ARMC1

Overview
NameARMC1 (AFD29626.1)
Smed IDSMED30028549
Length (bp)1065
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of ARMC1 (SMED30028549) t-SNE clustered cells

Violin plots show distribution of expression levels for ARMC1 (SMED30028549) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of ARMC1 (SMED30028549) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for ARMC1 (SMED30028549) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30028549

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30028549SMESG000075605.1 SmedASXL_009067SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30028549SMESG000075605.1 SmedASXL_009067SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
neoblastSMED30028549SMESG000075605.1 dd_Smed_v4_11494_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30028549SMESG000075605.1 dd_Smed_v6_11494_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
zeta neoblastSMED30028549SMESG000075605.1 dd_Smed_v4_11494_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30028549SMESG000075605.1 SMED_06686_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30028549SMESG000075605.1 SMED_06686_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30028549SMESG000075605.1 SMED30028549smed_20140614PMID:22385657
Wagner et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of ARMC1 vs. Ensembl Human
Match: ARMC1 (armadillo repeat containing 1 [Source:HGNC Symbol;Acc:HGNC:17684])

HSP 1 Score: 69.3218 bits (168), Expect = 8.676e-13
Identity = 54/229 (23.58%), Postives = 104/229 (45.41%), Query Frame = 1
Query:   79 VQDLKIMSLNPLSARLLGQDFTCIGGLILLLSSDQEKVILDILEIFHNLIVNENNKQFLREFIGIKQQLECLESRYLSGTVIHMSASKLKNKLYK---ASVKRFTSVIKKEPKIKDSFKIKNSR--NFIIELNGLTDMETVEEIKNNLINLEGVMSITFQLKIKRVIVKVNSSVSEQDILEAISDVSENIIGEVISSYKN------FNDTTIKNESIISIPDYLPEPSS 732
            V  L+ ++ +PL+ R + QD  C+ GLIL +      V+   L     L     N++ ++  +G+   L+ +  +  +     + AS++ + L     A    F  +  +  K +      N R    ++ ++GL D       +  L+ ++GV+S TFQ+ ++R +V++ S +  + +  AI+        +V+ S         F DT ++ E    +PDYLPE  S
Sbjct:   18 VNQLRDLAADPLNRRAIVQDQGCLPGLILFMDHPNPPVVHSALLALRYLAECRANREKMKGELGMMLSLQNVIQKTTTPGETKLLASEIYDILQSSNMADGDSFNEMNSRRRKAQFFLGTTNKRAKTVVLHIDGLDDTSRRNLCEEALLKIKGVISFTFQMAVQRCVVRIRSDLKAEALASAIASTKVMKAQQVVKSESGEEMLVPFQDTPVEVEQNTELPDYLPEDES 246          
BLAST of ARMC1 vs. Ensembl Human
Match: ARMC1 (armadillo repeat containing 1 [Source:HGNC Symbol;Acc:HGNC:17684])

HSP 1 Score: 50.8322 bits (120), Expect = 5.439e-7
Identity = 38/172 (22.09%), Postives = 82/172 (47.67%), Query Frame = 1
Query:   79 VQDLKIMSLNPLSARLLGQDFTCIGGLILLLSSDQEKVILDILEIFHNLIVNENNKQFLREFIGIKQQLECLESRYLSGTVIHMSASKLKNKLYKASVK---RFTSVIKKEPKIKDSFKIKNSR--NFIIELNGLTDMETVEEIKNNLINLEGVMSITFQLKIKRVIVKVNS 579
            V  L+ ++ +PL+ R + QD  C+ GLIL +      V+   L     L     N++ ++  +G+   L+ +  +  +     + AS++ + L  +++     F  +  +  K +      N R    ++ ++GL D       +  L+ ++GV+S TFQ+ ++R +V++ S
Sbjct:   18 VNQLRDLAADPLNRRAIVQDQGCLPGLILFMDHPNPPVVHSALLALRYLAECRANREKMKGELGMMLSLQNVIQKTTTPGETKLLASEIYDILQSSNMADGDSFNEMNSRRRKAQFFLGTTNKRAKTVVLHIDGLDDTSRRNLCEEALLKIKGVISFTFQMAVQRCVVRIRS 189          
BLAST of ARMC1 vs. Ensembl Human
Match: ARMC1 (armadillo repeat containing 1 [Source:HGNC Symbol;Acc:HGNC:17684])

HSP 1 Score: 48.9062 bits (115), Expect = 2.349e-6
Identity = 24/79 (30.38%), Postives = 43/79 (54.43%), Query Frame = 1
Query:  505 LINLEGVMSITFQLKIKRVIVKVNSSVSEQDILEAISDVSENIIGEVISSYKN------FNDTTIKNESIISIPDYLPE 723
            L+ ++GV+S TFQ+ ++R +V++ S +  + +  AI+        +V+ S         F DT ++ E    +PDYLPE
Sbjct:   63 LLKIKGVISFTFQMAVQRCVVRIRSDLKAEALASAIASTKVMKAQQVVKSESGEEMLVPFQDTPVEVEQNTELPDYLPE 141          
BLAST of ARMC1 vs. Ensembl Zebrafish
Match: armc1 (armadillo repeat containing 1 [Source:ZFIN;Acc:ZDB-GENE-041212-33])

HSP 1 Score: 63.929 bits (154), Expect = 3.976e-11
Identity = 53/241 (21.99%), Postives = 116/241 (48.13%), Query Frame = 1
Query:   79 VQDLKIMSLNPLSARLLGQDFTCIGGLILLLSSDQEKVILDILEIFHNLIVNENNKQFLREFIGIKQQLECLESRYLSGTVIHMSASKLKNKLY-----KASVKRFTSVIKKEPKIKDSFKIKNSRNFIIELNGLTDMETVEEIKNNLINLEGVMSITFQLKIKRVIVKVNSSVSEQDILEAISDV----SENII-----GEVISSYKNFNDTTIKNESIISIPDYLPE---PSSNVAKSV 750
            V  L+ ++ +PL+ R++ +D  C  GLIL L     +V+   L     L     N++ ++  +G+   L+ +  +  S     + AS++   L      +A      +  +++ +       K ++  +++++GL D       +  L+ ++GV+S TFQ+ +KR +V++ S +  + +  AI+      ++ ++      E++  ++  +D  +  E  +++PDYLPE   PS    K+V
Sbjct:   11 VNQLRDLAADPLNRRVIVEDQGCFSGLILFLDHPNPQVVYSALLAVRYLAECRANREKMKGELGMMLSLQNVMQKGTSPGETKLLASEIYEILQNSSSAEAEQAEAGASCRRKAQFFLGATNKRAKTVVLQIDGLDDSSRRSLCEEALLKIKGVISFTFQMAVKRCVVRIRSDLKAEALGTAIASTKVMKAQQVVKGEDGAELVIPFQEDSDVVV--EQNLNLPDYLPEDESPSQEQHKAV 249          
BLAST of ARMC1 vs. Ensembl Zebrafish
Match: armc1 (armadillo repeat containing 1 [Source:ZFIN;Acc:ZDB-GENE-041212-33])

HSP 1 Score: 60.4622 bits (145), Expect = 4.511e-10
Identity = 48/228 (21.05%), Postives = 110/228 (48.25%), Query Frame = 1
Query:   79 VQDLKIMSLNPLSARLLGQDFTCIGGLILLLSSDQEKVILDILEIFHNLIVNENNKQFLREFIGIKQQLECLESRYLSGTVIHMSASKLKNKLY-----KASVKRFTSVIKKEPKIKDSFKIKNSRNFIIELNGLTDMETVEEIKNNLINLEGVMSITFQLKIKRVIVKVNSSVSEQDILEAISDV----SENII-----GEVISSYKNFNDTTIKNESIISIPDYLP 720
            V  L+ ++ +PL+ R++ +D  C  GLIL L     +V+   L     L     N++ ++  +G+   L+ +  +  S     + AS++   L      +A      +  +++ +       K ++  +++++GL D       +  L+ ++GV+S TFQ+ +KR +V++ S +  + +  AI+      ++ ++      E++  ++  +D  +  E  +++PDYLP
Sbjct:   11 VNQLRDLAADPLNRRVIVEDQGCFSGLILFLDHPNPQVVYSALLAVRYLAECRANREKMKGELGMMLSLQNVMQKGTSPGETKLLASEIYEILQNSSSAEAEQAEAGASCRRKAQFFLGATNKRAKTVVLQIDGLDDSSRRSLCEEALLKIKGVISFTFQMAVKRCVVRIRSDLKAEALGTAIASTKVMKAQQVVKGEDGAELVIPFQEDSDVVV--EQNLNLPDYLP 236          
BLAST of ARMC1 vs. Ensembl Zebrafish
Match: armc1l (armadillo repeat containing 1, like [Source:ZFIN;Acc:ZDB-GENE-030131-9819])

HSP 1 Score: 58.151 bits (139), Expect = 3.497e-9
Identity = 66/267 (24.72%), Postives = 117/267 (43.82%), Query Frame = 1
Query:   79 VQDLKIMSLNPLSARLLGQDFTCIGGLILLLSSDQEKVILDILEIFHNLIVNENNKQFLREFIGIKQQLECLESRYLSGTVIHMSASKLKNKLYKASVKRF--TSVIKKEPKIKDSFKI----KNSRNFIIELNGLTDMETVEEIKNNLINLEGVMSITFQLKIKRVIVKVNSSVSEQDILEAISDVSENIIGEVISSYKN------FNDTTIKNESIISIPDYLPEPSSNVAKSVEVPVVSTLSIRSGFGSLLNRFSQAFTD-YLW 840
            V  L+ ++  P +  ++ QD  C+ GL+L L     KV+   L+    L  +  N   +R  +G+   LE L  R    T I   A ++ + L   S +    T   +K+ K K  F I    K +++  + + GL   +     +  L+ ++GV+S TFQ+ +KR  V++ + +  + +  AI+        +V+            + +  K E    +PDYLPE  S   K ++  V  T + +   GS LN  +   T  + W
Sbjct:    8 VTQLRDLASEPQNREVIVQDQGCLPGLVLFLDHKDPKVLFATLQALRYLAESPRNINTMRNELGMMVSLESLIKRTDLTTDITDLAKEVHDLLNAQSQRPGCQTPEQQKKKKNKPQFFINSTNKKAKSVTLHIQGLDGADQRGVCEEALLRVKGVISFTFQMALKRCTVRIRADLPTESLATAIASTKVLSAKQVVKDENGEEVLIPLSTSGSKVEENSHLPDYLPEEESP-EKELDRAVSRTGAKQDAGGSWLNTAASFLTKTFYW 273          
BLAST of ARMC1 vs. Ensembl Xenopus
Match: ppip5k1 (diphosphoinositol pentakisphosphate kinase 1 [Source:Xenbase;Acc:XB-GENE-6258750])

HSP 1 Score: 73.559 bits (179), Expect = 2.698e-14
Identity = 68/274 (24.82%), Postives = 121/274 (44.16%), Query Frame = 1
Query:   79 VQDLKIMSLNPLSARLLGQDFTCIGGLILLLSSDQEKVILDILEIFHNLIVNENNKQFLREFIGIKQQLECLESRY---------------LSGTVIHMSASKLKNKLYKASVKRFTSVIKKEPKIKDSFKIKNSRNFIIELNGLTDMETVEEIKNNLINLEGVMSITFQLKIKRVIVKVNSSVSEQDILEAISDVSENIIGEVISS------YKNFNDTTIKNESIISIPDYLPEPSSNVAKSVEVPVVSTLSIRSGFGSLLNRFSQAFTDYL 837
            V  L+ ++ +PL+   + +D +C+ GLIL LS   E V+   L+    L  +  +   +R  +G+ + LE L++RY               L     HM   +   K             K +P    +   K ++   + ++GL D E     +  L+ ++GV+S TFQ+ ++R  V+V   +  + +  AI++       +VI S      Y   ++  +  E  + +PDYLPE  S   K ++  V+ T S     GS +N    A T++L
Sbjct:    7 VTHLRDLASDPLNRTSIVRDKSCLAGLILFLSHQDEYVVESALKALIYLCEDPAHCGIIRNELGMMESLENLKNRYDIDDEVKQLGRRIQILLNPPAHMHTPETNGK-------------KNKPCFFATSCNKRAKTVTLYIHGLCDAEKKHLCEEALLKVKGVISFTFQIAMQRCTVRVKPDLETECLASAIAETRVLRAQQVIRSESGNEIYVPLHEMNVTVEKNLCLPDYLPEEVSP-QKDLDKAVIPTGSKNDCQGSWIN----AATNFL 262          
BLAST of ARMC1 vs. Ensembl Xenopus
Match: armc1 (armadillo repeat containing 1 [Source:NCBI gene;Acc:493368])

HSP 1 Score: 67.781 bits (164), Expect = 2.540e-12
Identity = 52/229 (22.71%), Postives = 108/229 (47.16%), Query Frame = 1
Query:   79 VQDLKIMSLNPLSARLLGQDFTCIGGLILLLSSDQEKVILDILEIFHNLIVNENNKQFLREFIGIKQQLECLESRYLSGTVIHMSASKLKNKLYKASVKRFTSVIK-KEPKIKDSFKI----KNSRNFIIELNGLTDMETVEEIKNNLINLEGVMSITFQLKIKRVIVKVNSSVSEQDILEAISDVSENIIGEVISSYKN------FNDTTIKNESIISIPDYLPEPSS 732
            V  L+ ++ +PL+ R + QD  C+ GLIL L     +V+   L     L    +N++ +R  +G+   L+ +  +  +     + A+++ + L   S      + +    + K  F +    K ++  ++ ++GL D       ++ L+ ++GV+S TFQ+ ++R +V++ S +  + +  AI+        +V+           F D+ ++ E    +PDYLPE  S
Sbjct:   11 VNQLRDLASDPLNRRAIVQDQGCLPGLILFLDHPNPQVVYSALLALRYLAECLSNREKMRCELGMMLSLQNVIQKTTTPGDTQLLATEVYDLLQGTSTGDGDCMNEMNSRRRKAQFFLGATNKRAKTVVLHIDGLDDTSRRSLCEDALLKIKGVISFTFQMAVQRCVVRIRSDLKAEALASAIASTKVMKAQQVVKGETGEELLVAFQDSPVEVEQNTDLPDYLPEDES 239          
BLAST of ARMC1 vs. Ensembl Xenopus
Match: armc1 (armadillo repeat containing 1 [Source:NCBI gene;Acc:493368])

HSP 1 Score: 67.781 bits (164), Expect = 2.876e-12
Identity = 52/229 (22.71%), Postives = 108/229 (47.16%), Query Frame = 1
Query:   79 VQDLKIMSLNPLSARLLGQDFTCIGGLILLLSSDQEKVILDILEIFHNLIVNENNKQFLREFIGIKQQLECLESRYLSGTVIHMSASKLKNKLYKASVKRFTSVIK-KEPKIKDSFKI----KNSRNFIIELNGLTDMETVEEIKNNLINLEGVMSITFQLKIKRVIVKVNSSVSEQDILEAISDVSENIIGEVISSYKN------FNDTTIKNESIISIPDYLPEPSS 732
            V  L+ ++ +PL+ R + QD  C+ GLIL L     +V+   L     L    +N++ +R  +G+   L+ +  +  +     + A+++ + L   S      + +    + K  F +    K ++  ++ ++GL D       ++ L+ ++GV+S TFQ+ ++R +V++ S +  + +  AI+        +V+           F D+ ++ E    +PDYLPE  S
Sbjct:   13 VNQLRDLASDPLNRRAIVQDQGCLPGLILFLDHPNPQVVYSALLALRYLAECLSNREKMRCELGMMLSLQNVIQKTTTPGDTQLLATEVYDLLQGTSTGDGDCMNEMNSRRRKAQFFLGATNKRAKTVVLHIDGLDDTSRRSLCEDALLKIKGVISFTFQMAVQRCVVRIRSDLKAEALASAIASTKVMKAQQVVKGETGEELLVAFQDSPVEVEQNTDLPDYLPEDES 241          
BLAST of ARMC1 vs. Ensembl Xenopus
Match: ppip5k1 (diphosphoinositol pentakisphosphate kinase 1 [Source:Xenbase;Acc:XB-GENE-6258750])

HSP 1 Score: 64.6994 bits (156), Expect = 2.141e-11
Identity = 64/255 (25.10%), Postives = 115/255 (45.10%), Query Frame = 1
Query:   79 VQDLKIMSLNPLSARLLGQDFTCIGGLILLLSSDQEKVILDILEIFHNLIVNENNKQFLREFIGIKQQLECLESRYLSGTVIHMSASKLKNKLYKASVKRF--TSVIKKEPKIKDSFKIKNSRNFIIELNGLTDMETVEEIKNNLINLEGVMSITFQLKIKRVIVKVNSSVSEQDILEAISDVSENIIGEVISSYKNFNDTTIKNESIISIPDYLPEPSSNVAKSVEVPVVSTLSIRSGFGSLLNRFSQAFTDYL 837
            V  L+ ++ +PL+   + +D +C+ GLIL LS   E V+   L+    L  +  +   +R  +G+ + LE L++RY     +     +++  L   +      T+  K +P    +   K ++   + ++GL D E     +  L+ ++GV+S TFQ+ ++R  V+V   +                  E+       N T  KN   + +PDYLPE  S   K ++  V+ T S     GS +N    A T++L
Sbjct:    7 VTHLRDLASDPLNRTSIVRDKSCLAGLILFLSHQDEYVVESALKALIYLCEDPAHCGIIRNELGMMESLENLKNRYDIDDEVKQLGRRIQILLNPPAHMHTPETNGKKNKPCFFATSCNKRAKTVTLYIHGLCDAEKKHLCEEALLKVKGVISFTFQIAMQRCTVRVKPDLET----------------EIYVPLHEMNVTVEKN---LCLPDYLPEEVSP-QKDLDKAVIPTGSKNDCQGSWIN----AATNFL 237          
BLAST of ARMC1 vs. Ensembl Mouse
Match: Armc1 (armadillo repeat containing 1 [Source:MGI Symbol;Acc:MGI:1921502])

HSP 1 Score: 67.781 bits (164), Expect = 2.400e-12
Identity = 53/229 (23.14%), Postives = 103/229 (44.98%), Query Frame = 1
Query:   79 VQDLKIMSLNPLSARLLGQDFTCIGGLILLLSSDQEKVILDILEIFHNLIVNENNKQFLREFIGIKQQLECLESRYLSGTVIHMSASKLKNKLYK---ASVKRFTSVIKKEPKIKDSFKIKNSR--NFIIELNGLTDMETVEEIKNNLINLEGVMSITFQLKIKRVIVKVNSSVSEQDILEAISDVSENIIGEVISSYKN------FNDTTIKNESIISIPDYLPEPSS 732
            V  L+ ++ +PL+ R + QD  C+ GLIL +      V+   L     L     N++ ++  +G+   L+ +  +  +     + AS++ + L     A    F  +  +  K +      N R    ++ ++GL D       +  L+ ++GV+S TFQ+ ++R +V++ S +  + +  AI+        +V+ S         F D  ++ E    +PDYLPE  S
Sbjct:   18 VNQLRDLAADPLNRRAIVQDQGCLPGLILFMDHPNPPVVHSALLALRYLAECRANREKMKGELGMMLSLQNVIQKTTTPGETKLLASEIYDILQSSNLADGDSFNEMNSRRRKAQFFLGTTNKRAKTVVLHIDGLDDTSRRNLCEEALLKIKGVISFTFQMAVQRCVVRIRSDLKAEALASAIASTKVMKAQQVVKSESGEEMLVPFQDAPVEVEENTELPDYLPEDES 246          
BLAST of ARMC1 vs. UniProt/SwissProt
Match: sp|Q9NVT9|ARMC1_HUMAN (Armadillo repeat-containing protein 1 OS=Homo sapiens OX=9606 GN=ARMC1 PE=1 SV=1)

HSP 1 Score: 69.3218 bits (168), Expect = 4.167e-12
Identity = 54/229 (23.58%), Postives = 104/229 (45.41%), Query Frame = 1
Query:   79 VQDLKIMSLNPLSARLLGQDFTCIGGLILLLSSDQEKVILDILEIFHNLIVNENNKQFLREFIGIKQQLECLESRYLSGTVIHMSASKLKNKLYK---ASVKRFTSVIKKEPKIKDSFKIKNSR--NFIIELNGLTDMETVEEIKNNLINLEGVMSITFQLKIKRVIVKVNSSVSEQDILEAISDVSENIIGEVISSYKN------FNDTTIKNESIISIPDYLPEPSS 732
            V  L+ ++ +PL+ R + QD  C+ GLIL +      V+   L     L     N++ ++  +G+   L+ +  +  +     + AS++ + L     A    F  +  +  K +      N R    ++ ++GL D       +  L+ ++GV+S TFQ+ ++R +V++ S +  + +  AI+        +V+ S         F DT ++ E    +PDYLPE  S
Sbjct:   18 VNQLRDLAADPLNRRAIVQDQGCLPGLILFMDHPNPPVVHSALLALRYLAECRANREKMKGELGMMLSLQNVIQKTTTPGETKLLASEIYDILQSSNMADGDSFNEMNSRRRKAQFFLGTTNKRAKTVVLHIDGLDDTSRRNLCEEALLKIKGVISFTFQMAVQRCVVRIRSDLKAEALASAIASTKVMKAQQVVKSESGEEMLVPFQDTPVEVEQNTELPDYLPEDES 246          
BLAST of ARMC1 vs. UniProt/SwissProt
Match: sp|Q3ZBE1|ARMC1_BOVIN (Armadillo repeat-containing protein 1 OS=Bos taurus OX=9913 GN=ARMC1 PE=2 SV=1)

HSP 1 Score: 69.3218 bits (168), Expect = 4.368e-12
Identity = 54/229 (23.58%), Postives = 104/229 (45.41%), Query Frame = 1
Query:   79 VQDLKIMSLNPLSARLLGQDFTCIGGLILLLSSDQEKVILDILEIFHNLIVNENNKQFLREFIGIKQQLECLESRYLSGTVIHMSASKLKNKLYK---ASVKRFTSVIKKEPKIKDSFKIKNSR--NFIIELNGLTDMETVEEIKNNLINLEGVMSITFQLKIKRVIVKVNSSVSEQDILEAISDVSENIIGEVISSYKN------FNDTTIKNESIISIPDYLPEPSS 732
            V  L+ ++ +PL+ R + QD  C+ GLIL +      V+   L     L     N++ ++  +G+   L+ +  +  +     + AS++ + L     A    F  +  +  K +      N R    ++ ++GL D       +  L+ ++GV+S TFQ+ ++R +V++ S +  + +  AI+        +V+ S         F DT ++ E    +PDYLPE  S
Sbjct:   18 VNQLRDLAADPLNRRAIVQDQGCLPGLILFMDHPNPPVVHSALLALRYLAECRANREKMKGELGMMLSLQNVIQKSTTPGETKLLASEIYDILQSSNMADGDSFNEMNSRRRKAQFFLGTTNKRAKTVVLHIDGLDDTSRRNLCEEALLKIKGVISFTFQMAVQRCVVRIRSDLKAEALASAIASTKVMKAQQVVKSESGEEMLVPFQDTPVEVEQNTELPDYLPEDES 246          
BLAST of ARMC1 vs. UniProt/SwissProt
Match: sp|Q5RCR8|ARMC1_PONAB (Armadillo repeat-containing protein 1 OS=Pongo abelii OX=9601 GN=ARMC1 PE=2 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 1.131e-11
Identity = 54/229 (23.58%), Postives = 104/229 (45.41%), Query Frame = 1
Query:   79 VQDLKIMSLNPLSARLLGQDFTCIGGLILLLSSDQEKVILDILEIFHNLIVNENNKQFLREFIGIKQQLECLESRYLSGTVIHMSASKLKNKLYK---ASVKRFTSVIKKEPKIKDSFKIKNSR--NFIIELNGLTDMETVEEIKNNLINLEGVMSITFQLKIKRVIVKVNSSVSEQDILEAISDVSENIIGEVISSYKN------FNDTTIKNESIISIPDYLPEPSS 732
            V  L+ ++ +PL+ R + QD  C+ GLIL +      V+   L     L     N++ ++  +G+   L+ +  +  +     + AS++ + L     A    F  +  +  K +      N R    ++ ++GL D       +  L+ ++GV+S TFQ+ ++R +V++ S +  + +  AI+        +V+ S         F DT ++ E    +PDYLPE  S
Sbjct:   18 VNQLRDLAADPLNRRAIVQDQGCLPGLILSMDHPNPPVVHSALLALRYLAECRANREKMKGELGMMLSLQNVIQKTTTPGETKLLASEIYDILQSSNMADGDSFNEMNSRRRKAQFFLGTTNKRAKTVVLHIDGLDDTSRRNLCEEALLKIKGVISFTFQMAVQRCVVRIRSDLKAEALASAIASTKVMKAQQVVKSESGEEMLVPFQDTPVEVEQNTELPDYLPEDES 246          
BLAST of ARMC1 vs. UniProt/SwissProt
Match: sp|Q5ZMQ0|ARMC1_CHICK (Armadillo repeat-containing protein 1 OS=Gallus gallus OX=9031 GN=ARMC1 PE=2 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 1.217e-11
Identity = 56/238 (23.53%), Postives = 113/238 (47.48%), Query Frame = 1
Query:   79 VQDLKIMSLNPLSARLLGQDFTCIGGLILLLSSDQEKVILDILEIFHNLIVNENNKQFLREFIGIKQQLECLESRYLSGTVIHMSASKLKNKLYKASVKRFTSVIKKE-PKIKDSFKI----KNSRNFIIELNGLTDMETVEEIKNNLINLEGVMSITFQLKIKRVIVKVNSSVSEQDILEAISDVSENIIGEVISSYKN------FNDTTIKNESIISIPDYLPE---PSSNVAKSV 750
            V  L+ ++ +PL+ R + QD  C+ GLIL L      V+   L     L     N++ ++  +G+   L+ +  +  +     + AS++ + L  +++    +V +    + K  F +    K ++  ++ ++GL D       +  L+ ++GV+S TFQ+ ++R +V++ S +  + +  AI+        +V+ S         F DT ++ E    +P+YLPE   PS    K+V
Sbjct:   15 VNQLRDLAADPLNRRAIVQDQGCLPGLILFLDHPSPPVVHSALLALRYLAECRANREKMKGELGMMLSLQNVIQKTTTPGETKLLASEVYDILQSSNMSDMDNVNEMNYRRRKAQFFLGSTNKRAKTVVLHIDGLDDSSRRNLCEEALLKIKGVISFTFQMAVQRCVVRIRSDLKAEALATAIASTKVMKAQQVVKSESGEEMLVPFQDTPVEVEQNTDLPEYLPEDESPSKEQDKAV 252          
BLAST of ARMC1 vs. UniProt/SwissProt
Match: sp|Q9D7A8|ARMC1_MOUSE (Armadillo repeat-containing protein 1 OS=Mus musculus OX=10090 GN=Armc1 PE=1 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 1.678e-11
Identity = 53/229 (23.14%), Postives = 103/229 (44.98%), Query Frame = 1
Query:   79 VQDLKIMSLNPLSARLLGQDFTCIGGLILLLSSDQEKVILDILEIFHNLIVNENNKQFLREFIGIKQQLECLESRYLSGTVIHMSASKLKNKLYK---ASVKRFTSVIKKEPKIKDSFKIKNSR--NFIIELNGLTDMETVEEIKNNLINLEGVMSITFQLKIKRVIVKVNSSVSEQDILEAISDVSENIIGEVISSYKN------FNDTTIKNESIISIPDYLPEPSS 732
            V  L+ ++ +PL+ R + QD  C+ GLIL +      V+   L     L     N++ ++  +G+   L+ +  +  +     + AS++ + L     A    F  +  +  K +      N R    ++ ++GL D       +  L+ ++GV+S TFQ+ ++R +V++ S +  + +  AI+        +V+ S         F D  ++ E    +PDYLPE  S
Sbjct:   18 VNQLRDLAADPLNRRAIVQDQGCLPGLILFMDHPNPPVVHSALLALRYLAECRANREKMKGELGMMLSLQNVIQKTTTPGETKLLASEIYDILQSSNLADGDSFNEMNSRRRKAQFFLGTTNKRAKTVVLHIDGLDDTSRRNLCEEALLKIKGVISFTFQMAVQRCVVRIRSDLKAEALASAIASTKVMKAQQVVKSESGEEMLVPFQDAPVEVEENTELPDYLPEDES 246          
BLAST of ARMC1 vs. TrEMBL
Match: H9CXV5 (ARMC1 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 516.538 bits (1329), Expect = 0.000e+0
Identity = 259/259 (100.00%), Postives = 259/259 (100.00%), Query Frame = 1
Query:   64 MNHQTVQDLKIMSLNPLSARLLGQDFTCIGGLILLLSSDQEKVILDILEIFHNLIVNENNKQFLREFIGIKQQLECLESRYLSGTVIHMSASKLKNKLYKASVKRFTSVIKKEPKIKDSFKIKNSRNFIIELNGLTDMETVEEIKNNLINLEGVMSITFQLKIKRVIVKVNSSVSEQDILEAISDVSENIIGEVISSYKNFNDTTIKNESIISIPDYLPEPSSNVAKSVEVPVVSTLSIRSGFGSLLNRFSQAFTDYLW 840
            MNHQTVQDLKIMSLNPLSARLLGQDFTCIGGLILLLSSDQEKVILDILEIFHNLIVNENNKQFLREFIGIKQQLECLESRYLSGTVIHMSASKLKNKLYKASVKRFTSVIKKEPKIKDSFKIKNSRNFIIELNGLTDMETVEEIKNNLINLEGVMSITFQLKIKRVIVKVNSSVSEQDILEAISDVSENIIGEVISSYKNFNDTTIKNESIISIPDYLPEPSSNVAKSVEVPVVSTLSIRSGFGSLLNRFSQAFTDYLW
Sbjct:    1 MNHQTVQDLKIMSLNPLSARLLGQDFTCIGGLILLLSSDQEKVILDILEIFHNLIVNENNKQFLREFIGIKQQLECLESRYLSGTVIHMSASKLKNKLYKASVKRFTSVIKKEPKIKDSFKIKNSRNFIIELNGLTDMETVEEIKNNLINLEGVMSITFQLKIKRVIVKVNSSVSEQDILEAISDVSENIIGEVISSYKNFNDTTIKNESIISIPDYLPEPSSNVAKSVEVPVVSTLSIRSGFGSLLNRFSQAFTDYLW 259          
BLAST of ARMC1 vs. TrEMBL
Match: A0A210QYH9 (Armadillo repeat-containing protein 1 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT08455 PE=4 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 2.128e-14
Identity = 73/249 (29.32%), Postives = 121/249 (48.59%), Query Frame = 1
Query:   73 QTVQDLKIMSLNPLSARLLGQDFTCIGGLILLLSSDQEKVILDILEIFHNLIVNENNKQFLREFIGIKQQLECLESRYLSGTVIHMSASKLKNKLYKASVKRFTSVIKKEPKIKDSF--------------------KIKNSR--NFIIELNGLTDMETVEEIKNNLINLEGVMSITFQLKIKRVIVKVNSSVSEQDILEAISD----VSENII----GE--VISSYKNFNDTTIKNESIISIPDYLPE 723
            +T+  LK M+ +P     L +D TCIGGLI++LS+   KV+   LE    L    +++  LR+F+G+  QLE +  R    +     AS L  KLY       T V  + P +KD+F                     + N R  + I+++ GL D    E +   L+ ++GV+SITF L  KR I++    V  + +++A+S     +++ +I    GE  ++S   N  +   +N    ++PDYLP+
Sbjct:    5 ETITALKGMASDPKKRSFLLKDLTCIGGLIMVLSNPDVKVVTVALETLLLLADRADHRSTLRDFLGMTDQLETIMRR----SSYDKKASNLAEKLYVT----LTQVDLQTP-LKDTFNRSTVSGQSSKKSSTSKNNRSVLNGRAKHIILQIRGLIDKADRELVMRLLLQVKGVVSITFDLNKKRCILRTKQEVKPETLVQAVSKSQTMIAQQVIKDDNGEEMLLSFGSNHQEMDKEN---TTLPDYLPD 241          
BLAST of ARMC1 vs. TrEMBL
Match: A0A444UNL2 (Armadillo repeat-containing protein 1 OS=Acipenser ruthenus OX=7906 GN=EOD39_11481 PE=4 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 2.468e-13
Identity = 67/261 (25.67%), Postives = 126/261 (48.28%), Query Frame = 1
Query:   79 VQDLKIMSLNPLSARLLGQDFTCIGGLILLLSSDQEKVILDILEIFHNLIVNENNKQFLREFIGIKQQLECL--------ESRYLSGTVIHM---SASKLKNKLYKASVKRFTSVIKKEPKIKDSFKIKNSRNFIIELNGLTDMETVEEIKNNLINLEGVMSITFQLKIKRVIVKVNSSVSEQDILEAISDV----SENII-----GEVISSYKNFNDTTIKNESIISIPDYLPE---PSSNVAKSVEVPVVSTLSIRSGF 792
            V  L+ ++ +PL+ R + QD  C+ GLIL L     +V+   L     L    +N++ +R  +G+ Q LE +        E++ L+  +  +   S++ + ++  +AS +R T               K ++  ++ ++GL D       +  L+ ++GV+S TFQ+ +KR IV++ S +  + +  AI+      ++ I+      EV+ S++   D  ++ E    +PDYLPE   PS  + K+V    V T    SG+
Sbjct:   11 VNQLRDLAADPLNRRAIVQDQGCLPGLILFLDQPNPQVVYSALLAVRYLAECRSNREKMRGELGMMQSLENVMKKTTTPGETKLLASEIYEILKSSSNAVTDQAEQASYRRKTQFFLGATN-------KRAKTVVLHIDGLDDAARRSLCEEALLKIKGVISFTFQMTVKRCIVRIRSDLKAEALGTAIASTKIMKAQQIVKGEDGDEVMISFE--EDAPVEAEQNTDLPDYLPEEESPSKELDKAVS--RVGTKQDASGW 260          
BLAST of ARMC1 vs. TrEMBL
Match: A0A0R3UPQ8 (Uncharacterized protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS9840 PE=4 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 1.750e-12
Identity = 60/185 (32.43%), Postives = 102/185 (55.14%), Query Frame = 1
Query:   79 VQDLKIMSLNPLSARLLGQDFTCIGGLILLLSSDQEKVILDILEIFHNLIVNENNKQFLREFIGIKQQLECLESRYLSGTVIHMSASKLKNKLY------KASVKRFTSVIKKEPKIKDSFKIKNSRNFIIELNGLTDMETVEEIKNNLINLEGVMSITFQLKIKRVIVKVNSSVSEQDILEAIS 615
            ++  K ++L+ LS   L +D T +GGL++LLS+++E  + +IL IF  L        +L +  G+ +QL  L++   SG    +   +L + L+      KA +KR  S   + PK     K + SR  +I+L+G    + ++ I++ LI ++GV+SITFQL   RV+V     +  + ILEA+S
Sbjct:    5 LESFKKLALDDLSYSSLLKDNTSLGGLVILLSNEKESAVEEILNIFKILSERNGGSYYLSKLPGMMEQLSSLKA---SGESHSVRIRELTDDLFETLFSSKAHLKRMPSQSHR-PK-----KSRKSRPVVIQLSGNITKQDLKAIESQLITVKGVVSITFQLNKLRVVVMALDDLDPERILEAVS 180          
BLAST of ARMC1 vs. TrEMBL
Match: H2TMD7 (Armadillo repeat-containing protein 1 OS=Takifugu rubripes OX=31033 GN=LOC101063538 PE=4 SV=2)

HSP 1 Score: 77.0258 bits (188), Expect = 2.673e-12
Identity = 71/273 (26.01%), Postives = 122/273 (44.69%), Query Frame = 1
Query:   79 VQDLKIMSLNPLSARLLGQDFTCIGGLILLLSSDQEKVILDILEIFHNLIVNENNKQFLREFIGIKQQLECLESRYLSGTVIHMSASKLKNKLYKASVKRF-------TSVIKKEP---KIKDSFKI----KNSRNFIIELNGLTDMETVEEIKNNLINLEGVMSITFQLKIKRVIVKVNSSVSEQDILEAISDVSENIIGEVISSYKN------FN-DTTIKNESIISIPDYLPE---PSSNVAKSVEVPVVSTLSIRSGFGSLLNRFSQAF 825
            V  L+ ++ +P++ R + QD  C+ GLIL L     +V+   L     L     NK+ L+  +G+   L+          V+  S +  + KL  A V +         S    EP   + K  F +    K ++  ++ + GL D       +  L+ + GV+S TFQ+ ++R IV+V S +  Q +  AI+        +V+           F+ D +++ E  + +PDYLPE   PS    K+V   V S+ +  S  G+  N  S++F
Sbjct:   11 VNQLRDLAADPMNRRAIVQDQGCLPGLILFLDHTNPQVVYSALLAIRYLAECRVNKEKLKGELGMMLSLQ---------NVMQKSTTPGETKLLAAGVYQLLQASGGAESGASGEPAAGRRKAQFFLGCSNKRAKTVVLHVQGLDDPSRRRLCEEVLLKIRGVISFTFQMTVRRCIVRVRSDLKAQALASAIASTQVMRAQQVVRGETGDEVLIPFDEDRSLQTEPNVDLPDYLPEDESPSQEPDKAVSR-VGSSQAGNSWLGAATNFMSRSF 273          
BLAST of ARMC1 vs. Ensembl Cavefish
Match: armc1 (armadillo repeat-containing protein 1 [Source:NCBI gene;Acc:103047274])

HSP 1 Score: 69.707 bits (169), Expect = 3.271e-13
Identity = 63/257 (24.51%), Postives = 121/257 (47.08%), Query Frame = 1
Query:   79 VQDLKIMSLNPLSARLLGQDFTCIGGLILLLSSDQEKVILDILEIFHNLIVNENNKQFLREFIGIKQQLECLESRYLSGTVIHMSASKLKNKLYKAS-VKRFTSVIKKEPKIKDSFKI----KNSRNFIIELNGLTDMETVEEIKNNLINLEGVMSITFQLKIKRVIVKVNSSVSEQDILEAISDVSENII-----------GEVISSYKNFNDTTIKNESIISIPDYLPEPSSNVAKSVEVPVVSTLSIRSGFGSL 801
            V  L+ ++ +PL+ R + +D  C+ GLIL L     +V+   L     L     N++ L+  +G+   L+ +  +  S     + AS++   L  AS  +   +      + K  F +    K ++  +++++GL D       +  L+ + GV+S TFQ+ +KR +V++ S +  + +  AI+  S N++            EV+  ++   D+++  E  + +PDYLPE  S  A+     V    S++ G G L
Sbjct:   11 VNQLRDLAADPLNRRAIVEDHGCLPGLILFLDHPNPQVVYSALLAVRYLAECRANREKLKGELGMMLSLQNVMQKGTSPGETKLLASEIYEILQNASNAETEQAEAAASCRRKAQFFLGSTNKRAKTVVLQIDGLDDSSRRSLCEEALLKIRGVISFTFQMAVKRCVVRIRSDLKAEALGSAIA--STNVMKAQQVVKGEDGSEVVIPFQ--EDSSMVVEQNMDLPDYLPEDESP-AQEQHKAVSRLGSMQDGVGWL 262          
BLAST of ARMC1 vs. Ensembl Cavefish
Match: armc1l (armadillo repeat-containing protein 1-like [Source:NCBI gene;Acc:103028287])

HSP 1 Score: 69.3218 bits (168), Expect = 6.169e-13
Identity = 63/269 (23.42%), Postives = 120/269 (44.61%), Query Frame = 1
Query:   79 VQDLKIMSLNPLSARLLGQDFTCIGGLILLLSSDQEKVILDILEIFHNLIVNENNKQFLREFIGIKQQLECLESRYLSGTVIHMSASKLKNKLYKASVKRFTSVIKKEPKIKDSFKI------KNSRNFIIELNGLTDMETVEEIKNNLINLEGVMSITFQLKIKRVIVKVNSSVSEQDILEAIS--------DVSENIIGEVISSYKNFNDTTIKNESIISIPDYLPEPSSNVAKSVEVPVVSTLSIRSGFGSLLNRFSQAFTD-YLW 840
            V  L+ ++  P +   + QD  C+ GL+L L     +V+   L+    L  +  N   ++  +G+   LE L    +  T +    + L  +++       T    ++P+ K+  +       K +++  + + GL   +     ++ L+ ++GV+S TFQ+ +KR  V+V + +  + +  AI+         V +N  GE +  +   + T +K E    IPDYLPE  S   K ++  V  T + +   GS LN  +   T  + W
Sbjct:   35 VSQLRDLASEPQNREAIVQDQGCLPGLVLFLDHKDPQVVFATLQTLRYLAESSQNINIMKNELGMMVTLESL----IENTAMTSDITDLAKEVHGVLSAMDTFRTPEQPRRKNKHQFFINSSNKKAKSVTLHIQGLDGNDQRGVCEDALLKVKGVISFTFQMALKRCTVRVRADLPTESLASAIASTKVLSAQQVVKNESGEEV--FIPLSTTGMKVEQNSQIPDYLPEDESP-EKELDRAVSRTAAKQESGGSWLNTAASFLTKTFYW 296          
BLAST of ARMC1 vs. Ensembl Cavefish
Match: ENSAMXT00000051956.1 (armadillo repeat-containing protein 1-like [Source:NCBI gene;Acc:103027258])

HSP 1 Score: 64.6994 bits (156), Expect = 2.033e-11
Identity = 61/268 (22.76%), Postives = 123/268 (45.90%), Query Frame = 1
Query:   79 VQDLKIMSLNPLSARLLGQDFTCIGGLILLLSSDQEKVILDILEIFHNLIVNENNKQFLREFIGIKQQLECL--------ESRYLSGTVIHMSASKLKNKLYKASVKRFTSVIKKEPKIKDSFKIKNSRNFIIELNGLTDMETVEEIKNNLINLEGVMSITFQLKIKRVIVKVNSSVSEQDILEAISDV----SENIIG-----EVISSYKNFNDTTIKNESIISIPDYLPEPSS-NVAKSVEVPVVSTLSIRSGF-GSLLNRFSQAF 825
            V  L+ ++ +PL+ R + +D  CI GLIL L     +V+   L+    L     N++ +    G+   L+ +        E+R L+  V  +  +   +   +      T+  +++ +       K ++   + ++GL D E     +  L+ + GV+S TFQ+ +KR IV++ S ++ + +  AI+      +++++      EV+  +    +        I++P+YL E  S +V K   +  V + S  SG+  S  N  S++F
Sbjct:   11 VNQLRELTADPLNRRAIAEDQGCIPGLILFLDHSNPEVVYSALQALRYLSECRANREKMSGEFGMLLSLQNIVEKTTTPGETRLLASEVYELLRNAGADGGGEDERGEETASCRRKAQFFLGSSNKRAKTVTLHIDGLDDSERRTLCEEVLLRIRGVISFTFQMAVKRCIVRIRSDLTAETLGSAIASTKVLKAQHVVKTENGEEVLIPFHEEGEEEDNAPVSINLPEYLSEDDSPSVEKEKVLSRVGSASEGSGWLASATNFLSRSF 278          
BLAST of ARMC1 vs. Ensembl Medaka
Match: ENSORLT00000009087.2 (armadillo repeat-containing protein 1 [Source:NCBI gene;Acc:101173737])

HSP 1 Score: 68.1662 bits (165), Expect = 1.153e-12
Identity = 64/270 (23.70%), Postives = 120/270 (44.44%), Query Frame = 1
Query:   79 VQDLKIMSLNPLSARLLGQDFTCIGGLILLLSSDQEKVILDILEIFHNLIVNENNKQFLREFIGIKQQLECLESRYLSGTVIHMSASKLKNKLYKASVKRFTSVIKKEP-------KIKDSFKI----KNSRNFIIELNGLTDMETVEEIKNNLINLEGVMSITFQLKIKRVIVKVNSSVSEQDILEAISDVSENIIGEVISSYKN-------FNDTTIKNESIISIPDYLPE---PSSNVAKSVEVPVVSTLSIRSGFGSLLNRFSQAF 825
            V  L+ ++ +P++ + + QD  C+ GLIL L     +V+   L     L     N++ LR  +G+   L+ +  +  +     + AS++   L  AS          EP       + K  F +    K ++  +++++GL D       +  L+ + GV+S TFQ+ +KR IV++ S +  + +  AI+        +V+ +            D ++  E    +P+YLPE   PS    K+V   + S+    S  G+  N  S++F
Sbjct:   11 VNQLRDLAADPMNRQAIVQDQGCLPGLILFLDHPNPQVVYSALLAIRYLAECRANREKLRGELGMMLSLQNIMQKSTTPGETKLLASEIYELLQAASAA------DSEPAGAAVSSRRKAQFFLGSSNKRAKTVVLQIDGLDDSSRRSLCEEALLKIRGVISFTFQMAVKRCIVRIRSDLKAEALGSAIASTQVMKAQQVVKTENGDEVLVPFAEDGSVAVERNEDLPEYLPEDESPSQEPDKAV-TRIGSSQDGASWLGAAANFLSRSF 273          
BLAST of ARMC1 vs. Ensembl Medaka
Match: armc1 (armadillo repeat-containing protein 1 [Source:NCBI gene;Acc:101157737])

HSP 1 Score: 67.781 bits (164), Expect = 1.575e-12
Identity = 64/267 (23.97%), Postives = 120/267 (44.94%), Query Frame = 1
Query:   79 VQDLKIMSLNPLSARLLGQDFTCIGGLILLLSSDQEKVILDILEIFHNLIVNENNKQFLREFIGIKQQLECLESRYLSGTVIHMSASKLKNKLYKAS--VKRFTSVIKKEPKIKDSFKI----KNSRNFIIELNGLTDMETVEEIKNNLINLEGVMSITFQLKIKRVIVKVNSSVSEQDILEAISDV----SENII-----GEVISSYKNFNDTTIKNESIISIPDYLPEPSSNVAKSVEVPVVSTLSIRSGFGSL---LNRFSQAF 825
            V  L+ ++ +PL+ R + +D  C+ GLIL       +V+   L     L     N++ ++  +G+   L+ +  +  S     + AS++   L  A               + K  F +    K ++  ++ ++GL D       +  L+ + GV+S TFQ+ +KR +V++ S +  + +  AI+      ++ ++     GE+I  ++   DT +  E    IPDYLPE  S  ++  +  V    SI  G G L    N  S++F
Sbjct:   11 VNQLRDLAADPLNRRAIVEDQGCLPGLILFFDHPNPQVVYSALLAVRYLAECRANREKMKSELGMMLSLQNVMQKSTSPGETKLLASEIYEILQSAGKEEAEQAEAAAASCRRKAHFFLGSNNKRAKTVVLHIDGLDDSARRGLCEEALLKIRGVISFTFQMAVKRCVVRIRSDLKAEALGTAINSTKVMKAQQVMKTDDGGEMIVPFQ--EDTAVLVEENTDIPDYLPEDESP-SQEQDKAVTRIGSITDGMGWLSTAANFLSRSF 274          
BLAST of ARMC1 vs. Ensembl Medaka
Match: armc1 (armadillo repeat-containing protein 1 [Source:NCBI gene;Acc:101157737])

HSP 1 Score: 67.781 bits (164), Expect = 1.575e-12
Identity = 64/267 (23.97%), Postives = 120/267 (44.94%), Query Frame = 1
Query:   79 VQDLKIMSLNPLSARLLGQDFTCIGGLILLLSSDQEKVILDILEIFHNLIVNENNKQFLREFIGIKQQLECLESRYLSGTVIHMSASKLKNKLYKAS--VKRFTSVIKKEPKIKDSFKI----KNSRNFIIELNGLTDMETVEEIKNNLINLEGVMSITFQLKIKRVIVKVNSSVSEQDILEAISDV----SENII-----GEVISSYKNFNDTTIKNESIISIPDYLPEPSSNVAKSVEVPVVSTLSIRSGFGSL---LNRFSQAF 825
            V  L+ ++ +PL+ R + +D  C+ GLIL       +V+   L     L     N++ ++  +G+   L+ +  +  S     + AS++   L  A               + K  F +    K ++  ++ ++GL D       +  L+ + GV+S TFQ+ +KR +V++ S +  + +  AI+      ++ ++     GE+I  ++   DT +  E    IPDYLPE  S  ++  +  V    SI  G G L    N  S++F
Sbjct:   11 VNQLRDLAADPLNRRAIVEDQGCLPGLILFFDHPNPQVVYSALLAVRYLAECRANREKMKSELGMMLSLQNVMQKSTSPGETKLLASEIYEILQSAGKEEAEQAEAAAASCRRKAHFFLGSNNKRAKTVVLHIDGLDDSARRGLCEEALLKIRGVISFTFQMAVKRCVVRIRSDLKAEALGTAINSTKVMKAQQVMKTDDGGEMIVPFQ--EDTAVLVEENTDIPDYLPEDESP-SQEQDKAVTRIGSITDGMGWLSTAANFLSRSF 274          
BLAST of ARMC1 vs. Ensembl Medaka
Match: armc1l (armadillo repeat-containing protein 1-like [Source:NCBI gene;Acc:101165191])

HSP 1 Score: 54.6842 bits (130), Expect = 4.042e-8
Identity = 60/254 (23.62%), Postives = 112/254 (44.09%), Query Frame = 1
Query:   79 VQDLKIMSLNPLSARLLGQDFTCIGGLILLLSSDQEKVILDILEIFHNLIVNENNKQFLREFIGIKQQLECLESRYLSGTVIHMSASKLKNKLYKAS---VKRFTSVIKKEPKIKDSFKIKNSRNFIIELNGLTDMETVEEIKNNLINLEGVMSITFQLKIKRVIVKVNSSVSEQDILEAIS--------DVSENIIGEVISSYKNFNDTTIKNESIISIPDYLPEPSSNVAKSVEVPVVSTLSIRSGFGSLLN 807
            V  L+ ++  P +   + QD  C+ GL+L L     +V+   L+    L     N   ++  +G+   LE L  R      I   A ++ N L + +    +      +K+P+   +   K +++  + + GL   +     +  L+ ++GV+S TFQ+  KR  V++ S +  +++  AI+         V +N  GE +    N   T +   S  ++PDYLPE   +  + V+  +  T +     GS LN
Sbjct:    8 VCQLRDLASEPQNREAIVQDQGCLPGLVLFLDHQDAEVLFATLQTLRYLAELTPNITTMKNELGMMVSLENLIGRDELSVDITALAKEVYNILSQPANPAPRTPERQRRKKPQFFINSSSKKAKSVTLHIQGLDSTQQRSLCEEALLTVKGVISFTFQMASKRCTVRIRSDLPTENLATAIAATKVLSAQQVVKNETGEEVYIPLNPAGTEVPQNS--ALPDYLPEEEESPEREVDRAISRTAAKEDSSGSWLN 259          
BLAST of ARMC1 vs. Planmine SMEST
Match: SMESG000075605.1 (SMESG000075605.1)

HSP 1 Score: 516.538 bits (1329), Expect = 0.000e+0
Identity = 259/259 (100.00%), Postives = 259/259 (100.00%), Query Frame = 1
Query:   64 MNHQTVQDLKIMSLNPLSARLLGQDFTCIGGLILLLSSDQEKVILDILEIFHNLIVNENNKQFLREFIGIKQQLECLESRYLSGTVIHMSASKLKNKLYKASVKRFTSVIKKEPKIKDSFKIKNSRNFIIELNGLTDMETVEEIKNNLINLEGVMSITFQLKIKRVIVKVNSSVSEQDILEAISDVSENIIGEVISSYKNFNDTTIKNESIISIPDYLPEPSSNVAKSVEVPVVSTLSIRSGFGSLLNRFSQAFTDYLW 840
            MNHQTVQDLKIMSLNPLSARLLGQDFTCIGGLILLLSSDQEKVILDILEIFHNLIVNENNKQFLREFIGIKQQLECLESRYLSGTVIHMSASKLKNKLYKASVKRFTSVIKKEPKIKDSFKIKNSRNFIIELNGLTDMETVEEIKNNLINLEGVMSITFQLKIKRVIVKVNSSVSEQDILEAISDVSENIIGEVISSYKNFNDTTIKNESIISIPDYLPEPSSNVAKSVEVPVVSTLSIRSGFGSLLNRFSQAFTDYLW
Sbjct:    1 MNHQTVQDLKIMSLNPLSARLLGQDFTCIGGLILLLSSDQEKVILDILEIFHNLIVNENNKQFLREFIGIKQQLECLESRYLSGTVIHMSASKLKNKLYKASVKRFTSVIKKEPKIKDSFKIKNSRNFIIELNGLTDMETVEEIKNNLINLEGVMSITFQLKIKRVIVKVNSSVSEQDILEAISDVSENIIGEVISSYKNFNDTTIKNESIISIPDYLPEPSSNVAKSVEVPVVSTLSIRSGFGSLLNRFSQAFTDYLW 259          
BLAST of ARMC1 vs. Planmine SMEST
Match: SMESG000075605.1 (SMESG000075605.1)

HSP 1 Score: 492.656 bits (1267), Expect = 1.411e-177
Identity = 248/248 (100.00%), Postives = 248/248 (100.00%), Query Frame = 1
Query:   97 MSLNPLSARLLGQDFTCIGGLILLLSSDQEKVILDILEIFHNLIVNENNKQFLREFIGIKQQLECLESRYLSGTVIHMSASKLKNKLYKASVKRFTSVIKKEPKIKDSFKIKNSRNFIIELNGLTDMETVEEIKNNLINLEGVMSITFQLKIKRVIVKVNSSVSEQDILEAISDVSENIIGEVISSYKNFNDTTIKNESIISIPDYLPEPSSNVAKSVEVPVVSTLSIRSGFGSLLNRFSQAFTDYLW 840
            MSLNPLSARLLGQDFTCIGGLILLLSSDQEKVILDILEIFHNLIVNENNKQFLREFIGIKQQLECLESRYLSGTVIHMSASKLKNKLYKASVKRFTSVIKKEPKIKDSFKIKNSRNFIIELNGLTDMETVEEIKNNLINLEGVMSITFQLKIKRVIVKVNSSVSEQDILEAISDVSENIIGEVISSYKNFNDTTIKNESIISIPDYLPEPSSNVAKSVEVPVVSTLSIRSGFGSLLNRFSQAFTDYLW
Sbjct:    1 MSLNPLSARLLGQDFTCIGGLILLLSSDQEKVILDILEIFHNLIVNENNKQFLREFIGIKQQLECLESRYLSGTVIHMSASKLKNKLYKASVKRFTSVIKKEPKIKDSFKIKNSRNFIIELNGLTDMETVEEIKNNLINLEGVMSITFQLKIKRVIVKVNSSVSEQDILEAISDVSENIIGEVISSYKNFNDTTIKNESIISIPDYLPEPSSNVAKSVEVPVVSTLSIRSGFGSLLNRFSQAFTDYLW 248          
The following BLAST results are available for this feature:
BLAST of ARMC1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ARMC18.676e-1323.58armadillo repeat containing 1 [Source:HGNC Symbol;... [more]
ARMC15.439e-722.09armadillo repeat containing 1 [Source:HGNC Symbol;... [more]
ARMC12.349e-630.38armadillo repeat containing 1 [Source:HGNC Symbol;... [more]
back to top
BLAST of ARMC1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of ARMC1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of ARMC1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
armc13.976e-1121.99armadillo repeat containing 1 [Source:ZFIN;Acc:ZDB... [more]
armc14.511e-1021.05armadillo repeat containing 1 [Source:ZFIN;Acc:ZDB... [more]
armc1l3.497e-924.72armadillo repeat containing 1, like [Source:ZFIN;A... [more]
back to top
BLAST of ARMC1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ppip5k12.698e-1424.82diphosphoinositol pentakisphosphate kinase 1 [Sour... [more]
armc12.540e-1222.71armadillo repeat containing 1 [Source:NCBI gene;Ac... [more]
armc12.876e-1222.71armadillo repeat containing 1 [Source:NCBI gene;Ac... [more]
ppip5k12.141e-1125.10diphosphoinositol pentakisphosphate kinase 1 [Sour... [more]
back to top
BLAST of ARMC1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Armc12.400e-1223.14armadillo repeat containing 1 [Source:MGI Symbol;A... [more]
back to top
BLAST of ARMC1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9NVT9|ARMC1_HUMAN4.167e-1223.58Armadillo repeat-containing protein 1 OS=Homo sapi... [more]
sp|Q3ZBE1|ARMC1_BOVIN4.368e-1223.58Armadillo repeat-containing protein 1 OS=Bos tauru... [more]
sp|Q5RCR8|ARMC1_PONAB1.131e-1123.58Armadillo repeat-containing protein 1 OS=Pongo abe... [more]
sp|Q5ZMQ0|ARMC1_CHICK1.217e-1123.53Armadillo repeat-containing protein 1 OS=Gallus ga... [more]
sp|Q9D7A8|ARMC1_MOUSE1.678e-1123.14Armadillo repeat-containing protein 1 OS=Mus muscu... [more]
back to top
BLAST of ARMC1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
H9CXV50.000e+0100.00ARMC1 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1[more]
A0A210QYH92.128e-1429.32Armadillo repeat-containing protein 1 OS=Mizuhopec... [more]
A0A444UNL22.468e-1325.67Armadillo repeat-containing protein 1 OS=Acipenser... [more]
A0A0R3UPQ81.750e-1232.43Uncharacterized protein OS=Mesocestoides corti OX=... [more]
H2TMD72.673e-1226.01Armadillo repeat-containing protein 1 OS=Takifugu ... [more]
back to top
BLAST of ARMC1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
armc13.271e-1324.51armadillo repeat-containing protein 1 [Source:NCBI... [more]
armc1l6.169e-1323.42armadillo repeat-containing protein 1-like [Source... [more]
ENSAMXT00000051956.12.033e-1122.76armadillo repeat-containing protein 1-like [Source... [more]
back to top
BLAST of ARMC1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of ARMC1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of ARMC1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of ARMC1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSORLT00000009087.21.153e-1223.70armadillo repeat-containing protein 1 [Source:NCBI... [more]
armc11.575e-1223.97armadillo repeat-containing protein 1 [Source:NCBI... [more]
armc11.575e-1223.97armadillo repeat-containing protein 1 [Source:NCBI... [more]
armc1l4.042e-823.62armadillo repeat-containing protein 1-like [Source... [more]
back to top
BLAST of ARMC1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000075605.10.000e+0100.00SMESG000075605.1[more]
SMESG000075605.11.411e-177100.00SMESG000075605.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30028549
GenBankAFD29626.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30028549 ID=SMED30028549|Name=ARMC1|organism=Schmidtea mediterranea sexual|type=transcript|length=1065bp
ATATAATACAAAGAAAATATTTTTAATTATAGTTTTTTGGAGGACTTATC
ATATTAATTCTCGATGAATCATCAAACAGTTCAGGATTTAAAAATAATGT
CTCTTAATCCGCTGTCTGCACGGTTGTTAGGCCAGGATTTTACATGTATC
GGTGGCTTAATCTTACTTTTATCCAGTGATCAGGAAAAAGTTATCCTAGA
TATTTTAGAGATTTTTCACAATTTGATTGTAAATGAAAATAATAAGCAAT
TCCTAAGAGAATTTATTGGCATTAAGCAGCAATTGGAATGTTTAGAGTCT
AGATATCTATCAGGCACTGTTATTCACATGTCTGCATCGAAATTAAAAAA
TAAGCTATATAAAGCTAGTGTAAAGCGGTTTACTAGTGTCATTAAAAAGG
AGCCTAAAATTAAAGATAGTTTTAAAATAAAGAATTCCCGAAACTTCATA
ATTGAATTGAATGGCTTAACGGATATGGAAACTGTAGAAGAGATAAAAAA
CAATTTAATTAACTTGGAAGGAGTAATGAGTATCACATTTCAGTTAAAAA
TTAAACGGGTTATTGTCAAAGTGAACTCATCAGTAAGTGAACAAGATATT
CTCGAAGCTATTTCTGATGTTTCCGAGAACATTATAGGAGAAGTAATTAG
TTCCTACAAAAATTTCAATGATACAACAATCAAAAACGAATCAATTATTT
CCATTCCAGACTATTTACCCGAGCCATCGAGTAATGTGGCTAAATCAGTA
GAAGTGCCGGTAGTGTCTACGTTGTCTATAAGGAGTGGTTTTGGGTCCCT
TTTGAATCGGTTTTCCCAAGCATTTACCGATTATTTGTGGTAGAGGTGGT
GCTTTATAGATTTTATACCAATAGAATTATAAATTTTGAACGACTTTGTT
GATATTTATAGGTTTTTGTATCTTTGAGAATAATTACTGTAGATTAAAAT
GATCGGTATTGATGTTTGTAAGATTTTCACAAAAGGACCTTGAAAATATT
CAATAATTTTGCTCAAAAATTTGGATGTATTGATAAATTTTGTTTTAGTA
AATATTTTAATCTGG
back to top

protein sequence of SMED30028549-orf-1

>SMED30028549-orf-1 ID=SMED30028549-orf-1|Name=SMED30028549-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=260bp
MNHQTVQDLKIMSLNPLSARLLGQDFTCIGGLILLLSSDQEKVILDILEI
FHNLIVNENNKQFLREFIGIKQQLECLESRYLSGTVIHMSASKLKNKLYK
ASVKRFTSVIKKEPKIKDSFKIKNSRNFIIELNGLTDMETVEEIKNNLIN
LEGVMSITFQLKIKRVIVKVNSSVSEQDILEAISDVSENIIGEVISSYKN
FNDTTIKNESIISIPDYLPEPSSNVAKSVEVPVVSTLSIRSGFGSLLNRF
SQAFTDYLW*
back to top
Aliases
The feature 'ARMC1' has the following synonyms
Synonym
ARMC1
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000420parapharyngeal region
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR036163HMA_dom_sf
IPR006121HMA_dom
Vocabulary: biological process
TermDefinition
GO:0030001metal ion transport
Vocabulary: molecular function
TermDefinition
GO:0046872metal ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePANTHERPTHR46840FAMILY NOT NAMEDcoord: 5..228
IPR006121Heavy metal-associated domain, HMAPROSITEPS50846HMA_2coord: 127..187
score: 9.02
IPR006121Heavy metal-associated domain, HMACDDcd00371HMAcoord: 141..185
e-value: 4.93271E-6
score: 41.0521
IPR036163Heavy metal-associated domain superfamilySUPERFAMILYSSF55008HMA, heavy metal-associated domaincoord: 129..185