM-LEASEWATIEGLVELLQPFKQVAEMLSASRYPTISMVKPLLHMLLNTTLNIKETDSKELSMAKEVIAKELSKTYQETPEIDMFLNVATFLDPRYKRLPF----LSAFERQQVENR--VVEEAKGLLDKVKDGGYRPA--EDKIFPVPEEPPVKKLMRTSTPPPASVINNMLAEIFCQTGGVEDQEEWHAQVVEELSNFKSQKVLGLNEDPLKWWSDRLALFPLLPKVLQKYWCVTATRVAPERLFGSAANVVSAKRNRL 636          
BLAST of zinc finger BED domain-containing protein 4-like vs. Ensembl Human
Match: ZBED1 (zinc finger BED-type containing 1 [Source:HGNC Symbol;Acc:HGNC:447])

HSP 1 Score: 148.288 bits (373), Expect = 2.984e-36
Identity = 147/631 (23.30%), Postives = 270/631 (42.79%), Query Frame = 1
Query:  601 SSIWNYFTVSP------LINSKAICNLCNVSLSRGGNESKSFTTSNLVQHLRSKHVVAFADFXXXXXXXXXXXXXXXTASIPRPATIEALLDR---RQPFEFNDKRALDWNKTIAEFMALDVQPFSVVDNVGFRRIIAKAEPRYTIPSSRYFSSTLIPAMHEKIQNKVREMVSSQPSTSLTSDAWSDPSISVALLSLTAHWVT----EDFQRKQAILAASPIEESHTGDYLGGMLLKILGDYTIEKSAVHVLLRDSGANMIKASRVADID-SISCFAHTLQLVINDSIMSQRSVKDILAISRSNVGKFRHSVLAQQHLSDLQGSLGVPKKKLVQDVQTRWNATLAMLRSLVEQKQVLGAYATE----HKLTNLDAHQWTLISHIIDTLSPFKDATKEVSDSQ-TSISVFLP------------KHTMSEGIMTMRQDILTSLNKRFAHTKE-NRKMVLATILDPRFKNFAYDDRELASTAKQWLKNECLILASAERSEEVVEPPSKRPRVETDQAHPGSSTSRLWDLFSDVVSEPALQTNSSI------IGNVND------AVDAMIALYLSSAALPRTENPYVWWNSNKLLFPYLATLSRRYLSAPASSVPSEQLFSGAWQIFSDRRGSL 2361
            S +W YF          L   K  C +C   ++  GN      TSNL  HL   H   F +F K + E+       + + +   ++ +   D    +    ++ K+  +    +   +   + P S+VD   F+ ++  A+PRY +PS +Y S+  IP  +  ++  + + ++      +++D W   + + A ++L AH++              L    + E +T + +  +L ++  ++ I  + V     + G +++KA  + D+   + C  HT    I  +    + +  +L+  R  V  F+ S +A   L + Q    V    LV +  + W +TLAML+ L EQ+ V+     E    H L  L+A +W  I  +++ L PFK   + +S S+  +IS+  P            K T S+ +   ++ I   L+K +  T E +  + +AT LDPR+K   +    L++  +Q ++N   ++  A+   + V+    RP    D+  P      +  L       PA   N+ +       G V D       V   ++ + S   L   E+P  WW+    LFP L  + ++Y    A+ V  E+LF  A  + S +R  L
Sbjct:   23 SKVWKYFGFDTNAEGCILQWKKIYCRICMAQIAYSGN------TSNLSYHLEKNHPEEFCEFVKSNTEQMREAFATAFSKLKPESSQQPGQDALAVKAGHGYDSKKQQELTAAVLGLICEGLYPASIVDEPTFKVLLKTADPRYELPSRKYISTKAIPEKYGAVREVILKELAEATWCGISTDMWRSENQNRAYVTLAAHFLGLGAPNCLSMGSRCLKTFEVPEENTAETITRVLYEVFIEWGI-SAKVFGATTNYGKDIVKACSLLDVAVHMPCLGHTFNAGIQQAFQLPK-LGALLSRCRKLVEYFQQSAVAMYMLYEKQKQQNVAHCMLVSNRVSWWGSTLAMLQRLKEQQFVIAGVLVEDSNNHHLM-LEASEWATIEGLVELLQPFKQVAEMLSASRYPTISMVKPLLHMLLNTTLNIKETDSKELSMAKEVIAKELSKTYQETPEIDMFLNVATFLDPRYKRLPF----LSAFERQQVENR--VVEEAKGLLDKVKDGGYRPA--EDKIFPVPEEPPVKKLMRTSTPPPASVINNMLAEIFCQTGGVEDQEEWHAQVVEELSNFKSQKVLGLNEDPLKWWSDRLALFPLLPKVLQKYWCVTATRVAPERLFGSAANVVSAKRNRL 636          
BLAST of zinc finger BED domain-containing protein 4-like vs. Ensembl Celegans
Match: C10A4.1 (pep chromosome:WBcel235:X:7415839:7418627:1 gene:WBGene00015662.1 transcript:C10A4.1.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C10A4.1)

HSP 1 Score: 125.176 bits (313), Expect = 2.019e-29
Identity = 115/525 (21.90%), Postives = 229/525 (43.62%), Query Frame = 1
Query:  886 KRALDWNKTIAEFMALDVQPFSVVDNVGFRRIIAKAEPRYTIPSSRYFSSTLIPAMHEKIQNKVREMVSSQPSTSLTSDAWSDPSISVALLSLTAHWVTEDFQRKQAILAASPIEESHTGDYLGGMLLKILGDYTIEKSAVHVLLRDSGANMIKASRVADIDSISCFAHTLQLVINDSIMSQRSVKDILAISRSNVGKFRHSVLAQQHLSDLQGSLGVPKKKLVQDVQTRWNATLAML-RSLVEQKQVLGAYATEHKLTNLDAHQWTLISHIIDTLSPFKDATKEVSDSQTSISVFLP---------KHTMS--EGIMTMRQDILTSLNKRFAHTKENRKMVLATILDPRFKN-FAYDDRELASTAKQWLKNECLILASAERSEEVVEPPSKRPRVETDQAHPGSSTSRLWDLFSDVVSEPALQTNSSIIGNVNDAVDAMIAL--YLSSAALPRTENPYVWWNS--NKLLFPYLATLSRRYLSAPASSVPSEQLFSGAWQIFSDRRGSLTAGKGEMLLLLKYNLP 2409
            K +   ++ I   +A+D+   + V+  GF+ +IA   P + + S    +   +P ++++ + K+ + + S     L  D WSD      +  +  +++  +    + +   +  E  HT   +   L +++ +Y IE   V  + RD G+N+  A  +   +S  C +H L L  ND+  +   V  +L + +  V K + S +  +    +Q  L +P   L +    RW+    M  R+L+ +  +     T + L  L  + W +I ++ D  +P    +K+  D +T  S  +P         K ++   E    +   +   L K  A     R +  AT+LDPR+K+ F  D+ +     +    NE  +  +++    +++  S      +D+A P  +    ++ F     E  +      I N ++++ A + +  YLS++      NP  +W S     ++P L   + R++  P+ S   E++FS A  I +  R SL +   ++ L L  N+P
Sbjct:  104 KESAKIHRAITSMIAIDLMSLTTVEKPGFKNLIATLRPNFKLKSRWSITREDLPNLYDEYKAKLEDELLSVDHAVLGFDLWSDEGSKHEVNGVIVYFLQNNEVVHRVLGVLNCRESKHTAQNIALGLKELISEYKIEGKIV-CMCRDGGSNVQNACDLLKCESFDCLSHKLHLAANDATKNMVGVGRVLLLYKKLVRKLKKSTVTAKQFESIQEVLELPVLCLQKSSSVRWSHMKLMFDRALIRKSAIEKLMETNNTLPQLTENDWNVIQNVSDVFTPIDLFSKKTQDRETPASQVIPLCYALIDHCKESIDHPEAFKAIEDRMQKELKKYSA----CRYLQFATLLDPRYKDHFCTDEFKHMFIEEFEKCNEDDVYITSDNEVRLLDSHSD----SSDEA-PAKNAKFDFEKF----IEKRISEQPKPIPNCDNSLTARMEVQRYLSTSV--EQVNPRQFWTSRVTTSVYPRLCKFAARFIICPSGSAEVERVFSTAGVILNKFRKSLYSEHFKLHLFLSKNIP 612          
BLAST of zinc finger BED domain-containing protein 4-like vs. Ensembl Celegans
Match: K09A11.1 (pep chromosome:WBcel235:X:13262495:13264589:1 gene:WBGene00010704.1 transcript:K09A11.1.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:K09A11.1)

HSP 1 Score: 120.939 bits (302), Expect = 4.298e-28
Identity = 129/620 (20.81%), Postives = 260/620 (41.94%), Query Frame = 1
Query:  595 LTSSIWNYFTVSPLINSKAICNLCNVSLSRGGNESKSFTTSNLVQHLRSKH----VVAFADFXXXXXXXXXXXXXXXTASIPRPATIEALLDRRQPFEFNDKRALDWNKTIAEFMALDVQPFSVVDNVGFRRIIAKAEPRYTIPSSRYFSSTLIPAMHEKIQNKVREMVSSQPSTSLTSDAWSDPSISVALLSLTAHWVTEDFQRKQAILAASPIEESHTGDYLGGMLLKILGDYTIEKSAVHVLLRDSGANMIKASRVADIDSISCFAHTLQLVINDSIMSQRSVKDILAISRSNVGKFRHSVLAQQHLSDLQGSLGVPKKKLVQDVQTRWNATLAMLRSLVEQKQVLGAYATEHKLTNLDAHQWTLISHIIDTLSPFKDATKEVSDSQTSISVFLP-----------KHTMSEGIMTMRQDILTSLNKRFAHTKENRKMVLATILDPRFKNFAYDDRELASTAKQWLKNECLILASAERSEEVVEPPSKRPRVETDQAHPGSSTSRLWDLFSDVVSEPALQTNSSIIGNVNDAVDAMIALYLSSAALPRTENPYVWWNS-NKLLFPYLATLSRRYLSAPASSVPSEQLFSGAWQIFSDRRGSLTAGKGEMLLLLKYNL 2406
            + S +W+YF    L + +  CNLCN  L+RG   S    T NL+ HL   H    V+        ++E     + QS        T+++  +      +ND    +  K+I E + +D  P +  D  GF+R +    P Y + S     S  +P ++++ ++++R  ++      L+ D WSD      ++ +T +++  +   ++ I   +  ++ H G Y+   L  ++  + +    V V+ RD  + +  A     I S++CF   L L   ++      +  +L   +  V   ++S +  Q    +Q  + +P   L       W         ++E +QV+       +L  L +  W L+  +++ L+P    +K     ++S SV +P                E  + +++ +   L+K  +     + +  +T+LDPR+K+   +D + ++  K  ++ E   +    R+ E          + ++   P   + +L D  + +  +   +   + +      V   +  YLS+A    T   + W N   K  +P LA  +RR++  P  S  +E+LFS       + R +L+    +ML+ L  N+
Sbjct:    2 VKSRVWDYFL--KLQDGRNKCNLCNKILARGSRGS----THNLISHLTRVHPKEYVLQEEPPVMIAQEDSSEFSFQSNNMKTEDFTMQSFFEPEFMKLYNDN---NITKSIMEMICMDSMPMTTTDRAGFKRFMTSVCPDYELKSPSSMISYELPKLYQEYEDQLRMELNLAEHVVLSVDIWSDKGSIQEMIGVTGNFLKNEKVVRRTIGVINYQKDVHNGVYVAAELDNLMARFNL-NGKVEVVCRDYNSIVENACDHLKISSVNCFNQQLHLAACEAKSKIGQINRVLLNCKLLVKNLKNSSVTWQTSEKIQSLMEIPNLCLNHCSDECWCFLQEFFGRVIECQQVI------EELQKLQSSDWDLMRDVVEILAPLSKFSKLSESKESSASVIIPYCDYLVKAYESTQNQPEAFLAVKEHMERELHKYTSC----QYLKFSTLLDPRYKDLYTNDSDTSNLIKA-IETEFETMDYKNRTFE---------EISSELCGPAPKSQKL-DFDAYIQEKIKSRGKHNALTGEKLTVRMEVTRYLSTAVEDVTPRDF-WLNDVTKASYPRLAKFARRFIICPTGSSAAEKLFSTDRATMDEYRNTLSDENLKMLIFLNKNI 589          
BLAST of zinc finger BED domain-containing protein 4-like vs. Ensembl Celegans
Match: mbl-1 (Muscleblind-like protein [Source:UniProtKB/Swiss-Prot;Acc:Q94250])

HSP 1 Score: 67.0106 bits (162), Expect = 4.895e-12
Identity = 23/46 (50.00%), Postives = 34/46 (73.91%), Query Frame = 2
Query:  443 WLTLEICREYMRGECLRDEFSCRYAHPAKNLETQSGRVICCYDYLK 580
            WL +E+CRE++RG+C R +  C++AHP  N++ Q GRV  CYD +K
Sbjct:   38 WLQVEVCREFLRGQCARSDQECKFAHPPPNVDVQQGRVTACYDSIK 83          
BLAST of zinc finger BED domain-containing protein 4-like vs. Ensembl Celegans
Match: mbl-1 (Muscleblind-like protein [Source:UniProtKB/Swiss-Prot;Acc:Q94250])

HSP 1 Score: 67.0106 bits (162), Expect = 4.895e-12
Identity = 23/46 (50.00%), Postives = 34/46 (73.91%), Query Frame = 2
Query:  443 WLTLEICREYMRGECLRDEFSCRYAHPAKNLETQSGRVICCYDYLK 580
            WL +E+CRE++RG+C R +  C++AHP  N++ Q GRV  CYD +K
Sbjct:   38 WLQVEVCREFLRGQCARSDQECKFAHPPPNVDVQQGRVTACYDSIK 83          
BLAST of zinc finger BED domain-containing protein 4-like vs. Ensembl Celegans
Match: mbl-1 (Muscleblind-like protein [Source:UniProtKB/Swiss-Prot;Acc:Q94250])

HSP 1 Score: 67.0106 bits (162), Expect = 4.895e-12
Identity = 23/46 (50.00%), Postives = 34/46 (73.91%), Query Frame = 2
Query:  443 WLTLEICREYMRGECLRDEFSCRYAHPAKNLETQSGRVICCYDYLK 580
            WL +E+CRE++RG+C R +  C++AHP  N++ Q GRV  CYD +K
Sbjct:   38 WLQVEVCREFLRGQCARSDQECKFAHPPPNVDVQQGRVTACYDSIK 83          
BLAST of zinc finger BED domain-containing protein 4-like vs. Ensembl Fly
Match: CG13775 (gene:FBgn0031874 transcript:FBtr0343775)

HSP 1 Score: 166.777 bits (421), Expect = 5.768e-43
Identity = 161/643 (25.04%), Postives = 277/643 (43.08%), Query Frame = 1
Query:  583 MSKQLTSSIWNYFTVSPLINSKAICNLCNVSLSRGGNESKSFTTSNLVQHLRSKHVVAFADFXXXXXXXXXXXXXXXTASIPRP-ATIEALLDR--RQPFEFNDKRALDWNKTIAEFMALDV--QPFSVVDNVGFRRIIAKAEPRYTIPSSRYFSSTLIPAMHEKIQNKVREMVSSQPSTSLTSDAWSDPSISVALLSLTAHWVTEDFQRKQAILAASPIEESHTGDYLGGMLLKILGDYTIE--KSAVHVLLRDSGANMIKASRVADIDSISCFAHTLQLVINDSIMSQRSVKDILAISRSNVGKFRHSVLAQQHLSDLQGSLGVPKKKLVQDVQT-------RWNATLAMLRSLVEQKQVLGAYATEHKLTNLDAHQWTLISHIIDTLSPFKDATKEVSDSQTSISVFLP--------------KHTMSEGIMTMRQDILTSLNKRFAHTKENRKMVLATILDPRFKNFAYDDRELASTAKQWLKNECLILASAERSEEVVEPPSKRPRVETDQAHPGSS-TSRLWDLFSDVVSEPALQTNSSIIGNVNDAVDAMIALYLSSAALPRTENPYVWWNSNKLLFPYLATLSRRYLSAPASSVPSEQLFSGAWQIFSDRRGSLTAGKGEMLLLLKYNLPQFSFN 2424
            MSK+  S++W YF  +    + A C LCN + SR G       T+ L  HL+SKH   F     + K     +++ S  S   P A +E  L      P +  D   + ++K   E +AL +    F  ++  GF   I   +PRYTI    Y+   L   +  K+   +++ V    + SL++  W        LLSL+   ++ DFQ  + +L    +    T   L   +  ++    IE  K  +H ++RD    +     + D     C  H LQ+ +  ++ S   ++++ +  +  V  F  S +A  HL  +Q      + +L +D  T       +WN+   M+ S+   K  L  Y  E+ L  +   +W  I      + P ++  K  S+  T+ S  +P                  S  I +  + +L  L  +FAH   +   ++AT LDPR+K   + +RE     +Q + NE L+  +    +   +PP K  +V +  +    S    + D      +    Q N+S+       +  ++ LY S   + R  +P +WW SN + +  L  + R++LSAPA+SV SE LF  +  ++ D +  L+      +LL+K N   FSF+
Sbjct:    1 MSKK-KSNVWQYFYKTS--GTVATCLLCNRNYSRRGR-----GTTCLRNHLKSKHPPEFLSLSGDIKYLDLVKSEISIGSPQHPTAQLELNLHETDSDPLDTED---ISYSKRCDEKLALMLLNHSFEFIEGPGFVNFIRTLQPRYTIQPRSYYEKILCEDIQRKMHQHLKQQVDLLDAISLSTSLWRGDK-GEGLLSLSCSGISRDFQTHRLMLKCEALNYESTSK-LACCIRDLVPSLAIEVPKEKIHCVIRDEMTAL--PGSLPD-----CSVHRLQMCVRFALQSNELLQNLSSKCKQIVDHFASSKMANDHLKFIQ------EIRLTRDPCTLTPYDPCQWNSAFQMMSSVFRMKDALSLYCEEYSLVQIYPDEWIEIDLCSKVMQPCEETIKIWSNPSTTTSSVIPLVAALRDSLRTDVHNFVSSVTICSFARKLLEELEMKFAHITSDINFLMATYLDPRYKQAFFTERE-----EQLVANEVLLQLAGVPEDCNGQPPLKIIKVSSTSSQKNESKIDSILDSILTTGTTNTQQPNTSM--GSQSQIKNLLYLYNSEPRIDRNMDPLIWWRSN-IKYISLYGIVRKFLSAPAASVVSEGLFRKSTHLYFDMQAGLSPESASKMLLMKAN---FSFS 606          
BLAST of zinc finger BED domain-containing protein 4-like vs. Ensembl Fly
Match: CG13775 (gene:FBgn0031874 transcript:FBtr0079363)

HSP 1 Score: 166.777 bits (421), Expect = 5.768e-43
Identity = 161/643 (25.04%), Postives = 277/643 (43.08%), Query Frame = 1
Query:  583 MSKQLTSSIWNYFTVSPLINSKAICNLCNVSLSRGGNESKSFTTSNLVQHLRSKHVVAFADFXXXXXXXXXXXXXXXTASIPRP-ATIEALLDR--RQPFEFNDKRALDWNKTIAEFMALDV--QPFSVVDNVGFRRIIAKAEPRYTIPSSRYFSSTLIPAMHEKIQNKVREMVSSQPSTSLTSDAWSDPSISVALLSLTAHWVTEDFQRKQAILAASPIEESHTGDYLGGMLLKILGDYTIE--KSAVHVLLRDSGANMIKASRVADIDSISCFAHTLQLVINDSIMSQRSVKDILAISRSNVGKFRHSVLAQQHLSDLQGSLGVPKKKLVQDVQT-------RWNATLAMLRSLVEQKQVLGAYATEHKLTNLDAHQWTLISHIIDTLSPFKDATKEVSDSQTSISVFLP--------------KHTMSEGIMTMRQDILTSLNKRFAHTKENRKMVLATILDPRFKNFAYDDRELASTAKQWLKNECLILASAERSEEVVEPPSKRPRVETDQAHPGSS-TSRLWDLFSDVVSEPALQTNSSIIGNVNDAVDAMIALYLSSAALPRTENPYVWWNSNKLLFPYLATLSRRYLSAPASSVPSEQLFSGAWQIFSDRRGSLTAGKGEMLLLLKYNLPQFSFN 2424
            MSK+  S++W YF  +    + A C LCN + SR G       T+ L  HL+SKH   F     + K     +++ S  S   P A +E  L      P +  D   + ++K   E +AL +    F  ++  GF   I   +PRYTI    Y+   L   +  K+   +++ V    + SL++  W        LLSL+   ++ DFQ  + +L    +    T   L   +  ++    IE  K  +H ++RD    +     + D     C  H LQ+ +  ++ S   ++++ +  +  V  F  S +A  HL  +Q      + +L +D  T       +WN+   M+ S+   K  L  Y  E+ L  +   +W  I      + P ++  K  S+  T+ S  +P                  S  I +  + +L  L  +FAH   +   ++AT LDPR+K   + +RE     +Q + NE L+  +    +   +PP K  +V +  +    S    + D      +    Q N+S+       +  ++ LY S   + R  +P +WW SN + +  L  + R++LSAPA+SV SE LF  +  ++ D +  L+      +LL+K N   FSF+
Sbjct:    1 MSKK-KSNVWQYFYKTS--GTVATCLLCNRNYSRRGR-----GTTCLRNHLKSKHPPEFLSLSGDIKYLDLVKSEISIGSPQHPTAQLELNLHETDSDPLDTED---ISYSKRCDEKLALMLLNHSFEFIEGPGFVNFIRTLQPRYTIQPRSYYEKILCEDIQRKMHQHLKQQVDLLDAISLSTSLWRGDK-GEGLLSLSCSGISRDFQTHRLMLKCEALNYESTSK-LACCIRDLVPSLAIEVPKEKIHCVIRDEMTAL--PGSLPD-----CSVHRLQMCVRFALQSNELLQNLSSKCKQIVDHFASSKMANDHLKFIQ------EIRLTRDPCTLTPYDPCQWNSAFQMMSSVFRMKDALSLYCEEYSLVQIYPDEWIEIDLCSKVMQPCEETIKIWSNPSTTTSSVIPLVAALRDSLRTDVHNFVSSVTICSFARKLLEELEMKFAHITSDINFLMATYLDPRYKQAFFTERE-----EQLVANEVLLQLAGVPEDCNGQPPLKIIKVSSTSSQKNESKIDSILDSILTTGTTNTQQPNTSM--GSQSQIKNLLYLYNSEPRIDRNMDPLIWWRSN-IKYISLYGIVRKFLSAPAASVVSEGLFRKSTHLYFDMQAGLSPESASKMLLMKAN---FSFS 606          
BLAST of zinc finger BED domain-containing protein 4-like vs. Ensembl Fly
Match: CG13775 (gene:FBgn0031874 transcript:FBtr0343776)

HSP 1 Score: 148.673 bits (374), Expect = 1.505e-37
Identity = 125/517 (24.18%), Postives = 222/517 (42.94%), Query Frame = 1
Query:  946 FSVVDNVGFRRIIAKAEPRYTIPSSRYFSSTLIPAMHEKIQNKVREMVSSQPSTSLTSDAWSDPSISVALLSLTAHWVTEDFQRKQAILAASPIEESHTGDYLGGMLLKILGDYTIE--KSAVHVLLRDSGANMIKASRVADIDSISCFAHTLQLVINDSIMSQRSVKDILAISRSNVGKFRHSVLAQQHLSDLQGSLGVPKKKLVQDVQT-------RWNATLAMLRSLVEQKQVLGAYATEHKLTNLDAHQWTLISHIIDTLSPFKDATKEVSDSQTSISVFLP--------------KHTMSEGIMTMRQDILTSLNKRFAHTKENRKMVLATILDPRFKNFAYDDRELASTAKQWLKNECLILASAERSEEVVEPPSKRPRVETDQAHPGSS-TSRLWDLFSDVVSEPALQTNSSIIGNVNDAVDAMIALYLSSAALPRTENPYVWWNSNKLLFPYLATLSRRYLSAPASSVPSEQLFSGAWQIFSDRRGSLTAGKGEMLLLLKYNLPQFSFN 2424
            F  ++  GF   I   +PRYTI    Y+   L   +  K+   +++ V    + SL++  W        LLSL+   ++ DFQ  + +L    +    T   L   +  ++    IE  K  +H ++RD    +     + D     C  H LQ+ +  ++ S   ++++ +  +  V  F  S +A  HL  +Q      + +L +D  T       +WN+   M+ S+   K  L  Y  E+ L  +   +W  I      + P ++  K  S+  T+ S  +P                  S  I +  + +L  L  +FAH   +   ++AT LDPR+K   + +RE     +Q + NE L+  +    +   +PP K  +V +  +    S    + D      +    Q N+S+       +  ++ LY S   + R  +P +WW SN + +  L  + R++LSAPA+SV SE LF  +  ++ D +  L+      +LL+K N   FSF+
Sbjct:    7 FEFIEGPGFVNFIRTLQPRYTIQPRSYYEKILCEDIQRKMHQHLKQQVDLLDAISLSTSLWRGDK-GEGLLSLSCSGISRDFQTHRLMLKCEALNYESTSK-LACCIRDLVPSLAIEVPKEKIHCVIRDEMTAL--PGSLPD-----CSVHRLQMCVRFALQSNELLQNLSSKCKQIVDHFASSKMANDHLKFIQ------EIRLTRDPCTLTPYDPCQWNSAFQMMSSVFRMKDALSLYCEEYSLVQIYPDEWIEIDLCSKVMQPCEETIKIWSNPSTTTSSVIPLVAALRDSLRTDVHNFVSSVTICSFARKLLEELEMKFAHITSDINFLMATYLDPRYKQAFFTERE-----EQLVANEVLLQLAGVPEDCNGQPPLKIIKVSSTSSQKNESKIDSILDSILTTGTTNTQQPNTSM--GSQSQIKNLLYLYNSEPRIDRNMDPLIWWRSN-IKYISLYGIVRKFLSAPAASVVSEGLFRKSTHLYFDMQAGLSPESASKMLLMKAN---FSFS 497          
BLAST of zinc finger BED domain-containing protein 4-like vs. Ensembl Fly
Match: mbl (gene:FBgn0265487 transcript:FBtr0086991)

HSP 1 Score: 62.7734 bits (151), Expect = 9.940e-11
Identity = 23/46 (50.00%), Postives = 33/46 (71.74%), Query Frame = 2
Query:  443 WLTLEICREYMRGECLRDEFSCRYAHPAKNLETQSGRVICCYDYLK 580
            WL LE+CRE+ R +C R +  C++AHP  N+E Q+G+V  CYD +K
Sbjct:   18 WLQLEVCREFQRNKCSRQDTECKFAHPPANVEVQNGKVTACYDSIK 63          
BLAST of zinc finger BED domain-containing protein 4-like vs. Ensembl Fly
Match: mbl (gene:FBgn0265487 transcript:FBtr0086994)

HSP 1 Score: 63.1586 bits (152), Expect = 1.390e-10
Identity = 23/46 (50.00%), Postives = 33/46 (71.74%), Query Frame = 2
Query:  443 WLTLEICREYMRGECLRDEFSCRYAHPAKNLETQSGRVICCYDYLK 580
            WL LE+CRE+ R +C R +  C++AHP  N+E Q+G+V  CYD +K
Sbjct:   18 WLQLEVCREFQRNKCSRQDTECKFAHPPANVEVQNGKVTACYDSIK 63          
BLAST of zinc finger BED domain-containing protein 4-like vs. Ensembl Zebrafish
Match: zbed4 (zinc finger, BED-type containing 4 [Source:ZFIN;Acc:ZDB-GENE-041210-305])

HSP 1 Score: 215.312 bits (547), Expect = 2.279e-57
Identity = 179/645 (27.75%), Postives = 299/645 (46.36%), Query Frame = 1
Query:  598 TSSIWNYFTVSPLINSKAICNLCNVSLSRGGNESKSFTTSNLVQHLRSKHVVAFADFXXXXXXXXXXXXXXXTASIPRPATIEALLDRRQPFEFNDKRALDWNKTIAEFMALDVQPFSVVDNVGFRRIIAKAEPRYTIPSSRYFSSTLIPAMHEKIQNKVREMVSSQPS--TSLTSDAWSDPSISVALLSLTAHWVT---------EDFQRKQAILAASPIEESHTGDYLGGML-----LKILGDYTIEKSAVHVLLRDSGANMIK-ASRVADIDSISCFAHTLQLVINDSIMSQRSVKDILAISRSNVGKFRHSVLAQQHLSDLQGSLGVPKKKLVQDVQTRWNATLAMLRSLVEQKQVLGAYATEHKLTNL-DAHQWTLISHIIDTLSPFKDATKEVSDSQTSISVFLP-------------KHTMSEGIMTMRQDILTSLNKRFAHTKENRKMVLATILDPRFKNFAYDDRELASTAKQWLKNECLILASAERSEEVVEPPSKRPRVETDQAHPGSSTS------RLWDLFSDVVSEPALQTNSSIIGNVNDAVDAMIALYLSSAALPRTENPYVWWNSNKLLFPYLATLSRRYLSAPASSVPSEQLFSGAWQIFSDRRGSLTAGKGEMLLLLKYNLPQFSF 2421
            TS +WN+F++S    +K +C  C+ ++SRG  ++ +  TS L +H++  H        + +           T        I    +  + F      A    K IAE +ALD+QP +VV+NVG  R++   +P+Y++P S YF+ST IP M+E ++  V   +          T+  W   S +   L LTAHWV+         +DF    A+L  + I+     DY   ML     L+ L D  +  S + +    +    I+      D  ++ CF H + L++N++I SQR V+++L+I+R    +   S  A++ L++LQ    +P+ +LVQDV ++W  +  ML  LVEQK+ +   + E     L    QW ++  + + L PF  A +E+S+   ++   +P               TM  GI  M + +  +L  R + T  + + + AT+LDPR+K   + + E A   K  L  E L ++++  +E      +K P        P SS S       LW L  D+  +   +           +++  +  YL    L ++ +P  +WN  KLL+P LA ++ RY+  P S VP++ LFS +    +  +        E LL LK NLP   F
Sbjct:  633 TSKLWNHFSISSADPTKVVCLHCSRTISRG-KKTTNLGTSCLFRHMQRFH----GHVLENNSNISGDGPSAETQVKQELMDISTYQENAEKFSECHPAAKKITKLIAEMLALDLQPSTVVENVGLNRLLEYLQPQYSLPPSSYFTSTAIPEMYESVKEVVLTHLKEAEGGIIHFTTSVWIG-SQTQEYLILTAHWVSFESQVLPQGQDFH-CSALLGVASID----CDY--NMLNIQKQLEYLWDTWMGSSGLKIGFTVTDNQTIRNVLESCDHTTMQCFVHNIDLIVNEAIKSQRMVQNLLSIARKICERVHRSAKAKEKLAELQKVYQLPENQLVQDVPSKWKTSYFMLERLVEQKKAIDEMSIECNFRELISCDQWEVMGSVCNALKPFVVACREMSNRTATLGQVIPLIHILNRKIDMLFDETM--GIDNMLKSLKEALVTRMSPTLHDPRYIWATMLDPRYKTSLFTEEE-AEQCKHDLIQE-LEVSTSNSAE------TKTPLSNGCSEIPASSNSLASNKENLWSLMDDIRQKIKQEEKPK-------SLELAVLEYLEEDILDQSCDPLDYWNLKKLLWPDLAKVAVRYVGCPPSIVPADTLFSTSTVNCALNQSRPLLENFEGLLFLKVNLPLIYF 1247          
BLAST of zinc finger BED domain-containing protein 4-like vs. Ensembl Zebrafish
Match: zbed4 (zinc finger, BED-type containing 4 [Source:ZFIN;Acc:ZDB-GENE-041210-305])

HSP 1 Score: 215.312 bits (547), Expect = 2.279e-57
Identity = 179/645 (27.75%), Postives = 299/645 (46.36%), Query Frame = 1
Query:  598 TSSIWNYFTVSPLINSKAICNLCNVSLSRGGNESKSFTTSNLVQHLRSKHVVAFADFXXXXXXXXXXXXXXXTASIPRPATIEALLDRRQPFEFNDKRALDWNKTIAEFMALDVQPFSVVDNVGFRRIIAKAEPRYTIPSSRYFSSTLIPAMHEKIQNKVREMVSSQPS--TSLTSDAWSDPSISVALLSLTAHWVT---------EDFQRKQAILAASPIEESHTGDYLGGML-----LKILGDYTIEKSAVHVLLRDSGANMIK-ASRVADIDSISCFAHTLQLVINDSIMSQRSVKDILAISRSNVGKFRHSVLAQQHLSDLQGSLGVPKKKLVQDVQTRWNATLAMLRSLVEQKQVLGAYATEHKLTNL-DAHQWTLISHIIDTLSPFKDATKEVSDSQTSISVFLP-------------KHTMSEGIMTMRQDILTSLNKRFAHTKENRKMVLATILDPRFKNFAYDDRELASTAKQWLKNECLILASAERSEEVVEPPSKRPRVETDQAHPGSSTS------RLWDLFSDVVSEPALQTNSSIIGNVNDAVDAMIALYLSSAALPRTENPYVWWNSNKLLFPYLATLSRRYLSAPASSVPSEQLFSGAWQIFSDRRGSLTAGKGEMLLLLKYNLPQFSF 2421
            TS +WN+F++S    +K +C  C+ ++SRG  ++ +  TS L +H++  H        + +           T        I    +  + F      A    K IAE +ALD+QP +VV+NVG  R++   +P+Y++P S YF+ST IP M+E ++  V   +          T+  W   S +   L LTAHWV+         +DF    A+L  + I+     DY   ML     L+ L D  +  S + +    +    I+      D  ++ CF H + L++N++I SQR V+++L+I+R    +   S  A++ L++LQ    +P+ +LVQDV ++W  +  ML  LVEQK+ +   + E     L    QW ++  + + L PF  A +E+S+   ++   +P               TM  GI  M + +  +L  R + T  + + + AT+LDPR+K   + + E A   K  L  E L ++++  +E      +K P        P SS S       LW L  D+  +   +           +++  +  YL    L ++ +P  +WN  KLL+P LA ++ RY+  P S VP++ LFS +    +  +        E LL LK NLP   F
Sbjct:  633 TSKLWNHFSISSADPTKVVCLHCSRTISRG-KKTTNLGTSCLFRHMQRFH----GHVLENNSNISGDGPSAETQVKQELMDISTYQENAEKFSECHPAAKKITKLIAEMLALDLQPSTVVENVGLNRLLEYLQPQYSLPPSSYFTSTAIPEMYESVKEVVLTHLKEAEGGIIHFTTSVWIG-SQTQEYLILTAHWVSFESQVLPQGQDFH-CSALLGVASID----CDY--NMLNIQKQLEYLWDTWMGSSGLKIGFTVTDNQTIRNVLESCDHTTMQCFVHNIDLIVNEAIKSQRMVQNLLSIARKICERVHRSAKAKEKLAELQKVYQLPENQLVQDVPSKWKTSYFMLERLVEQKKAIDEMSIECNFRELISCDQWEVMGSVCNALKPFVVACREMSNRTATLGQVIPLIHILNRKIDMLFDETM--GIDNMLKSLKEALVTRMSPTLHDPRYIWATMLDPRYKTSLFTEEE-AEQCKHDLIQE-LEVSTSNSAE------TKTPLSNGCSEIPASSNSLASNKENLWSLMDDIRQKIKQEEKPK-------SLELAVLEYLEEDILDQSCDPLDYWNLKKLLWPDLAKVAVRYVGCPPSIVPADTLFSTSTVNCALNQSRPLLENFEGLLFLKVNLPLIYF 1247          
BLAST of zinc finger BED domain-containing protein 4-like vs. Ensembl Zebrafish
Match: zbed4 (zinc finger, BED-type containing 4 [Source:ZFIN;Acc:ZDB-GENE-041210-305])

HSP 1 Score: 215.312 bits (547), Expect = 2.279e-57
Identity = 179/645 (27.75%), Postives = 299/645 (46.36%), Query Frame = 1
Query:  598 TSSIWNYFTVSPLINSKAICNLCNVSLSRGGNESKSFTTSNLVQHLRSKHVVAFADFXXXXXXXXXXXXXXXTASIPRPATIEALLDRRQPFEFNDKRALDWNKTIAEFMALDVQPFSVVDNVGFRRIIAKAEPRYTIPSSRYFSSTLIPAMHEKIQNKVREMVSSQPS--TSLTSDAWSDPSISVALLSLTAHWVT---------EDFQRKQAILAASPIEESHTGDYLGGML-----LKILGDYTIEKSAVHVLLRDSGANMIK-ASRVADIDSISCFAHTLQLVINDSIMSQRSVKDILAISRSNVGKFRHSVLAQQHLSDLQGSLGVPKKKLVQDVQTRWNATLAMLRSLVEQKQVLGAYATEHKLTNL-DAHQWTLISHIIDTLSPFKDATKEVSDSQTSISVFLP-------------KHTMSEGIMTMRQDILTSLNKRFAHTKENRKMVLATILDPRFKNFAYDDRELASTAKQWLKNECLILASAERSEEVVEPPSKRPRVETDQAHPGSSTS------RLWDLFSDVVSEPALQTNSSIIGNVNDAVDAMIALYLSSAALPRTENPYVWWNSNKLLFPYLATLSRRYLSAPASSVPSEQLFSGAWQIFSDRRGSLTAGKGEMLLLLKYNLPQFSF 2421
            TS +WN+F++S    +K +C  C+ ++SRG  ++ +  TS L +H++  H        + +           T        I    +  + F      A    K IAE +ALD+QP +VV+NVG  R++   +P+Y++P S YF+ST IP M+E ++  V   +          T+  W   S +   L LTAHWV+         +DF    A+L  + I+     DY   ML     L+ L D  +  S + +    +    I+      D  ++ CF H + L++N++I SQR V+++L+I+R    +   S  A++ L++LQ    +P+ +LVQDV ++W  +  ML  LVEQK+ +   + E     L    QW ++  + + L PF  A +E+S+   ++   +P               TM  GI  M + +  +L  R + T  + + + AT+LDPR+K   + + E A   K  L  E L ++++  +E      +K P        P SS S       LW L  D+  +   +           +++  +  YL    L ++ +P  +WN  KLL+P LA ++ RY+  P S VP++ LFS +    +  +        E LL LK NLP   F
Sbjct:  633 TSKLWNHFSISSADPTKVVCLHCSRTISRG-KKTTNLGTSCLFRHMQRFH----GHVLENNSNISGDGPSAETQVKQELMDISTYQENAEKFSECHPAAKKITKLIAEMLALDLQPSTVVENVGLNRLLEYLQPQYSLPPSSYFTSTAIPEMYESVKEVVLTHLKEAEGGIIHFTTSVWIG-SQTQEYLILTAHWVSFESQVLPQGQDFH-CSALLGVASID----CDY--NMLNIQKQLEYLWDTWMGSSGLKIGFTVTDNQTIRNVLESCDHTTMQCFVHNIDLIVNEAIKSQRMVQNLLSIARKICERVHRSAKAKEKLAELQKVYQLPENQLVQDVPSKWKTSYFMLERLVEQKKAIDEMSIECNFRELISCDQWEVMGSVCNALKPFVVACREMSNRTATLGQVIPLIHILNRKIDMLFDETM--GIDNMLKSLKEALVTRMSPTLHDPRYIWATMLDPRYKTSLFTEEE-AEQCKHDLIQE-LEVSTSNSAE------TKTPLSNGCSEIPASSNSLASNKENLWSLMDDIRQKIKQEEKPK-------SLELAVLEYLEEDILDQSCDPLDYWNLKKLLWPDLAKVAVRYVGCPPSIVPADTLFSTSTVNCALNQSRPLLENFEGLLFLKVNLPLIYF 1247          
BLAST of zinc finger BED domain-containing protein 4-like vs. Ensembl Zebrafish
Match: si:dkey-109j17.5 (si:dkey-109j17.5 [Source:ZFIN;Acc:ZDB-GENE-090313-173])

HSP 1 Score: 122.865 bits (307), Expect = 1.847e-28
Identity = 152/676 (22.49%), Postives = 271/676 (40.09%), Query Frame = 1
Query:  583 MSKQLTSSIWNYFTVSPLINSKAICNLCNVSLSRGGNESKSFTTSNLVQHLRSKHVVAFADFXXXXXXXXXXXXXXXTASIPR--PATIEALLDRRQPFEFNDKRALDWNKTIAEFMALDVQPFSVVDNVGFRRIIAKAEPRYTIPSSRYFSSTLIPAMHEKIQNKVREMVSSQPSTSLTSDAWSDPSI----SVALLSLTAHWVTEDFQRKQAILAASP----------------IEESHTGDYLGGMLLKILGDYTIEKSAVHVLL---------------------RDSGANMIKAS-----------RVADIDSISCFAHTLQLVINDSIMSQRSVKDILAISRSN-VGKFRHSVLAQQHLSDLQGSLGVPKKKLVQDVQTRWNATLAMLRSLVEQKQVLGAYATEHKLTNLDAHQWTLISHIIDTLSPFKDATKEV-SDSQTSISVFLP-------------KHTMSEGIMTMRQDILTSLNKRFAHTKENRKMVLATILDPRFKNFAYDDRELASTAKQWLKNECLILASAERSEEVVEPPSKRPRVETDQAHPGSSTSRLWDLFSDVVSEPALQTNSSIIGNVNDAVDAMIALYLSSAALPRTENPYVWWNSNKLLFPYLATLSRRYLSAPASSVPSEQLFSGAWQIFSDRRGSLTAGKGEMLLLLKYN 2403
            M+ +   SI +YF +     +  I + C    +R   ++K   TSN V HL+ KH   + +F ++   K+EA    +     R  P T   L      F+++D R    ++ IA+ +  D+QP  +V+  GFR ++   EPRY      Y    L+PA   ++Q   ++ +    S S+T D W   S+        L +T H++  D+  + A+LA  P                I ESH    + G + +++ D    +S     L                      D G    K             +      I CFA  L   I + + +   V   L +++++ +  +  + +A + L  + GS    ++    D   +WN  L +LR +V+    L      + L  L   +  L+  +++ L PF++A+  V  D   SIS+ LP              H  S  +M + Q    +L++R A   E+   V AT LDP+FK  ++      S+   W K   ++L   E+    + P       +        S S+   LFS +   P +Q  +         V+  ++ YL     P  E+P  +W    + FP L+ ++++  + PA++   +Q+F+   +     +        + L+ LK N
Sbjct:    1 MASKSRVSILDYFNIVCEGENGKIESNCKACGTR--IQAKRTVTSNFVTHLKRKHQAMYDEFVRKKDVKREAMQTCTGPPSGRMIPQTAAGL----NKFDYSDPRQSLISEAIAKMIIRDLQPPQIVEYEGFRELLQLLEPRYIPVQCHYIQQQLLPAYVSQVQLAAKQALKGAESCSVTLDLWRSSSVGNSSGAGYLGVTCHFINADWHIRSALLACLPLPDHSNTQQMLSEFDEISESHG---ITGKVFRVVADLLPCESRSDFRLPGFSLIGNGEEDEEGEEDGSNGDPGEGESKEGISSNEYHRSLDQCLGRSRIDCFARLLAQCIKEGVCASPHVS--LPLNKASLLYNYIIATVAPEKLVQVFGSSANWQRPSSTD---KWNDQLKILRQMVDSMDFLEDIVDRNDLV-LGNLEKELLRELVEVLEPFEEASDMVQGDKHVSISLALPCVLGLRKHLAEVVTHQCSGIVMGLSQ----ALDRRLAGILEDPLYVTATTLDPQFK-LSW------SSDSDWHKQ--VLLEEVEKHTRTLSPIEHYSETQ-------PSPSKRCKLFSFIKQRPTMQAKT---------VEQELSTYLHEE--PTDEDPLQYWKRKSIDFPLLSQVAKKVFTVPATTTSVDQIFNTVSKTLRPDQCRFLPKNLDTLIYLKAN 630          
BLAST of zinc finger BED domain-containing protein 4-like vs. Ensembl Zebrafish
Match: si:dkey-13n23.3 (si:dkey-13n23.3 [Source:ZFIN;Acc:ZDB-GENE-120214-42])

HSP 1 Score: 116.701 bits (291), Expect = 1.939e-26
Identity = 116/461 (25.16%), Postives = 204/461 (44.25%), Query Frame = 1
Query:  607 IWNYFTVSPLINSKAICNLCNVSLSRGGNESKSFTTSNLVQHLRSKHVVAFADFXXXXXXXXXXXXXXXTA-SIPRPATIEALLDRRQPFEFNDKRALDWNKTIAEFMALDVQPFSVVDNVGFRRIIAKAEPRYTIPSSRYFSSTLIPAMHEKIQNKVREMVSSQPSTSLTSDAWSDPSISVALLSLTA-HWVTEDFQRKQAILAASPIEESHTGDYLGGMLLKILGDYTIEKSAVHVLLRDSGANMIKA-----------------------SRVAD---------IDSISCFAHTLQLVINDSIMSQRSVKDILAISRSNVGKFRHSVLAQQHLSDLQGSLGVPKKKLVQDVQTRWNATLAMLRSLVEQKQVLGAYATEHKLTNLDAHQWTLISHIIDTLSPFKDATKEVSDSQTSISVFLP------KHTMSEGIMTMRQDILT-------SLNKRFA 1848
            IW+ FT     N K++C  C V ++ G N      T+NL +HL++ H       QK S +      K S A S  +   I   L R   ++   K      + IA ++     P + V++  F  ++   + R T+P     S+ LI   +E  + K RE +++    S+  D W+   ++ + L+++A ++  E  +    +LA   +   HT   +   + K + ++TI K  +  ++ D+G+NM+ A                       S + D         +D   C  HT+QLV++  +  + +VK +L  +RS V  FR S +A Q L D  G +      +V D  TRW++T  M+  L++ K  +   + +    +L   +W  +S + D L PF + TK +    TS+S+ +P       H     + T  +D+ T       +LN+RFA
Sbjct:   20 IWSNFTYDNKDN-KSVCKPCGVKIA-GKN------TTNLKRHLQTAHPEIHTKIQKMSDDHGPGGNKASDATSTTQQQAISDFL-RSSKYKTESKEQQTKEQAIARWIGRTGLPLTTVEDEDFVLMMGMIDGRLTVPKKTKISN-LIETQYEHERQKFRESLAAARKVSIGLDLWTKKGLTASFLAISACYFCVEKSKPAHILLALQQVGHPHTAQAIKACVDKCMQEWTIPKEKILTVITDNGSNMVAAFKNTTAEETSSEDDSPGSTIESDSEIDDQRYRHVDMELDRTPCVVHTIQLVVH-MLQKETTVKRVLDKARSVVKLFRKSSVATQKLLDQCGVI------VVNDCPTRWSSTFNMITRLLKVKDAVCQISNDMGWDSLLTSEWQKLSSLHDLLLPFAEHTKTLQSDTTSMSLVVPALFDLLTHLTDFAVNTRYRDLATLADKMRSNLNQRFA 463          
BLAST of zinc finger BED domain-containing protein 4-like vs. Ensembl Xenopus
Match: ZBED4 (zinc finger, BED-type containing 4 [Source:NCBI gene;Acc:100270676])

HSP 1 Score: 236.113 bits (601), Expect = 3.975e-64
Identity = 176/635 (27.72%), Postives = 301/635 (47.40%), Query Frame = 1
Query:  598 TSSIWNYFTVSPLINSKAICNLCNVSLSRGGNESKSFTTSNLVQHLRSKHVVAFADFXXXXXXXXXXXXXXXTASIPRPATIE----ALLDRRQPFEFNDKRALDWNKTIAEFMALDVQPFSVVDNVGFRRIIAKAEPRYTIPSSRYFSSTLIPAMHEKIQNKVREMVSSQPS--TSLTSDAWSDPSISVALLSLTAHWVT--------EDFQRKQAILAASPIEESHTGDYLGGMLLKILGDYTIEKSAVHVLLRDSGANMI-KASRVADIDSISCFAHTLQLVINDSIMSQRSVKDILAISRSNVGKFRHSVLAQQHLSDLQGSLGVPKKKLVQDVQTRWNATLAMLRSLVEQKQVLGAYATEHKLTNL-DAHQWTLISHIIDTLSPFKDATKEVSDSQTSISVFLPK-HTMSE----------GIMTMRQDILTSLNKRFAHTKENRKMVLATILDPRFKNFAYDDRELASTAKQWLKNECLILASAERSEEVVEPPSKRPRVETDQAHPGSSTSRLWDLFSDVVSEPALQTNSSIIGNVNDAVDAMIALYLSSAALPRTENPYVWWNSNKLLFPYLATLSRRYLSAPASSVPSEQLFSGAWQIFSDRRGSLTAGKGEMLLLLKYNLPQFSF 2421
            TS +WN+F++    ++K IC  C  ++SRG   + +  TS L++HL+  H     +                 A    P   E    +  D    F  +   A      IAE +ALD+QP+S V+NVGF R++   +P+Y++PS+ YFS T IP M+E ++  +   +    S     T+  W   S +   L+LTAHWVT         +     A+L  S I+  +  D      L+ L +  I    + + +  +  + I K    ++  S+ CF HT+ L++N++I SQR V+++L+I+R    +   S  A++ L++LQ    +P+  L+QDV ++WN +  ML  L+EQK+ +   + E     L    QW ++  +   L PF+ A++E+S    ++S  +P  H ++           GI TM + +  ++  R + T  + + + AT+LDPR+K   + + E A   KQ L  E  IL+S      ++   +K    +++          +W L +++    AL+             + ++  YL    L    +P  +WN  K  +P LA L+ R+L  P S +PSE+LF+ A +  +  +  L     E L+ LK NLP   F
Sbjct:  539 TSKLWNHFSICSADSTKVICMHCGRTISRGKKPT-NLGTSCLLRHLQRFHSNVLQN--------NSVSETLRPADSQTPVNTELAASSFEDTTDKFSDSHPVAKKITSLIAEMIALDLQPYSFVNNVGFNRLLEYLQPQYSLPSASYFSRTAIPDMYENVKQIIVSHLKEAESGVIHFTAGIWMS-SQTREYLTLTAHWVTFESSFRPHCENHHCSALLHVSQIDCDY-NDVSVQKHLEYLWESWIASCGLQIGITVTDNHSIAKTLNESEHSSVQCFGHTVDLIVNEAIKSQRMVQNLLSIARKICERVHRSTKAKEKLAELQKEYDLPQHHLIQDVPSKWNTSFHMLDRLIEQKRAIDEMSIECSFRELISCDQWEVMQSVCHALKPFEAASREMSMHMATLSQVIPMIHILNRKIEMLFEETMGIDTMLKSLKEAMVCRLSSTLHDPRYIFATLLDPRYKASLFSEEE-AEEYKQGLIRELEILSSTSDDALILNGCNKSSSPKSN------GEENIWSLMANIKRSKALK---------EKLPEDIVFAYLEEEVLEHNCDPLTYWNLKKSAWPVLAKLAVRFLGCPPSIIPSERLFNTANENCNFNQNRLMMEHFEQLIFLKVNLPLIYF 1146          
BLAST of zinc finger BED domain-containing protein 4-like vs. Ensembl Xenopus
Match: far1 (fatty acyl-CoA reductase 1 [Source:Xenbase;Acc:XB-GENE-973776])

HSP 1 Score: 187.963 bits (476), Expect = 1.523e-48
Identity = 143/530 (26.98%), Postives = 250/530 (47.17%), Query Frame = 1
Query:  853 LDRRQPFEFNDKRALDWNKTIAEFMALDVQPFSVVDNVGFRRIIAKAEPRYTIPSSRYFSSTLIPAMHEKIQNKV-REMVSSQPS-TSLTSDAWSDPSISVALLSLTAHWVT------EDFQRKQAILAASPIEESHTGDYLGGMLLKILGDYTIEKSAVHVLLRDSGA-NMIKASRVADIDSISCFAHTLQLVINDSIMSQRSVKDILAISRSNVGKFRHSVLAQQHLSDLQGSLGVPKKKLVQDVQTRWNATLAMLRSLVEQKQVLGAYATEHKLTN----LDAHQWTLISHIIDTLSPFKDATKEVSDSQTSISVFLPK-------------HTMSEG---------IMTMRQDILTSLNKRFAHTKENRKMVLATILDPRFKNFAYDDRELASTAKQW----LKNECLILASAERSEEVVEPPSKRPRVETDQAHPGSSTSRLWDLFSDVVSEPALQTNSSIIGNVNDAVDAMIALYLS-SAALPRTENPYVWWNSNKLLFPYLATLSRRYLSAPASSVPSEQLFS 2322
            L+ +  +  N  +A  WN+ IAE +     P+S + +  F++ +A+A+P+Y +PS  +FS+  +P ++E +  KV  E+  S+ +   LT+  WS   +SV  L+LTAHW        +  QRK A+L      + +    +   L++ +  +    +        SG  N+I A + A+ +SI CF HTL L++ D + +   +  +L ++R     F HS  A++ LS+LQ    +PK+ L  +    W +T  ML+ L+EQ++ +  Y   HKL      L +  W+L++ ++D L PF+  T+EV+ S + +S  LP+             H  S+G           T++      +N+ F    +  + V++T+LDPRFK          S    W    +K    I++S+ R    ++  S  P              RL  L +   +  +L T S        +   M+  YL  +  +   E+P V+W   K L+P L  L+  YL+ P SS+ ++++FS
Sbjct:  453 LNIKGKYAPNHPKAQSWNRNIAELVCGMALPYSFITSKAFKKFMARADPKYCVPSKSFFSAKAVPQLYEAVCEKVMSELKRSECAHVHLTTHVWSG-GLSVDYLALTAHWSVLNPEDLQSIQRKNAVLCTKGFPKDYIDGSIQQELIRQMNLWLSPNALSPGFFISSGNFNLIHAIKSANFNSIPCFTHTLNLLVMDFLQNNHYISSMLEVARKVCSHFIHSARARRILSELQFQNHLPKQPLKSETLPHWTSTFYMLQRLLEQQRAIEEYLGSHKLETAELRLTSSNWSLMACLVDLLQPFEMVTREVNASGSCLSQVLPEVRYLHIFLKQIRGHFESKGDVNGVVLTDSFTLKFSSDFGINEMF----QREEYVVSTLLDPRFKGRIEAILPPGSDIDHWKQILVKKVKEIMSSSSRPVSHLKDSSSEP-------------DRLASLLASKSTGASLSTES-------HSACVMVEKYLQDNQTIGAKEDPLVYWEKRKCLWPALTKLAFMYLTCPPSSIFAQRVFS 957          
BLAST of zinc finger BED domain-containing protein 4-like vs. Ensembl Xenopus
Match: ENSXETT00000038245.1 (zinc finger BED domain-containing protein 1-like [Source:NCBI gene;Acc:100486384])

HSP 1 Score: 145.591 bits (366), Expect = 2.318e-35
Identity = 143/610 (23.44%), Postives = 270/610 (44.26%), Query Frame = 1
Query:  643 SKAICNLCNVSLSRGGNESKSFTTSNLVQHLRSKHVVAFADFXXXXXXXXXXXXXXXTASIPRPATIEALLDRRQPFEFNDKRAL-----DWNKTIAEFMALDVQPFSVVDNVGFRRIIAKAEPRYTIPSSRYFSSTLIPAMHEKIQNKVREMVSSQPSTSLTSDAWSDPSISVALLSLTAHWVTEDFQRKQAILAASPIEESHTGDYLGGMLLKILGDYTIEKSAVHVLLRDSGANMIKASRVADIDSISCFAHTLQLVINDSIMSQRSVKDILAISRSNVGKFRHSVLAQQHLSDLQGSLGVPKKKLVQDVQTRWNATLAMLRSLVEQKQVLGAYATEHKLTNLDAHQ--WTLISHIIDTLSPFKDATKEVSDSQTS--------ISVFLPKHTM-----SEGIMTMRQDILTSLNKRFAHTKENRKMVLATILDPRFKNFAYDDRELASTAKQWLKNECLILASAERSEEVV---EPPSKRPRVETDQAHPGSSTSRLWDLFSDVVSEPALQTNSSIIGNVNDAVDAMIALYLSSAALPRTENPYVWWNSNKLLFPYLATLSRRYLSAPASSVPSEQLFSGAWQIFSDRRGSLTAGKGEMLLLLKYN 2403
            +K IC LC V LS  GN      T+NL QHL  KH   + D                 A +    +IE++     P E   +  +        + +A+F+  D+ P  +++  GF +++A  +P Y +P+  + + T++  M+ +++ KV E+V +    S++ D W   S +++ L+LT H+V E F+ +  +L++  + E  +   L  +LL    ++ I  +  + +  +S +  +  S V     + C    L+  I ++++   +++  L   R        S    + +S     L V  K  ++D  T+W +   +L+S+V+            + +++   Q  W+++  ++D L P   AT   +  Q +        I+  L KH       S+   T+++ I   L+ ++A    N+ + LA  LDPRF+   +  +         LK E   LA  +  E      EP + +P ++  +   G        L  D+ S       +S +  VN   +  I+ + +S A    ++P  WW  +   +P LA  +R+ L+ PA+SVP+  LF+ A      +R +LTA   ++L+ L  N
Sbjct:  170 TKIICKLCGVRLSYSGN------TTNLRQHLIYKHRRQYNDLVGTQG-----------AVVDPHKSIESV----SPCELASRAIVAPTVGRTTRAVADFIVRDLMPLEIIEGEGFIQMLAILDPNYKLPAISFLAHTILQEMYIQVKVKVVELVKNLQECSISLDFWKH-SGALSYLTLTIHYVDEGFESRNIMLSSRAVAEDLSEGNLTSVLLDAAEEWGIRDNTFYAVGLNSSSVKVATSNVG-WRPLPCVGQVLRGCI-ETVLQHHTIQSTLDRFRKLTAFVCSSPTQIEEMSTHGPVLKVHLKMFLRD-GTKWYSIYTLLQSIVDHSNYFKNLTETIRESDIVLQQDDWSVLQDVVDILKPLAIATSTFTKDQFAGLSLVKPVITSLLYKHLAPNEWDSDFCKTIKKAIHEDLSFKYADHDVNQVLNLACALDPRFRGLDFLSQPDRVETLHLLKLEASNLAKLQTPEHTCVTPEPLNAKPPIKKVKQDSGIEF-----LLGDLCS-----VRNSSVSTVNQQAEQEISSFQTSEASSLCQDPLQWWKMHHTQYPLLARAARKLLAIPATSVPTNWLFTDAGLAVYRKRSALTAENVDLLVFLNGN 744          
BLAST of zinc finger BED domain-containing protein 4-like vs. Ensembl Xenopus
Match: ENSXETT00000026109.1 (zinc finger BED domain-containing protein 1-like [Source:NCBI gene;Acc:100486384])

HSP 1 Score: 145.976 bits (367), Expect = 2.976e-35
Identity = 143/610 (23.44%), Postives = 270/610 (44.26%), Query Frame = 1
Query:  643 SKAICNLCNVSLSRGGNESKSFTTSNLVQHLRSKHVVAFADFXXXXXXXXXXXXXXXTASIPRPATIEALLDRRQPFEFNDKRAL-----DWNKTIAEFMALDVQPFSVVDNVGFRRIIAKAEPRYTIPSSRYFSSTLIPAMHEKIQNKVREMVSSQPSTSLTSDAWSDPSISVALLSLTAHWVTEDFQRKQAILAASPIEESHTGDYLGGMLLKILGDYTIEKSAVHVLLRDSGANMIKASRVADIDSISCFAHTLQLVINDSIMSQRSVKDILAISRSNVGKFRHSVLAQQHLSDLQGSLGVPKKKLVQDVQTRWNATLAMLRSLVEQKQVLGAYATEHKLTNLDAHQ--WTLISHIIDTLSPFKDATKEVSDSQTS--------ISVFLPKHTM-----SEGIMTMRQDILTSLNKRFAHTKENRKMVLATILDPRFKNFAYDDRELASTAKQWLKNECLILASAERSEEVV---EPPSKRPRVETDQAHPGSSTSRLWDLFSDVVSEPALQTNSSIIGNVNDAVDAMIALYLSSAALPRTENPYVWWNSNKLLFPYLATLSRRYLSAPASSVPSEQLFSGAWQIFSDRRGSLTAGKGEMLLLLKYN 2403
            +K IC LC V LS  GN      T+NL QHL  KH   + D                 A +    +IE++     P E   +  +        + +A+F+  D+ P  +++  GF +++A  +P Y +P+  + + T++  M+ +++ KV E+V +    S++ D W   S +++ L+LT H+V E F+ +  +L++  + E  +   L  +LL    ++ I  +  + +  +S +  +  S V     + C    L+  I ++++   +++  L   R        S    + +S     L V  K  ++D  T+W +   +L+S+V+            + +++   Q  W+++  ++D L P   AT   +  Q +        I+  L KH       S+   T+++ I   L+ ++A    N+ + LA  LDPRF+   +  +         LK E   LA  +  E      EP + +P ++  +   G        L  D+ S       +S +  VN   +  I+ + +S A    ++P  WW  +   +P LA  +R+ L+ PA+SVP+  LF+ A      +R +LTA   ++L+ L  N
Sbjct:  284 TKIICKLCGVRLSYSGN------TTNLRQHLIYKHRRQYNDLVGTQG-----------AVVDPHKSIESV----SPCELASRAIVAPTVGRTTRAVADFIVRDLMPLEIIEGEGFIQMLAILDPNYKLPAISFLAHTILQEMYIQVKVKVVELVKNLQECSISLDFWKH-SGALSYLTLTIHYVDEGFESRNIMLSSRAVAEDLSEGNLTSVLLDAAEEWGIRDNTFYAVGLNSSSVKVATSNVG-WRPLPCVGQVLRGCI-ETVLQHHTIQSTLDRFRKLTAFVCSSPTQIEEMSTHGPVLKVHLKMFLRD-GTKWYSIYTLLQSIVDHSNYFKNLTETIRESDIVLQQDDWSVLQDVVDILKPLAIATSTFTKDQFAGLSLVKPVITSLLYKHLAPNEWDSDFCKTIKKAIHEDLSFKYADHDVNQVLNLACALDPRFRGLDFLSQPDRVETLHLLKLEASNLAKLQTPEHTCVTPEPLNAKPPIKKVKQDSGIEF-----LLGDLCS-----VRNSSVSTVNQQAEQEISSFQTSEASSLCQDPLQWWKMHHTQYPLLARAARKLLAIPATSVPTNWLFTDAGLAVYRKRSALTAENVDLLVFLNGN 858          
BLAST of zinc finger BED domain-containing protein 4-like vs. Ensembl Xenopus
Match: ZBED1 (zinc finger BED domain-containing protein 1-like [Source:NCBI gene;Acc:105945140])

HSP 1 Score: 136.346 bits (342), Expect = 1.996e-32
Identity = 150/661 (22.69%), Postives = 283/661 (42.81%), Query Frame = 1
Query:  601 SSIWNYFTVSP------LINSKAICNLCNVSLSRGGNESKSFTTSNLVQHLRSKHVVAFADFXXXXXXXXXXXXXXXTASIPRPAT----IEALLDRRQPFEFNDKRALDWNKTIAEFMALDVQPFSVVDNVGFRRIIAKAEPRYTIPSSRYFSSTLIPAMHEKIQNKVREMVSSQPS----TSLTSDAWSDPSISVALLSLTAHWVTED----FQRKQAILAASPIEESHTGDYLGGMLLKILGDYTIEKSAVHVLLRDSGANMIKASRVADID-SISCFAHTLQLVINDSIMSQRSVKDILAISRSNVGKFRHSVLAQQHLSDLQGSLGVPKKKLVQDVQTRWNATLAMLRSLVEQKQVLGAYATE----HKLTNLDAHQWTLISHIIDTLSPFKDATKEVSDSQ-TSISVFLP------------KHTMSEGIMTMRQDILTSLNKRFAHTKE-NRKMVLATILDPRFKNFAYDDRELASTAKQWLKN------ECLILASAE--RSEEVV-----EPPSKRPRVETDQAHPGSS-TSRLWDLFSDV-VSEPALQTNSSIIGNVNDAVDAMIALYLSSAALPRTENPYVWWNSNKLLFPYLATLSRRYLSAPASSVPSEQLFSGAWQIFSDRRGSLTAGKGEMLLLLKYNLPQFSFNC 2427
            S +W YF          L   K  C +C   ++  GN      TSNL  HL   H   F +F K + E+       + + + +P +    ++  L  +    F +K+ L+   ++   +   + P S++D   F+ ++  AEPRY +P  +Y  S ++P  +    N +REMV    +      +++D W   + + + ++L+ ++++             L    + E +  + +  +L +   ++ I  + V     D   +++KA  + DI   + C   T  + I  +    + +  +L+  R  V  F+ S +A   L + Q    +    L+ D  + W +TL ML+ L EQ+  +     E    H L  L+A +W  I  ++D L PFK   + +S S+  +IS+  P            K T  + I   ++ I   L+  +  T E +  + +AT LDPR+K   +    L++  +  ++N      +C I    E  ++EE V     EPP K+  + +    P SS  S L ++F     SE   + ++ ++  +++        + S   L   E+P  WW+    LFP L  + ++Y     + V  E+LF+ +  + + +R  L     +  + L  N    + NC
Sbjct:   23 SKVWKYFGFDTNAEGCILQWKKIYCRICMAQIAYSGN------TSNLSYHLEKNHPDEFCEFVKSNTEQMREAFATAFSKL-KPESSQQVVQETLIMKNTHSFENKKHLELTSSVISLICEGMYPASILDEPTFKNLLKTAEPRYEVPMRKYICSRVLPEKY----NAIREMVLKDLNDILWCGISTDMWKSVTQNRSYVTLSVYFMSTGPSNCLSVNSRCLKTFEVPEENKAETITRVLYETFIEWGI-SAKVFGATTDFSKDIVKACSLLDIPVDMPCLGQTFDMGIQQAFQLPK-LSSLLSRCRKLVEYFQQSSIAMYMLCEKQKQQNLFPCMLISDRVSWWGSTLVMLQRLKEQQFTIAGVLVEDSNNHHLM-LEASEWNTIEGLVDLLQPFKQVAEMLSVSKYPTISMVKPLLHMLLNTSLNIKETDPKEISMAKEVIAKVLSSTYQQTPEIDMFLNVATFLDPRYKKLPF----LSAFERAQVENRVIEEAKCFIDKGKENIKNEEKVFTISEEPPMKK--MASSTPPPTSSINSMLAEIFCQSGSSEDQEEWHAQVVEELSN--------FKSQKVLGLNEDPLKWWSDRLTLFPLLPKVLQKYWCIRPTRVFPERLFNSSANVVNSKRNRLAPAHVDEQIFLYEN----THNC 651          
BLAST of zinc finger BED domain-containing protein 4-like vs. Ensembl Mouse
Match: Zbed4 (zinc finger, BED type containing 4 [Source:MGI Symbol;Acc:MGI:2682302])

HSP 1 Score: 237.654 bits (605), Expect = 8.888e-65
Identity = 188/652 (28.83%), Postives = 314/652 (48.16%), Query Frame = 1
Query:  571 LFEEMSKQLTSSIWNYFTVSPLINSKAICNLCNVSLSRGGNESKSFTTSNLVQHLRSKHVVAFADFXXXXXXXXXXXXXXXTASIPRPATIE-----ALLDRRQPFEFNDKRALDWNKTIAEFMALDVQPFSVVDNVGFRRIIAKAEPRYTIPSSRYFSSTLIPAMHEKIQNKVREMVSSQPS--TSLTSDAWSDPSISVALLSLTAHWVT---------EDFQRKQAILAASPIEESHTGDYLGGMLLKILGDY-----TIEKSAVHVLLRDSGANMIKASRVADIDSISCFAHTLQLVINDSIMSQRSVKDILAISRSNVGKFRHSVLAQQHLSDLQGSLGVPKKKLVQDVQTRWNATLAMLRSLVEQKQVLGAYATEHKLTNL-DAHQWTLISHIIDTLSPFKDATKEVSDSQTSISVFLPK-HTMSE----------GIMTMRQDILTSLNKRFAHTKENRKMVLATILDPRFKNFAYDDRELASTAKQWLKNECLILASAERSEEVVEPPSKRPRVETDQAHPGSSTSRLWDLFSDVVSEPALQTNSSIIGNVNDAV-DAMIALYLSSAALPRTENPYVWWNSNKLLFPYLATLSRRYLSAPASSVPSEQLFSGAWQIFSDRRGSLTAGKGEMLLLLKYNLPQFSFN 2424
            +F   SK+ TS +WN+F++    ++K +C  C  ++SRG  +  +  TS L++HL+  H     +                +  I RP  IE     +  D  + F  +   A      IAE +ALD+QP+S+VDNVGF R++   +P+Y++PS  YFS T IP M++ ++  +   +    S     TS  W   S +   L+LTAHWVT         ED     A+L  S I+     DY G  + K L  +     T     + + + D+  ++ K     +  S+ CF+HT+ L+++++I SQR V+++L+I+R    +   S  A++ L++LQ    +P+ +L+QDV ++W+ +  ML  L+EQK+ +   + E     L    QW ++  +   L PF  A++E+S   +++S  +P  H +S           GI TM + +  ++  R + T  + + + AT+LDPR+K   + + E A   +Q L  E  IL S   SE+             D   P            D  +E +L + + I  +  + + + M+  YL    L  + +P  +WN  +  +P L+TL+ R+L  P S+VPSE+LFS      S  +  L     E L+ LK NLP   F 
Sbjct:  551 VFPTNSKK-TSKLWNHFSICSADSTKVVCLHCGRTISRG-KKPTNLGTSCLLRHLQRFHGHVLKN-------DVSEATLSRSPGIRRPLGIELSGPSSFRDSTEKFYDSHPVAKKITSLIAEMIALDLQPYSLVDNVGFNRLLEYLKPQYSLPSPSYFSRTAIPGMYDNVKQIIMSHLKEAESGVVHFTSGIWMS-SQTREYLTLTAHWVTFASAVRPHCED-HHCSALLDVSQID----CDYSGNSIQKQLECWWEAWVTSIGLQIGITVTDN-PSIGKMLSEGEHSSVQCFSHTVNLIVSEAIKSQRMVQNLLSIARKLCERVHRSPRAREKLAELQKEYELPQHQLIQDVPSKWSTSFHMLERLIEQKRAVNEVSIECNFRELISCDQWEVMQSVCHVLRPFDAASREMSAHMSTLSQVIPMIHILSRKVEMLFGETMGIDTMLKSLKEAMASRLSATLHDPRYIFATLLDPRYKASLFTEEE-AEQYRQDLIRELEILNST--SEDTATSNG------CDSGSP----------LKDTGTEESLWSLAPIKRDQREKLPEDMVLAYLEEEVLEHSCDPLTYWNLKRSSWPGLSTLAVRFLGCPPSTVPSEKLFSTPMDAGSFGQPRLMMEHFEKLIFLKVNLPLICFQ 1167          
BLAST of zinc finger BED domain-containing protein 4-like vs. Ensembl Mouse
Match: Gm38394 (predicted gene, 38394 [Source:MGI Symbol;Acc:MGI:5614057])

HSP 1 Score: 160.229 bits (404), Expect = 7.873e-40
Identity = 148/561 (26.38%), Postives = 250/561 (44.56%), Query Frame = 1
Query:  904 NKTIAEFMALDVQPFSVVDNVGFRRIIAKAEPRYTIPSSRYFSSTLIPAMHEKIQNKV---REMVSSQPSTSLTSDAWS-DPSISVALLSLTAHWV------------TEDFQRKQAILAASPIEESHTGDYLGGMLLKILGD-----YTIEKSAVHVLLRDSGANMIKASRVADIDSISCFAHTLQLVINDSIMSQRSVKDILAISRSNVGKFRHSVLAQQHLSDLQGSLGVPKKKLVQDVQTRWNATLAMLRSLVEQKQVLGAYATEHKLTN-----LDAHQWTLISHIIDTLSPFKDATKEVSDSQTSISVFLPK-HTMSEGIMTMRQD-----ILTSLN------------KRFAHTKENRKMVLATILDPRFKNFAYD------DRELASTAKQWLKNE-CLILASAERSEEVVEPPSKRP--RVETDQ-AHPGSSTSRLWDLFSDVVSEPALQTNSSIIGNVNDAVDAMIALYLSSAALPRTENPYVWWNSNKLLFPYLATLSRRYLSAPASSVPSEQLFSGAWQIFSDRRGSLTAGKGEMLLLLKYNLPQFSFN 2424
            ++ + + +  D+ P++      F+R +    P Y +PS  YF +  +P +++ ++ K+    E V SQ    LT+D W+ DPS    ++  T HWV            T +F RK A+L  + + +    D L   +L+ L D      +        ++ D+ +N++ A +      + CF H L +VI D     +S++++L  +R     F HSV A+Q L + Q    +P K L QD    W +T  ML+ L+E       Y+  H L       L + QWTL++++ D L PF++AT+ VS   T ++  LP  H +   +  +R+D     I  +LN               +   +++  +LAT+LDP FKN   D      D E   T KQ L  E C  + S+  + ++    +  P  R+ TD        TS    L S      A+ + SS++      VD       S   L   ++P V+W     ++P L  ++ +YLS P  S  SE +F+        +  ++     E L+ LK NL   +++
Sbjct:  414 SQAVIQMIVEDLHPYNYFSTPAFQRFLQIVAPDYRLPSETYFFTKAVPQLYDSVREKIFLTLENVQSQ-KIHLTADIWTHDPSTDYFIV--TVHWVSLETASSPSNGGTPNF-RKWAVLCVTGLAK----DCLITNILQELNDQIGLWLSPNFLTPSFIVSDNSSNVVHAIKGGGFTHVPCFLHCLNIVIQDFFCEHKSIENMLVAARKTCHHFSHSVKARQILQEFQNDHQLPWKNLKQDETGHWISTFYMLKWLLEH-----CYSVHHSLGRASGVVLTSLQWTLMTYVCDILKPFEEATQRVSVKTTGLNQVLPLIHHLLFSLQRLREDFQVRGITQALNLVDSLSLKLESDALLSAMLKSKHCILATLLDPCFKNSLEDFFPQGADLE---TYKQILAEEVCNYMESSPGACQISSSETSGPLVRLGTDSFTSIKEGTSSAGSLDSSAAGSVAVGSKSSLLPAAVAVVDEYFKEKYSE--LSGGDDPLVYWQRKVSIWPALTQVAIQYLSCPMCSWQSECMFTTNSHFHPKQIMNMDFDNIEQLIFLKMNLENVNYD 956          
BLAST of zinc finger BED domain-containing protein 4-like vs. Ensembl Mouse
Match: Mbnl1 (muscleblind like splicing factor 1 [Source:MGI Symbol;Acc:MGI:1928482])

HSP 1 Score: 67.3958 bits (163), Expect = 2.242e-12
Identity = 25/47 (53.19%), Postives = 37/47 (78.72%), Query Frame = 2
Query:  440 EWLTLEICREYMRGECLRDEFSCRYAHPAKNLETQSGRVICCYDYLK 580
            +WLTLE+CRE+ RG C R +  C++AHP+K+ + ++GRVI C+D LK
Sbjct:   12 KWLTLEVCREFQRGTCSRPDTECKFAHPSKSCQVENGRVIACFDSLK 58          
BLAST of zinc finger BED domain-containing protein 4-like vs. Ensembl Mouse
Match: Mbnl1 (muscleblind like splicing factor 1 [Source:MGI Symbol;Acc:MGI:1928482])

HSP 1 Score: 67.0106 bits (162), Expect = 1.936e-11
Identity = 25/47 (53.19%), Postives = 37/47 (78.72%), Query Frame = 2
Query:  440 EWLTLEICREYMRGECLRDEFSCRYAHPAKNLETQSGRVICCYDYLK 580
            +WLTLE+CRE+ RG C R +  C++AHP+K+ + ++GRVI C+D LK
Sbjct:   12 KWLTLEVCREFQRGTCSRPDTECKFAHPSKSCQVENGRVIACFDSLK 58          
BLAST of zinc finger BED domain-containing protein 4-like vs. Ensembl Mouse
Match: Mbnl1 (muscleblind like splicing factor 1 [Source:MGI Symbol;Acc:MGI:1928482])

HSP 1 Score: 67.781 bits (164), Expect = 2.220e-11
Identity = 25/47 (53.19%), Postives = 37/47 (78.72%), Query Frame = 2
Query:  440 EWLTLEICREYMRGECLRDEFSCRYAHPAKNLETQSGRVICCYDYLK 580
            +WLTLE+CRE+ RG C R +  C++AHP+K+ + ++GRVI C+D LK
Sbjct:   12 KWLTLEVCREFQRGTCSRPDTECKFAHPSKSCQVENGRVIACFDSLK 58          

HSP 2 Score: 52.373 bits (124), Expect = 1.826e-6
Identity = 23/45 (51.11%), Postives = 29/45 (64.44%), Query Frame = 2
Query:  452 LEICREYMRGECLRDEFSCRYAHPAKN--LETQSGRVICCYDYLK 580
            LE+CREY RG C R E  CR+AHPA +  ++T    V  C DY+K
Sbjct:  181 LEVCREYQRGNCNRGENDCRFAHPADSTMIDTNDNTVTVCMDYIK 225          
BLAST of zinc finger BED domain-containing protein 4-like vs. UniProt/SwissProt
Match: sp|Q80WQ9|ZBED4_MOUSE (Zinc finger BED domain-containing protein 4 OS=Mus musculus OX=10090 GN=Zbed4 PE=2 SV=1)

HSP 1 Score: 237.654 bits (605), Expect = 6.217e-64
Identity = 188/652 (28.83%), Postives = 314/652 (48.16%), Query Frame = 1
Query:  571 LFEEMSKQLTSSIWNYFTVSPLINSKAICNLCNVSLSRGGNESKSFTTSNLVQHLRSKHVVAFADFXXXXXXXXXXXXXXXTASIPRPATIE-----ALLDRRQPFEFNDKRALDWNKTIAEFMALDVQPFSVVDNVGFRRIIAKAEPRYTIPSSRYFSSTLIPAMHEKIQNKVREMVSSQPS--TSLTSDAWSDPSISVALLSLTAHWVT---------EDFQRKQAILAASPIEESHTGDYLGGMLLKILGDY-----TIEKSAVHVLLRDSGANMIKASRVADIDSISCFAHTLQLVINDSIMSQRSVKDILAISRSNVGKFRHSVLAQQHLSDLQGSLGVPKKKLVQDVQTRWNATLAMLRSLVEQKQVLGAYATEHKLTNL-DAHQWTLISHIIDTLSPFKDATKEVSDSQTSISVFLPK-HTMSE----------GIMTMRQDILTSLNKRFAHTKENRKMVLATILDPRFKNFAYDDRELASTAKQWLKNECLILASAERSEEVVEPPSKRPRVETDQAHPGSSTSRLWDLFSDVVSEPALQTNSSIIGNVNDAV-DAMIALYLSSAALPRTENPYVWWNSNKLLFPYLATLSRRYLSAPASSVPSEQLFSGAWQIFSDRRGSLTAGKGEMLLLLKYNLPQFSFN 2424
            +F   SK+ TS +WN+F++    ++K +C  C  ++SRG  +  +  TS L++HL+  H     +                +  I RP  IE     +  D  + F  +   A      IAE +ALD+QP+S+VDNVGF R++   +P+Y++PS  YFS T IP M++ ++  +   +    S     TS  W   S +   L+LTAHWVT         ED     A+L  S I+     DY G  + K L  +     T     + + + D+  ++ K     +  S+ CF+HT+ L+++++I SQR V+++L+I+R    +   S  A++ L++LQ    +P+ +L+QDV ++W+ +  ML  L+EQK+ +   + E     L    QW ++  +   L PF  A++E+S   +++S  +P  H +S           GI TM + +  ++  R + T  + + + AT+LDPR+K   + + E A   +Q L  E  IL S   SE+             D   P            D  +E +L + + I  +  + + + M+  YL    L  + +P  +WN  +  +P L+TL+ R+L  P S+VPSE+LFS      S  +  L     E L+ LK NLP   F 
Sbjct:  551 VFPTNSKK-TSKLWNHFSICSADSTKVVCLHCGRTISRG-KKPTNLGTSCLLRHLQRFHGHVLKN-------DVSEATLSRSPGIRRPLGIELSGPSSFRDSTEKFYDSHPVAKKITSLIAEMIALDLQPYSLVDNVGFNRLLEYLKPQYSLPSPSYFSRTAIPGMYDNVKQIIMSHLKEAESGVVHFTSGIWMS-SQTREYLTLTAHWVTFASAVRPHCED-HHCSALLDVSQID----CDYSGNSIQKQLECWWEAWVTSIGLQIGITVTDN-PSIGKMLSEGEHSSVQCFSHTVNLIVSEAIKSQRMVQNLLSIARKLCERVHRSPRAREKLAELQKEYELPQHQLIQDVPSKWSTSFHMLERLIEQKRAVNEVSIECNFRELISCDQWEVMQSVCHVLRPFDAASREMSAHMSTLSQVIPMIHILSRKVEMLFGETMGIDTMLKSLKEAMASRLSATLHDPRYIFATLLDPRYKASLFTEEE-AEQYRQDLIRELEILNST--SEDTATSNG------CDSGSP----------LKDTGTEESLWSLAPIKRDQREKLPEDMVLAYLEEEVLEHSCDPLTYWNLKRSSWPGLSTLAVRFLGCPPSTVPSEKLFSTPMDAGSFGQPRLMMEHFEKLIFLKVNLPLICFQ 1167          
BLAST of zinc finger BED domain-containing protein 4-like vs. UniProt/SwissProt
Match: sp|O75132|ZBED4_HUMAN (Zinc finger BED domain-containing protein 4 OS=Homo sapiens OX=9606 GN=ZBED4 PE=1 SV=2)

HSP 1 Score: 233.032 bits (593), Expect = 1.995e-62
Identity = 182/643 (28.30%), Postives = 311/643 (48.37%), Query Frame = 1
Query:  598 TSSIWNYFTVSPLINSKAICNLCNVSLSRGGNESKSFTTSNLVQHLRSKHVVAFADFXXXXXXXXXXXXXXXTASIPRPATIEA---LLDRRQPFEFNDKRALDWNKTIAEFMALDVQPFSVVDNVGFRRIIAKAEPRYTIPSSRYFSSTLIPAMHEKIQNKVREMVSSQPSTSL--TSDAWSDPSISVALLSLTAHWVT--------EDFQRKQAILAASPIEESHTGDYLGGMLLKILGDY-----TIEKSAVHVLLRDSGANMIKASRVADIDSISCFAHTLQLVINDSIMSQRSVKDILAISRSNVGKFRHSVLAQQHLSDLQGSLGVPKKKLVQDVQTRWNATLAMLRSLVEQKQVLGAYATEHKLTNL-DAHQWTLISHIIDTLSPFKDATKEVSDSQTSISVFLP-------------KHTMSEGIMTMRQDILTSLNKRFAHTKENRKMVLATILDPRFKNFAYDDRELASTAKQWLKNECLILASAERSEEVVEPPSKRPRVETDQAHPGSSTS---RLWDLFSDVVSEPALQTNSSIIGNVNDAVDAMIALYLSSAALPRTENPYVWWNSNKLLFPYLATLSRRYLSAPASSVPSEQLFSGAWQIFSDRRGSLTAGKGEMLLLLKYNLPQFSF 2421
            TS +WN+F++    ++K +C  C  ++SRG  +  +  TS L++HL+  H         +++  + A        +PR   +       D  + F  +   A      IAE +ALD+QP+S VDNVGF R++   +P+Y++P+  YFS T IP M++ ++  +   +    S  +  TS  W   + +   L+LTAHWV+         D     A+L  S ++     DY G  + K L  +     T     V + + D+ A++ K     +  S+ CF+HT+ L+++++I SQR V+++L+++R    +   S  A++ L++LQ    +P+  L+QDV ++W+ +  ML  L+EQK+ +   + E     L    QW ++  +   L PF+ A++E+S   +++S  +P             + TM  GI TM + +  ++  R + T  + + V AT+LDPR+K   + + E A   KQ L  E  ++ S   SE+V    S R     D   P   ++    LW L + V  +   +             +AM+  YL    L  + +P  +WN  K  +P L+ L+ R+L  P S VPSE+LF+   +  S  +  L     E L+ LK NLP   F
Sbjct:  560 TSKLWNHFSICSADSTKVVCLHCGRTISRG-KKPTNLGTSCLLRHLQRFHSNVL-----KTEVSETARPSSPDTRVPRGTELSGASSFDDTNEKFYDSHPVAKKITSLIAEMIALDLQPYSFVDNVGFNRLLEYLKPQYSLPAPSYFSRTAIPGMYDNVKQIIMSHLKEAESGVIHFTSGIWMS-NQTREYLTLTAHWVSFESPARPRCDDHHCSALLDVSQVD----CDYSGNSIQKQLECWWEAWVTSTGLQVGITVTDN-ASIGKTLNEGEHSSVQCFSHTVNLIVSEAIKSQRMVQNLLSLARKICERVHRSPKAKEKLAELQREYALPQHHLIQDVPSKWSTSFHMLERLIEQKRAINEMSVECNFRELISCDQWEVMQSVCRALKPFEAASREMSTQMSTLSQVIPMVHILNRKVEMLFEETM--GIDTMLRSLKEAMVSRLSATLHDPRYVFATLLDPRYKASLFTEEE-AEQYKQDLIRELELMNST--SEDVAA--SHR----CDAGSPSKDSAAEENLWSLVAKVKKKDPREK----------LPEAMVLAYLEEEVLEHSCDPLTYWNLKKASWPGLSALAVRFLGCPPSIVPSEKLFNTPTENGSLGQSRLMMEHFEKLIFLKVNLPLIYF 1169          
BLAST of zinc finger BED domain-containing protein 4-like vs. UniProt/SwissProt
Match: sp|D2EAC2|ZBED6_MOUSE (Zinc finger BED domain-containing protein 6 OS=Mus musculus OX=10090 GN=Zbed6 PE=1 SV=1)

HSP 1 Score: 160.229 bits (404), Expect = 5.507e-39
Identity = 148/561 (26.38%), Postives = 250/561 (44.56%), Query Frame = 1
Query:  904 NKTIAEFMALDVQPFSVVDNVGFRRIIAKAEPRYTIPSSRYFSSTLIPAMHEKIQNKV---REMVSSQPSTSLTSDAWS-DPSISVALLSLTAHWV------------TEDFQRKQAILAASPIEESHTGDYLGGMLLKILGD-----YTIEKSAVHVLLRDSGANMIKASRVADIDSISCFAHTLQLVINDSIMSQRSVKDILAISRSNVGKFRHSVLAQQHLSDLQGSLGVPKKKLVQDVQTRWNATLAMLRSLVEQKQVLGAYATEHKLTN-----LDAHQWTLISHIIDTLSPFKDATKEVSDSQTSISVFLPK-HTMSEGIMTMRQD-----ILTSLN------------KRFAHTKENRKMVLATILDPRFKNFAYD------DRELASTAKQWLKNE-CLILASAERSEEVVEPPSKRP--RVETDQ-AHPGSSTSRLWDLFSDVVSEPALQTNSSIIGNVNDAVDAMIALYLSSAALPRTENPYVWWNSNKLLFPYLATLSRRYLSAPASSVPSEQLFSGAWQIFSDRRGSLTAGKGEMLLLLKYNLPQFSFN 2424
            ++ + + +  D+ P++      F+R +    P Y +PS  YF +  +P +++ ++ K+    E V SQ    LT+D W+ DPS    ++  T HWV            T +F RK A+L  + + +    D L   +L+ L D      +        ++ D+ +N++ A +      + CF H L +VI D     +S++++L  +R     F HSV A+Q L + Q    +P K L QD    W +T  ML+ L+E       Y+  H L       L + QWTL++++ D L PF++AT+ VS   T ++  LP  H +   +  +R+D     I  +LN               +   +++  +LAT+LDP FKN   D      D E   T KQ L  E C  + S+  + ++    +  P  R+ TD        TS    L S      A+ + SS++      VD       S   L   ++P V+W     ++P L  ++ +YLS P  S  SE +F+        +  ++     E L+ LK NL   +++
Sbjct:  414 SQAVIQMIVEDLHPYNYFSTPAFQRFLQIVAPDYRLPSETYFFTKAVPQLYDSVREKIFLTLENVQSQ-KIHLTADIWTHDPSTDYFIV--TVHWVSLETASSPSNGGTPNF-RKWAVLCVTGLAK----DCLITNILQELNDQIGLWLSPNFLTPSFIVSDNSSNVVHAIKGGGFTHVPCFLHCLNIVIQDFFCEHKSIENMLVAARKTCHHFSHSVKARQILQEFQNDHQLPWKNLKQDETGHWISTFYMLKWLLEH-----CYSVHHSLGRASGVVLTSLQWTLMTYVCDILKPFEEATQRVSVKTTGLNQVLPLIHHLLFSLQRLREDFQVRGITQALNLVDSLSLKLESDALLSAMLKSKHCILATLLDPCFKNSLEDFFPQGADLE---TYKQILAEEVCNYMESSPGACQISSSETSGPLVRLGTDSFTSIKEGTSSAGSLDSSAAGSVAVGSKSSLLPAAVAVVDEYFKEKYSE--LSGGDDPLVYWQRKVSIWPALTQVAIQYLSCPMCSWQSECMFTTNSHFHPKQIMNMDFDNIEQLIFLKMNLENVNYD 956          
BLAST of zinc finger BED domain-containing protein 4-like vs. UniProt/SwissProt
Match: sp|P86452|ZBED6_HUMAN (Zinc finger BED domain-containing protein 6 OS=Homo sapiens OX=9606 GN=ZBED6 PE=3 SV=1)

HSP 1 Score: 159.458 bits (402), Expect = 1.017e-38
Identity = 149/564 (26.42%), Postives = 249/564 (44.15%), Query Frame = 1
Query:  904 NKTIAEFMALDVQPFSVVDNVGFRRIIAKAEPRYTIPSSRYFSSTLIPAMHEKIQNKV---REMVSSQPSTSLTSDAWS-DPSISVALLSLTAHWVT------------EDFQRKQAILAASPIEESHTGDYLGGMLLKILGDYTIEKSAVHVLL-----RDSGANMIKASRVADIDSISCFAHTLQLVINDSIMSQRSVKDILAISRSNVGKFRHSVLAQQHLSDLQGSLGVPKKKLVQDVQTRWNATLAMLRSLVEQKQVLGAYATEHKLTN-----LDAHQWTLISHIIDTLSPFKDATKEVSDSQTSISVFLPK-HTMSEGIMTMRQD-----ILTSLN------------KRFAHTKENRKMVLATILDPRFKNFAYD------DRELASTAKQWLKNECLILASAERSEEVVEPPSKRPRVETDQAHPGSSTSRLWD-------LFSDVVSEPALQTNSSIIGNVNDAVDAMIALYLSSAALPRTENPYVWWNSNKLLFPYLATLSRRYLSAPASSVPSEQLFSGAWQIFSDRRGSLTAGKGEMLLLLKYNLPQFSFN 2424
            ++ I + +  D+ P++      F+R +    P Y +PS  YF +  +P +++ ++ K+    E V SQ    LT D W+ DPS    ++  T HWV+             DF RK A+L  + + +    D L   +L+ L D      + + L+      D+ +N++ A +      + CF H L +VI D     +S++++L  +R     F HSV A+Q L + Q    +P K L QD    W +T  ML+ L+E       Y+  H L       L + QWTL++++ D L PF++AT++VS     ++  LP  H +   +  +R+D     I  +LN               +   +++  +LAT+LDP FKN   D      D E   T KQ+L  E  +    E S E+ + P+      +      S TS L +       + S  V   AL + S +  +    VD       S       ++P ++W     ++P L  ++ +YLS P  S  SE +F+        +  SL     E L+ LK NL   +++
Sbjct:  411 SQAIIQMIVEDMHPYNYFSTPAFQRFMQIVAPDYRLPSETYFFTKAVPQLYDCVREKIFLTLENVQSQ-KIHLTVDIWTHDPSTDYFIV--TVHWVSLETASFLNNGRIPDF-RKWAVLCVTGLAK----DCLITNILQELNDQIGLWLSPNFLIPSFIVSDNSSNVVHAIKDGGFTHVPCFLHCLNMVIQDFFCEHKSIENMLVAARKTCHHFSHSVKARQILQEFQNDHQLPWKNLKQDETGHWISTFYMLKWLLEH-----CYSVHHSLGRASGVVLTSLQWTLMTYVCDILKPFEEATQKVSVKTAGLNQVLPLIHHLLLSLQKLREDFQVRGITQALNLVDSLSLKLETDTLLSAMLKSKPCILATLLDPCFKNSLEDFFPQGADLE---TYKQFLAEE--VCNYMESSPEICQIPTSEASCPSVTVGADSFTSSLKEGTSSSGSVDSSAVDNVALGSKSFMFPSAVAVVDEYFKEKYSE--FSGGDDPLIYWQRKISIWPALTQVAIQYLSCPMCSWQSECIFTKNSHFHPKQIMSLDFDNIEQLMFLKMNLKNVNYD 954          
BLAST of zinc finger BED domain-containing protein 4-like vs. UniProt/SwissProt
Match: sp|O96006|ZBED1_HUMAN (Zinc finger BED domain-containing protein 1 OS=Homo sapiens OX=9606 GN=ZBED1 PE=1 SV=1)

HSP 1 Score: 148.288 bits (373), Expect = 1.433e-35
Identity = 147/631 (23.30%), Postives = 270/631 (42.79%), Query Frame = 1
Query:  601 SSIWNYFTVSP------LINSKAICNLCNVSLSRGGNESKSFTTSNLVQHLRSKHVVAFADFXXXXXXXXXXXXXXXTASIPRPATIEALLDR---RQPFEFNDKRALDWNKTIAEFMALDVQPFSVVDNVGFRRIIAKAEPRYTIPSSRYFSSTLIPAMHEKIQNKVREMVSSQPSTSLTSDAWSDPSISVALLSLTAHWVT----EDFQRKQAILAASPIEESHTGDYLGGMLLKILGDYTIEKSAVHVLLRDSGANMIKASRVADID-SISCFAHTLQLVINDSIMSQRSVKDILAISRSNVGKFRHSVLAQQHLSDLQGSLGVPKKKLVQDVQTRWNATLAMLRSLVEQKQVLGAYATE----HKLTNLDAHQWTLISHIIDTLSPFKDATKEVSDSQ-TSISVFLP------------KHTMSEGIMTMRQDILTSLNKRFAHTKE-NRKMVLATILDPRFKNFAYDDRELASTAKQWLKNECLILASAERSEEVVEPPSKRPRVETDQAHPGSSTSRLWDLFSDVVSEPALQTNSSI------IGNVND------AVDAMIALYLSSAALPRTENPYVWWNSNKLLFPYLATLSRRYLSAPASSVPSEQLFSGAWQIFSDRRGSL 2361
            S +W YF          L   K  C +C   ++  GN      TSNL  HL   H   F +F K + E+       + + +   ++ +   D    +    ++ K+  +    +   +   + P S+VD   F+ ++  A+PRY +PS +Y S+  IP  +  ++  + + ++      +++D W   + + A ++L AH++              L    + E +T + +  +L ++  ++ I  + V     + G +++KA  + D+   + C  HT    I  +    + +  +L+  R  V  F+ S +A   L + Q    V    LV +  + W +TLAML+ L EQ+ V+     E    H L  L+A +W  I  +++ L PFK   + +S S+  +IS+  P            K T S+ +   ++ I   L+K +  T E +  + +AT LDPR+K   +    L++  +Q ++N   ++  A+   + V+    RP    D+  P      +  L       PA   N+ +       G V D       V   ++ + S   L   E+P  WW+    LFP L  + ++Y    A+ V  E+LF  A  + S +R  L
Sbjct:   23 SKVWKYFGFDTNAEGCILQWKKIYCRICMAQIAYSGN------TSNLSYHLEKNHPEEFCEFVKSNTEQMREAFATAFSKLKPESSQQPGQDALAVKAGHGYDSKKQQELTAAVLGLICEGLYPASIVDEPTFKVLLKTADPRYELPSRKYISTKAIPEKYGAVREVILKELAEATWCGISTDMWRSENQNRAYVTLAAHFLGLGAPNCLSMGSRCLKTFEVPEENTAETITRVLYEVFIEWGI-SAKVFGATTNYGKDIVKACSLLDVAVHMPCLGHTFNAGIQQAFQLPK-LGALLSRCRKLVEYFQQSAVAMYMLYEKQKQQNVAHCMLVSNRVSWWGSTLAMLQRLKEQQFVIAGVLVEDSNNHHLM-LEASEWATIEGLVELLQPFKQVAEMLSASRYPTISMVKPLLHMLLNTTLNIKETDSKELSMAKEVIAKELSKTYQETPEIDMFLNVATFLDPRYKRLPF----LSAFERQQVENR--VVEEAKGLLDKVKDGGYRPA--EDKIFPVPEEPPVKKLMRTSTPPPASVINNMLAEIFCQTGGVEDQEEWHAQVVEELSNFKSQKVLGLNEDPLKWWSDRLALFPLLPKVLQKYWCVTATRVAPERLFGSAANVVSAKRNRL 636          
BLAST of zinc finger BED domain-containing protein 4-like vs. TrEMBL
Match: A0A498LRH3 (Zinc finger BED domain-containing 4-like protein OS=Labeo rohita OX=84645 GN=ROHU_030391 PE=4 SV=1)

HSP 1 Score: 412.92 bits (1060), Expect = 2.734e-130
Identity = 233/614 (37.95%), Postives = 351/614 (57.17%), Query Frame = 1
Query:  601 SSIWNYFTVSPLINSKAICNLCNVSLSRGGNESKSFTTSNLVQHLRSKHVVAFADFXXXXXXXXXXXXXXXTASIPRPATIEALLDRRQPFEFNDKRALDWNKTIAEFMALDVQPFSVVDNVGFRRIIAKAEPRYTIPSSRYFSSTLIPAMHEKIQNKVREMVSSQPSTSLTSDAWSDPSISVALLSLTAHWVTEDFQRKQAILAASPIEESHTGDYLGGMLLKILGDYTIEKSAVHVLLRDSGANMIKASRVADIDSISCFAHTLQLVINDSIMSQRSVKDILAISRSNVGKFRHSVLAQQHLSDLQGSLGVPKKKLVQDVQTRWNATLAMLRSLVEQKQVLGAYATEHKLTN-LDAHQWTLISHIIDTLSPFKDATKEVSDSQTSISVFLPKHTM-----------SEGIMTMRQDILTSLNKRFAHTKENRKMVLATILDPRFKNFAYDDRELASTAKQWLKNECLILASAERS---EEVVEPPSKRPRVETDQAHPGSSTSRLWDLFSDVVSEPALQTNSSIIGNVNDAVDAMIALYLSSAALPRTENPYVWWNSNKLLFPYLATLSRRYLSAPASSVPSEQLFSGAWQIFSDRRGSLTAGKGEMLLLLK 2397
            S++WNYF V+    +KA C LC+  LSRGG++  +F TSNL++HL+S+H   + +F                A  P   T++  L RR+    ++ RA+   + I E+ AL  QP S V+NVGF R++   EPRY +PS RY + T +P +H+ ++  +  ++ +  + S T+D W+     V+L+SLT+ W+ E F  ++AIL       SHT   +  +  ++L  + I K+ VHV+LRD+  NMIKA   A + S+ C AHTLQL +++ +++QRS+ D +A+ R  VG F+HS LA   L D+QG L  P K+L QDVQTRWN+T  ML+SL+EQK+VLG Y +EH+L + L AHQW L+   +  L+PF++ TK+VS      S  +P  T+             G+ TM+  +L ++ KRF+  + N    ++TILDPR+K+  + +   A  AK  LK E  +++ AE      E  EPP+K       QA   S++S L  +F ++  E   Q  ++       A++  +  YL  A  PR ++P  +W  NK+ FP LA ++R+YLSAP SSV SE+LFS    I  + R  LTA   E LL LK
Sbjct:    2 SAVWNYFKVNEDDKTKADCKLCSAKLSRGGSKGSAFNTSNLIKHLKSQHDNEYKEFTL--------------APKPTQPTLQQTLARREKMSRDNPRAVKITQAIIEYTALSDQPLSEVENVGFLRLLHVLEPRYDVPSRRYMTDTELPKLHDSVKKHIHSLLQTSSAFSFTTDIWTSSVSPVSLISLTSQWIDESFTPQRAILHVKQFRGSHTSQAIVHVFEEMLQTWGIPKTLVHVVLRDNAKNMIKAMNNAGLPSLPCVAHTLQLAVHEGLLAQRSIADAIAVGRKIVGHFKHSALAYSRLEDIQGQLNQPIKRLQQDVQTRWNSTYYMLQSLIEQKRVLGVYVSEHELPDCLTAHQWALMEKTVAILAPFEELTKKVSSYDALASDVIPAVTVLVRLLNRETDEDHGVKTMKATLLAAVKKRFSDVETNPLYFISTILDPRYKDRFFSN-NTAPEAKLHLKQELQMMSRAEAEGSRAEAAEPPAK--LFLKAQA---STSSSLDTVFEEIAKE---QPQAAQPLAAGAAIE--LDTYLGEAPSPREDSPLKYWGVNKIRFPTLAKMARKYLSAPCSSVESERLFSSVSHIIDENRNRLTADNAEKLLFLK 590          
BLAST of zinc finger BED domain-containing protein 4-like vs. TrEMBL
Match: A0A1X7TWE0 (BED-type domain-containing protein OS=Amphimedon queenslandica OX=400682 GN=100640810 PE=4 SV=1)

HSP 1 Score: 395.586 bits (1015), Expect = 1.431e-123
Identity = 234/621 (37.68%), Postives = 349/621 (56.20%), Query Frame = 1
Query:  583 MSKQLTSSIWNYFTVSPLINSKAICNLCNVSLSRGGNESKSFTTSNLVQHLRSKHVVAFADFXXXXXXXXXXXXXXXTASIPRPATIEALLDRRQPFEFNDKRALDWNKTIAEFMALDVQPFSVVDNVGFRRIIAKAEPRYTIPSSRYFSSTLIPAMHEKIQNKVREMVSSQPSTSLTSDAWSDPSISVALLSLTAHWVTE-DFQRKQAILAASPIEESHTGDYLGGMLLKILGDYTIEKSAVHVLLRDSGANMIKASRVADIDSISCFAHTLQLVINDSIMSQRSVKDILAISRSNVGKFRHSVLAQQHLSDLQGSLGVPKKKLVQDVQTRWNATLAMLRSLVEQKQVLGAYATE-HKLTNLDAHQWTLISHIIDTLSPFKDATKEVSDSQTSISVFLP----------KHTMSEGIMTMRQDILTSLNKRFAHTKENRKMVLATILDPRFKNFAYDDRELASTAKQWLKNECLILASAERSEEVVEPPSKRPRVETDQAHPGSSTSRLWDLFSDVVSEPALQTNSSIIGNVNDAVDAMIALYLSSAALP-RTENPYVWWNSNKLLFPYLATLSRRYLSAPASSVPSEQLFSGAWQIFSDRRGSLTAGKGEMLLLLKYNL 2406
            MSK+  S IW YFT S    S AIC  C   +SRGG   KSFTT+NLV HL+ KH   + +++   +++Q       +  + + AT+E    +   +  +D RA++    +AE +A+D QP S+VD++GF R++  AEPRYT+PS +Y + T+IP ++ ++  KV + +S     S TSD WS    + +L+SLTAHW++   F RK  +L AS I  SHT D +     ++L  + IE S +H  + D+ ANM KA        I CFAH++QLVI+D I+SQR V DILA  R  VG F+HS +A   L ++Q SL +P+++L QDV TRWN+TL ML+S++ QK VL AY TE   +  L +HQ  +I  II  L P  D TK +S  + S+S+ +P          K     G+ TM++++L SLN+RF   + N  +V+AT+LDP FK+  +        AK+ L  +    +  +  EE +EPP+K PR    Q             F +++ E + + +SS+          ++  YL+   +     N Y WW  NK  FP L+ L+ +YLS P +SV SE+LFS A  I+ ++R  L   + E LL +K N+
Sbjct:    1 MSKR-RSPIWQYFTASEGDKS-AICTTCGTQVSRGGKSVKSFTTTNLVNHLK-KHPAEYKEYEDAKRKEQLDATSTPSKPVLKQATLEESSTKMHKWAQSDSRAVNITTKVAEMIAVDCQPMSIVDDIGFTRVLHAAEPRYTLPSRKYMTDTVIPRVYSEVHMKVAKEISEAKWVSCTSDIWSTNISNESLISLTAHWLSPISFDRKSIMLNASHIPGSHTADAIRKKCKEMLQTWGIE-SRLHCFVVDNAANMKKAMADGKYIHIGCFAHSIQLVIHDGIISQRYVLDILAKCRRIVGHFKHSQVASSRLKEIQSSLCLPQQRLKQDVSTRWNSTLHMLQSIIAQKVVLAAYNTESDDIPQLSSHQLDIIDKIITVLKPVDDITKSISSEKASVSIIIPYIRALRKTWEKSGDDRGVQTMKKELLDSLNRRFCDIESNETLVVATLLDPCFKDKFFTSITEKEAAKELLITKITNNSHDQDIEESIEPPNKLPRTTVMQC------------FDEILEESSARLSSSL------CYTTIVEQYLAEPNIDYHAGNAYQWWAENKCRFPRLSELALQYLSPPPTSVASERLFSTAGDIYDEKRNRLDPERAETLLFIKNNI 599          
BLAST of zinc finger BED domain-containing protein 4-like vs. TrEMBL
Match: A0A3P8Q7N8 (BED-type domain-containing protein OS=Astatotilapia calliptera OX=8154 PE=4 SV=1)

HSP 1 Score: 395.586 bits (1015), Expect = 4.480e-123
Identity = 235/647 (36.32%), Postives = 360/647 (55.64%), Query Frame = 1
Query:  601 SSIWNYFTVSPLINSKAICNLCNVSLSRGGNESKSFTTSNLVQHLRSKHVVAFADFXXXXXXXXXXXXXXXTASIPRPATIEALLDRRQPFEFNDKRALDWNKTIAEFMALDVQPFSVVDNVGFRRIIAKAEPRYTIPSSRYFSSTLIPAMHEKIQNKVREMVSSQPSTSLTSDAWSDPSISVALLSLTAHWVTEDFQRKQAILAASPIEESHTGDYLGGMLLKILGDYTIEKSAVHVLLRDSGANMIKASRVADIDSISCFAHTLQLVINDSIMSQRSVKDILAISRSNVGKFRHSVLAQQHLSDLQGSLGVPKKKLVQDVQTRWNATLAMLRSLVEQKQVLGAYATEHKL-TNLDAHQWTLISHIIDTLSPFKDATKEVSDSQTSISVFLP-----KHTMS------EGIMTMRQDILTSLNKRFAHTKENRKMVLATILDPRFKNF------AYDDRE-------------LASTAK-QWLKNECLILASAERSEEVVEPPSKRPRVETDQAHPGSSTSRLWDLFSDVVSE------PALQTNSSIIGNVNDAVDAMIALYLSSAALPRTENPYVWWNSNKLLFPYLATLSRRYLSAPASSVPSEQLFSGAWQIFSDRRGSLTAGKGEMLLLLKYNLPQFSFNC 2427
            S++W YF +    +  A CNLC+ S+SRGG+    F T+N+++HL+  H   +A+F   SK KQ+        S+P   T+   + RR+ F     RA    + + EF+ LD QP SVV+N GFRR+I   EPRY +P+  + S   IP  +++++  + E +   P+ S+T+D WS     ++LLSLT HW+   F  ++A+L A     SHTG+ +   + ++L  + I K+ VHV+LRD+ +N+ KA     + S+ CFAHTLQLV+N+ +++QR V D + + R  VG F+HS  A   L D+Q  L +  K+L+QDV+TRWN+T  M+++L EQK+ L AY+ E+ L   L A QW L+  ++  L+PF++ TKEVS S +S S  +P     K  +S      +GI  M+  +L ++N+RF   +      +AT+LDPR+K+        Y +R              LA   K ++L+        AE +  V+EP  K PRVE+      SS SRL  +F +++ +      P L T S+ +          +  YLS   + R++NP ++W  NKL FP L + + ++L AP +S+ SE+LFS A  I  +RR  LTA K EML+ LK NLP     C
Sbjct:    2 SAVWTYFKLKDEKSKTAECNLCDASVSRGGSSVGIFNTTNMIKHLQKHHAKEYAEFSLASKAKQK--------SVPYQQTLLENIQRREKFPPESNRAKLITEKMVEFVVLDDQPLSVVENDGFRRLIEHLEPRYMLPNRHFISEEAIPGKYKQVRKFISESLEIIPTLSMTTDIWSSDVCPLSLLSLTVHWIDSSFTMQKAVLQAKEFCGSHTGESIAAAMEEMLNAWKIPKNKVHVVLRDNASNIKKAMSRLGVASLGCFAHTLQLVVNEGLLAQRGVCDAVTVGRKIVGHFKHSPQAYSRLEDIQMELNMSPKRLIQDVRTRWNSTYYMIKTLTEQKRALCAYSAEYDLPATLSAQQWGLLEKVLTALAPFEELTKEVSASSSSASDVIPIVCVLKRVLSRENEADDGIKKMKGTLLEAVNRRFRDVESEPLYTVATLLDPRYKDRYVRLHSCYFNRSTCFVCVCVCVNALLAEMRKMEFLRTTLNSSEPAEGTSAVLEPAKKTPRVES------SSQSRLESVFDEILKKNTQDPVPQLATTSARVE---------VQTYLSEPTIQRSDNPLLYWQVNKLRFPTLVSTAAKFLCAPTTSIESERLFSTASIIIDERRSRLTAEKVEMLIFLKKNLPLMLNEC 625          
BLAST of zinc finger BED domain-containing protein 4-like vs. TrEMBL
Match: A0A498LZ21 (Zinc finger BED domain-containing 4-like protein OS=Labeo rohita OX=84645 GN=ROHU_009680 PE=3 SV=1)

HSP 1 Score: 392.504 bits (1007), Expect = 1.897e-120
Identity = 223/625 (35.68%), Postives = 353/625 (56.48%), Query Frame = 1
Query:  583 MSKQLTSSIWNYFTVSPLINSKAICNLCNVSLSRGGNESKSFTTSNLVQHLRSKHVVAFADFXXXXXXXXXXXXXXXTASIPRPATIEALLDRRQPFEFNDKRALDWNKTIAEFMALDVQPFSVVDNVGFRRIIAKAEPRYTIPSSRYFSSTLIPAMHEKIQNKVREMVSSQPSTSLTSDAWSDPSISVALLSLTAHWVTEDFQRKQAILAASPIEESHTGDYLGGMLLKILGDYTIEKSAVHVLLRDSGANMIKASRVADIDSISCFAHTLQLVINDSIMSQRSVKDILAISRSNVGKFRHSVLAQQHLSDLQGSLGVPKKKLVQDVQTRWNATLAMLRSLVEQKQVLGAYATEHKL-TNLDAHQWTLISHIIDTLSPFKDATKEVSDSQTSISVFLPKHTM-----------SEGIMTMRQDILTSLNKRFAHTKENRKMVLATILDPRFKNFAYDDRELASTAKQWLKNECLIL----ASAERSEEVVEPPSKRPRVETDQAHPGSSTSRLWDLFSDVVSEPALQTNSSIIGNVNDAVDAMIALYLSSAALPRTENPYVWWNSNKLLFPYLATLSRRYLSAPASSVPSEQLFSGAWQIFSDRRGSLTAGKGEMLLLLKYNLP 2409
            M +   S++W YF ++    S A+CN+C  ++ RGG ++ +F T+NL++HL+  H    A F + +K K + +    TA+  +  T+   L RR+ F     +AL   + + EF+ LD QP S V++ GFRR++   EPRY++PS +YFS T +P +++K+   + + +    S S T+D WS     ++LLSLT HW+     R+ A+L A     SHT D +   + ++L  + I  + VH++LRD+ +N+ KA     + S+ CFAHTLQLV+N+ ++SQRSV D +AI R  VG F+HS LA   L D+Q  + +  K+L QDV+TRWN+T  +++SL+EQK+VLGAY  ++ L + L A+QW L+      L+PF++ T++VS +  S +  +P  T+             GI TM++ +L ++N+RF   ++     LAT+LDPR+K+  +   + A +AK  L  E   L    +S   + E  EP  K PRVE   A P  S S     F  +V E             + +    +  YL+   +  ++NPY +W  NK   P LA  + +YL AP +SV SE++FS  + I  ++R  LTA + EML+ ++ NLP
Sbjct:    1 MERAKESAVWRYFMLAAPTCSTAVCNVCKGNVLRGGGKTATFNTTNLIKHLQKHHAKEHAKFLQLNKTKGKGDN---TAATAQQLTLADALQRREKFPTESLKALGITQKVLEFIVLDAQPMSFVEDEGFRRLLEYLEPRYSLPSRKYFSETALPELYKKVCEHISKEIKDVKSMSFTTDIWSSAVCPMSLLSLTVHWLDVSCTRRGAMLQAKNFHGSHTSDTISAAIKEMLDQWHIPLNKVHLILRDNASNIKKAMDNMGVRSLGCFAHTLQLVVNEGLLSQRSVSDAIAIGRQIVGHFKHSPLAYSRLQDIQLQMQMQPKRLQQDVKTRWNSTY-LIQSLLEQKRVLGAYIADNDLPSTLTANQWALLEKTSIVLAPFEELTRKVSSATASTADVIPAVTVLKRILAKEGDADTGIKTMKKTLLEAVNRRFDSVEDEPLYALATLLDPRYKDRYFTSAQSAMSAKDALTGELEELEDLRSSTAGASEAAEPQEKAPRVEAAAAAP--SKSSFMQEFDQIVEE-----CEDPSAASSSSPAVQLHGYLAEKTIATSDNPYQYWGVNKYRLPCLAATATKYLCAPCTSVESERVFSTVFNIVDEKRNRLTAERTEMLVFMRKNLP 614          
BLAST of zinc finger BED domain-containing protein 4-like vs. TrEMBL
Match: A0A1A8RA88 (Zinc finger, BED domain containing 4 OS=Nothobranchius rachovii OX=451742 GN=ZBED4 PE=4 SV=1)

HSP 1 Score: 385.185 bits (988), Expect = 1.208e-119
Identity = 215/617 (34.85%), Postives = 345/617 (55.92%), Query Frame = 1
Query:  601 SSIWNYFTVSPLINSKAICNLCNVSLSRGGNESKSFTTSNLVQHLRSKHVVAFADFXXXXXXXXXXXXXXXTASIPRPATIEALLDRRQPFEFNDKRALDWNKTIAEFMALDVQPFSVVDNVGFRRIIAKAEPRYTIPSSRYFSSTLIPAMHEKIQNKVREMVSSQPSTSLTSDAWSDPSISVALLSLTAHWVTEDFQRKQAILAASPIEESHTGDYLGGMLLKILGDYTIEKSAVHVLLRDSGANMIKASRVADIDSISCFAHTLQLVINDSIMSQRSVKDILAISRSNVGKFRHSVLAQQHLSDLQGSLGVPKKKLVQDVQTRWNATLAMLRSLVEQKQVLGAYATEHKL-TNLDAHQWTLISHIIDTLSPFKDATKEVSDSQTSISVFLP-----------KHTMSEGIMTMRQDILTSLNKRFAHTKENRKMVLATILDPRFKNFAYDDRELASTAKQWLKNECLILAS---AERSEEVVEPPSKRPRVETDQAHPGSSTSRLWDLFSDVVSEPALQTNSSIIGNVNDAVDAMIALYLSSAALPRTENPYVWWNSNKLLFPYLATLSRRYLSAPASSVPSEQLFSGAWQIFSDRRGSLTAGKGEMLLLLKYNL 2406
            S++WN+F +       A CN+C +S+SRGG +  +F T+NL++HL++KH   +++F   ++ K        T S P   T+EA+L  ++    +  +A +    IAEF+ALD QP SVV NVGFRR++   EPRY +PS  YF+ T +P++H K+++ +  M+S   +   T+D WS     ++L+S TA W+   F  ++A L A     SHT +++   + ++L  + IEK  VHV++RD+  NM +A     + S+ C AHTLQLV+++ ++SQRSV D +A +R  +G F+HS LA   L D+Q SL +  K+L QDV  RWN++L ML+S++EQK+ L  Y  +H L   L + QWTL+ +  + L P ++ T+EVS    + +  +P           + T  +G+ TM++ +L ++  RFA  ++     +AT++DPR+K+  +   +    AK  L  E + +     A +  E  EP SK PR          + S L  +  +++ E   +  S    NVN      +  YLS   +PR  NP  +W ++   FP LA ++ ++L AP +SV SE+LFS    I  + R  L+  K EML+ LK N+
Sbjct:    2 SAVWNHFKLETEGCPTATCNICKLSVSRGGKDRAAFNTTNLIRHLKNKHPAQYSEFTAATQIK--------TWSQP---TLEAMLKNKEKLPKDSDKAKNITAKIAEFIALDDQPLSVVSNVGFRRLMEHLEPRYELPSRSYFTDTALPSIHNKLRDHLLVMLSKVSAFGFTTDIWSSSVCPMSLISFTAQWIDSSFNLQRATLNAQHFRGSHTAEHVKQAIEEMLNSWGIEKERVHVIVRDNARNMKRAMEDLAVPSLGCVAHTLQLVVHEGLLSQRSVTDTMANARKIIGHFKHSPLAYSRLEDIQISLKMTVKRLQQDVHVRWNSSLYMLQSILEQKRALSIYTADHNLPATLTSSQWTLMENTAEVLVPLEELTREVSKETATAADVIPAISALRRVLSREQTTDQGVRTMKRTLLEAVETRFAEVEKETLYSIATLVDPRYKDRYFTKSDHLRFAKDSLIQEVMKMEENRVASKEPEAAEPVSKAPR--------QGAGSSLGSILDEILEERQPEAQSG--HNVN------LQGYLSEQTIPRKSNPLDYWKTHATQFPSLAAVATKFLCAPCTSVDSERLFSAVSNILDENRNRLSPDKLEMLIFLKKNM 591          
BLAST of zinc finger BED domain-containing protein 4-like vs. Ensembl Cavefish
Match: ENSAMXT00000036437.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001642.1:69110:71525:-1 gene:ENSAMXG00000035695.1 transcript:ENSAMXT00000036437.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 235.343 bits (599), Expect = 5.331e-67
Identity = 168/632 (26.58%), Postives = 303/632 (47.94%), Query Frame = 1
Query:  574 FEEMSKQLTSSIWNYFTVSPLINSKAICNLCNVSLSRGGNESKSFTTSNLVQHLRSKHVVAFADFXXXXXXXXXXXXXXXTASIPRPATIEALLDRRQPFEFNDKRALDWNKTIAEFMALDVQPFSVVDNVGFRRIIAKAEPRYTIPSSRYFSSTLIPAMHEKIQNKVREMVSSQPSTSLTSDAWSDPSISVALLSLTAHWVTEDFQRKQAILAASPIEESHTGDYLGGMLLKILGDYTIEKSAVHVLLRDSGANMIKASRVADIDSISCFAHTLQLVINDSIMSQRSVKDILAISRSNVGKFRHSVLAQQHLSDLQGSLGVPKKKLVQDVQTRWNATLAMLRSLVEQKQVLGAYATEHK--LTNLDAHQWTLISHIIDTLSPFKDATKEVSDS-QTSISVFLP-----KHTMS--------EGIMTMRQDILTSLNKRFAHTKENRKMVLATILDPRFKNFAYDDRELASTAKQWLKNEC--LILASAERSEEVVEPPSKRPRVETDQA--HPGSSTSRLWDLFSDVVSEPALQTNSSIIGNVNDAVDAMIAL--YLSSAALPRTENPYVWWNSNKLLFPYLATLSRRYLSAPASSVPSEQLFSGAWQIFSDRRGSLTAGKGEMLLLLKYN 2403
             E + K+  S +W +F + P  ++K  C +C+  L+   N      TS++++H R+K        +      Q          I  P++ + L                 +  +   +  D+QPF++VD+ GFR  +   +P Y IPS +   S ++ A + + + K +E V    + SLTSD W+   +  A L++T H + E  +    +L      +SH+ + L  +   ++ ++ I+K  V  L+ D+  NM+  + +  +    C AH L L++  +I     ++ I + +R   G FR S  A++ L  +QG +G P  KL+Q+V+TRWN+T AML+ + +Q++ +GA     K  LT L + ++  I+  +  LS F +AT E+S+  + S S  +P     +H ++        E  + +  ++   LN R +  +    M LAT+LDPR+K   +  +  A  A + L  EC  +I    +++       + +P++E   A      ST   ++    +++          +  +N   DA + +  YLS   +PRTE+P  +W S K ++P+L  L+  +L  PASSVP E++FS A ++ + +R  L     E +L L  N
Sbjct:    1 MEPVRKRGRSEVWEHFELLP--SNKVKCLVCSQQLAYNNN------TSSMLRHFRAKRENIPCQSRTTLSSTQGIAYSFLLVYIFYPSSQQML-----------------DSALVNMIVKDLQPFTIVDDAGFREFVGILDPTYVIPSRKALKS-MVEAKYTETKEKAKEEVQKATAVSLTSDMWTSIHMD-AYLAITCHLINEKDELSTFLLGVGKFPKSHSAENLAEVKTALMAEWGIQKK-VRCLVTDAAPNMVACAGLLKMLHTICIAHALNLIVKKAIDQTPGLEHIRSKARKIAGYFRSSTTAKERLFQMQGQMGRPTLKLIQEVETRWNSTFAMLQRMYQQREPVGAALVTLKTDLTPLTSEEYHTINECLGVLSTFNEATTELSEERRVSGSKVIPLIRMLRHALNTKQSQAQDEKSIQLCSNLFRLLNDRVSSYETMSIMTLATLLDPRYKTVGFCSQSNAQAAVKRLTGECATVIRTQEQQNTTSTSSATSQPQLEATVASSSTTPSTGTPYETLFLLIT----------VMKINATADATVEVQRYLSDPIIPRTEDPLRFWASQKNVYPHLYHLALEFLCTPASSVPCERIFSKAGEVVTKKRNQLNPSTVEKILFLNKN 594          
BLAST of zinc finger BED domain-containing protein 4-like vs. Ensembl Cavefish
Match: zbed4 (zinc finger BED-type containing 4 [Source:NCBI gene;Acc:103043950])

HSP 1 Score: 227.254 bits (578), Expect = 2.396e-61
Identity = 192/648 (29.63%), Postives = 311/648 (47.99%), Query Frame = 1
Query:  583 MSKQLTSSIWNYFTVSPLINSKAICNLCNVSLSRGGNESKSFTTSNLVQHLRSKHVVAFADFXXXXXXXXXXXXXXXTASIPRPATIEALLDRRQPFEFNDKRALDWNKTIAEFMALDVQPFSVVDNVGFRRIIAKAEPRYTIPSSRYFSSTLIPAMHEKIQNKVREMVSSQPS--TSLTSDAWSDPSISVALLSLTAHWVT---------EDFQRKQAILAASPIEESHTGDYLGGML-----LKILGDYTIEKSAVHV--LLRDSGA--NMIKASRVADIDSISCFAHTLQLVINDSIMSQRSVKDILAISRSNVGKFRHSVLAQQHLSDLQGSLGVPKKKLVQDVQTRWNATLAMLRSLVEQKQVLGAYATEHKLTNL-DAHQWTLISHIIDTLSPFKDATKEVSDSQTSISVFLPK-HTMSE----------GIMTMRQDILTSLNKRFAHTKENRKMVLATILDPRFKNFAYDDRELASTAKQWLKNECLILASAERSEEV-VEPPSKRPRVETDQAHPGSSTSRLWDLFSDVVSEPALQTNSSIIGNVNDAVDAMIALYLSSAALPRTENPYVWWNSNKLLFPYLATLSRRYLSAPASSVPSEQLF--SGAWQIFSDRRGSLTAGKGEMLLLLKYNLPQFSF 2421
            M  + TS +WN+F++S    +K +C  CN ++SRG  ++ +  TS L +H++  H     +    S +   A        +   A ++    + + FE     A    K IAE +ALD+QP +VV+NVG  R++   +P+Y++PSS YF+ST IP M+E ++  V   +    S     T+  W   S +   L+LTAHWVT         +DF    A+L  SPI+     DY   ML     L+ L D  I  S + +   + D+ A  N++K S  A    + CF H + L++N++I SQR V+++L+I+R    +   S  A++ L++LQ    +P+ +LVQDV ++W  +  ML  LVEQK+ +   + E     L    QW ++  + + L PF+ A +E+S   +++   +P  H ++           GI  M + +  ++  R +    + +   AT+LDPR+K   + + E A   KQ L  E   ++ A  S +   +  +    V      P      LW L  D + +   Q           + D ++  YL    L ++ +P  +WN  K  +P LA ++ RY+  P S VP+E LF  S A    S  R  L   +G  LL LK NLP   F
Sbjct:  646 MFSKKTSKLWNHFSISTGDPTKVVCLHCNRTISRG-KKTTNLGTSCLFRHMQRFHGHMLENSSSISGDVSSAALAVKQELMDTSAYVQ----QNKKFEDCHPVAKKITKLIAEMLALDLQPSTVVENVGLNRLLDYLQPQYSVPSSSYFTSTAIPEMYETVKEVVLTHLKEAESGIIHFTTSMWVS-SQTREYLTLTAHWVTFESRVRPQGQDFHC-SALLGVSPID----CDY--NMLSIQKQLEYLWDTWIASSGLKIGFTVTDNQAIGNVLKDSNHA---IMHCFGHNIDLIVNEAIKSQRMVQNLLSIARKICERVHRSAKAKERLAELQKEYNLPENQLVQDVPSKWKTSYFMLERLVEQKKAIDELSLECNFRELISCDQWEVMQSVCNALKPFEVACQEMSAHTSTLGQVIPLIHILNRKIDMLFDETMGIDNMLKSLKEAMVTRMSPILHDTRYTWATMLDPRYKTSLFTEEE-AEQCKQDLIRELDKVSLATTSPDTKTQLSNGCVEVPASSDGPSGKKENLWALM-DGIRQKIKQEERP------KSPDLIVVEYLEEEILDQSCDPLDYWNLKKFQWPELAKVAVRYVGCPPSIVPAETLFSTSSANCALSQSRPLLENLEG--LLFLKVNLPLVYF 1267          
BLAST of zinc finger BED domain-containing protein 4-like vs. Ensembl Cavefish
Match: ENSAMXT00000045953.1 (zinc finger BED domain-containing protein 1-like [Source:NCBI gene;Acc:111189856])

HSP 1 Score: 218.779 bits (556), Expect = 7.905e-61
Identity = 169/647 (26.12%), Postives = 305/647 (47.14%), Query Frame = 1
Query:  574 FEEMSKQLTSSIWNYF--------TVSPLINSKAICNLC--NVSLSRGGNESKSFTTSNLVQHLRSKHVVAFADFXXXXXXXXXXXXXXXTASIPRPATIEALLDRRQPFEFNDKRALDWNKTIAEFMALDVQPFSVVDNVGFRRIIAKAEPRYTIPSSRYFSSTLIPAMHEKIQNKVREMVSSQPSTSLTSDAWSDPSISVALLSLTAHWVTEDFQRKQAILAASPIEESHTGDYLGGMLLKILGDYTIEKSAVHV-LLRDSGANMIKASRVADIDS-ISCFAHTLQLVINDSIMSQRSVKDILAISRSNVGKFRHSVLAQQHLSDLQGSLGVPKKKLVQDVQTRWNATLAMLRSLVEQKQVLGAYATE-------HKLTNLDAHQWTLISHIIDTLSPFKDATKEV-SDSQTSISVFLP-KHTM----------SEGIMTMRQDILTSLNKRFAHTKENRKMVLATILDPRFKNFAYDDRELASTAKQWLKNECLILASAERSEEVVE-----PPSKRPRVETDQAHPGSSTSRLWDLFSDVVSEPALQTNSSIIGNVNDAVDAMIALYLSSAALPRTENPYVWWNSNKLLFPYLATLSRRYLSAPASSVPSEQLFSGAWQIFSDRRGSLTAGKGEMLLLLKYNL 2406
             E     L S++W YF        +V  +  +  +C +C   V     GN      T+N+  H+R  H              ++ +    T+S+ +P    + + +         RA      I  F+A D+QP+SVV+N GF+ +I+  EPRY+IPS  + ++ ++P+M+E  +  V   +S+    ++T+D W+  +   + +++TAH+V  +++ +  +L   PI ESHT D L  +L + + ++ +++    + +  D+  N++ AS  A +   I CFAHT+ L      +    +  +L   R  V  F  S  A   L   Q  L +P  KL+QDV TRWN++  ML   +EQ+  + +  TE         L  L     T++  +++ L P K  T  + S+ Q ++S+ LP KH++          S+ +  ++  I T++  R+++    + +  +T LDPRFK+  + D     + K+   N    +     +++  +     PP       + +  P +  + L +LF D  S       +  +    D V   I LY  +  +    NP  WW +N+  +P L+ LS+ YL+  A+SV SE++FS A  I + +R +L+    ++L+ LK NL
Sbjct:   12 LEAAPASLKSAVWKYFAFPVSYVASVRVVDRNTTVCKMCYMRVPYPATGN------TTNMAAHIRRHH--------------KDVDLTGKTSSLVQPTIQSSFVVK---LAQTSARAEAITNAIGLFIAADLQPYSVVENTGFKHLISVLEPRYSIPSRSHLTTKVLPSMYEDTKENVLRGLSNAELIAITTDGWTSRATE-SYITVTAHYVNNEWEIESPVLQTRPIYESHTSDNLAEVLQEAVLEWKLDRQNTTIPVTTDNAKNIVNASNAAGLSPHIGCFAHTVNLASQKG-LGVNQISRLLGKVRRVVTFFHKSTTAAAVLKAKQEMLQLPPHKLIQDVATRWNSSYDMLTRYLEQQAAVYSALTEKDVKKNAKDLITLSDQDVTVLEDVVEVLKPMKTITTLLSSEQQPTVSMILPLKHSILTAMKHSGTDSQIVKDVKSAIATNIEGRYSNPSLQQFLNESTALDPRFKSLPHLDD---PSRKEIFNNLAEKIIQRHPTQDPGQGTSQNPPEDPETAASSEGSPPAKRTTLSELFGDFYSTAPTTPTTPELW--PDVVKEEIELYRMAKVISVDANPLKWWKNNEHQYPNLSKLSKHYLAVQATSVASERVFSTAGDIVTAQRAALSPDNVDILIFLKKNL 628          
BLAST of zinc finger BED domain-containing protein 4-like vs. Ensembl Cavefish
Match: ENSAMXT00000030725.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000043.1:648734:652625:-1 gene:ENSAMXG00000030453.1 transcript:ENSAMXT00000030725.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 218.779 bits (556), Expect = 1.076e-60
Identity = 186/655 (28.40%), Postives = 288/655 (43.97%), Query Frame = 1
Query:  589 KQLTSSIWNYFTV------SPLINSKAICNLCNVSLSRGGNESKSFTTSNLVQHLRSKHVVAFADFXXXXXXXXXXXXXXXTASIPRPATIEALLDRRQPFEFNDKRALDWNKTIAEFMALDVQPFSVVDNVGFRRIIAKAEPRYTIPSSRYFSSTLIPAMHEKIQNKVREMVSSQPSTSLTSDAWSDPSISVALLSLTAHWVTEDFQRKQAILAASPIEESHTGDYLGGMLLKILGDYTIEKSAVHVLLRDSGANMIKASRVADIDSISCFAHTLQLVINDSIMSQRSVKDILAISRSNVGKFRHSVLAQQHLSDLQGSLGVPKKKLVQDVQTRWNATLAMLRSLVEQKQVLGA-------YATEHKLTNLDAHQWTLISHIIDTLSPFKDATKEVSDSQT-SISVFLPKHTM-----------SEGIMTMRQDILTSLNKRFAHTKENRKMVLATILDPRFKNFAYDDRELASTAKQWLKNECLILASAERS---------EEVV----EPPSKRPRVETDQAHP---GSSTSRLWDLFS------DVVSE--PALQTNSSIIGNVNDAVDAMIALYLSSAALPRTENPYVWWNSNKLLFPYLATLSRRYLSAPASSVPSEQLFSGAWQIFSDRRGSLTAGKGEMLLLLKYNL 2406
            K L + +W +F          L  SKA+C LCN  L   GN      T+NL  HL   H                    Q TA  P    +E     + P   +  RA   ++ +  F+  D++P+SVV+NVGFR +I   EPRY +P+ ++ S   IP ++  +++ V   + S    +LT D+W   ++  + L++TAH++  +++    +L    IE SHT   L  +L + + ++ +       ++ D+ ANM +A  + ++  + CFAHTL L  + + +    V  +L   R     F  S  A   L + Q  LG+P  KLV DV TRWN+ L ML+  +EQ+  + A          E  L  L     T+   ++  L P K AT  +S+ ++ ++SV  P H             S  I  ++    T+L  R+   K+  K+ +A+ LDPRFK   +   E        L  E   L   E S         E +V    E  S  P   +D   P      +S L  L        D VSE  PA++                +  Y     +P +ENP  WW  +   +P LA  ++RYL  P +SVPSE++FS A  I + +R  LT    + LL L+ NL
Sbjct:   39 KNLKADVWLHFGFRSYGGREELDKSKAVCKLCNKELKYCGN------TTNLRNHLTRHH-----------------PDTQKTAE-PTQTPLEKAFAMKLPS--SSPRAKKISEALVTFICKDIRPYSVVENVGFRSLINVLEPRYVLPTRKHLSEVAIPNLYRDVKHGVATSLKSTERVALTCDSWVSRAMD-SYLTITAHYIDNEWRLMSHVLQTREIETSHTASNLAELLSEAIQEWELANKDP-AIVTDNAANMTRAVELTNLLHVGCFAHTLNLA-SQAALKTPPVARLLGRVRRIASFFHRSTTASHQLKEKQKILGLPAHKLVIDVTTRWNSALEMLQRFLEQQPAISAALLSPEVRRNESDLCTLSELDITVAEDVVKALGPLKAATLVMSEEKSPTLSVIAPLHAQLLAEMNNVTHDSTVIKDLKTAAHTNLKSRYVVLKD--KLYVASALDPRFKALPFLTDEARDNTFSKLVTEAAGLEPVEASIQQSDDDGAEHIVPVEQEDNSLDPVEVSDAPTPPKKPKESSALMSLLGPSYTPKDTVSEKTPAVKATEE------------VNRYREVKPIPLSENPLTWWRLHAGEYPLLARQAKRYLCIPGTSVPSERVFSTAGDIVTAQRSCLTPQHVDQLLFLQKNL 650          
BLAST of zinc finger BED domain-containing protein 4-like vs. Ensembl Cavefish
Match: ENSAMXT00000030135.1 (zinc finger BED domain-containing protein 1-like [Source:NCBI gene;Acc:111188279])

HSP 1 Score: 201.06 bits (510), Expect = 7.346e-55
Identity = 151/552 (27.36%), Postives = 267/552 (48.37%), Query Frame = 1
Query:  907 KTIAEFMALDVQPFSVVDNVGFRRIIAKAEPRYTIPSSRYFSSTLIPAMHEKIQNKVREMVSSQPSTSLTSDAWSDPSISVALLSLTAHWVTEDFQRKQAILAASPIEESHTGDYLGGMLLKILGDYTIEKSAVHVLLRDSGANMIKASRVADIDSISCFAHTLQLVINDSIMSQRS-----VKDILAISRSNVGKFRHSVLAQQHLSDLQGSLGVPKKKLVQDVQTRWNATLAMLRSLVEQKQVLGAYATEHKLTNLDAHQWTL-------ISHIIDTLSPFKDATKEVS-DSQTSISVFLPKHTM--------SEGIMTMRQ---DILTSLNKRFAHTKENRKMVLATILDPRFKNFAYDDRELASTAKQWLKNECLILASAERSEEVVEP----------------------------PSKRPRVETDQAHPGSSTSRLWDLFSDVVSEPALQTNSSIIGNVNDAVDAMIALYLSSAALPRTENPYVWWNSNKLLFPYLATLSRRYLSAPASSVPSEQLFSGAWQIFSDRRGSLTAGKGEMLLLLKYNL 2406
            +++  F+  D++P SVV+N GFR+++   EPRYT+PS ++ +   +P ++++++ +V E +SS    +LT DAW+  +   + +++TA  +TE  +    +L    +  SHTG+ +  +L + + ++ +E +   V++ D+ +NM  A++ AD+  I CFAH+L L       SQ++     V+ +L+  R     FR S +A   L   Q  L +PK +L+ DV TRWN++  M+   +EQ+  + A     ++  ++   +TL          ++  L P KDAT  +S +S  ++++  P H          SE   T+++    I   L KR+   KE   + +A+ LDPRFK+  +     A T   + K    ++A+ E+    +E                             P KRPR        GS    L DL        A   +++   + +D   A I  +     LP TENP  WW  ++  +P L+ +++ +L  P +SV +E++FS A  I + +R  L A   + L+ L  NL
Sbjct:   65 QSVLYFICKDMRPLSVVENEGFRKMVNIMEPRYTLPSRQHITDIAVPRLYKEVKARVAEALSSTDRVALTCDAWTSRATE-SYVTITAPHITEKCELDTYVLQTRALHVSHTGENIADLLKEAVTEWRLE-AKDPVIVTDNASNMNIAAKRADMTHIRCFAHSLNLA------SQKAPKLPKVERLLSRIRLVTTFFRRSTIASHQLKQKQDLLQLPKHRLITDVVTRWNSSYDMIERFLEQQPEICAALLSTEVRKIEKDVFTLSETDITCAEEVLKALKPMKDATLVMSEESMPTLAIVAPLHAKLVMGTEESSEDTQTVKEIKTVIAQDLGKRYGSEKET--LFMASALDPRFKDLPFLSE--AETNDTYSKITAAVVAAIEKQHNQLEQIDSLVKETDQLKEVYHSADNVPALASQLPIKRPR--------GSCA--LLDLLGATF---ASTKDNAAQKSTHDVAAAEIKRFREETPLPLTENPLSWWKEHEHEYPQLSRVAKSFLCIPGTSVSAERVFSTAGNIVTAQRSVLKAEHVDQLVFLHKNL 591          
BLAST of zinc finger BED domain-containing protein 4-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001841.1 (pep scaffold:Pmarinus_7.0:GL477152:41279:42850:-1 gene:ENSPMAG00000001672.1 transcript:ENSPMAT00000001841.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 238.424 bits (607), Expect = 1.046e-69
Identity = 153/500 (30.60%), Postives = 257/500 (51.40%), Query Frame = 1
Query:  904 NKTIAEFMALDVQPFSVVDNVGFRRIIAKAEP----RYTIPSSRYFSSTLIPAMHEKIQNKVREMVSSQPSTSLTSDAWSDPSISVALLSLTAHWVTEDFQRKQAILAASPIEESHTGDYLGGMLLKILGDYTIEKSAVHVLLRDSGANMIKASRVADIDSISCFAHTLQLVINDSIMSQRSVKDILAISRSNVGKFRHSVLAQQHLSDLQGSLGVPKKKLVQDVQTRWNATLAMLRSLVEQKQVLGAYATEHK-LTNLDAHQWTLISHIIDTLSPFKDATKEVSDSQTSISV----------FLPKHTMSEGIMTMRQDILTSLNKRFAHTKENRKMVLATILDPRFKNFAYDDRELASTAKQWLKNECLILASAERS--EEVVEPPSKRPRVETDQAHPGSSTSRLWDLFSDVVSEPALQTNSSIIGNVNDAVDAMIALYLSSAALPR-TENPYVWWNSNKLLFPYLATLSRRYLSAPASSVPSEQLFSGAWQIFSDR 2349
            ++ I + + +++ P+SVV+   F+R+    +P    RY + S +Y+ +TL+PA ++K+   V  ++      S T+D WS+P+ S +LLS T H++ +   RK  IL+ + +E+ H G YL   L + +  + I +  +HV +RD+ ANM  A R+A +  I C +HTLQLV+ D++ +Q SV+ ++  +R  V   +HS  A +HL + Q ++  P+  L+QDV+TRWN    ML  LVEQ++ +  Y+ +   + +    +W L + ++  L PF  AT E+      ISV           L      +G+  M+  +  ++  RF+        + AT++DP FK+  Y + + A  AK+ + N    L S + S  + +  P +  P    D   PG  +S          SE   Q         +      +  YL    LPR T   Y +W+ ++  +P L   +++YLSAP  SV SEQLFS A Q+++DR
Sbjct:   26 DECIMDLIVVNMLPYSVVEGEAFKRL-KIGDPLGAHRYKVKSEKYYRTTLMPATYDKVVKHVTNLLQEATWISFTTDGWSNPTKSCSLLSFTGHFIHDAVWRK-VILSVTVLEQDHDGKYLASKLCEAMTKWEIAEK-IHVGVRDNAANMKLAMRLAGVADIGCMSHTLQLVLRDALFTQTSVEVVIKKARKIVTHLKHSEQACRHLVEHQQTVKTPEHSLLQDVETRWNGMYLMLERLVEQRKAVNLYSVQRSGIDSFSLAEWELAARVVKILKPFYTATLEICVDDACISVVILLVSNLNNMLNTTAADQGLKQMKATLRDAMCCRFSDISSLAPFLAATLIDPHFKD-TYFNVQKAVAAKKVVLN---FLRSVQESAMKNMTAPSAASP---IDNVEPGLESSE--------TSESGAQEEDDPWAAYDSQPANQLTNYLKELRLPRMTTGIYAYWHCSQ--YPLLEAAAQKYLSAPLISVASEQLFSAAGQLYADR 505          
BLAST of zinc finger BED domain-containing protein 4-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008876.1 (pep scaffold:Pmarinus_7.0:GL476791:39849:44790:1 gene:ENSPMAG00000008036.1 transcript:ENSPMAT00000008876.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 155.606 bits (392), Expect = 6.344e-40
Identity = 157/645 (24.34%), Postives = 275/645 (42.64%), Query Frame = 1
Query:  601 SSIWNYFTVSPLINSKAI-CNLCNVSLSRGGNESKSFTTSNLVQHLRSKHVVAFADFXXXXXXXXXXXXXXXTASIPRPATIEALLDRRQPFEFNDKRALDWNKTIAEFMALDVQPFSVVDNVGFRRIIAKAEPRYTIPSSRYFSSTLIPAMHEKIQNKVREMVSSQPSTSLTSDAWSDPSISVALLSLTAHWVTEDFQRKQAILAASPIEESHTGDYLGGMLLKILGDYTIEKSAVHVLLRDSGANMIKASRVAD----IDSISCFAHTLQLVINDSIMSQRSVKD-ILAISRSNVGKFRHSVLAQQHLSDLQGSLGVPKKKLVQDVQTRWNATLAMLRSLVEQK----QVLGAYAT-----EHKLTNLDAHQWTLISHIIDTLSPFKDAT----KEVSDSQTSISVFLPK--------HTMSEGIMTMRQDILTSLNKRFAHTKENR----------KMVLATILDPRFKNFAYDDRELASTAKQWLKNECLIL----ASAERSEEVVEPPSKRPRVETDQAHPGSSTSRLWDLFSDVVSEPALQTNSSIIG--NVNDAVDAMIALYLSSAALPRTENPYVWWNSNKLLFPYLATLSRRYLSAPASSVPSEQLFSGAWQIFSDRRGSLTAGKGEMLLLLKYNL 2406
            S  W+YFT+  +   K + C  C ++L+      KS T  N  +HL  KH                   K+   +IP+       + RR+  +    RA      + + +  D++P  +V+ V FR  ++  EP Y++PS  YF   L    +E  Q  + E+  +    SL+ D W+  ++  A +S++ H++ ED+Q +  +L ++ + ESHT   +   +   L  + +E + +  ++ D+G NM  A+R+ +       + C AH+LQL++ D  +S+    D  + ++R  V  FR S  A   LS  +    + +  LV D  +RWN T  M+  L+E +     VLG  A         +  +   QW ++  +   L PF  AT     E   S +++ V +          H   +G+  +    +  L +R     E R           ++ A  LDPRF+   +     A   +  +  + +       SA R   VV+P               S   +L+  FSD   +       +++G  ++   V      Y +    PR  NP VWW  N+   PYL+ ++++ L  PA+S P++++FS A   F     SL      M++ L  N+
Sbjct:   18 SKCWDYFTM--MEGRKQVQCKTCLLTLTY----HKSTTMMN--KHLNRKHPNMLPLEDGHRDTTDVRIKKEIKLTIPK-------VRRRRCAQ---DRARSITGLLLQVIVKDLRPLDLVNGVAFREFLSFLEPGYSVPSVVYFEKMLEEKYNEVKQQCIAELKKAS-GLSLSCDVWNSAAVD-AYMSVSVHFIDEDWQLRNFLLESTNVLESHTPIVIRQWIEDALQRFEVEPAKIVSMVHDTGENMSAAARLLEEAYSWKPVQCAAHSLQLIVKDHGISKLPALDRAVDVARQLVEYFRKSEFALSQLSVREKEYNIIECPLVVDTPSRWNTTFDMIDRLLELRVPIAAVLGDMAVMPSWPSAPMELVMPQQWDMLMELKTLLEPFVHATAFLGSETHVSASTVPVLVKGLIRALEAVHYTLDGVEVVDSPHIQQLKERVKWQLEERWKFPTAPHVDFLLYAAALDPRFRGLKFLSGPDADAVRSHVLAKAIDFNRQDPSANRDPSVVKPTIIH----------VSGLDQLFAGFSDFADD----MEVAVVGSSDIEAIVYKEAEQYFNEKQTPRGVNPLVWWRDNQSRLPYLSRVAKQVLCLPATSSPADKIFSTAGLDFMRLCTSLHPSHLNMVIYLNRNM 628          
BLAST of zinc finger BED domain-containing protein 4-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008230.1 (pep scaffold:Pmarinus_7.0:GL479508:145707:147445:-1 gene:ENSPMAG00000007442.1 transcript:ENSPMAT00000008230.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 136.732 bits (343), Expect = 1.259e-35
Identity = 81/252 (32.14%), Postives = 142/252 (56.35%), Query Frame = 1
Query:  904 NKTIAEFMALDVQPFSVVDNVGFRRIIAKAEP----RYTIPSSRYFSSTLIPAMHEKIQNKVREMVSSQPSTSLTSDAWSDPSISVALLSLTAHWVTEDFQRKQAILAASPIEESHTGDYLGGMLLKILGDYTIEKSAVHVLLRDSGANMIKASRVADIDSISCFAHTLQLVINDSIMSQRSVKDILAISRSNVGKFRHSVLAQQHLSDLQGSLGVPKKKLVQDVQTRWNATLAMLRSLVEQKQVLGAYATE 1647
            +K I + + +++ P+SVV+   F+R+    +P    RY + S +Y+ +TL+PA H+K+   V  ++      S  +D     +I  +LLS T H + +   RK  IL+ + +++ H G++    + +           ++V +RD+ ANM  A R+A I  I C +HTLQLV+ D++ +Q SV+ ++  +R  V  F+HS  A +HL + Q ++  P+  L+QDV TRWN+   ML  LVEQ++ +  Y+ +
Sbjct:   84 DKCIMDLIVVNMLPYSVVEGEAFKRL-KIGDPLGAHRYKVKSEKYYRTTLMPA-HDKVVKHVTNLLQEATCISFITDG----AIH-SLLSFTGHIIHDAVWRK-VILSVTVLKQEHDGNHTKWEIAE----------KINVRVRDNAANMKMAMRLAGITDIGCMSHTLQLVLRDALFTQTSVEAVVKKARKIVTHFKHSEQACRHLVEHQQTIKSPEHSLLQDVDTRWNSAYLMLERLVEQRKAVNLYSVQ 317          
BLAST of zinc finger BED domain-containing protein 4-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010575.1 (pep scaffold:Pmarinus_7.0:GL479154:930238:931044:-1 gene:ENSPMAG00000009579.1 transcript:ENSPMAT00000010575.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 64.6994 bits (156), Expect = 8.162e-12
Identity = 25/46 (54.35%), Postives = 33/46 (71.74%), Query Frame = 2
Query:  443 WLTLEICREYMRGECLRDEFSCRYAHPAKNLETQSGRVICCYDYLK 580
            WL LE+CR++ RG C R E  CRYAHP K++    GRVI C+D++K
Sbjct:   16 WLMLEVCRDFQRGTCSRTEDECRYAHPPKHVTAPHGRVIACFDFVK 61          
BLAST of zinc finger BED domain-containing protein 4-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006371.1 (pep scaffold:Pmarinus_7.0:GL477500:192013:216759:1 gene:ENSPMAG00000005739.1 transcript:ENSPMAT00000006371.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 48.9062 bits (115), Expect = 3.099e-6
Identity = 20/45 (44.44%), Postives = 30/45 (66.67%), Query Frame = 2
Query:  452 LEICREYMRGECLRDEFSCRYAHPAKN--LETQSGRVICCYDYLK 580
            LE+CRE+ RG C R E  CR+AHPA++  +++    V  C D++K
Sbjct:  139 LEVCREFQRGNCSRGESECRFAHPAESTAVDSADNTVTVCMDHVK 183          
BLAST of zinc finger BED domain-containing protein 4-like vs. Ensembl Nematostella
Match: EDO38367 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SD65])

HSP 1 Score: 59.6918 bits (143), Expect = 1.384e-9
Identity = 23/46 (50.00%), Postives = 32/46 (69.57%), Query Frame = 2
Query:  443 WLTLEICREYMRGECLRDEFSCRYAHPAKNLETQSGRVICCYDYLK 580
            WL +E+CRE+ RG+C R E  CR+AHP  ++   +GRV  C+D LK
Sbjct:    7 WLQVEVCREFQRGKCSRTEDDCRFAHPPAHVAIHNGRVTACFDSLK 52          

HSP 2 Score: 53.9138 bits (128), Expect = 1.063e-7
Identity = 25/49 (51.02%), Postives = 34/49 (69.39%), Query Frame = 2
Query:  452 LEICREYMRGECLRDEFSCRYAHPAKN--LETQSGRVICCYDYLK-KCR 589
            LE+CREY RG C R+E  CRYAHP ++  ++T  G V  C D++K KC+
Sbjct:  150 LEVCREYQRGACTREESECRYAHPPRHTSIDTSDGMVTVCMDFIKGKCQ 198          
BLAST of zinc finger BED domain-containing protein 4-like vs. Ensembl Medaka
Match: zbed4 (zinc finger BED-type containing 4 [Source:NCBI gene;Acc:101172119])

HSP 1 Score: 219.935 bits (559), Expect = 6.478e-59
Identity = 180/635 (28.35%), Postives = 300/635 (47.24%), Query Frame = 1
Query:  598 TSSIWNYFTVSPLINSKAICNLCNVSLSRGGNESKSFTTSNLVQHLRSKHVVAFADFXXXXXXXXXXXXXXXTASIPRPATIEALLDRRQPFEFNDKR---ALDWNKTIAEFMALDVQPFSVVDNVGFRRIIAKAEPRYTIPSSRYFSSTLIPAMHEKIQNKVREMVSSQPS--TSLTSDAWSDPSISVALLSLTAHWVT---------EDFQRKQAILAASPIEESHTGDYLGGMLLKILGDYTIEKSAVHVLLRDSGANMIKASRVADIDSI-SCFAHTLQLVINDSIMSQRSVKDILAISRSNVGKFRHSVLAQQHLSDLQGSLGVPKKKLVQDVQTRWNATLAMLRSLVEQKQVLGAYATEHKLTN-LDAHQWTLISHIIDTLSPFKDATKEVSDSQTSISVFLPK-HTMSE----------GIMTMRQDILTSLNKRFAHTKENRKMVLATILDPRFKNFAYDDRELASTAKQWLKNECLILASAERSEEVVEPPSKRPRVETDQAHPGSSTSRLWDLFSDVVSEPALQTNSSIIGNVNDAVDAMIALYLSSAALPRTENPYVWWNSNKLLFPYLATLSRRYLSAPASSVPSEQLFSGAWQIFSDRRGSLTAGKGEMLLLLKYNLPQFSF 2421
            TS +WN+F++SP   +K +C  CN ++SRG        T+NL      +H+  F     ES      +A+ +   + +     ++ +  Q  E  D+    A    K +AE +ALD+QP +VV+N G  R++   +P+Y++P S YF+ST IP M+EK+++ V   +          T+  W   S +   L+LTAHW T         +DF    A+L+ S I+       +   L + L D  I  S +      +    I+ +       I  CF HT+ L+++++I SQR V+++L+I+R    +   S  A++ L +LQ +  +P+ +LVQDV ++W  +  ML  LVEQK  +   + E      +   QW ++  + + L PF+ A +E+S+   ++   +P  H +S           GI  M + +  +L  R + T  +++   AT+LDPR+K   + + E A   KQ L  E L  +S+  +E    PP+         +   S+   LW L  D+      +           + +  +  YL    L ++ +P  +WN  K L+P LA ++ RY+  P S VP+E LFS A    +  +        E LL LK NLP   F
Sbjct:  633 TSKLWNHFSISPADPTKVVCLHCNRTISRGKK------TTNLGTSCLFRHMQRFHGHVLESNNAISGDAQDAEIHVKQEVMETSVYETEQNCERFDEEHPVAKKITKLVAEMLALDLQPSAVVENAGLNRLLEYLKPQYSLPPSSYFTSTAIPDMYEKVKDVVLTHLKEAEGGVVHFTTSIWVS-SQTREYLTLTAHWATYESSVRPQGQDFH-CSALLSVSQIDCDQDMHDIPKQL-EYLWDSWITSSGLKRGFTLTDNITIQHTLEEHGHPIMECFGHTIDLIVSEAIKSQRMVQNLLSIARKICERVHRSAKAKEKLVELQRAHQLPENQLVQDVPSKWRTSFFMLERLVEQKNAIDEMSIECNFREIISCDQWEVMLSVCNALKPFEVACREMSNHTATLGQVIPLIHILSRKIDLLFDETVGIDNMLRSLKEALVSRMSATLHDQRYTWATMLDPRYKTSLFTEEE-AEQCKQDLIRE-LDSSSSTSAEAKSLPPNGCSDDPASHSSSHSNVDDLWSLMPDIRQRTKNEEKPK-------SSEEAVLEYLEEDILDQSCDPLDYWNLKKFLWPDLAKVAARYVGCPPSIVPAETLFSTASVNCALNQPRPMLDNIEGLLFLKVNLPLIYF 1249          
BLAST of zinc finger BED domain-containing protein 4-like vs. Ensembl Medaka
Match: ENSORLT00000046033.1 (pep primary_assembly:ASM223467v1:18:700339:706184:1 gene:ENSORLG00000022856.1 transcript:ENSORLT00000046033.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 180.259 bits (456), Expect = 7.942e-48
Identity = 134/513 (26.12%), Postives = 244/513 (47.56%), Query Frame = 1
Query:  898 DWNKTIAEFMALDVQPFSVVDNVGFRRIIAKAEPRYTIPSSRYFSSTLIPAMHEKIQNKVREMVSSQPSTSLTSDAWSDPSISVALLSLTAHWVTEDFQRKQAILAASPIEESHTGDYLGGMLLKILGDYTIEKSAVHVLLRDSGANMIKASRVADIDSISCFAHTLQLVINDSIMSQRSVKDILAISRSNVGKFRHSVLAQQHLSDLQGSLGVPKKKLVQDVQTRWNATLAMLRSLVEQKQVLGAYATE--HKLTNLDAHQWTLISHIIDTLSPFKDATKEVSDSQTSI-SVFLPKHTM-----------SEGIMT--MRQDILTSLNKRFAHTKENRKMVLATILDPRFKNFAYDDRELASTAKQWLKNECLILASAERSEEVVEPPSKRPRVETDQAHPGSSTSRLWDLFSDVVSEPALQTNSSIIGNVNDAVDAMIAL--YLSSAALPRTENPYVWWNSNKLLFPYLATLSRRYLSAPASSVPSEQLFSGAWQIFSDRRGSLTAGKGEM 2382
            D ++ +   +  D QP S+V++ GFR  + K +P Y +PS +     ++   +++ +   +  +    + SLT D W+        L++  H+V E+ +    +L   P  ++H    +      ++ ++ +E   V  L+ D+   M+ A+    +  + C AH L  V+  ++     +K +   +   V  FR S  A++ L   Q  L +P  KLV++  +RW +T  ML+SL++ ++ +G+  T    K+  L   +    +  +  L PF  AT E+S+ +  + S+ +P   M           S+ +    + Q++   L + F   +EN  + LAT+LDPRFK   +  +E A  A Q L  EC  L         V P + RP  E   +        LW    D  S   ++T+S      N   DA + +  Y++   L R+++P V+W  +K ++P+L +L++++L  PASSVP E++FS A  +FS +R  L+    E+
Sbjct:   56 DLDQALVNLVVKDSQPCSIVEDRGFRDFVKKLDPSYALPSKQALKK-MVDDRYQEEKADAQAQLREAEAVSLTVDLWTSADTR---LAVACHYVLENSKLATVLLGVLPFPQNHGPTDVADAQRTLMAEWGLE-GKVKCLVSDTTPAMVAAADDLALPHVECIAHALNGVVRRALDKTAGLKGLRRRAGEVVALFRSSAAAKEKLRSKQQKLALPVTKLVREESSRWTSTFLMLQSLLDARRAVGSALTALGAKVEPLSCDESETSAACLQVLKPFYTATVEMSEQKRVLGSMGIPLVKMLLLATEEVAEESDNVTAELLGQNLSAGLRREFDGLEENPVLSLATLLDPRFKTIGFRCQEKAQQAVQTLTAECAAL---------VRPAADRP-TERPVSTFCPPAFNLWKSLDDQAS--MVRTHS------NATADATLEVQRYMTDPPLERSQDPLVYWKEHKNIYPHLFSLAKKHLCIPASSVPFERVFSKAGDVFSRKRNRLSPKAHEV 545          
BLAST of zinc finger BED domain-containing protein 4-like vs. Ensembl Medaka
Match: ENSORLT00000035819.1 (pep primary_assembly:ASM223467v1:2:6014183:6016710:-1 gene:ENSORLG00000024444.1 transcript:ENSORLT00000035819.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 161.384 bits (407), Expect = 1.157e-41
Identity = 108/409 (26.41%), Postives = 200/409 (48.90%), Query Frame = 1
Query:  589 KQLTSSIWNYFTVSPLINSKAICNLCNVSLSRGGNESKSFTTSNLVQHLRSKHVVAFADFXXXXXXXXXXXXXXXTASIPRPATIEALLDRRQPFEFNDKRALDWNKTIAEFMALDVQPFSVVDNVGFRRIIAKAEPRYTIPSSRYFSSTLIPAMHEKIQNKVREMVSSQPSTSLTSDAWSDPSISVALLSLTAHWVTEDFQRKQAILAASPIEESHTGDYLGGMLLKILGDYTIEKSAVHVLLRDSGANMIKASRV----ADIDSISCFAHTLQLVINDSIMSQRSVKDILAISRSNVGKFRHSVLAQQHLSDLQGSLGVPKKKLVQDVQTRWNATLAMLRSLVEQKQVLGAYATE--------HKLTNLDAHQWTLISHIIDTLSPFKDATKEVSDSQTSISVFLPK 1779
            +Q  S +W+++T++   N K  C  C + L+         +TS+++QHL  +H + +A     ++      +  S   + RPA    +           + A  + ++I   +  D++P S+V++ GFR +I+    +Y++PS  YF+  L+   H  I +K++ ++      +LT+D W+  +   A L +T H++ ED++ K   L   P+EE HT   +   L +    + I +  V  ++ D+ AN++ A+R+        S+ C  HTL LV+  ++ + +++   +  +R  V  F+ S LA   L + Q  +G P   L+QDV TRWN+T  ML  L+EQ+  + A  ++        H   +L   QW +   +   L PF+ AT+ +S  +      LP+
Sbjct:   10 RQKLSKVWDHYTLNKDEN-KVQCLYCKIELAYHN------STSSMIQHLNRRHPL-YAVSPSIAETSSSQRSMDSFVRLNRPAQSCTV-----------QEAAIFTESILNMLVTDMRPLSMVEDKGFRDMISTFNSKYSLPSRTYFTQ-LMEKKHRDITDKLKAVLKQTECVALTTDIWTSVATE-AYLGVTCHFLGEDWEMKSLSLTTMPLEERHTAANIADWLEETTAQFEIPREKVKAVVHDNRANVVAAARILTERHGWASVRCAGHTLNLVVQSTLKNNKTIASCVGSARCLVEHFKKSELACTKLKEKQQQMGKPLHMLIQDVSTRWNSTYHMLSRLLEQRWPVTAVLSDPAVNPRGKHHYLDLKPEQWHISEELTQILGPFEGATEFLSGEKYVTLSALPQ 397          

HSP 2 Score: 66.2402 bits (160), Expect = 9.311e-11
Identity = 32/66 (48.48%), Postives = 41/66 (62.12%), Query Frame = 1
Query: 2206 ENPYVWWNSNKLLFPYLATLSRRYLSAPASSVPSEQLFSGAWQIFSDRRGSLTAGKGEMLLLLKYN 2403
            ENP  WW  N+  +P LA L++ +L  PA+S PSE+LFS A  I S RR SL+A   +ML  L  N
Sbjct:  455 ENPLPWWRINEARYPTLAQLAKSFLGIPATSTPSERLFSAAGNIASKRRASLSAQHVDMLTFLHCN 520          
BLAST of zinc finger BED domain-containing protein 4-like vs. Ensembl Medaka
Match: ENSORLT00000037653.1 (pep primary_assembly:ASM223467v1:21:546436:551984:-1 gene:ENSORLG00000024821.1 transcript:ENSORLT00000037653.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 142.124 bits (357), Expect = 8.982e-35
Identity = 142/631 (22.50%), Postives = 266/631 (42.16%), Query Frame = 1
Query:  601 SSIWNYFTVS------PLINSKAICNLC--NVSLSRGGNESKSFTTSNLVQHLRSKHVVAFADFXXXXXXXXXXXXXXXTASIPRPATIEALLDRRQPFEFNDKRALDWNKTIAEFMALDVQPFSVVDNVGFRRIIAKAEPRYTIPSSRYFSSTLIPAMHEKIQNKVREMVSSQPSTSLTSDAWSDPSISVALLSLTAHWVTEDFQRKQAILAASPIEESHTGDYLGGMLLKILGDYTIEKSAVHVLLRDSGANMIKASRVADIDSISCFAHTLQLVINDSIMSQRS-VKDILAISRSNVGKFRHSVLAQQHLSDLQGSLGVPKKKLVQDVQTRWNATLAMLRSLVEQKQVLGAYATEHKLTNLDAHQWTLISHIIDTLSPFKDATKEVSDSQTSIS--------------------VFLPKHTMSEGIMTMRQDILTSLNKRFAHTKENRKMVLATILDPRFKNFAYDDRELASTAKQWLKNECLILASAERSEEVVEPPSKRPRVETDQAHPGSSTSRLWDLFSDVVSEPALQTNSSIIGNVNDAVDAMIALYLSSAALPRTENPYVWWNSNKLLFPYLATLSRRYLSAPASSVPSEQLFSGAWQIFSDRRGSLTAGKGEMLLLLKYNL 2406
            S IW +F         P+   KAIC +C   VS+SRG        T+NL  HLR  H VAFA   + S           T+   R   +     R   ++    R      ++  ++  ++ PF  V+   F+ ++ + + +Y +P  +YFS T IP  +  +++ V + +      S+T+D WS  + ++  +SLT H+++ +++ K   L      ESHT D L   L     ++++++  +  +  D+GAN++ A R      ++CF H L L + +S+ +++      + + R+ V  F  S   ++ L   Q    +P+  LV  V   W     M+  ++EQ   +     + + +      W      I+ L     A K+V+D   ++S                    + LP +  +E    ++Q ++  L  +++     + +  A+ +DPR K         A T  Q    + L+       EE++  P +R  +   +A   ++ +      S   S P  +  + ++G         + + + +                   FP L+ ++R+YL+  A+S PSE++FS A  I +  R SL   K  ML+ L  N+
Sbjct:   31 SDIWAHFGFEADDKGQPVNLDKAICRICRTEVSVSRGN-------TTNLRSHLRINHPVAFAGLGRTSSRPS-------TSGQQRQLGVSEAFARGAKYQSGSNRWRALTDSVTRYLVEEMVPFRTVEKPAFKAMLHEFDKQYVLPDRKYFSQTAIPEKYLSVKDGVIQELKYVDYFSVTADMWSSVN-NMPYMSLTIHYLSANWELKSKCLETVFTPESHTADNLAEALRSSFEEWSLDERKLICITTDNGANIVAAVRKLGWTWLNCFGHNLHLAVTNSMKTEKDRTARAMGVCRNLVTAFSQSWQKKKKLQKEQVEHNLPQHGLVL-VSCAWGTKQKMVARILEQIPAIRRVLMDDRRSQHLIPTW----QDIEVLESINAALKKVADFTDALSSEKTVTASSVLPVLQLLTEDILLPTNEDTELTRNIKQKMIEVLKDKYSAPGSQQLLAKASFIDPRHK---------ADTNSQHDTKDALL-------EEMLAMPEERRHIGGGEAAMSAAAAGEGKGESASSSPPKKKKLADLLGKRRAQSSNPVPIRICAR------------------FPLLSKVARKYLTVCATSTPSERVFSAAGNIVTPLRSSLKPDKVNMLVFLSRNM 607          
BLAST of zinc finger BED domain-containing protein 4-like vs. Ensembl Medaka
Match: ENSORLT00000045677.1 (pep primary_assembly:ASM223467v1:19:24251509:24253748:-1 gene:ENSORLG00000025620.1 transcript:ENSORLT00000045677.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 138.272 bits (347), Expect = 8.314e-34
Identity = 165/613 (26.92%), Postives = 252/613 (41.11%), Query Frame = 1
Query:  640 NSKAICNLCNVSLSRGGNESKSF----TTSNLVQHLRSKHVVAFADFXXXXXXXXXXXXXXXTASIPRPATIEALLDRRQPFEFNDKRALDWNKTIAEFMALDVQPFSVVDNVGFRRI--IAKAEPRYTIPSSRYFSSTLIPAMHEKIQNKVREMVSSQPSTSLTSDAWSDPSISVALLSLTAHWVTEDFQRKQAILAASPIEESHTGDYLGGMLLKILGDYTIEKSAVHVLLRDSGANMIKASRVADIDSISCFAHTLQLVINDSIMSQRSVKDILAISRSNVGKFRHSVLAQQHLSDLQGSLGVPKKKLVQDVQTRWNATLAMLRSLVEQKQVLGAY--ATEHKLTNLDAHQWTLISHIIDTLSPFKDATKEVS-DSQTSISVFLPKHTMSEGIMTMRQD-------ILTSLNKRFAHTKE---NRKMVLATILDPRFKNFAY---DDRELASTAKQWLKNECLILASAERSEEVVEPPSKRPRVETDQAHPGSSTSRLWDLFSDVVSEPALQTNSSIIGNVNDAVDAMIALYLSSAALPRTENPYVWWNSNKLLFPYLATLSRRYLSAPASSVPSEQLFSGAWQIFSDRRGSLTAGKGEMLLLLKYNLPQ 2412
              K IC +CN          K F    + S+L  H+ +KH  AFA                 +AS  R  T    L+ R+P   +    L    TIA+++A D +P S+V++ GF  +  +A  +  Y  P SR    T I A++E  + K +E+++     +LT D  +  S +   L +TAH++++ ++ K   L     EE H  +   G  L +   + IE      +  +S  NM+ A R+   + ++C AH          M QR V   LA S                      SLG  ++ L+QDV TRWN+ L M++ +   K+ + A     EHKL    A +W  +  +   L P +  T+ +  ++  S SV LP        M    +         T   +  A  +E   N  + +AT+LDPRFK+       DRE   T                  E +++  S R   +T    P      L  + SD  SE              D V   I  Y +   +   E P  WW S+      LATL+ +YL+ PA++VP E+LFS A  I   ++ S T  K E     K +LPQ
Sbjct:   25 KCKVICKICN----------KEFQFHRSCSSLRYHVNAKH--AFAG-------------PSGSASGLRQTT----LNVRRPLTKSTSDHL--TNTIAKWIAKDCRPISIVEDSGFLDVLQVASQDSSYK-PPSRATVMTKIHALYESEKEKRKEVLAQVNYIALTGDHMTSVS-NDNYLGVTAHFISDTWELKSFALTILKTEERHFVEACKGQFLSVARKWDIEGKTT-TIGTESARNMVAAIRLTRYEHMNCVAH----------MVQRCVTVSLADS---------------------VSLGKKQEPLIQDVPTRWNSALEMVKRVSRNKEAVIAALDNQEHKLILPTAAEWDKLQRLETLLEPCRYVTELLGGEAYVSCSVVLPSLCHLRLKMEACDENPAYVVRFKTKFKEDLASRQEQLNNAWLQIATVLDPRFKDLKCLPKTDREAVWTT----------------LEGMLQQESPRKSSQTHDDGPPRKKISLLQMGSDSESE-------------EDEVQPAIQRYRAEPTIKLEECPLRWWASHSGAHEKLATLAHKYLATPATTVPCERLFSVAGHIVIKKKVSFTFRKCE-----KVSLPQ 538          
BLAST of zinc finger BED domain-containing protein 4-like vs. Planmine SMEST
Match: SMESG000045018.1 (SMESG000045018.1)

HSP 1 Score: 1040.02 bits (2688), Expect = 0.000e+0
Identity = 527/556 (94.78%), Postives = 535/556 (96.22%), Query Frame = 1
Query:  580 EMSKQLTSSIWNYFTVSPLINSKAICNLCNVSLSRGGNESKSFTTSNLVQHLRSKHVVAFADFXXXXXXXXXXXXXXXTASIPRPATIEALLDRRQPFEFNDKRALDWNKTIAEFMALDVQPFSVVDNVGFRRIIAKAEPRYTIPSSRYFSSTLIPAMHEKIQNKVREMVSSQPSTSLTSDAWSDPSISVALLSLTAHWVTEDFQRKQAILAASPIEESHTGDYLGGMLLKILGDYTIEKSAVHVLLRDSGANMIKASRVADIDSISCFAHTLQLVINDSIMSQRSVKDILAISRSNVGKFRHSVLAQQHLSDLQGSLGVPKKKLVQDVQTRWNATLAMLRSLVEQKQVLGAYATEHKLTNLDAHQWTLISHIIDTLSPFKDATKEVSDSQTSISVFLP-----------KHTMSEGIMTMRQDILTSLNKRFAHTKENRKMVLATILDPRFKNFAYDDRELASTAKQWLKNECLILASAERSEEVVEPPSKRPRVETDQAHPGSSTSRLWDLFSDVVSEPALQTNSSIIGNVNDAVDAMIALYLSSAALPRTENP 2214
            +MSKQLTSSIWNYFT SPLINSKAICNLCNVSLSRGGNESKSFTTSNLVQHLRSKHVVAF+DFQKESKEKQEAEAKQSTASIPRPATIEALLDRRQPFEFNDKRA DWNKTIAEFMALDVQPFSVVD+VGFRRIIAKAEPRYTIPSSRYFSSTLIPAMHEKIQNKVREMVSSQPS S TSDAWSDPSISVALLSLTAHWVTEDFQRKQAILAASPIEESHTGDYLGGMLLKILGDYTIEKSAVHVLLRDSGANMIKASRVADIDSISCFAHTLQLVINDSIMSQRSVKDILAISRS VGKFRHSVLAQQHLSDLQ SLGVPKKKLVQDVQTRWNATLAMLRSLV++KQVLGAYATEHKLTNLDAHQWTLISHIIDTLSPF+DATKEVSDSQTSIS+ LP           KHTMSEGIMTMRQD+LTSLNKRFAHT ENRKMVLATILDPRFKNFAYDD ELASTAKQWLKNECLILASAERSEEVVEPPSKRPRVETDQ HPGSSTSRLWDLFSDVVSEPALQTNSSIIGNVNDAVDAMIALYLSSAALPRTENP
Sbjct:   40 KMSKQLTSSIWNYFTDSPLINSKAICNLCNVSLSRGGNESKSFTTSNLVQHLRSKHVVAFSDFQKESKEKQEAEAKQSTASIPRPATIEALLDRRQPFEFNDKRAFDWNKTIAEFMALDVQPFSVVDSVGFRRIIAKAEPRYTIPSSRYFSSTLIPAMHEKIQNKVREMVSSQPSVSFTSDAWSDPSISVALLSLTAHWVTEDFQRKQAILAASPIEESHTGDYLGGMLLKILGDYTIEKSAVHVLLRDSGANMIKASRVADIDSISCFAHTLQLVINDSIMSQRSVKDILAISRSIVGKFRHSVLAQQHLSDLQTSLGVPKKKLVQDVQTRWNATLAMLRSLVDRKQVLGAYATEHKLTNLDAHQWTLISHIIDTLSPFEDATKEVSDSQTSISLVLPMLSMLRRLLDRKHTMSEGIMTMRQDMLTSLNKRFAHTTENRKMVLATILDPRFKNFAYDDGELASTAKQWLKNECLILASAERSEEVVEPPSKRPRVETDQTHPGSSTSRLWDLFSDVVSEPALQTNSSIIGNVNDAVDAMIALYLSSAALPRTENP 595          
BLAST of zinc finger BED domain-containing protein 4-like vs. Planmine SMEST
Match: SMESG000034450.1 (SMESG000034450.1)

HSP 1 Score: 924.465 bits (2388), Expect = 0.000e+0
Identity = 486/579 (83.94%), Postives = 499/579 (86.18%), Query Frame = 1
Query:  583 MSKQLTSSIWNYFTVSPLINSKAICNLCNVSLSRGGNESKSFTTSNLVQHLRSKHVVAFADFXXXXXXXXXXXXXXXTASIPRPATIEALLDRRQPFEFNDKRALDWNKTIAEFMALDVQPFSVVDNVGFRRIIAKAEPRYTIPSSRYFSSTLIPAMHEKIQNKVREMVSSQPSTSLTSDAWSDPSISVALLSLTAHWVTEDFQRKQAILAASPIEESHTGDYLGGMLLKILGDYTIEKSAVHVLLRDSGANMIKASRVADIDSISCFAHTLQLVINDSIMSQRSVKDILAISRSNVGKFRHSVLAQQHLSDLQGSLGVPKKKLVQDVQTRWNATLAMLRSLVEQKQVLGAYATEHKLTNLDAHQWTLISHIIDTLSPFKDATKEVSDSQTSISVFLP-----------KHTMSEGIMTMRQDILTSLNKRFAHTKENRKMVLATILDPRFKNFAYDDRELASTAKQWLKNECLILASAERSEEVVEPPSKRPRVETDQAHPGSSTSRLWDLFSDVVSEPALQTNSSIIGNVNDAVDAMIALYLSSAALPRTENPYVWWNSN----KLLFPYLATLSRR 2274
            MSKQLTSSIWNYFTVSPLINSKAICNLCNVSLS+GGNESKSFTTSNLVQHLRSKHVVAFADFQKESKEKQEAEAKQSTASIPR ATIEALLD RQPFEFNDKRALDWNK IAEFMALDVQPFSVVDNVGFRRIIAKAEPRYTIPSSRYFSSTLIP MHEKIQNKVREMVSSQPS S TSDAWSDPSISVA LSLTAHW                  ESHTGDYLGGMLLKILGDYTIEKSAVHVLLRDSGANMIK SRV DI SISCFAHTLQLVINDSIMSQRSVK+ILAISRS VGKFRHSVLAQQ+LSDLQGSLGVPKKKLVQDVQTRWNATLAMLRSLVEQKQVLGAYATEH+L NLDAHQWTLISHIIDTLSPF+DATK+VSDSQTSISV LP           KHTMS+GIMTMRQD+LTSLNKRFAHTKENRKM                   LASTA QWL NECLILASAERSEEVVEP SKRPRVETD AHPGSSTSRLWDLFSDVVSEPALQTNSSIIGNVNDAVDAMI +YLSSAALPRTENPY+   +N      LFP +    +R
Sbjct:    1 MSKQLTSSIWNYFTVSPLINSKAICNLCNVSLSQGGNESKSFTTSNLVQHLRSKHVVAFADFQKESKEKQEAEAKQSTASIPRHATIEALLDSRQPFEFNDKRALDWNKIIAEFMALDVQPFSVVDNVGFRRIIAKAEPRYTIPSSRYFSSTLIPVMHEKIQNKVREMVSSQPSVSFTSDAWSDPSISVAFLSLTAHW------------------ESHTGDYLGGMLLKILGDYTIEKSAVHVLLRDSGANMIKESRVVDIHSISCFAHTLQLVINDSIMSQRSVKNILAISRSIVGKFRHSVLAQQYLSDLQGSLGVPKKKLVQDVQTRWNATLAMLRSLVEQKQVLGAYATEHELKNLDAHQWTLISHIIDTLSPFEDATKKVSDSQTSISVVLPMLSMLRRLLDRKHTMSKGIMTMRQDMLTSLNKRFAHTKENRKM-------------------LASTANQWLNNECLILASAERSEEVVEPSSKRPRVETDPAHPGSSTSRLWDLFSDVVSEPALQTNSSIIGNVNDAVDAMIPVYLSSAALPRTENPYMTSPNNIPRIPRLFPSIVATRQR 542          
BLAST of zinc finger BED domain-containing protein 4-like vs. Planmine SMEST
Match: SMESG000023965.1 (SMESG000023965.1)

HSP 1 Score: 144.821 bits (364), Expect = 4.218e-38
Identity = 99/101 (98.02%), Postives = 99/101 (98.02%), Query Frame = 2
Query:  290 MIPFNSSSVLLNIAQTXXXXXXXXXXXXXINFNSIPVXXXXXXXXXXXXXEWLTLEICREYMRGECLRDEFSCRYAHPAKNLETQSGRVICCYDYLK-KCR 589
            MIPFNSSSVLLNIAQTNSSSSACNSKRNSINFNSIPVKPKSNSFSSSKDSEWLTLEICREYMRGECLRDEFSCRYAHPAKNLETQSGRVICCYDYLK KC 
Sbjct:    1 MIPFNSSSVLLNIAQTNSSSSACNSKRNSINFNSIPVKPKSNSFSSSKDSEWLTLEICREYMRGECLRDEFSCRYAHPAKNLETQSGRVICCYDYLKGKCH 101          
BLAST of zinc finger BED domain-containing protein 4-like vs. Planmine SMEST
Match: SMESG000007132.1 (SMESG000007132.1)

HSP 1 Score: 73.559 bits (179), Expect = 2.496e-15
Identity = 39/105 (37.14%), Postives = 63/105 (60.00%), Query Frame = 1
Query: 1225 IEESHTGDYLGGMLLKILGDYTIEKSAVHVLLRDSGANMIKASRVADIDSISCFAHTLQLVINDSIMS--QRSVKDILAISRSNVGKFRHSVLAQQHLSDLQGSL 1533
            ++ SH+G  +G  L +IL ++ I      +++ D+GA+M  A+R+     + C+ HT+QLV+ND + S  Q SV D +A++RS  G  RHS  A + L  +Q SL
Sbjct:    1 MQGSHSGQLIGSHLQEILREWNINDDRKGIIVSDNGASMKAAARLGGFQYLGCYIHTIQLVVNDELKSSTQSSVADTIAVARSIAGHLRHSTQATEALRKIQVSL 105          
BLAST of zinc finger BED domain-containing protein 4-like vs. Planmine SMEST
Match: SMESG000073369.1 (SMESG000073369.1)

HSP 1 Score: 73.9442 bits (180), Expect = 1.466e-13
Identity = 30/50 (60.00%), Postives = 39/50 (78.00%), Query Frame = 2
Query:  440 EWLTLEICREYMRGECLRDEFSCRYAHPAKNLETQSGRVICCYDYLK-KC 586
            +WLTLE+CRE+ R  C R+E  C+YAHP   +ETQ+GRV+CCYD +K KC
Sbjct:   38 QWLTLEVCREFQRSMCPRNELECKYAHPPPYIETQNGRVMCCYDSIKGKC 87          
The following BLAST results are available for this feature:
BLAST of zinc finger BED domain-containing protein 4-like vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ZBED44.153e-6328.30zinc finger BED-type containing 4 [Source:HGNC Sym... [more]
ZBED62.118e-3926.42zinc finger BED-type containing 6 [Source:HGNC Sym... [more]
ZBED12.984e-3623.30zinc finger BED-type containing 1 [Source:HGNC Sym... [more]
ZBED12.984e-3623.30zinc finger BED-type containing 1 [Source:HGNC Sym... [more]
ZBED12.984e-3623.30zinc finger BED-type containing 1 [Source:HGNC Sym... [more]
back to top
BLAST of zinc finger BED domain-containing protein 4-like vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
C10A4.12.019e-2921.90pep chromosome:WBcel235:X:7415839:7418627:1 gene:W... [more]
K09A11.14.298e-2820.81pep chromosome:WBcel235:X:13262495:13264589:1 gene... [more]
mbl-14.895e-1250.00Muscleblind-like protein [Source:UniProtKB/Swiss-... [more]
mbl-14.895e-1250.00Muscleblind-like protein [Source:UniProtKB/Swiss-... [more]
mbl-14.895e-1250.00Muscleblind-like protein [Source:UniProtKB/Swiss-... [more]
back to top
BLAST of zinc finger BED domain-containing protein 4-like vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG137755.768e-4325.04gene:FBgn0031874 transcript:FBtr0343775[more]
CG137755.768e-4325.04gene:FBgn0031874 transcript:FBtr0079363[more]
CG137751.505e-3724.18gene:FBgn0031874 transcript:FBtr0343776[more]
mbl9.940e-1150.00gene:FBgn0265487 transcript:FBtr0086991[more]
mbl1.390e-1050.00gene:FBgn0265487 transcript:FBtr0086994[more]
back to top
BLAST of zinc finger BED domain-containing protein 4-like vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zbed42.279e-5727.75zinc finger, BED-type containing 4 [Source:ZFIN;Ac... [more]
zbed42.279e-5727.75zinc finger, BED-type containing 4 [Source:ZFIN;Ac... [more]
zbed42.279e-5727.75zinc finger, BED-type containing 4 [Source:ZFIN;Ac... [more]
si:dkey-109j17.51.847e-2822.49si:dkey-109j17.5 [Source:ZFIN;Acc:ZDB-GENE-090313-... [more]
si:dkey-13n23.31.939e-2625.16si:dkey-13n23.3 [Source:ZFIN;Acc:ZDB-GENE-120214-4... [more]
back to top
BLAST of zinc finger BED domain-containing protein 4-like vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ZBED43.975e-6427.72zinc finger, BED-type containing 4 [Source:NCBI ge... [more]
far11.523e-4826.98fatty acyl-CoA reductase 1 [Source:Xenbase;Acc:XB-... [more]
ENSXETT00000038245.12.318e-3523.44zinc finger BED domain-containing protein 1-like [... [more]
ENSXETT00000026109.12.976e-3523.44zinc finger BED domain-containing protein 1-like [... [more]
ZBED11.996e-3222.69zinc finger BED domain-containing protein 1-like [... [more]
back to top
BLAST of zinc finger BED domain-containing protein 4-like vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Zbed48.888e-6528.83zinc finger, BED type containing 4 [Source:MGI Sym... [more]
Gm383947.873e-4026.38predicted gene, 38394 [Source:MGI Symbol;Acc:MGI:5... [more]
Mbnl12.242e-1253.19muscleblind like splicing factor 1 [Source:MGI Sym... [more]
Mbnl11.936e-1153.19muscleblind like splicing factor 1 [Source:MGI Sym... [more]
Mbnl12.220e-1153.19muscleblind like splicing factor 1 [Source:MGI Sym... [more]
back to top
BLAST of zinc finger BED domain-containing protein 4-like vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q80WQ9|ZBED4_MOUSE6.217e-6428.83Zinc finger BED domain-containing protein 4 OS=Mus... [more]
sp|O75132|ZBED4_HUMAN1.995e-6228.30Zinc finger BED domain-containing protein 4 OS=Hom... [more]
sp|D2EAC2|ZBED6_MOUSE5.507e-3926.38Zinc finger BED domain-containing protein 6 OS=Mus... [more]
sp|P86452|ZBED6_HUMAN1.017e-3826.42Zinc finger BED domain-containing protein 6 OS=Hom... [more]
sp|O96006|ZBED1_HUMAN1.433e-3523.30Zinc finger BED domain-containing protein 1 OS=Hom... [more]
back to top
BLAST of zinc finger BED domain-containing protein 4-like vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A498LRH32.734e-13037.95Zinc finger BED domain-containing 4-like protein O... [more]
A0A1X7TWE01.431e-12337.68BED-type domain-containing protein OS=Amphimedon q... [more]
A0A3P8Q7N84.480e-12336.32BED-type domain-containing protein OS=Astatotilapi... [more]
A0A498LZ211.897e-12035.68Zinc finger BED domain-containing 4-like protein O... [more]
A0A1A8RA881.208e-11934.85Zinc finger, BED domain containing 4 OS=Nothobranc... [more]
back to top
BLAST of zinc finger BED domain-containing protein 4-like vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000036437.15.331e-6726.58pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
zbed42.396e-6129.63zinc finger BED-type containing 4 [Source:NCBI gen... [more]
ENSAMXT00000045953.17.905e-6126.12zinc finger BED domain-containing protein 1-like [... [more]
ENSAMXT00000030725.11.076e-6028.40pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000030135.17.346e-5527.36zinc finger BED domain-containing protein 1-like [... [more]
back to top
BLAST of zinc finger BED domain-containing protein 4-like vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000001841.11.046e-6930.60pep scaffold:Pmarinus_7.0:GL477152:41279:42850:-1 ... [more]
ENSPMAT00000008876.16.344e-4024.34pep scaffold:Pmarinus_7.0:GL476791:39849:44790:1 g... [more]
ENSPMAT00000008230.11.259e-3532.14pep scaffold:Pmarinus_7.0:GL479508:145707:147445:-... [more]
ENSPMAT00000010575.18.162e-1254.35pep scaffold:Pmarinus_7.0:GL479154:930238:931044:-... [more]
ENSPMAT00000006371.13.099e-644.44pep scaffold:Pmarinus_7.0:GL477500:192013:216759:1... [more]
back to top
BLAST of zinc finger BED domain-containing protein 4-like vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of zinc finger BED domain-containing protein 4-like vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO383671.384e-950.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of zinc finger BED domain-containing protein 4-like vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zbed46.478e-5928.35zinc finger BED-type containing 4 [Source:NCBI gen... [more]
ENSORLT00000046033.17.942e-4826.12pep primary_assembly:ASM223467v1:18:700339:706184:... [more]
ENSORLT00000035819.11.157e-4126.41pep primary_assembly:ASM223467v1:2:6014183:6016710... [more]
ENSORLT00000037653.18.982e-3522.50pep primary_assembly:ASM223467v1:21:546436:551984:... [more]
ENSORLT00000045677.18.314e-3426.92pep primary_assembly:ASM223467v1:19:24251509:24253... [more]
back to top
BLAST of zinc finger BED domain-containing protein 4-like vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000045018.10.000e+094.78SMESG000045018.1[more]
SMESG000034450.10.000e+083.94SMESG000034450.1[more]
SMESG000023965.14.218e-3898.02SMESG000023965.1[more]
SMESG000007132.12.496e-1537.14SMESG000007132.1[more]
SMESG000073369.11.466e-1360.00SMESG000073369.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30028553 ID=SMED30028553|Name=zinc finger BED domain-containing protein 4-like|organism=Schmidtea mediterranea sexual|type=transcript|length=2602bp
ATTTACTTCACTACTTTGAATCATTTGTATCTAAACTGTCCAAATAATTC
AACTGCATGATCGACTGATCTTATTCTATTAATCTGTTAAAAATCAATAT
TCTATTGTTGATGCAGCAAGAATGGAGATAAAAAATCTAAACATTTACTT
TTATTTTCATCATGCACACACAACGGACAATAATATAAAATGATTTTATT
GGCTGTTCTTTCGACCTATTGGATGATGGCTATCATTGCACAAACACTTA
CTTGATTTGAAAGTTTTGTTCAACTCTATCTGAGCATTAATGATTCCATT
TAACTCAAGTTCTGTTCTTTTAAATATTGCTCAAACCAATTCTTCATCAT
CAGCATGTAATTCAAAACGAAACAGTATTAATTTCAATTCAATTCCAGTC
AAGCCAAAATCAAACAGTTTTTCATCGAGCAAAGATTCAGAATGGTTGAC
TTTGGAAATTTGTCGAGAATATATGCGGGGTGAATGCCTAAGAGATGAGT
TTTCTTGTCGATATGCTCATCCGGCGAAAAACTTAGAAACTCAAAGCGGA
CGAGTGATATGTTGTTATGATTATTTGAAGAAATGTCGAAACAACTGACG
AGCTCCATTTGGAATTATTTCACTGTCAGCCCGCTAATCAATAGTAAAGC
CATTTGCAATCTTTGCAACGTATCTTTGTCTCGAGGTGGTAACGAATCCA
AAAGTTTTACTACATCAAATTTGGTGCAGCACTTGCGAAGCAAACATGTT
GTTGCATTCGCAGACTTCCAAAAAGAGTCGAAAGAAAAACAAGAAGCTGA
AGCTAAACAATCGACAGCTTCAATTCCAAGACCTGCAACCATTGAAGCCC
TCCTAGACAGAAGGCAGCCATTCGAGTTCAATGACAAAAGAGCACTTGAC
TGGAACAAAACCATCGCGGAATTCATGGCACTAGATGTCCAACCATTTTC
TGTAGTTGATAATGTGGGCTTTCGACGGATAATTGCCAAAGCAGAGCCAC
GATACACGATTCCCAGCAGTAGATATTTTTCATCCACTCTCATTCCAGCA
ATGCATGAAAAAATCCAAAACAAGGTTCGTGAGATGGTATCCTCTCAACC
TAGCACCAGTCTCACATCTGATGCATGGTCTGATCCGTCAATTTCCGTTG
CTTTGCTAAGTCTCACTGCACATTGGGTTACGGAAGATTTTCAGAGGAAA
CAGGCTATTCTAGCTGCCTCGCCTATAGAGGAATCGCACACAGGAGATTA
CTTGGGTGGAATGCTTCTAAAAATTCTTGGTGATTACACAATTGAAAAGT
CGGCCGTTCACGTGCTTTTGCGCGACAGTGGTGCTAACATGATTAAGGCA
TCAAGAGTTGCAGATATCGACAGCATTAGCTGCTTTGCACACACTCTGCA
ATTAGTCATCAATGACAGCATAATGTCTCAGAGAAGCGTGAAAGATATAC
TGGCCATTTCACGTTCTAATGTTGGGAAGTTCCGACATTCAGTTCTCGCA
CAGCAACATCTGTCAGATCTACAGGGATCTCTTGGGGTGCCAAAGAAGAA
ACTTGTCCAGGACGTACAAACTCGATGGAATGCAACGCTTGCTATGCTCA
GGTCACTGGTTGAGCAGAAGCAAGTCCTAGGAGCGTATGCTACCGAGCAT
AAACTCACAAATTTGGATGCTCATCAGTGGACACTGATCAGCCATATCAT
CGACACTCTTTCACCATTCAAAGATGCAACAAAAGAGGTGAGTGATTCCC
AGACTTCGATTTCTGTATTTCTTCCCAAGCATACTATGAGCGAAGGAATC
ATGACAATGCGACAAGATATACTCACATCGCTGAATAAGCGTTTTGCACA
TACCAAAGAAAACCGAAAAATGGTATTGGCAACCATACTGGATCCACGTT
TCAAGAATTTTGCTTATGATGATAGAGAGTTGGCTTCGACTGCAAAGCAA
TGGTTGAAAAATGAGTGCTTAATTTTGGCCTCGGCTGAAAGGAGTGAAGA
AGTTGTCGAACCACCGTCTAAAAGACCAAGAGTTGAAACGGATCAGGCCC
ATCCCGGATCATCAACGTCTCGACTTTGGGATTTGTTCTCAGATGTTGTG
AGCGAACCAGCTCTGCAAACAAATTCTTCTATCATCGGTAATGTCAATGA
CGCAGTAGATGCAATGATTGCATTGTACTTGTCATCCGCAGCATTGCCTC
GCACAGAAAACCCGTATGTATGGTGGAATAGCAACAAATTACTTTTTCCA
TACCTAGCCACACTTTCGAGAAGGTATCTATCCGCACCAGCATCTAGCGT
GCCCAGCGAACAGCTTTTTAGCGGTGCTTGGCAGATCTTCTCAGATCGCC
GTGGATCTTTGACAGCTGGAAAAGGAGAAATGCTACTTCTTCTCAAGTAT
AATCTGCCACAGTTTTCGTTCAACTGTTGAATATCAAGACTGGAACTGGG
AATTGCAAAATGTCACGGACACCTTCAAGGTCGAGGAGTTAAAAAATAAA
AATTACAACTTTTAAATTTATTGACAGGCCGTTTAATAGTTAAGTTTGAC
AATAATACATTTTTTTCGAAGTTACATATTATACTTGTTAGCCTATGTTT
TA
back to top

protein sequence of SMED30028553-orf-1

>SMED30028553-orf-1 ID=SMED30028553-orf-1|Name=SMED30028553-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=616bp
MSKQLTSSIWNYFTVSPLINSKAICNLCNVSLSRGGNESKSFTTSNLVQH
LRSKHVVAFADFQKESKEKQEAEAKQSTASIPRPATIEALLDRRQPFEFN
DKRALDWNKTIAEFMALDVQPFSVVDNVGFRRIIAKAEPRYTIPSSRYFS
STLIPAMHEKIQNKVREMVSSQPSTSLTSDAWSDPSISVALLSLTAHWVT
EDFQRKQAILAASPIEESHTGDYLGGMLLKILGDYTIEKSAVHVLLRDSG
ANMIKASRVADIDSISCFAHTLQLVINDSIMSQRSVKDILAISRSNVGKF
RHSVLAQQHLSDLQGSLGVPKKKLVQDVQTRWNATLAMLRSLVEQKQVLG
AYATEHKLTNLDAHQWTLISHIIDTLSPFKDATKEVSDSQTSISVFLPKH
TMSEGIMTMRQDILTSLNKRFAHTKENRKMVLATILDPRFKNFAYDDREL
ASTAKQWLKNECLILASAERSEEVVEPPSKRPRVETDQAHPGSSTSRLWD
LFSDVVSEPALQTNSSIIGNVNDAVDAMIALYLSSAALPRTENPYVWWNS
NKLLFPYLATLSRRYLSAPASSVPSEQLFSGAWQIFSDRRGSLTAGKGEM
LLLLKYNLPQFSFNC*
back to top

protein sequence of SMED30028553-orf-2

>SMED30028553-orf-2 ID=SMED30028553-orf-2|Name=SMED30028553-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=103bp
MIPFNSSSVLLNIAQTNSSSSACNSKRNSINFNSIPVKPKSNSFSSSKDS
EWLTLEICREYMRGECLRDEFSCRYAHPAKNLETQSGRVICCYDYLKKCR
NN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0002142parenchyma
Vocabulary: INTERPRO
TermDefinition
IPR000571Znf_CCCH
IPR003656Znf_BED
IPR008906HATC_C_dom
IPR012337RNaseH-like_sf
Vocabulary: molecular function
TermDefinition
GO:0046872metal ion binding
GO:0003677DNA binding
GO:0046983protein dimerization activity
GO:0003676nucleic acid binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR008906HAT, C-terminal dimerisation domainPFAMPF05699Dimer_Tnp_hATcoord: 280..326
e-value: 3.7E-7
score: 29.8
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 222..243
NoneNo IPR availablePANTHERPTHR46481FAMILY NOT NAMEDcoord: 3..326
IPR012337Ribonuclease H-like superfamilySUPERFAMILYSSF53098Ribonuclease H-likecoord: 12..324