Lysine-specific demethylase 7A

Overview
NameLysine-specific demethylase 7A
Smed IDSMED30028546
Length (bp)2230
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Lysine-specific demethylase 7A (SMED30028546) t-SNE clustered cells

Violin plots show distribution of expression levels for Lysine-specific demethylase 7A (SMED30028546) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Lysine-specific demethylase 7A (SMED30028546) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Lysine-specific demethylase 7A (SMED30028546) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30028546

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30028546SMESG000032757.1 SMESG000017771.1 SMESG000010058.1 Contig667newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30028546SMESG000032757.1 SMESG000017771.1 SMESG000010058.1 Contig668newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30028546SMESG000022857.1 Contig667newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30028546SMESG000035255.1 Contig668newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
X1 cellSMED30028546SMESG000017771.1 SmedASXL_029631SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30028546SMESG000017771.1 SmedASXL_029631SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X1 cellSMED30028546SMESG000017771.1 SmedASXL_014845SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30028546SMESG000017771.1 SmedASXL_014845SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30028546SMESG000017771.1 SMESG000002927.1 Contig49266newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30028546SMESG000017771.1 SMESG000002927.1 Contig49266uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Lysine-specific demethylase 7A vs. Ensembl Human
Match: PHF8 (PHD finger protein 8 [Source:HGNC Symbol;Acc:HGNC:20672])

HSP 1 Score: 273.478 bits (698), Expect = 2.413e-79
Identity = 134/307 (43.65%), Postives = 198/307 (64.50%), Query Frame = 1
Query:  157 SGTKEFLEYLQEKQCLPIGDQLKELRGKEVTEDYFIKNGFNKPIMIRRKKGLRIVLPESPFSVEDVGRNLGKDYILDVIDVVQQDQYKMRFGEFLDYFRESEPRSKLLNVLSLEISHTKIAHLVEPPYVIKEMSIVEKLWPCDNLYQRANKPSVQKYCLMSMKDSWTDFHIDFGGSSVWYHMYSGHKIFYLIPPKRRYIKAYTSWMGEYNNRMLFFPDQIKKFSLNDQAEVYRLEIKSGDTILLPAGWIHAVHTLEDSLVFGGNFVHSLSIPLQLKIYKIERFLQTEDRFLFPYFEKLHWFVAEYIL 1077
            +G+  F+  L+ +      + + +  G ++T ++  +N F+ PI++ +K GL + LP   F+V DV   +G D  +DVIDV +Q   KM+ G+F+ Y+  S  R K+LNV+SLE S T++++LVE P +++++S VE LWP + +++R   P+VQKYCLMS++DS+TDFHIDFGG+SVWYH+  G KIFYLI P    +  +  W    N   +FF DQ+ K         Y+  +K G T+ +P GWIHAV T  D L FGGNF+HSL+I +QLK Y+IE+ L T D F FP FE + W+V ++IL
Sbjct:   82 TGSPTFVRELRSRTFDSSDEVILKPTGNQLTVEFLEENSFSVPILVLKKDGLGMTLPSPSFTVRDVEHYVGSDKEIDVIDVTRQADCKMKLGDFVKYYY-SGKREKVLNVISLEFSDTRLSNLVETPKIVRKLSWVENLWPEECVFER---PNVQKYCLMSVRDSYTDFHIDFGGTSVWYHVLKGEKIFYLIRPTNANLTLFECWSSSSNQNEMFFGDQVDK--------CYKCSVKQGQTLFIPTGWIHAVLTPVDCLAFGGNFLHSLNIEMQLKAYEIEKRLSTADLFRFPNFETICWYVGKHIL 376          
BLAST of Lysine-specific demethylase 7A vs. Ensembl Human
Match: PHF8 (PHD finger protein 8 [Source:HGNC Symbol;Acc:HGNC:20672])

HSP 1 Score: 273.863 bits (699), Expect = 5.431e-79
Identity = 130/281 (46.26%), Postives = 187/281 (66.55%), Query Frame = 1
Query:  235 GKEVTEDYFIKNGFNKPIMIRRKKGLRIVLPESPFSVEDVGRNLGKDYILDVIDVVQQDQYKMRFGEFLDYFRESEPRSKLLNVLSLEISHTKIAHLVEPPYVIKEMSIVEKLWPCDNLYQRANKPSVQKYCLMSMKDSWTDFHIDFGGSSVWYHMYSGHKIFYLIPPKRRYIKAYTSWMGEYNNRMLFFPDQIKKFSLNDQAEVYRLEIKSGDTILLPAGWIHAVHTLEDSLVFGGNFVHSLSIPLQLKIYKIERFLQTEDRFLFPYFEKLHWFVAEYIL 1077
            G ++T ++  +N F+ PI++ +K GL + LP   F+V DV   +G D  +DVIDV +Q   KM+ G+F+ Y+   + R K+LNV+SLE S T++++LVE P +++++S VE LWP + +++R   P+VQKYCLMS++DS+TDFHIDFGG+SVWYH+  G KIFYLI P    +  +  W    N   +FF DQ+ K         Y+  +K G T+ +P GWIHAV T  D L FGGNF+HSL+I +QLK Y+IE+ L T D F FP FE + W+V ++IL
Sbjct:   12 GNQLTVEFLEENSFSVPILVLKKDGLGMTLPSPSFTVRDVEHYVGSDKEIDVIDVTRQADCKMKLGDFVKYYYSGK-REKVLNVISLEFSDTRLSNLVETPKIVRKLSWVENLWPEECVFER---PNVQKYCLMSVRDSYTDFHIDFGGTSVWYHVLKGEKIFYLIRPTNANLTLFECWSSSSNQNEMFFGDQVDK--------CYKCSVKQGQTLFIPTGWIHAVLTPVDCLAFGGNFLHSLNIEMQLKAYEIEKRLSTADLFRFPNFETICWYVGKHIL 280          
BLAST of Lysine-specific demethylase 7A vs. Ensembl Human
Match: PHF8 (PHD finger protein 8 [Source:HGNC Symbol;Acc:HGNC:20672])

HSP 1 Score: 273.478 bits (698), Expect = 6.791e-79
Identity = 130/281 (46.26%), Postives = 187/281 (66.55%), Query Frame = 1
Query:  235 GKEVTEDYFIKNGFNKPIMIRRKKGLRIVLPESPFSVEDVGRNLGKDYILDVIDVVQQDQYKMRFGEFLDYFRESEPRSKLLNVLSLEISHTKIAHLVEPPYVIKEMSIVEKLWPCDNLYQRANKPSVQKYCLMSMKDSWTDFHIDFGGSSVWYHMYSGHKIFYLIPPKRRYIKAYTSWMGEYNNRMLFFPDQIKKFSLNDQAEVYRLEIKSGDTILLPAGWIHAVHTLEDSLVFGGNFVHSLSIPLQLKIYKIERFLQTEDRFLFPYFEKLHWFVAEYIL 1077
            G ++T ++  +N F+ PI++ +K GL + LP   F+V DV   +G D  +DVIDV +Q   KM+ G+F+ Y+   + R K+LNV+SLE S T++++LVE P +++++S VE LWP + +++R   P+VQKYCLMS++DS+TDFHIDFGG+SVWYH+  G KIFYLI P    +  +  W    N   +FF DQ+ K         Y+  +K G T+ +P GWIHAV T  D L FGGNF+HSL+I +QLK Y+IE+ L T D F FP FE + W+V ++IL
Sbjct:  108 GNQLTVEFLEENSFSVPILVLKKDGLGMTLPSPSFTVRDVEHYVGSDKEIDVIDVTRQADCKMKLGDFVKYYYSGK-REKVLNVISLEFSDTRLSNLVETPKIVRKLSWVENLWPEECVFER---PNVQKYCLMSVRDSYTDFHIDFGGTSVWYHVLKGEKIFYLIRPTNANLTLFECWSSSSNQNEMFFGDQVDK--------CYKCSVKQGQTLFIPTGWIHAVLTPVDCLAFGGNFLHSLNIEMQLKAYEIEKRLSTADLFRFPNFETICWYVGKHIL 376          
BLAST of Lysine-specific demethylase 7A vs. Ensembl Human
Match: PHF8 (PHD finger protein 8 [Source:HGNC Symbol;Acc:HGNC:20672])

HSP 1 Score: 273.863 bits (699), Expect = 1.277e-78
Identity = 130/281 (46.26%), Postives = 187/281 (66.55%), Query Frame = 1
Query:  235 GKEVTEDYFIKNGFNKPIMIRRKKGLRIVLPESPFSVEDVGRNLGKDYILDVIDVVQQDQYKMRFGEFLDYFRESEPRSKLLNVLSLEISHTKIAHLVEPPYVIKEMSIVEKLWPCDNLYQRANKPSVQKYCLMSMKDSWTDFHIDFGGSSVWYHMYSGHKIFYLIPPKRRYIKAYTSWMGEYNNRMLFFPDQIKKFSLNDQAEVYRLEIKSGDTILLPAGWIHAVHTLEDSLVFGGNFVHSLSIPLQLKIYKIERFLQTEDRFLFPYFEKLHWFVAEYIL 1077
            G ++T ++  +N F+ PI++ +K GL + LP   F+V DV   +G D  +DVIDV +Q   KM+ G+F+ Y+   + R K+LNV+SLE S T++++LVE P +++++S VE LWP + +++R   P+VQKYCLMS++DS+TDFHIDFGG+SVWYH+  G KIFYLI P    +  +  W    N   +FF DQ+ K         Y+  +K G T+ +P GWIHAV T  D L FGGNF+HSL+I +QLK Y+IE+ L T D F FP FE + W+V ++IL
Sbjct:  108 GNQLTVEFLEENSFSVPILVLKKDGLGMTLPSPSFTVRDVEHYVGSDKEIDVIDVTRQADCKMKLGDFVKYYYSGK-REKVLNVISLEFSDTRLSNLVETPKIVRKLSWVENLWPEECVFER---PNVQKYCLMSVRDSYTDFHIDFGGTSVWYHVLKGEKIFYLIRPTNANLTLFECWSSSSNQNEMFFGDQVDK--------CYKCSVKQGQTLFIPTGWIHAVLTPVDCLAFGGNFLHSLNIEMQLKAYEIEKRLSTADLFRFPNFETICWYVGKHIL 376          
BLAST of Lysine-specific demethylase 7A vs. Ensembl Human
Match: PHF8 (PHD finger protein 8 [Source:HGNC Symbol;Acc:HGNC:20672])

HSP 1 Score: 273.863 bits (699), Expect = 1.979e-78
Identity = 130/281 (46.26%), Postives = 187/281 (66.55%), Query Frame = 1
Query:  235 GKEVTEDYFIKNGFNKPIMIRRKKGLRIVLPESPFSVEDVGRNLGKDYILDVIDVVQQDQYKMRFGEFLDYFRESEPRSKLLNVLSLEISHTKIAHLVEPPYVIKEMSIVEKLWPCDNLYQRANKPSVQKYCLMSMKDSWTDFHIDFGGSSVWYHMYSGHKIFYLIPPKRRYIKAYTSWMGEYNNRMLFFPDQIKKFSLNDQAEVYRLEIKSGDTILLPAGWIHAVHTLEDSLVFGGNFVHSLSIPLQLKIYKIERFLQTEDRFLFPYFEKLHWFVAEYIL 1077
            G ++T ++  +N F+ PI++ +K GL + LP   F+V DV   +G D  +DVIDV +Q   KM+ G+F+ Y+   + R K+LNV+SLE S T++++LVE P +++++S VE LWP + +++R   P+VQKYCLMS++DS+TDFHIDFGG+SVWYH+  G KIFYLI P    +  +  W    N   +FF DQ+ K         Y+  +K G T+ +P GWIHAV T  D L FGGNF+HSL+I +QLK Y+IE+ L T D F FP FE + W+V ++IL
Sbjct:  144 GNQLTVEFLEENSFSVPILVLKKDGLGMTLPSPSFTVRDVEHYVGSDKEIDVIDVTRQADCKMKLGDFVKYYYSGK-REKVLNVISLEFSDTRLSNLVETPKIVRKLSWVENLWPEECVFER---PNVQKYCLMSVRDSYTDFHIDFGGTSVWYHVLKGEKIFYLIRPTNANLTLFECWSSSSNQNEMFFGDQVDK--------CYKCSVKQGQTLFIPTGWIHAVLTPVDCLAFGGNFLHSLNIEMQLKAYEIEKRLSTADLFRFPNFETICWYVGKHIL 412          
BLAST of Lysine-specific demethylase 7A vs. Ensembl Celegans
Match: jmjd-1.2 (Lysine-specific demethylase 7 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q9GYI0])

HSP 1 Score: 206.068 bits (523), Expect = 1.015e-55
Identity = 114/295 (38.64%), Postives = 172/295 (58.31%), Query Frame = 1
Query:  268 NGFNKPIMIRRKKGLRIVLPESPFSVEDVGRNLGKDYILDVIDVVQQDQYKMRFGEFLDYFRESEPRSKLLNVLSLEIS-HTKIAHLVEPPYVIKEMSIVEKLWPCDN------LYQRA------NKPSVQKYCLMSMKDSWTDFHIDFGGSSVWYHMYSGHKIFYLIPPKRRYIKAYTSWMGEYNNRMLFFPDQIKKFSLNDQAEVYRLEIKSGDTILLPAGWIHAVHTLEDSLVFGGNFVHSLSIPLQLKIYKIE----RFLQTEDRFLFPYFEKLHW-FVAEYILHKL-EAN 1095
            + + K  M++   GL + +P+  F +EDV + +G DY +D IDV  Q  Y M+   F   FR+++ R  L N LSLE S + ++  + +PP  ++E+S+V +LWP  +      L QR        +P V+++CL  M  S+TDFH+DFGGSSV+YH+  G KIFY+  P  +   AY +            PD    F       V R+ IK G T+L+PAGWIHAV T  DSLVFGGNF+H  ++ +Q+++Y +E    + +++E++F FP FE LHW ++   +L K+ EAN
Sbjct:  363 DNWGKVFMVKDMDGLNMTMPKPGFDLEDVVKIMGSDYEVDTIDVYNQSTYSMKLDTFRKLFRDTKNRPLLYNFLSLEFSDNNEMKEIAKPPRFVQEISMVNRLWPDVSGAEYIKLLQREEYLPEDQRPKVEQFCLAGMAGSYTDFHVDFGGSSVYYHILKGEKIFYIAAPTEQNFAAYQAHETS--------PDTTTWFGDIANGAVKRVVIKEGQTLLIPAGWIHAVLTPVDSLVFGGNFLHLGNLEMQMRVYHLENAIRKEIRSEEKFYFPNFELLHWMYMRNVLLEKITEAN 649          
BLAST of Lysine-specific demethylase 7A vs. Ensembl Celegans
Match: jmjd-1.2 (Lysine-specific demethylase 7 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q9GYI0])

HSP 1 Score: 206.068 bits (523), Expect = 1.264e-55
Identity = 114/295 (38.64%), Postives = 172/295 (58.31%), Query Frame = 1
Query:  268 NGFNKPIMIRRKKGLRIVLPESPFSVEDVGRNLGKDYILDVIDVVQQDQYKMRFGEFLDYFRESEPRSKLLNVLSLEIS-HTKIAHLVEPPYVIKEMSIVEKLWPCDN------LYQRA------NKPSVQKYCLMSMKDSWTDFHIDFGGSSVWYHMYSGHKIFYLIPPKRRYIKAYTSWMGEYNNRMLFFPDQIKKFSLNDQAEVYRLEIKSGDTILLPAGWIHAVHTLEDSLVFGGNFVHSLSIPLQLKIYKIE----RFLQTEDRFLFPYFEKLHW-FVAEYILHKL-EAN 1095
            + + K  M++   GL + +P+  F +EDV + +G DY +D IDV  Q  Y M+   F   FR+++ R  L N LSLE S + ++  + +PP  ++E+S+V +LWP  +      L QR        +P V+++CL  M  S+TDFH+DFGGSSV+YH+  G KIFY+  P  +   AY +            PD    F       V R+ IK G T+L+PAGWIHAV T  DSLVFGGNF+H  ++ +Q+++Y +E    + +++E++F FP FE LHW ++   +L K+ EAN
Sbjct:  382 DNWGKVFMVKDMDGLNMTMPKPGFDLEDVVKIMGSDYEVDTIDVYNQSTYSMKLDTFRKLFRDTKNRPLLYNFLSLEFSDNNEMKEIAKPPRFVQEISMVNRLWPDVSGAEYIKLLQREEYLPEDQRPKVEQFCLAGMAGSYTDFHVDFGGSSVYYHILKGEKIFYIAAPTEQNFAAYQAHETS--------PDTTTWFGDIANGAVKRVVIKEGQTLLIPAGWIHAVLTPVDSLVFGGNFLHLGNLEMQMRVYHLENAIRKEIRSEEKFYFPNFELLHWMYMRNVLLEKITEAN 668          
BLAST of Lysine-specific demethylase 7A vs. Ensembl Celegans
Match: jmjd-1.2 (Lysine-specific demethylase 7 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q9GYI0])

HSP 1 Score: 205.682 bits (522), Expect = 1.342e-55
Identity = 114/295 (38.64%), Postives = 172/295 (58.31%), Query Frame = 1
Query:  268 NGFNKPIMIRRKKGLRIVLPESPFSVEDVGRNLGKDYILDVIDVVQQDQYKMRFGEFLDYFRESEPRSKLLNVLSLEIS-HTKIAHLVEPPYVIKEMSIVEKLWPCDN------LYQRA------NKPSVQKYCLMSMKDSWTDFHIDFGGSSVWYHMYSGHKIFYLIPPKRRYIKAYTSWMGEYNNRMLFFPDQIKKFSLNDQAEVYRLEIKSGDTILLPAGWIHAVHTLEDSLVFGGNFVHSLSIPLQLKIYKIE----RFLQTEDRFLFPYFEKLHW-FVAEYILHKL-EAN 1095
            + + K  M++   GL + +P+  F +EDV + +G DY +D IDV  Q  Y M+   F   FR+++ R  L N LSLE S + ++  + +PP  ++E+S+V +LWP  +      L QR        +P V+++CL  M  S+TDFH+DFGGSSV+YH+  G KIFY+  P  +   AY +            PD    F       V R+ IK G T+L+PAGWIHAV T  DSLVFGGNF+H  ++ +Q+++Y +E    + +++E++F FP FE LHW ++   +L K+ EAN
Sbjct:  350 DNWGKVFMVKDMDGLNMTMPKPGFDLEDVVKIMGSDYEVDTIDVYNQSTYSMKLDTFRKLFRDTKNRPLLYNFLSLEFSDNNEMKEIAKPPRFVQEISMVNRLWPDVSGAEYIKLLQREEYLPEDQRPKVEQFCLAGMAGSYTDFHVDFGGSSVYYHILKGEKIFYIAAPTEQNFAAYQAHETS--------PDTTTWFGDIANGAVKRVVIKEGQTLLIPAGWIHAVLTPVDSLVFGGNFLHLGNLEMQMRVYHLENAIRKEIRSEEKFYFPNFELLHWMYMRNVLLEKITEAN 636          
BLAST of Lysine-specific demethylase 7A vs. Ensembl Celegans
Match: jhdm-1 (JmjC domain-containing histone demethylation protein 1 [Source:UniProtKB/Swiss-Prot;Acc:Q95Q98])

HSP 1 Score: 199.519 bits (506), Expect = 3.295e-55
Identity = 116/292 (39.73%), Postives = 169/292 (57.88%), Query Frame = 1
Query:  253 DYFIKNGFNKPIMIR-RKKGLRIVLPESPFSVEDVGRNLGKDYILDVIDVVQQDQYKMRFGEFLDYFRE-SEPRSKLLNVLSLEISHTKIAHLVEPPYVIKEMSIVEKLWPCDNLYQR---------------ANKPSVQKYCLMSMKDSWTDFHIDFGGSSVWYHMYSGHKIFYLIPPKRRYIKAYTSWMGEYNNRMLFFPDQIKKFSLNDQAEVYRLEIKSGDTILLPAGWIHAVHTLEDSLVFGGNFVHSLSIPLQLKIYKIERFLQTEDRFLFPYFEKLHWFV-AEYI 1074
            +++ KNG + PI  R   K + + LP   FSV+DV   +G + +++V+ V  Q   KM   EF+++++   E R  L NVLSLE S T +  LV+ P +++++  V   WP D L QR                  P VQ YCLMS+ + +TDFHIDF G+SVWYH+  G K+F+LIPP       Y  ++   N+   FF   ++K        V  LE   GDT+L+P+GWIHAV+T +DSLVFGGNF+HS S   QL++Y++E  L    +F  PY E+L ++V A+Y+
Sbjct:   82 EFYDKNGLDNPIHFRCDPKRIGMTLPSPDFSVDDVLELVGGNRMIEVVQVQNQGSVKMSLQEFINFYKTPQEKREVLYNVLSLEFSQTPLEDLVKSPELVRQIDWVGNQWP-DALRQRWISFNGRDKKFYNPHHTFPKVQNYCLMSVANCYTDFHIDFSGTSVWYHVLKGRKVFWLIPPTETNFFIYQEFIKTVNDNA-FFGKSVEK------CHVAILE--PGDTMLIPSGWIHAVYTPDDSLVFGGNFLHSQSCKTQLRVYQVENKLNITRKFRLPYNEELIFYVIADYV 363          
BLAST of Lysine-specific demethylase 7A vs. Ensembl Celegans
Match: jhdm-1 (JmjC domain-containing histone demethylation protein 1 [Source:UniProtKB/Swiss-Prot;Acc:Q95Q98])

HSP 1 Score: 199.519 bits (506), Expect = 4.132e-53
Identity = 117/292 (40.07%), Postives = 171/292 (58.56%), Query Frame = 1
Query:  253 DYFIKNGFNKPIMIR-RKKGLRIVLPESPFSVEDVGRNLGKDYILDVIDVVQQDQYKMRFGEFLDYFRE-SEPRSKLLNVLSLEISHTKIAHLVEPPYVIKEMSIVEKLWPCDNLYQR------ANK---------PSVQKYCLMSMKDSWTDFHIDFGGSSVWYHMYSGHKIFYLIPPKRRYIKAYTSWMGEYNNRMLFFPDQIKKFSLNDQAEVYRLEIKSGDTILLPAGWIHAVHTLEDSLVFGGNFVHSLSIPLQLKIYKIERFLQTEDRFLFPYFEKLHWFV-AEYI 1074
            +++ KNG + PI  R   K + + LP   FSV+DV   +G + +++V+ V  Q   KM   EF+++++   E R  L NVLSLE S T +  LV+ P +++++  V   WP D L QR       +K         P VQ YCLMS+ + +TDFHIDF G+SVWYH+  G K+F+LIPP       Y  ++   N+   FF   ++K        V  LE   GDT+L+P+GWIHAV+T +DSLVFGGNF+HS S   QL++Y++E  L    +F  PY E+L ++V A+Y+
Sbjct:   82 EFYDKNGLDNPIHFRCDPKRIGMTLPSPDFSVDDVLELVGGNRMIEVVQVQNQGSVKMSLQEFINFYKTPQEKREVLYNVLSLEFSQTPLEDLVKSPELVRQIDWVGNQWP-DALRQRWISFNGRDKKFYNPHHTFPKVQNYCLMSVANCYTDFHIDFSGTSVWYHVLKGRKVFWLIPPTETNFFIYQEFIKTVNDNA-FFGKSVEK------CHVAILE--PGDTMLIPSGWIHAVYTPDDSLVFGGNFLHSQSCKTQLRVYQVENKLNITRKFRLPYNEELIFYVIADYV 363          
BLAST of Lysine-specific demethylase 7A vs. Ensembl Fly
Match: Kdm2 (gene:FBgn0037659 transcript:FBtr0336759)

HSP 1 Score: 231.491 bits (589), Expect = 1.579e-63
Identity = 122/321 (38.01%), Postives = 189/321 (58.88%), Query Frame = 1
Query:  160 GTKEF--LEYLQEKQCLPIGDQLKELRGKEVTEDYFIKNGFNKPIMIRRKKGLRIVLPE-SPFSVEDVGRNLGKDYILDVIDVVQQDQYKMRFGEFLDYFRESEPRSKLLNVLSLEISHTKIAHLVEPPYVIKEMSIVEKLWP---------CDNLYQRANKPSVQKYCLMSMKDSWTDFHIDFGGSSVWYHMYSGHKIFYLIPPKRRYIKAYTSWMGEYNNRMLFFPDQIKKFSLNDQAEVYRLEIKSGDTILLPAGWIHAVHTLEDSLVFGGNFVHSLSIPLQLKIYKIERFLQTEDRFLFPYFEKLHWFVAEYILHKL 1086
            GT+ F   E L+  +    G  ++E+RG ++T  +  ++GFN P++ R K GL + +P+   F+V DV   +G   +LDV+DV  Q   +M   E+  Y+ +S  + +LLNV+SLE SHT++   V+ P +++++  V+ +WP           NL      P VQKYCLMS+K+ +TDFHIDFGG+SVWYH+  G K+F+LIPP  R ++ Y  W+       +FF D ++K +        R+ + +G+T  +P GWIHAV+T   SLVFGGNF+HS  I  QLK   +E   +   +F +P+F ++ W+V    +H L
Sbjct:   66 GTRGFSVAEKLESSKFAQAG-MVREMRGCDLTVAFLQQHGFNIPLLFRDKAGLGLRMPDPQEFTVNDVRLCVGSRRLLDVMDVNTQKNLQMTMKEWQQYY-DSPQKDRLLNVISLEFSHTRLDRFVQSPEIVRQIDWVDVVWPKQLKDAQREGTNLLGGMMYPKVQKYCLMSVKNCYTDFHIDFGGTSVWYHILRGSKVFWLIPPTDRNLQLYEKWVLSGKQADIFFGDTVEKCA--------RVYLTAGNTFFIPTGWIHAVYTPTQSLVFGGNFLHSFGIVKQLKTASVEDSTKVPQKFRYPFFTEMLWYVLARYVHTL 376          
BLAST of Lysine-specific demethylase 7A vs. Ensembl Fly
Match: Kdm2 (gene:FBgn0037659 transcript:FBtr0300691)

HSP 1 Score: 231.491 bits (589), Expect = 1.579e-63
Identity = 122/321 (38.01%), Postives = 189/321 (58.88%), Query Frame = 1
Query:  160 GTKEF--LEYLQEKQCLPIGDQLKELRGKEVTEDYFIKNGFNKPIMIRRKKGLRIVLPE-SPFSVEDVGRNLGKDYILDVIDVVQQDQYKMRFGEFLDYFRESEPRSKLLNVLSLEISHTKIAHLVEPPYVIKEMSIVEKLWP---------CDNLYQRANKPSVQKYCLMSMKDSWTDFHIDFGGSSVWYHMYSGHKIFYLIPPKRRYIKAYTSWMGEYNNRMLFFPDQIKKFSLNDQAEVYRLEIKSGDTILLPAGWIHAVHTLEDSLVFGGNFVHSLSIPLQLKIYKIERFLQTEDRFLFPYFEKLHWFVAEYILHKL 1086
            GT+ F   E L+  +    G  ++E+RG ++T  +  ++GFN P++ R K GL + +P+   F+V DV   +G   +LDV+DV  Q   +M   E+  Y+ +S  + +LLNV+SLE SHT++   V+ P +++++  V+ +WP           NL      P VQKYCLMS+K+ +TDFHIDFGG+SVWYH+  G K+F+LIPP  R ++ Y  W+       +FF D ++K +        R+ + +G+T  +P GWIHAV+T   SLVFGGNF+HS  I  QLK   +E   +   +F +P+F ++ W+V    +H L
Sbjct:   66 GTRGFSVAEKLESSKFAQAG-MVREMRGCDLTVAFLQQHGFNIPLLFRDKAGLGLRMPDPQEFTVNDVRLCVGSRRLLDVMDVNTQKNLQMTMKEWQQYY-DSPQKDRLLNVISLEFSHTRLDRFVQSPEIVRQIDWVDVVWPKQLKDAQREGTNLLGGMMYPKVQKYCLMSVKNCYTDFHIDFGGTSVWYHILRGSKVFWLIPPTDRNLQLYEKWVLSGKQADIFFGDTVEKCA--------RVYLTAGNTFFIPTGWIHAVYTPTQSLVFGGNFLHSFGIVKQLKTASVEDSTKVPQKFRYPFFTEMLWYVLARYVHTL 376          
BLAST of Lysine-specific demethylase 7A vs. Ensembl Fly
Match: Kdm2 (gene:FBgn0037659 transcript:FBtr0336760)

HSP 1 Score: 231.491 bits (589), Expect = 1.579e-63
Identity = 122/321 (38.01%), Postives = 189/321 (58.88%), Query Frame = 1
Query:  160 GTKEF--LEYLQEKQCLPIGDQLKELRGKEVTEDYFIKNGFNKPIMIRRKKGLRIVLPE-SPFSVEDVGRNLGKDYILDVIDVVQQDQYKMRFGEFLDYFRESEPRSKLLNVLSLEISHTKIAHLVEPPYVIKEMSIVEKLWP---------CDNLYQRANKPSVQKYCLMSMKDSWTDFHIDFGGSSVWYHMYSGHKIFYLIPPKRRYIKAYTSWMGEYNNRMLFFPDQIKKFSLNDQAEVYRLEIKSGDTILLPAGWIHAVHTLEDSLVFGGNFVHSLSIPLQLKIYKIERFLQTEDRFLFPYFEKLHWFVAEYILHKL 1086
            GT+ F   E L+  +    G  ++E+RG ++T  +  ++GFN P++ R K GL + +P+   F+V DV   +G   +LDV+DV  Q   +M   E+  Y+ +S  + +LLNV+SLE SHT++   V+ P +++++  V+ +WP           NL      P VQKYCLMS+K+ +TDFHIDFGG+SVWYH+  G K+F+LIPP  R ++ Y  W+       +FF D ++K +        R+ + +G+T  +P GWIHAV+T   SLVFGGNF+HS  I  QLK   +E   +   +F +P+F ++ W+V    +H L
Sbjct:   66 GTRGFSVAEKLESSKFAQAG-MVREMRGCDLTVAFLQQHGFNIPLLFRDKAGLGLRMPDPQEFTVNDVRLCVGSRRLLDVMDVNTQKNLQMTMKEWQQYY-DSPQKDRLLNVISLEFSHTRLDRFVQSPEIVRQIDWVDVVWPKQLKDAQREGTNLLGGMMYPKVQKYCLMSVKNCYTDFHIDFGGTSVWYHILRGSKVFWLIPPTDRNLQLYEKWVLSGKQADIFFGDTVEKCA--------RVYLTAGNTFFIPTGWIHAVYTPTQSLVFGGNFLHSFGIVKQLKTASVEDSTKVPQKFRYPFFTEMLWYVLARYVHTL 376          
BLAST of Lysine-specific demethylase 7A vs. Ensembl Fly
Match: Kdm2 (gene:FBgn0037659 transcript:FBtr0336758)

HSP 1 Score: 231.491 bits (589), Expect = 1.579e-63
Identity = 122/321 (38.01%), Postives = 189/321 (58.88%), Query Frame = 1
Query:  160 GTKEF--LEYLQEKQCLPIGDQLKELRGKEVTEDYFIKNGFNKPIMIRRKKGLRIVLPE-SPFSVEDVGRNLGKDYILDVIDVVQQDQYKMRFGEFLDYFRESEPRSKLLNVLSLEISHTKIAHLVEPPYVIKEMSIVEKLWP---------CDNLYQRANKPSVQKYCLMSMKDSWTDFHIDFGGSSVWYHMYSGHKIFYLIPPKRRYIKAYTSWMGEYNNRMLFFPDQIKKFSLNDQAEVYRLEIKSGDTILLPAGWIHAVHTLEDSLVFGGNFVHSLSIPLQLKIYKIERFLQTEDRFLFPYFEKLHWFVAEYILHKL 1086
            GT+ F   E L+  +    G  ++E+RG ++T  +  ++GFN P++ R K GL + +P+   F+V DV   +G   +LDV+DV  Q   +M   E+  Y+ +S  + +LLNV+SLE SHT++   V+ P +++++  V+ +WP           NL      P VQKYCLMS+K+ +TDFHIDFGG+SVWYH+  G K+F+LIPP  R ++ Y  W+       +FF D ++K +        R+ + +G+T  +P GWIHAV+T   SLVFGGNF+HS  I  QLK   +E   +   +F +P+F ++ W+V    +H L
Sbjct:   66 GTRGFSVAEKLESSKFAQAG-MVREMRGCDLTVAFLQQHGFNIPLLFRDKAGLGLRMPDPQEFTVNDVRLCVGSRRLLDVMDVNTQKNLQMTMKEWQQYY-DSPQKDRLLNVISLEFSHTRLDRFVQSPEIVRQIDWVDVVWPKQLKDAQREGTNLLGGMMYPKVQKYCLMSVKNCYTDFHIDFGGTSVWYHILRGSKVFWLIPPTDRNLQLYEKWVLSGKQADIFFGDTVEKCA--------RVYLTAGNTFFIPTGWIHAVYTPTQSLVFGGNFLHSFGIVKQLKTASVEDSTKVPQKFRYPFFTEMLWYVLARYVHTL 376          
BLAST of Lysine-specific demethylase 7A vs. Ensembl Fly
Match: PSR (gene:FBgn0038948 transcript:FBtr0330378)

HSP 1 Score: 56.6102 bits (135), Expect = 5.059e-8
Identity = 39/139 (28.06%), Postives = 67/139 (48.20%), Query Frame = 1
Query:  583 DNLYQRA--NKPSVQKYCLMSMKDSWTDFHIDFGGSSVWYHMYSGHKIFYLIPPKR-RYIKAYTSWMG--EYNNRMLFFPDQIKKFSLNDQAEVYR-LEI--KSGDTILLPAGWIHAVHTLEDSLVFGGNFVHSLSIPL 975
            D+L+Q    N+    ++ +M    S T  HID  G+S W  +  GHK + L P +  + +   TS MG  + +  + +F     +  L    E YR +E+   +G+T+ +P GW H V  ++D++    NF    + P 
Sbjct:  163 DDLFQYCGENRRPPYRWFVMGPARSGTGIHIDPLGTSAWNTLIRGHKRWCLFPTQTPKELLKVTSAMGGKQRDEAITWFSTIYPRTQLPSWPEQYRPIEVLQGAGETVFVPGGWWHVVLNMDDTIAITQNFSSQTNFPC 301          
BLAST of Lysine-specific demethylase 7A vs. Ensembl Zebrafish
Match: kdm7aa (lysine (K)-specific demethylase 7Aa [Source:NCBI gene;Acc:321248])

HSP 1 Score: 283.878 bits (725), Expect = 1.079e-85
Identity = 146/316 (46.20%), Postives = 208/316 (65.82%), Query Frame = 1
Query:  145 TMPL-SGTKEFLEYLQEKQCLPIGDQLKELRGKEVTEDYFIKNGFNKPIMIRRKKGLRIVLPESPFSVEDVGRNLGKDYILDVIDVVQQDQYKMRFGEFLDYFRESEPRSKLLNVLSLEISHTKIAHLVEPPYVIKEMSIVEKLWPCDNLYQRANKPSVQKYCLMSMKDSWTDFHIDFGGSSVWYHMYSGHKIFYLIPPKRRYIKAYTSWMGEYNNRMLFFPDQIKKFSLNDQAEVYRLEIKSGDTILLPAGWIHAVHTLEDSLVFGGNFVHSLSIPLQLKIYKIERFLQTEDRFLFPYFEKLHWFVAEYILHKLE 1089
            T P+ +GT  F++ LQ +     GD L +++G +VT+ +  K GFN PI++    GL + LP   FSV DV   +G + ++DVIDV +Q   KM+ GEF+ Y+ + E R K+LNV+SLE S T++++LV  P + ++MS VE  WP D+ +    KP VQKYCLM MK+S+TDFHIDFGG+SVWYH+  G KIFYLI P +  +  Y +W    N   +FF +++ K         Y+  +K G TILLP GWIHAV T +DS+ FGGNF+H+L+I +QL+ Y++ER L+T D F FPYFE + W+VA+ +L  L+
Sbjct:   80 TRPVQAGTAVFVKELQARS-FASGDILVQMQGNQVTKRFLEKEGFNYPIVVHDLDGLGLKLPPPSFSVSDVEHYVGANKVIDVIDVAKQADSKMKLGEFVKYYYQPE-RPKVLNVISLEFSDTRMSNLVVVPDIAQKMSWVENYWPDDSFFP---KPFVQKYCLMGMKNSYTDFHIDFGGTSVWYHVLWGEKIFYLIKPTKANLALYEAWSSSPNQSEVFFGEKVDK--------CYKCVVKQGTTILLPTGWIHAVLTSQDSMAFGGNFLHNLNIDMQLRCYEMERRLKTPDLFKFPYFEAICWYVAKNLLETLK 382          
BLAST of Lysine-specific demethylase 7A vs. Ensembl Zebrafish
Match: kdm7aa (lysine (K)-specific demethylase 7Aa [Source:NCBI gene;Acc:321248])

HSP 1 Score: 284.263 bits (726), Expect = 8.846e-84
Identity = 146/316 (46.20%), Postives = 208/316 (65.82%), Query Frame = 1
Query:  145 TMPL-SGTKEFLEYLQEKQCLPIGDQLKELRGKEVTEDYFIKNGFNKPIMIRRKKGLRIVLPESPFSVEDVGRNLGKDYILDVIDVVQQDQYKMRFGEFLDYFRESEPRSKLLNVLSLEISHTKIAHLVEPPYVIKEMSIVEKLWPCDNLYQRANKPSVQKYCLMSMKDSWTDFHIDFGGSSVWYHMYSGHKIFYLIPPKRRYIKAYTSWMGEYNNRMLFFPDQIKKFSLNDQAEVYRLEIKSGDTILLPAGWIHAVHTLEDSLVFGGNFVHSLSIPLQLKIYKIERFLQTEDRFLFPYFEKLHWFVAEYILHKLE 1089
            T P+ +GT  F++ LQ +     GD L +++G +VT+ +  K GFN PI++    GL + LP   FSV DV   +G + ++DVIDV +Q   KM+ GEF+ Y+ + E R K+LNV+SLE S T++++LV  P + ++MS VE  WP D+ +    KP VQKYCLM MK+S+TDFHIDFGG+SVWYH+  G KIFYLI P +  +  Y +W    N   +FF +++ K         Y+  +K G TILLP GWIHAV T +DS+ FGGNF+H+L+I +QL+ Y++ER L+T D F FPYFE + W+VA+ +L  L+
Sbjct:   80 TRPVQAGTAVFVKELQARS-FASGDILVQMQGNQVTKRFLEKEGFNYPIVVHDLDGLGLKLPPPSFSVSDVEHYVGANKVIDVIDVAKQADSKMKLGEFVKYYYQPE-RPKVLNVISLEFSDTRMSNLVVVPDIAQKMSWVENYWPDDSFFP---KPFVQKYCLMGMKNSYTDFHIDFGGTSVWYHVLWGEKIFYLIKPTKANLALYEAWSSSPNQSEVFFGEKVDK--------CYKCVVKQGTTILLPTGWIHAVLTSQDSMAFGGNFLHNLNIDMQLRCYEMERRLKTPDLFKFPYFEAICWYVAKNLLETLK 382          
BLAST of Lysine-specific demethylase 7A vs. Ensembl Zebrafish
Match: kdm7aa (lysine (K)-specific demethylase 7Aa [Source:NCBI gene;Acc:321248])

HSP 1 Score: 284.263 bits (726), Expect = 1.979e-83
Identity = 146/316 (46.20%), Postives = 208/316 (65.82%), Query Frame = 1
Query:  145 TMPL-SGTKEFLEYLQEKQCLPIGDQLKELRGKEVTEDYFIKNGFNKPIMIRRKKGLRIVLPESPFSVEDVGRNLGKDYILDVIDVVQQDQYKMRFGEFLDYFRESEPRSKLLNVLSLEISHTKIAHLVEPPYVIKEMSIVEKLWPCDNLYQRANKPSVQKYCLMSMKDSWTDFHIDFGGSSVWYHMYSGHKIFYLIPPKRRYIKAYTSWMGEYNNRMLFFPDQIKKFSLNDQAEVYRLEIKSGDTILLPAGWIHAVHTLEDSLVFGGNFVHSLSIPLQLKIYKIERFLQTEDRFLFPYFEKLHWFVAEYILHKLE 1089
            T P+ +GT  F++ LQ +     GD L +++G +VT+ +  K GFN PI++    GL + LP   FSV DV   +G + ++DVIDV +Q   KM+ GEF+ Y+ + E R K+LNV+SLE S T++++LV  P + ++MS VE  WP D+ +    KP VQKYCLM MK+S+TDFHIDFGG+SVWYH+  G KIFYLI P +  +  Y +W    N   +FF +++ K         Y+  +K G TILLP GWIHAV T +DS+ FGGNF+H+L+I +QL+ Y++ER L+T D F FPYFE + W+VA+ +L  L+
Sbjct:   80 TRPVQAGTAVFVKELQARS-FASGDILVQMQGNQVTKRFLEKEGFNYPIVVHDLDGLGLKLPPPSFSVSDVEHYVGANKVIDVIDVAKQADSKMKLGEFVKYYYQPE-RPKVLNVISLEFSDTRMSNLVVVPDIAQKMSWVENYWPDDSFFP---KPFVQKYCLMGMKNSYTDFHIDFGGTSVWYHVLWGEKIFYLIKPTKANLALYEAWSSSPNQSEVFFGEKVDK--------CYKCVVKQGTTILLPTGWIHAVLTSQDSMAFGGNFLHNLNIDMQLRCYEMERRLKTPDLFKFPYFEAICWYVAKNLLETLK 382          
BLAST of Lysine-specific demethylase 7A vs. Ensembl Zebrafish
Match: kdm7ab (pep chromosome:GRCz11:CHR_ALT_CTG25_1_10:17244337:17292043:1 gene:ENSDARG00000116755.1 transcript:ENSDART00000162165.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:kdm7ab)

HSP 1 Score: 269.24 bits (687), Expect = 1.116e-82
Identity = 139/313 (44.41%), Postives = 202/313 (64.54%), Query Frame = 1
Query:  157 SGTKEFLEYLQEKQCLPIGDQ-LKELRGKEVTEDYFIKNGFNKPIMIRRKKGLRIVLPESPFSVEDVGRNLGKDYILDVIDVVQQDQYKMRFGEFLDYFRESEPRSKLLNVLSLEISHTKIAHLVEPPYVIKEMSIVEKLWPCDNLYQRANKPSVQKYCLMSMKDSWTDFHIDFGGSSVWYHMYSGHKIFYLIPPKRRYIKAYTSWMGEYNNRMLFFPDQIKKFSLNDQAEVYRLEIKSGDTILLPAGWIHAVHTLEDSLVFGGNFVHSLSIPLQLKIYKIERFLQTEDRFLFPYFEKLHWFVAEYILHKLEA 1092
            +GT  F+  LQ +   P GD+ L+ + G +VT+ Y  ++GF  PI++ +++ L + LP   FS++DV R +G + ++DVIDV +Q   KM+   F+ Y+  S  R K+LNV+SLE S TK+A LV  P + ++MS VE  WP D+ +    KP VQKYCLM +KDS+TDFHIDFGG+SVWYH+  G KIFYLI P    +  Y  W    N   +FF +++ K         Y+  ++ G T+L+P GWIHAV T +D + FGGNF+H+L+I +QL+ Y++ER L+T D F FPYFE + W+VA+ +L  L+ 
Sbjct:   85 AGTSVFVRELQART-FPSGDEILQPMHGGQVTQRYLERHGFRYPIIVSKREELGLRLPPPDFSIKDVERYVGGNKVIDVIDVARQADSKMKLKAFVKYYY-SPQRPKVLNVISLEFSDTKMAELVVVPDIAQKMSWVENYWPDDSYFP---KPFVQKYCLMGVKDSYTDFHIDFGGTSVWYHVLWGEKIFYLIKPTPANLALYEEWSSSPNQSEVFFGEKVDK--------CYKCVVRQGTTLLIPTGWIHAVLTSQDCMAFGGNFLHNLNIGMQLRCYEMERRLKTPDLFKFPYFEAICWYVAKNLLETLKG 384          
BLAST of Lysine-specific demethylase 7A vs. Ensembl Zebrafish
Match: kdm7ab (lysine (K)-specific demethylase 7Ab [Source:NCBI gene;Acc:503902])

HSP 1 Score: 273.478 bits (698), Expect = 1.941e-79
Identity = 141/318 (44.34%), Postives = 204/318 (64.15%), Query Frame = 1
Query:  157 SGTKEFLEYLQEKQCLPIGDQ-LKELRGKEVTEDYFIKNGFNKPIMIRRKKGLRIVLPESPFSVEDVGRNLGKDYILDVIDVVQQDQYKMRFGEFLDYFRESEPRSKLLNVLSLEISHTKIAHLVEPPYVIKEMSIVEKLWPCDNLYQRANKPSVQKYCLMSMKDSWTDFHIDFGGSSVWYHMYSGHKIFYLIPPKRRYIKAYTSWMGEYNNRMLFFPDQIKKFSLNDQAEVYRLEIKSGDTILLPAGWIHAVHTLEDSLVFGGNFVHSLSIPLQLKIYKIERFLQTEDRFLFPYFEKLHWFVAEYILHKLEANLTHN 1107
            +GT  F+  LQ +   P GD+ L+ + G +VT+ Y  ++GF  PI++ +++ L + LP   FS++DV R +G D ++DVIDV +Q   KM+   F+ Y+  S  R K+LNV+SLE S TK+A LV  P + ++MS VE  WP D+ +    KP VQKYCLM +KDS+TDFHIDFGG+SVWYH+  G KIFYLI P    +  Y  W    N   +FF +++ K         Y+  ++ G T+L+P GWIHAV T +D + FGGNF+H+L+I +QL+ Y++ER L+T D F FPYFE + W+VA+ +L  L+ +   N
Sbjct:   85 AGTSVFVRELQART-FPSGDEILQPMHGGQVTQRYLERHGFRYPIIVSKREELGLRLPPPDFSIKDVERYVGGDKVIDVIDVARQADSKMKLKAFVKYYY-SPQRPKVLNVISLEFSDTKMAELVVVPDIAQKMSWVENYWPDDSYFP---KPFVQKYCLMGVKDSYTDFHIDFGGTSVWYHVLWGEKIFYLIKPTPANLALYEEWSSSPNQSEVFFGEKVDK--------CYKCVVRQGTTLLIPTGWIHAVLTSQDCMAFGGNFLHNLNIGMQLRCYEMERRLKTPDLFKFPYFEAICWYVAKNLLETLKESREEN 389          
BLAST of Lysine-specific demethylase 7A vs. Ensembl Xenopus
Match: kdm7a (lysine (K)-specific demethylase 7A [Source:NCBI gene;Acc:780121])

HSP 1 Score: 274.248 bits (700), Expect = 1.372e-79
Identity = 157/383 (40.99%), Postives = 225/383 (58.75%), Query Frame = 1
Query:  145 TMPL-SGTKEFLEYLQEKQCLPIGDQLKELRGKEVTEDYFIKNGFNKPIMIRRKKGLRIVLPESPFSVEDVGRNLGKDYILDVIDVVQQDQYKMRFGEFLDYFRESEPRSKLLNVLSLEISHTKIAHLVEPPYVIKEMSIVEKLWPCDNLYQRANKPSVQKYCLMSMKDSWTDFHIDFGGSSVWYHMYSGHKIFYLIPPKRRYIKAYTSWMGEYNNRMLFFPDQIKKFSLNDQAEVYRLEIKSGDTILLPAGWIHAVHTLEDSLVFGGNFVHSLSIPLQLKIYKIERFLQTEDRFLFPYFEKLHWFVAEYILHKLEANLTHNXXXXXXXXXXXXXXXETLPDWLSKYHTCTPDEREYNYPEKGLMESSKVHLIRKLSDVVKTL 1290
            T P+ +GT+ F++ LQ +      D L ++ G ++T+ Y  K GFN PIM+ R   L + LP   FSV DV R +G + I+DVIDV +Q   KM+   F+ YF   + R K+LNV+SLE S TK+A LV+ P + K++S VE  WP D+ +    KP VQKYCLM ++DS+TDFHIDFGG+SVWYH+  G K+FYLI P    +  Y SW         FF D++ K         Y+  +K G T+ +P GWIHAV T +D + FGGNF+H+L+I +QL+ Y++E+ L+T D F FP+FE + WFVA+ +L  L+        P   +  G   LI  L  W+ K       E  +  P+         HLI++LS V++++
Sbjct:  104 TKPVQAGTRTFIQQLQARSFPSADDLLLKMNGSQLTQRYLEKQGFNLPIMVPRLDDLGLRLPPPTFSVMDVERYVGGEKIIDVIDVARQADSKMKLKNFVKYFMNPD-RPKVLNVISLEFSDTKMADLVKVPDISKKLSWVENYWPDDSFF---TKPFVQKYCLMGVQDSYTDFHIDFGGTSVWYHVLWGEKVFYLIKPSDENLALYESWSSSVTQSEEFFGDKVDK--------CYKCVVKQGHTLFVPTGWIHAVLTSQDCMAFGGNFLHNLNIGMQLRCYEMEKRLKTPDLFKFPFFEAICWFVAKNLLETLKELKEDGFHPPNYLKHGVKALISALKSWMKKESVA---EHAFEIPDN----IRPGHLIKELSKVIRSV 467          
BLAST of Lysine-specific demethylase 7A vs. Ensembl Xenopus
Match: kdm7a (lysine (K)-specific demethylase 7A [Source:NCBI gene;Acc:780121])

HSP 1 Score: 273.863 bits (699), Expect = 2.893e-79
Identity = 142/316 (44.94%), Postives = 200/316 (63.29%), Query Frame = 1
Query:  145 TMPL-SGTKEFLEYLQEKQCLPIGDQLKELRGKEVTEDYFIKNGFNKPIMIRRKKGLRIVLPESPFSVEDVGRNLGKDYILDVIDVVQQDQYKMRFGEFLDYFRESEPRSKLLNVLSLEISHTKIAHLVEPPYVIKEMSIVEKLWPCDNLYQRANKPSVQKYCLMSMKDSWTDFHIDFGGSSVWYHMYSGHKIFYLIPPKRRYIKAYTSWMGEYNNRMLFFPDQIKKFSLNDQAEVYRLEIKSGDTILLPAGWIHAVHTLEDSLVFGGNFVHSLSIPLQLKIYKIERFLQTEDRFLFPYFEKLHWFVAEYILHKLE 1089
            T P+ +GT+ F++ LQ +      D L ++ G ++T+ Y  K GFN PIM+ R   L + LP   FSV DV R +G + I+DVIDV +Q   KM+   F+ YF   + R K+LNV+SLE S TK+A LV+ P + K++S VE  WP D+ +    KP VQKYCLM ++DS+TDFHIDFGG+SVWYH+  G K+FYLI P    +  Y SW         FF D++ K         Y+  +K G T+ +P GWIHAV T +D + FGGNF+H+L+I +QL+ Y++E+ L+T D F FP+FE + WFVA+ +L  L+
Sbjct:   81 TKPVQAGTRTFIQQLQARSFPSADDLLLKMNGSQLTQRYLEKQGFNLPIMVPRLDDLGLRLPPPTFSVMDVERYVGGEKIIDVIDVARQADSKMKLKNFVKYFMNPD-RPKVLNVISLEFSDTKMADLVKVPDISKKLSWVENYWPDDSFF---TKPFVQKYCLMGVQDSYTDFHIDFGGTSVWYHVLWGEKVFYLIKPSDENLALYESWSSSVTQSEEFFGDKVDK--------CYKCVVKQGHTLFVPTGWIHAVLTSQDCMAFGGNFLHNLNIGMQLRCYEMEKRLKTPDLFKFPFFEAICWFVAKNLLETLK 384          
BLAST of Lysine-specific demethylase 7A vs. Ensembl Xenopus
Match: gan (gigaxonin [Source:Xenbase;Acc:XB-GENE-1013088])

HSP 1 Score: 270.781 bits (691), Expect = 3.612e-78
Identity = 131/307 (42.67%), Postives = 198/307 (64.50%), Query Frame = 1
Query:  157 SGTKEFLEYLQEKQCLPIGDQLKELRGKEVTEDYFIKNGFNKPIMIRRKKGLRIVLPESPFSVEDVGRNLGKDYILDVIDVVQQDQYKMRFGEFLDYFRESEPRSKLLNVLSLEISHTKIAHLVEPPYVIKEMSIVEKLWPCDNLYQRANKPSVQKYCLMSMKDSWTDFHIDFGGSSVWYHMYSGHKIFYLIPPKRRYIKAYTSWMGEYNNRMLFFPDQIKKFSLNDQAEVYRLEIKSGDTILLPAGWIHAVHTLEDSLVFGGNFVHSLSIPLQLKIYKIERFLQTEDRFLFPYFEKLHWFVAEYIL 1077
            +G+  F++ L+ +      + + + +G ++T +Y  +N F+ PI++ +K GL + LP   F+V DV   +G +  +DVIDV +Q   KM+  +F+ Y+  S  R K+LNV+SLE S T++ +LVE P +++++S VE LWP  ++++R   P+VQKYCLM +KDS+TDFHIDFGG+SVWYH+  G KIFYLI P +  +  +  W    N   +FF DQ+ K         YR  +K G T+ +P GWIH+V T  D L FGGNF+HSL+I +QL+ Y+IE+ L T D F FP FE + W+V +++L
Sbjct:   85 TGSASFIKELKSRNFPSAEEIILKPQGAQLTVEYLEENSFSVPILVLKKDGLGMTLPAPTFTVSDVEYYVGPEKEIDVIDVTRQADLKMKLKDFVKYYN-SPKREKVLNVISLEFSETRLTNLVETPKIVRKLSWVENLWPEQSVFER---PNVQKYCLMGVKDSYTDFHIDFGGTSVWYHVLKGEKIFYLIQPTKTNLALFECWSSSSNQNEMFFGDQVDK--------CYRCPVKQGQTLFIPTGWIHSVLTPVDCLAFGGNFLHSLNIAIQLRAYEIEKRLSTADLFKFPNFETICWYVGKHLL 379          
BLAST of Lysine-specific demethylase 7A vs. Ensembl Xenopus
Match: gan (gigaxonin [Source:Xenbase;Acc:XB-GENE-1013088])

HSP 1 Score: 268.855 bits (686), Expect = 3.799e-78
Identity = 128/282 (45.39%), Postives = 186/282 (65.96%), Query Frame = 1
Query:  232 RGKEVTEDYFIKNGFNKPIMIRRKKGLRIVLPESPFSVEDVGRNLGKDYILDVIDVVQQDQYKMRFGEFLDYFRESEPRSKLLNVLSLEISHTKIAHLVEPPYVIKEMSIVEKLWPCDNLYQRANKPSVQKYCLMSMKDSWTDFHIDFGGSSVWYHMYSGHKIFYLIPPKRRYIKAYTSWMGEYNNRMLFFPDQIKKFSLNDQAEVYRLEIKSGDTILLPAGWIHAVHTLEDSLVFGGNFVHSLSIPLQLKIYKIERFLQTEDRFLFPYFEKLHWFVAEYIL 1077
            +G ++T +Y  +N F+ PI++ +K GL + LP   F+V DV   +G +  +DVIDV +Q   KM+  +F+ Y+  S  R K+LNV+SLE S T++ +LVE P +++++S VE LWP  ++++R   P+VQKYCLM +KDS+TDFHIDFGG+SVWYH+  G KIFYLI P +  +  +  W    N   +FF DQ+ K         YR  +K G T+ +P GWIH+V T  D L FGGNF+HSL+I +QL+ Y+IE+ L T D F FP FE + W+V +++L
Sbjct:   97 QGAQLTVEYLEENSFSVPILVLKKDGLGMTLPAPTFTVSDVEYYVGPEKEIDVIDVTRQADLKMKLKDFVKYYN-SPKREKVLNVISLEFSETRLTNLVETPKIVRKLSWVENLWPEQSVFER---PNVQKYCLMGVKDSYTDFHIDFGGTSVWYHVLKGEKIFYLIQPTKTNLALFECWSSSSNQNEMFFGDQVDK--------CYRCPVKQGQTLFIPTGWIHSVLTPVDCLAFGGNFLHSLNIAIQLRAYEIEKRLSTADLFKFPNFETICWYVGKHLL 366          
BLAST of Lysine-specific demethylase 7A vs. Ensembl Xenopus
Match: gan (gigaxonin [Source:Xenbase;Acc:XB-GENE-1013088])

HSP 1 Score: 270.781 bits (691), Expect = 6.645e-78
Identity = 131/307 (42.67%), Postives = 198/307 (64.50%), Query Frame = 1
Query:  157 SGTKEFLEYLQEKQCLPIGDQLKELRGKEVTEDYFIKNGFNKPIMIRRKKGLRIVLPESPFSVEDVGRNLGKDYILDVIDVVQQDQYKMRFGEFLDYFRESEPRSKLLNVLSLEISHTKIAHLVEPPYVIKEMSIVEKLWPCDNLYQRANKPSVQKYCLMSMKDSWTDFHIDFGGSSVWYHMYSGHKIFYLIPPKRRYIKAYTSWMGEYNNRMLFFPDQIKKFSLNDQAEVYRLEIKSGDTILLPAGWIHAVHTLEDSLVFGGNFVHSLSIPLQLKIYKIERFLQTEDRFLFPYFEKLHWFVAEYIL 1077
            +G+  F++ L+ +      + + + +G ++T +Y  +N F+ PI++ +K GL + LP   F+V DV   +G +  +DVIDV +Q   KM+  +F+ Y+  S  R K+LNV+SLE S T++ +LVE P +++++S VE LWP  ++++R   P+VQKYCLM +KDS+TDFHIDFGG+SVWYH+  G KIFYLI P +  +  +  W    N   +FF DQ+ K         YR  +K G T+ +P GWIH+V T  D L FGGNF+HSL+I +QL+ Y+IE+ L T D F FP FE + W+V +++L
Sbjct:   85 TGSASFIKELKSRNFPSAEEIILKPQGAQLTVEYLEENSFSVPILVLKKDGLGMTLPAPTFTVSDVEYYVGPEKEIDVIDVTRQADLKMKLKDFVKYYN-SPKREKVLNVISLEFSETRLTNLVETPKIVRKLSWVENLWPEQSVFER---PNVQKYCLMGVKDSYTDFHIDFGGTSVWYHVLKGEKIFYLIQPTKTNLALFECWSSSSNQNEMFFGDQVDK--------CYRCPVKQGQTLFIPTGWIHSVLTPVDCLAFGGNFLHSLNIAIQLRAYEIEKRLSTADLFKFPNFETICWYVGKHLL 379          
BLAST of Lysine-specific demethylase 7A vs. Ensembl Mouse
Match: Phf8 (PHD finger protein 8 [Source:MGI Symbol;Acc:MGI:2444341])

HSP 1 Score: 271.552 bits (693), Expect = 1.197e-82
Identity = 134/307 (43.65%), Postives = 199/307 (64.82%), Query Frame = 1
Query:  157 SGTKEFLEYLQEKQCLPIGDQLKELRGKEVTEDYFIKNGFNKPIMIRRKKGLRIVLPESPFSVEDVGRNLGKDYILDVIDVVQQDQYKMRFGEFLDYFRESEPRSKLLNVLSLEISHTKIAHLVEPPYVIKEMSIVEKLWPCDNLYQRANKPSVQKYCLMSMKDSWTDFHIDFGGSSVWYHMYSGHKIFYLIPPKRRYIKAYTSWMGEYNNRMLFFPDQIKKFSLNDQAEVYRLEIKSGDTILLPAGWIHAVHTLEDSLVFGGNFVHSLSIPLQLKIYKIERFLQTEDRFLFPYFEKLHWFVAEYIL 1077
            +G+  F+  L+ +      + + +  G ++T ++  +N F+ PI++ +K GL + LP   F+V DV   +G D  +DVIDV +Q   KM+ G+F+ Y+  S  R K+LNV+SLE S T++++LVE P +++++S VE LWP + +++R   P+VQKYCLMS++DS+TDFHIDFGG+SVWYH+  G KIFYLI P    +  +  W    N   +FF DQ++K         Y+  +K G T+ +P GWIHAV T  D L FGGNF+HSL+I +QLK Y+IE+ L T D F FP FE + W+V ++IL
Sbjct:   82 TGSSMFIRELRGRTFDSSDEVILKPTGSQLTVEFLEENSFSVPILVLKKDGLGMTLPSPSFTVRDVEHYVGSDKEIDVIDVARQADCKMKLGDFVKYYY-SGKREKVLNVISLEFSDTRLSNLVETPRIVRKLSWVENLWPEECVFER---PNVQKYCLMSVRDSYTDFHIDFGGTSVWYHVLKGEKIFYLIRPTNANLTLFECWSSSSNQNEMFFGDQVEK--------CYKCSVKQGQTLFIPTGWIHAVLTPVDCLAFGGNFLHSLNIEMQLKAYEIEKRLSTADLFKFPNFETICWYVGKHIL 376          
BLAST of Lysine-specific demethylase 7A vs. Ensembl Mouse
Match: Phf8 (PHD finger protein 8 [Source:MGI Symbol;Acc:MGI:2444341])

HSP 1 Score: 273.092 bits (697), Expect = 1.182e-81
Identity = 134/307 (43.65%), Postives = 199/307 (64.82%), Query Frame = 1
Query:  157 SGTKEFLEYLQEKQCLPIGDQLKELRGKEVTEDYFIKNGFNKPIMIRRKKGLRIVLPESPFSVEDVGRNLGKDYILDVIDVVQQDQYKMRFGEFLDYFRESEPRSKLLNVLSLEISHTKIAHLVEPPYVIKEMSIVEKLWPCDNLYQRANKPSVQKYCLMSMKDSWTDFHIDFGGSSVWYHMYSGHKIFYLIPPKRRYIKAYTSWMGEYNNRMLFFPDQIKKFSLNDQAEVYRLEIKSGDTILLPAGWIHAVHTLEDSLVFGGNFVHSLSIPLQLKIYKIERFLQTEDRFLFPYFEKLHWFVAEYIL 1077
            +G+  F+  L+ +      + + +  G ++T ++  +N F+ PI++ +K GL + LP   F+V DV   +G D  +DVIDV +Q   KM+ G+F+ Y+  S  R K+LNV+SLE S T++++LVE P +++++S VE LWP + +++R   P+VQKYCLMS++DS+TDFHIDFGG+SVWYH+  G KIFYLI P    +  +  W    N   +FF DQ++K         Y+  +K G T+ +P GWIHAV T  D L FGGNF+HSL+I +QLK Y+IE+ L T D F FP FE + W+V ++IL
Sbjct:   82 TGSSMFIRELRGRTFDSSDEVILKPTGSQLTVEFLEENSFSVPILVLKKDGLGMTLPSPSFTVRDVEHYVGSDKEIDVIDVARQADCKMKLGDFVKYYY-SGKREKVLNVISLEFSDTRLSNLVETPRIVRKLSWVENLWPEECVFER---PNVQKYCLMSVRDSYTDFHIDFGGTSVWYHVLKGEKIFYLIRPTNANLTLFECWSSSSNQNEMFFGDQVEK--------CYKCSVKQGQTLFIPTGWIHAVLTPVDCLAFGGNFLHSLNIEMQLKAYEIEKRLSTADLFKFPNFETICWYVGKHIL 376          
BLAST of Lysine-specific demethylase 7A vs. Ensembl Mouse
Match: Phf8 (PHD finger protein 8 [Source:MGI Symbol;Acc:MGI:2444341])

HSP 1 Score: 273.863 bits (699), Expect = 3.754e-80
Identity = 131/281 (46.62%), Postives = 188/281 (66.90%), Query Frame = 1
Query:  235 GKEVTEDYFIKNGFNKPIMIRRKKGLRIVLPESPFSVEDVGRNLGKDYILDVIDVVQQDQYKMRFGEFLDYFRESEPRSKLLNVLSLEISHTKIAHLVEPPYVIKEMSIVEKLWPCDNLYQRANKPSVQKYCLMSMKDSWTDFHIDFGGSSVWYHMYSGHKIFYLIPPKRRYIKAYTSWMGEYNNRMLFFPDQIKKFSLNDQAEVYRLEIKSGDTILLPAGWIHAVHTLEDSLVFGGNFVHSLSIPLQLKIYKIERFLQTEDRFLFPYFEKLHWFVAEYIL 1077
            G ++T ++  +N F+ PI++ +K GL + LP   F+V DV   +G D  +DVIDV +Q   KM+ G+F+ Y+  S  R K+LNV+SLE S T++++LVE P +++++S VE LWP + +++R   P+VQKYCLMS++DS+TDFHIDFGG+SVWYH+  G KIFYLI P    +  +  W    N   +FF DQ++K         Y+  +K G T+ +P GWIHAV T  D L FGGNF+HSL+I +QLK Y+IE+ L T D F FP FE + W+V ++IL
Sbjct:  108 GSQLTVEFLEENSFSVPILVLKKDGLGMTLPSPSFTVRDVEHYVGSDKEIDVIDVARQADCKMKLGDFVKYYY-SGKREKVLNVISLEFSDTRLSNLVETPRIVRKLSWVENLWPEECVFER---PNVQKYCLMSVRDSYTDFHIDFGGTSVWYHVLKGEKIFYLIRPTNANLTLFECWSSSSNQNEMFFGDQVEK--------CYKCSVKQGQTLFIPTGWIHAVLTPVDCLAFGGNFLHSLNIEMQLKAYEIEKRLSTADLFKFPNFETICWYVGKHIL 376          
BLAST of Lysine-specific demethylase 7A vs. Ensembl Mouse
Match: Phf8 (PHD finger protein 8 [Source:MGI Symbol;Acc:MGI:2444341])

HSP 1 Score: 273.863 bits (699), Expect = 3.754e-80
Identity = 131/281 (46.62%), Postives = 188/281 (66.90%), Query Frame = 1
Query:  235 GKEVTEDYFIKNGFNKPIMIRRKKGLRIVLPESPFSVEDVGRNLGKDYILDVIDVVQQDQYKMRFGEFLDYFRESEPRSKLLNVLSLEISHTKIAHLVEPPYVIKEMSIVEKLWPCDNLYQRANKPSVQKYCLMSMKDSWTDFHIDFGGSSVWYHMYSGHKIFYLIPPKRRYIKAYTSWMGEYNNRMLFFPDQIKKFSLNDQAEVYRLEIKSGDTILLPAGWIHAVHTLEDSLVFGGNFVHSLSIPLQLKIYKIERFLQTEDRFLFPYFEKLHWFVAEYIL 1077
            G ++T ++  +N F+ PI++ +K GL + LP   F+V DV   +G D  +DVIDV +Q   KM+ G+F+ Y+  S  R K+LNV+SLE S T++++LVE P +++++S VE LWP + +++R   P+VQKYCLMS++DS+TDFHIDFGG+SVWYH+  G KIFYLI P    +  +  W    N   +FF DQ++K         Y+  +K G T+ +P GWIHAV T  D L FGGNF+HSL+I +QLK Y+IE+ L T D F FP FE + W+V ++IL
Sbjct:  108 GSQLTVEFLEENSFSVPILVLKKDGLGMTLPSPSFTVRDVEHYVGSDKEIDVIDVARQADCKMKLGDFVKYYY-SGKREKVLNVISLEFSDTRLSNLVETPRIVRKLSWVENLWPEECVFER---PNVQKYCLMSVRDSYTDFHIDFGGTSVWYHVLKGEKIFYLIRPTNANLTLFECWSSSSNQNEMFFGDQVEK--------CYKCSVKQGQTLFIPTGWIHAVLTPVDCLAFGGNFLHSLNIEMQLKAYEIEKRLSTADLFKFPNFETICWYVGKHIL 376          
BLAST of Lysine-specific demethylase 7A vs. Ensembl Mouse
Match: Phf8 (PHD finger protein 8 [Source:MGI Symbol;Acc:MGI:2444341])

HSP 1 Score: 273.863 bits (699), Expect = 5.438e-80
Identity = 131/281 (46.62%), Postives = 188/281 (66.90%), Query Frame = 1
Query:  235 GKEVTEDYFIKNGFNKPIMIRRKKGLRIVLPESPFSVEDVGRNLGKDYILDVIDVVQQDQYKMRFGEFLDYFRESEPRSKLLNVLSLEISHTKIAHLVEPPYVIKEMSIVEKLWPCDNLYQRANKPSVQKYCLMSMKDSWTDFHIDFGGSSVWYHMYSGHKIFYLIPPKRRYIKAYTSWMGEYNNRMLFFPDQIKKFSLNDQAEVYRLEIKSGDTILLPAGWIHAVHTLEDSLVFGGNFVHSLSIPLQLKIYKIERFLQTEDRFLFPYFEKLHWFVAEYIL 1077
            G ++T ++  +N F+ PI++ +K GL + LP   F+V DV   +G D  +DVIDV +Q   KM+ G+F+ Y+  S  R K+LNV+SLE S T++++LVE P +++++S VE LWP + +++R   P+VQKYCLMS++DS+TDFHIDFGG+SVWYH+  G KIFYLI P    +  +  W    N   +FF DQ++K         Y+  +K G T+ +P GWIHAV T  D L FGGNF+HSL+I +QLK Y+IE+ L T D F FP FE + W+V ++IL
Sbjct:  108 GSQLTVEFLEENSFSVPILVLKKDGLGMTLPSPSFTVRDVEHYVGSDKEIDVIDVARQADCKMKLGDFVKYYY-SGKREKVLNVISLEFSDTRLSNLVETPRIVRKLSWVENLWPEECVFER---PNVQKYCLMSVRDSYTDFHIDFGGTSVWYHVLKGEKIFYLIRPTNANLTLFECWSSSSNQNEMFFGDQVEK--------CYKCSVKQGQTLFIPTGWIHAVLTPVDCLAFGGNFLHSLNIEMQLKAYEIEKRLSTADLFKFPNFETICWYVGKHIL 376          
BLAST of Lysine-specific demethylase 7A vs. UniProt/SwissProt
Match: sp|Q5RHD1|KDM7A_DANRE (Lysine-specific demethylase 7A OS=Danio rerio OX=7955 GN=kdm7a PE=2 SV=2)

HSP 1 Score: 284.263 bits (726), Expect = 1.494e-82
Identity = 146/316 (46.20%), Postives = 208/316 (65.82%), Query Frame = 1
Query:  145 TMPL-SGTKEFLEYLQEKQCLPIGDQLKELRGKEVTEDYFIKNGFNKPIMIRRKKGLRIVLPESPFSVEDVGRNLGKDYILDVIDVVQQDQYKMRFGEFLDYFRESEPRSKLLNVLSLEISHTKIAHLVEPPYVIKEMSIVEKLWPCDNLYQRANKPSVQKYCLMSMKDSWTDFHIDFGGSSVWYHMYSGHKIFYLIPPKRRYIKAYTSWMGEYNNRMLFFPDQIKKFSLNDQAEVYRLEIKSGDTILLPAGWIHAVHTLEDSLVFGGNFVHSLSIPLQLKIYKIERFLQTEDRFLFPYFEKLHWFVAEYILHKLE 1089
            T P+ +GT  F++ LQ +     GD L +++G +VT+ +  K GFN PI++    GL + LP   FSV DV   +G + ++DVIDV +Q   KM+ GEF+ Y+ + E R K+LNV+SLE S T++++LV  P + ++MS VE  WP D+ +    KP VQKYCLM MK+S+TDFHIDFGG+SVWYH+  G KIFYLI P +  +  Y +W    N   +FF +++ K         Y+  +K G TILLP GWIHAV T +DS+ FGGNF+H+L+I +QL+ Y++ER L+T D F FPYFE + W+VA+ +L  L+
Sbjct:   80 TRPVQAGTAVFVKELQARS-FASGDILVQMQGNQVTKRFLEKEGFNYPIVVHDLDGLGLKLPPPSFSVSDVEHYVGANKVIDVIDVAKQADSKMKLGEFVKYYYQPE-RPKVLNVISLEFSDTRMSNLVVVPDIAQKMSWVENYWPDDSFFP---KPFVQKYCLMGMKNSYTDFHIDFGGTSVWYHVLWGEKIFYLIKPTKANLALYEAWSSSPNQSEVFFGEKVDK--------CYKCVVKQGTTILLPTGWIHAVLTSQDSMAFGGNFLHNLNIDMQLRCYEMERRLKTPDLFKFPYFEAICWYVAKNLLETLK 382          
BLAST of Lysine-specific demethylase 7A vs. UniProt/SwissProt
Match: sp|P0CF52|KDM7B_DANRE (Lysine-specific demethylase 7B OS=Danio rerio OX=7955 GN=jhdm1db PE=2 SV=1)

HSP 1 Score: 273.478 bits (698), Expect = 2.854e-81
Identity = 157/390 (40.26%), Postives = 236/390 (60.51%), Query Frame = 1
Query:  157 SGTKEFLEYLQEKQCLPIGDQ-LKELRGKEVTEDYFIKNGFNKPIMIRRKKGLRIVLPESPFSVEDVGRNLGKDYILDVIDVVQQDQYKMRFGEFLDYFRESEPRSKLLNVLSLEISHTKIAHLVEPPYVIKEMSIVEKLWPCDNLYQRANKPSVQKYCLMSMKDSWTDFHIDFGGSSVWYHMYSGHKIFYLIPPKRRYIKAYTSWMGEYNNRMLFFPDQIKKFSLNDQAEVYRLEIKSGDTILLPAGWIHAVHTLEDSLVFGGNFVHSLSIPLQLKIYKIERFLQTEDRFLFPYFEKLHWFVAEYILHKLEANLTHNXXXXXXXXXXXXXXXETLPDWLSKYHTCTPDEREYNYPEKGLMESSKV-HLIRKLSDVVKTLITASIIDDPL 1320
            +GT  F+  LQ +   P GD+ L+ + G +VT+ Y  ++GF  PI++ +++ L + LP   FS++DV R +G + ++DVIDV +Q   KM+   F+ Y+  S  R K+LNV+SLE S TK+A LV  P + ++MS VE  WP D+ +    KP VQKYCLM +KDS+TDFHIDFGG+SVWYH+  G KIFYLI P    +  Y  W    N   +FF +++ K         Y+  ++ G T+L+P GWIHAV T +D + FGGNF+H+L+I +QL+ Y++ER L+T D F FPYFE + W+VA+ +L  L+ +   N  P + ++KG   LI  L +WL         +RE   P   + +  +  HLI+ L+  ++ L   +  + P+
Sbjct:   85 AGTSVFVRELQART-FPSGDEILQPMHGGQVTQRYLERHGFRYPIIVSKREELGLRLPPPDFSIKDVERYVGGNKVIDVIDVARQADSKMKLKAFVKYYY-SPQRPKVLNVISLEFSDTKMAELVVVPDIAQKMSWVENYWPDDSYFP---KPFVQKYCLMGVKDSYTDFHIDFGGTSVWYHVLWGEKIFYLIKPTPANLALYEEWSSSPNQSEVFFGEKVDK--------CYKCVVRQGTTLLIPTGWIHAVLTSQDCMAFGGNFLHNLNIGMQLRCYEMERRLKTPDLFKFPYFEAICWYVAKNLLETLKESREENCLPPEYLIKGVKALITALRNWL---------KREVTEPASEVPDHIRPNHLIKMLTKEIQYLENGNCGNKPM 452          
BLAST of Lysine-specific demethylase 7A vs. UniProt/SwissProt
Match: sp|Q08D35|KDM7A_XENTR (Lysine-specific demethylase 7A OS=Xenopus tropicalis OX=8364 GN=kdm7a PE=2 SV=1)

HSP 1 Score: 273.478 bits (698), Expect = 2.839e-78
Identity = 157/383 (40.99%), Postives = 225/383 (58.75%), Query Frame = 1
Query:  145 TMPL-SGTKEFLEYLQEKQCLPIGDQLKELRGKEVTEDYFIKNGFNKPIMIRRKKGLRIVLPESPFSVEDVGRNLGKDYILDVIDVVQQDQYKMRFGEFLDYFRESEPRSKLLNVLSLEISHTKIAHLVEPPYVIKEMSIVEKLWPCDNLYQRANKPSVQKYCLMSMKDSWTDFHIDFGGSSVWYHMYSGHKIFYLIPPKRRYIKAYTSWMGEYNNRMLFFPDQIKKFSLNDQAEVYRLEIKSGDTILLPAGWIHAVHTLEDSLVFGGNFVHSLSIPLQLKIYKIERFLQTEDRFLFPYFEKLHWFVAEYILHKLEANLTHNXXXXXXXXXXXXXXXETLPDWLSKYHTCTPDEREYNYPEKGLMESSKVHLIRKLSDVVKTL 1290
            T P+ +GT+ F++ LQ +      D L ++ G ++T+ Y  K GFN PIM+ R   L + LP   FSV DV R +G + I+DVIDV +Q   KM+   F+ YF   + R K+LNV+SLE S TK+A LV+ P + K++S VE  WP D+ +    KP VQKYCLM ++DS+TDFHIDFGG+SVWYH+  G K+FYLI P    +  Y SW         FF D++ K         Y+  +K G T+ +P GWIHAV T +D + FGGNF+H+L+I +QL+ Y++E+ L+T D F FP+FE + WFVA+ +L  L+        P   +  G   LI  L  W+ K       E  +  P+         HLI++LS V++++
Sbjct:   81 TKPVQAGTRTFIQQLQARSFPSADDLLLKMNGSQLTQRYLEKQGFNLPIMVPRLDDLGLRLPPPTFSVMDVERYVGGEKIIDVIDVARQADSKMKLKNFVKYFMNPD-RPKVLNVISLEFSDTKMADLVKVPDISKKLSWVENYWPDDSFF---TKPFVQKYCLMGVQDSYTDFHIDFGGTSVWYHVLWGEKVFYLIKPSDENLALYESWSSSVTQSEEFFGDKVDK--------CYKCVVKQGHTLFVPTGWIHAVLTSQDCMAFGGNFLHNLNIGMQLRCYEMEKRLKTPDLFKFPFFEAICWFVAKNLLETLKELKEDGFHPPNYLKHGVKALISALKSWMKKESVA---EHAFEIPDN----IRPGHLIKELSKVIRSV 444          
BLAST of Lysine-specific demethylase 7A vs. UniProt/SwissProt
Match: sp|Q80TJ7|PHF8_MOUSE (Histone lysine demethylase PHF8 OS=Mus musculus OX=10090 GN=Phf8 PE=1 SV=2)

HSP 1 Score: 274.248 bits (700), Expect = 4.777e-78
Identity = 130/281 (46.26%), Postives = 188/281 (66.90%), Query Frame = 1
Query:  235 GKEVTEDYFIKNGFNKPIMIRRKKGLRIVLPESPFSVEDVGRNLGKDYILDVIDVVQQDQYKMRFGEFLDYFRESEPRSKLLNVLSLEISHTKIAHLVEPPYVIKEMSIVEKLWPCDNLYQRANKPSVQKYCLMSMKDSWTDFHIDFGGSSVWYHMYSGHKIFYLIPPKRRYIKAYTSWMGEYNNRMLFFPDQIKKFSLNDQAEVYRLEIKSGDTILLPAGWIHAVHTLEDSLVFGGNFVHSLSIPLQLKIYKIERFLQTEDRFLFPYFEKLHWFVAEYIL 1077
            G ++T ++  +N F+ PI++ +K GL + LP   F+V DV   +G D  +DVIDV +Q   KM+ G+F+ Y+   + R K+LNV+SLE S T++++LVE P +++++S VE LWP + +++R   P+VQKYCLMS++DS+TDFHIDFGG+SVWYH+  G KIFYLI P    +  +  W    N   +FF DQ++K         Y+  +K G T+ +P GWIHAV T  D L FGGNF+HSL+I +QLK Y+IE+ L T D F FP FE + W+V ++IL
Sbjct:  108 GSQLTVEFLEENSFSVPILVLKKDGLGMTLPSPSFTVRDVEHYVGSDKEIDVIDVARQADCKMKLGDFVKYYYSGK-REKVLNVISLEFSDTRLSNLVETPRIVRKLSWVENLWPEECVFER---PNVQKYCLMSVRDSYTDFHIDFGGTSVWYHVLKGEKIFYLIRPTNANLTLFECWSSSSNQNEMFFGDQVEK--------CYKCSVKQGQTLFIPTGWIHAVLTPVDCLAFGGNFLHSLNIEMQLKAYEIEKRLSTADLFKFPNFETICWYVGKHIL 376          
BLAST of Lysine-specific demethylase 7A vs. UniProt/SwissProt
Match: sp|Q9UPP1|PHF8_HUMAN (Histone lysine demethylase PHF8 OS=Homo sapiens OX=9606 GN=PHF8 PE=1 SV=3)

HSP 1 Score: 273.863 bits (699), Expect = 9.503e-78
Identity = 130/281 (46.26%), Postives = 187/281 (66.55%), Query Frame = 1
Query:  235 GKEVTEDYFIKNGFNKPIMIRRKKGLRIVLPESPFSVEDVGRNLGKDYILDVIDVVQQDQYKMRFGEFLDYFRESEPRSKLLNVLSLEISHTKIAHLVEPPYVIKEMSIVEKLWPCDNLYQRANKPSVQKYCLMSMKDSWTDFHIDFGGSSVWYHMYSGHKIFYLIPPKRRYIKAYTSWMGEYNNRMLFFPDQIKKFSLNDQAEVYRLEIKSGDTILLPAGWIHAVHTLEDSLVFGGNFVHSLSIPLQLKIYKIERFLQTEDRFLFPYFEKLHWFVAEYIL 1077
            G ++T ++  +N F+ PI++ +K GL + LP   F+V DV   +G D  +DVIDV +Q   KM+ G+F+ Y+   + R K+LNV+SLE S T++++LVE P +++++S VE LWP + +++R   P+VQKYCLMS++DS+TDFHIDFGG+SVWYH+  G KIFYLI P    +  +  W    N   +FF DQ+ K         Y+  +K G T+ +P GWIHAV T  D L FGGNF+HSL+I +QLK Y+IE+ L T D F FP FE + W+V ++IL
Sbjct:  144 GNQLTVEFLEENSFSVPILVLKKDGLGMTLPSPSFTVRDVEHYVGSDKEIDVIDVTRQADCKMKLGDFVKYYYSGK-REKVLNVISLEFSDTRLSNLVETPKIVRKLSWVENLWPEECVFER---PNVQKYCLMSVRDSYTDFHIDFGGTSVWYHVLKGEKIFYLIRPTNANLTLFECWSSSSNQNEMFFGDQVDK--------CYKCSVKQGQTLFIPTGWIHAVLTPVDCLAFGGNFLHSLNIEMQLKAYEIEKRLSTADLFRFPNFETICWYVGKHIL 412          
BLAST of Lysine-specific demethylase 7A vs. TrEMBL
Match: A0A4S2M098 (JmjC domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_004904 PE=4 SV=1)

HSP 1 Score: 325.865 bits (834), Expect = 8.450e-99
Identity = 176/398 (44.22%), Postives = 249/398 (62.56%), Query Frame = 1
Query:  148 MPLSGTKEFLEYLQEKQCLPIGDQLKELRGKEVTEDYFIKNGFNKPIMIRRKKGLRIVLPESPFSVEDVGRNLGKDYILDVIDVVQQDQYKMRFGEFLDYFRESEPRSKLLNVLSLEISHTKIAHLVEPPYVIKEMSIVEKLW---PCDNLYQRANK-------PSVQKYCLMSMKDSWTDFHIDFGGSSVWYHMYSGHKIFYLIPPKRRYIKAYTSWMGEYNNRMLFFPDQIK----KFSLNDQAEVYRLEIKSGDTILLPAGWIHAVHTLEDSLVFGGNFVHSLSIPLQLKIYKIERFLQTEDRFLFPYFEKLHWFVAEYILHKLEANLTHNXXXXXXXXXXXXXXXETLPDWLSKYHTCTPDEREYNYPEKGLMESSKVHLIRKLSDVVKTLITA 1299
            MPLSG++EF++ L ++        ++ ++G +V     I +GFN PI++  K GLRI +P   F  ED+ + +  ++ +DVIDV QQ + +M  G+F+ +F  S+ R +LLN+LSLE S T ++ LVEPP+V+ E+S++   W   P D L + ++        PSVQKYCLMSM+ S+TDFHIDFGGSSVWYH+  G KIFYLIPP      AY  W+   N+R +F PD +     + +++ +A V++L +  G TILLPAGWIHAV+T  D LVFGGNF++ L IP+QL +Y++E+  +T  +F FP FEK+HWFVAE I  +L   L  N  P    ++ A  L + LP WL K  T  PDER Y  P +  ME S   LI KL ++   L+ A
Sbjct:    1 MPLSGSEEFIKELLQRTFRSTEGHVQVMKGCDVNGHALICDGFNMPILVTEKDGLRIRVPSHNFMPEDLLKFMDPNFTVDVIDVRQQAEVQMALGDFIGHFV-SKHRVRLLNMLSLEFSQTSLSKLVEPPHVVSELSLISNCWITSPDDELGEVSDDESLASSIPSVQKYCLMSMEGSYTDFHIDFGGSSVWYHVVWGEKIFYLIPPTHENRHAYWRWIWNPNHRTIFLPDLLDAPKDESTIHSEAPVFQLHVGPGQTILLPAGWIHAVYTPSDCLVFGGNFLNELHIPIQLSVYRMEQKSETPRKFQFPNFEKIHWFVAERIAGRLTNALYDNREPAAYEIEAAHALAKVLPRWLEKRLTLPPDERLYYLPSRATMEMSYSQLIDKLEELSSILLPA 397          
BLAST of Lysine-specific demethylase 7A vs. TrEMBL
Match: A0A4S2LZH1 (JmjC domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_004904 PE=4 SV=1)

HSP 1 Score: 325.479 bits (833), Expect = 3.212e-98
Identity = 176/398 (44.22%), Postives = 249/398 (62.56%), Query Frame = 1
Query:  148 MPLSGTKEFLEYLQEKQCLPIGDQLKELRGKEVTEDYFIKNGFNKPIMIRRKKGLRIVLPESPFSVEDVGRNLGKDYILDVIDVVQQDQYKMRFGEFLDYFRESEPRSKLLNVLSLEISHTKIAHLVEPPYVIKEMSIVEKLW---PCDNLYQRANK-------PSVQKYCLMSMKDSWTDFHIDFGGSSVWYHMYSGHKIFYLIPPKRRYIKAYTSWMGEYNNRMLFFPDQIK----KFSLNDQAEVYRLEIKSGDTILLPAGWIHAVHTLEDSLVFGGNFVHSLSIPLQLKIYKIERFLQTEDRFLFPYFEKLHWFVAEYILHKLEANLTHNXXXXXXXXXXXXXXXETLPDWLSKYHTCTPDEREYNYPEKGLMESSKVHLIRKLSDVVKTLITA 1299
            MPLSG++EF++ L ++        ++ ++G +V     I +GFN PI++  K GLRI +P   F  ED+ + +  ++ +DVIDV QQ + +M  G+F+ +F  S+ R +LLN+LSLE S T ++ LVEPP+V+ E+S++   W   P D L + ++        PSVQKYCLMSM+ S+TDFHIDFGGSSVWYH+  G KIFYLIPP      AY  W+   N+R +F PD +     + +++ +A V++L +  G TILLPAGWIHAV+T  D LVFGGNF++ L IP+QL +Y++E+  +T  +F FP FEK+HWFVAE I  +L   L  N  P    ++ A  L + LP WL K  T  PDER Y  P +  ME S   LI KL ++   L+ A
Sbjct:    1 MPLSGSEEFIKELLQRTFRSTEGHVQVMKGCDVNGHALICDGFNMPILVTEKDGLRIRVPSHNFMPEDLLKFMDPNFTVDVIDVRQQAEVQMALGDFIGHFV-SKHRVRLLNMLSLEFSQTSLSKLVEPPHVVSELSLISNCWITSPDDELGEVSDDESLASSIPSVQKYCLMSMEGSYTDFHIDFGGSSVWYHVVWGEKIFYLIPPTHENRHAYWRWIWNPNHRTIFLPDLLDAPKDESTIHSEAPVFQLHVGPGQTILLPAGWIHAVYTPSDCLVFGGNFLNELHIPIQLSVYRMEQKSETPRKFQFPNFEKIHWFVAERIAGRLTNALYDNREPAAYEIEAAHALAKVLPRWLEKRLTLPPDERLYYLPSRATMEMSYSQLIDKLEELSSILLPA 397          
BLAST of Lysine-specific demethylase 7A vs. TrEMBL
Match: A0A5K3F6B6 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 316.235 bits (809), Expect = 1.149e-96
Identity = 173/388 (44.59%), Postives = 241/388 (62.11%), Query Frame = 1
Query:  151 PLSGTKEFLEYLQEKQCLPIGDQLKELRGKEVTEDYFIKNGFNKPIMIRRKKGLRIVLPESPFSVEDVGRNLGKDYILDVIDVVQQDQYKMRFGEFLDYFRESEPRSKLLNVLSLEISHTKIAHLVEPPYVIKEMSIVEKLW--PCDNLYQ----RANKPSVQKYCLMSMKDSWTDFHIDFGGSSVWYHMYSGHKIFYLIPPKRRYIKAYTSWMGEYNNRMLFFPDQIKKFSLNDQAEVYRLEIKSGDTILLPAGWIHAVHTLEDSLVFGGNFVHSLSIPLQLKIYKIERFLQTEDRFLFPYFEKLHWFVAEYILHKLEANLTHNXXXXXXXXXXXXXXXETLPDWLSKYHTCTPDEREYNYPEKGLMESSKVHLIRKLSDVVKTLIT 1296
            P +GT  F+E L + + L     +    G+EV     I  GF KPI++  K GLR+ +P + FS+ DV        I+DVIDV+ Q   ++  GEF+D F E +PR +LLNVLS E S T++A  + PP+V+KE+S+V+  W  P D   +     + +P+VQKYCLMSM  S+TDFHIDFGGSSVWYH+  G KIFY+ PP + +++AY  W G  +NR +FFPD I K  ++ +  V RL +K+G+T+LLPAGWIHAV+T  DSLVFGGNF+  LSIPLQL +Y +E    T  RFLFP+FEKLHW+ A+ IL +L  +L     P   +LK A  L+  L  W  +       +R Y  P +  ++ +   LI KL +VV+  ++
Sbjct:    3 PAAGTPSFIEKLLQVEFLDPDPFVDYKAGEEVNGFNLINEGFRKPIVVSHKVGLRMKVPPANFSLRDVVAYTDPSIIIDVIDVLYQTDMQLSLGEFVDEFYE-KPRERLLNVLSFEYSQTRLAKFIRPPHVVKELSLVDNCWAEPTDEDDECGTGSSERPNVQKYCLMSMAGSYTDFHIDFGGSSVWYHVLWGEKIFYVTPPSKDHLEAYWRWNGLLDNRRVFFPDTINK--IDSRIPVARLHLKAGETVLLPAGWIHAVYTPTDSLVFGGNFLTQLSIPLQLGVYHMEVKQGTSQRFLFPFFEKLHWYAADVILGRLTNDLYAGQEPPTYLLKAAHALLRPLSQWFQQRKVLPKGQRNYYLPARTYLQYACPTLIGKLEEVVQAFLS 387          
BLAST of Lysine-specific demethylase 7A vs. TrEMBL
Match: A0A419QFI9 (Lysine-specific demethylase 7B (Fragment) OS=Clonorchis sinensis OX=79923 GN=jhdm1db PE=4 SV=1)

HSP 1 Score: 318.546 bits (815), Expect = 1.253e-96
Identity = 179/410 (43.66%), Postives = 249/410 (60.73%), Query Frame = 1
Query:  148 MPLSGTKEFLEYLQEKQCLPIGDQLKELRGKEVTEDYFIKNGFNKPIMIRRKKGLRIVLPESPFSVEDV----------GRN--LGKDYILDVIDVVQQDQYKMRFGEFLDYFRESEPRSKLLNVLSLEISHTKIAHLVEPPYVIKEMSIVEKLW---PCDNLYQRANK-------PSVQKYCLMSMKDSWTDFHIDFGGSSVWYHMYSGHKIFYLIPPKRRYIKAYTSWMGEYNNRMLFFPDQIK----KFSLNDQAEVYRLEIKSGDTILLPAGWIHAVHTLEDSLVFGGNFVHSLSIPLQLKIYKIERFLQTEDRFLFPYFEKLHWFVAEYILHKLEANLTHNXXXXXXXXXXXXXXXETLPDWLSKYHTCTPDEREYNYPEKGLMESSKVHLIRKLSDVVKTLITA 1299
            MPLSG++EF+E L ++        ++ ++G +V     I  GFN PI+I  K GLR+ +P   F  ED+          GRN  +  ++ +DVIDV QQ + +M  G+F+ +F  S+ R +LLN+LSLE S T ++ LVEPP+V+ E+S++   W   P D   + ++        PSVQKYCLMSM+ S+TDFHIDFGGSSVWYH+  G KIFYLIPP      AY  W    ++R +F PD +     + +++ +A V++L +  G TILLPAGWIHAV+T  D LVFGGNF++ L IP+QL +Y++E+  +T  +F FP FEK+HWFVAE I  +L   L  N  P    ++ A  L + LP WL K  T  PDER Y  P +  ME S   LI KL ++   L+TA
Sbjct:    1 MPLSGSEEFVEELLQRTFRSSEGHVQVMKGCDVNGHSLICEGFNMPILITEKDGLRMRVPPQNFMPEDLLKFMGTNCFSGRNCHIDPNFTVDVIDVRQQAEVQMTLGDFIGHFV-SKRRVRLLNMLSLEFSQTSLSKLVEPPHVVSELSLISNCWIAAPDDEFGEVSDDGSFATSIPSVQKYCLMSMEGSYTDFHIDFGGSSVWYHVVWGEKIFYLIPPTHDNRHAYWRWSWNPDHRTIFLPDLLDAPKDESNIHSEAPVFQLHVGPGQTILLPAGWIHAVYTPSDCLVFGGNFLNELHIPIQLSVYRMEQKSETPRKFQFPNFEKIHWFVAERIAGRLTNALYDNREPAAYEIEAAHALAKVLPRWLEKRLTLPPDERLYYLPSRATMELSYSQLIDKLEELSSILLTA 409          
BLAST of Lysine-specific demethylase 7A vs. TrEMBL
Match: G4V5L1 (Putative phd/f-box containing protein OS=Schistosoma mansoni OX=6183 GN=Smp_196270 PE=4 SV=1)

HSP 1 Score: 317.775 bits (813), Expect = 1.389e-95
Identity = 172/399 (43.11%), Postives = 245/399 (61.40%), Query Frame = 1
Query:  148 MPLSGTKEFLEYLQEKQCLPIGDQLKELRGKEVTEDYFIKNGFNKPIMIRRKKGLRIVLPESPFSVEDVGRNLGKDYILDVIDVVQQDQYKMRFGEFLDYFRESEPRSK-LLNVLSLEISHTKIAHLVEPPYVIKEMSIVEKLWPCDNL-------YQRANKPSVQKYCLMSMKDSWTDFHIDFGGSSVWYHMYSGHKIFYLIPPKRRYIKAYTSWMGEYNNRMLFFPDQIKKF------SLNDQAEVYRLEIKSGDTILLPAGWIHAVHTLEDSLVFGGNFVHSLSIPLQLKIYKIERFLQTEDRFLFPYFEKLHWFVAEYILHKLEANLTHNXXXXXXXXXXXXXXXETLPDWLSKYHTCTPDEREYNYPEKGLMESSKVHLIRKLSDVVKTLITAS 1302
            M LSG+KEF++ L  ++     DQ+  + G +V+   F  NGF+KP+++R K GLR+ +P   FS  D+ R +     +DVIDV QQ + +M   E +D+F  S PR + LLN+LSLE S T +A  V PP+V+ E+S+V   WP D+        +     P+VQKYCL+SMK S+TDFHIDFGGSSVWYH+  G K+FYL+PP   ++ AY  W    N+R  FFPD +         S  ++  VY L I  G TI LP+GWIHAV+T  D LVFGGNF+  L + +QL+IY++E+  +T  +FLFP FEK+HWF ++ +L +L  NLT    P+   ++ A  L + LP W SK H   P+ER+Y  P +  ++     LI +LS+VV ++ + S
Sbjct:    1 MALSGSKEFVDMLLAREFTSADDQVLIMNGCDVSGHSFKANGFSKPVLVRSKDGLRLKVPLDSFSHTDLTRFIDPSTQVDVIDVRQQVEIQMTLQELVDHF--SSPRRQVLLNMLSLEFSRTSLAKFVHPPHVVSELSLVTTCWPEDDPNDLKDIEFVDETAPTVQKYCLLSMKGSYTDFHIDFGGSSVWYHVMWGEKVFYLMPPTPEFVSAYWRWCMSSNHRATFFPDFVDSLREQESNSNVNRPTVYCLRILPGQTIFLPSGWIHAVYTPSDCLVFGGNFLSGLHVSMQLRIYRMEQKCKTPIKFLFPNFEKVHWFYSQCLLDRLTNNLTDGEIPVIFDVEAAECLAKVLPLWYSKRHLLPPEERDYFLPNQSQLDMLCPSLIERLSEVVNSISSRS 397          
BLAST of Lysine-specific demethylase 7A vs. Ensembl Cavefish
Match: ENSAMXT00000056168.1 (lysine-specific demethylase 7B [Source:NCBI gene;Acc:103040257])

HSP 1 Score: 281.182 bits (718), Expect = 7.748e-83
Identity = 144/317 (45.43%), Postives = 210/317 (66.25%), Query Frame = 1
Query:  145 TMPL-SGTKEFLEYLQEKQCLPIGDQ-LKELRGKEVTEDYFIKNGFNKPIMIRRKKGLRIVLPESPFSVEDVGRNLGKDYILDVIDVVQQDQYKMRFGEFLDYFRESEPRSKLLNVLSLEISHTKIAHLVEPPYVIKEMSIVEKLWPCDNLYQRANKPSVQKYCLMSMKDSWTDFHIDFGGSSVWYHMYSGHKIFYLIPPKRRYIKAYTSWMGEYNNRMLFFPDQIKKFSLNDQAEVYRLEIKSGDTILLPAGWIHAVHTLEDSLVFGGNFVHSLSIPLQLKIYKIERFLQTEDRFLFPYFEKLHWFVAEYILHKLE 1089
            T+P+ +GT  F++ LQE+   P  D+ L +++G +VT+ +    GF+ PI +   +GL + LP   FSV DV + +G + ++DVIDV +Q   KM+  EF+ Y+ + E R K+LN++SLE S TK+A LVE P + ++MS VE  WP D+ +    KP VQKYCLM +K+S+TDFHIDFGG+SVWYH+  G KIFYLI P +  +  Y SW    N   +FF ++++K         Y+  +K G T+LLP GWIHAV T +D + FGGNF+H+L+I +QL+ Y++ER L+T D F FPYFE + W+VA+ +L  L+
Sbjct:   80 TLPVQAGTAVFIKELQERT-FPSADEILVQMQGSQVTQHFLETEGFHYPITVADMEGLGLKLPPLSFSVTDVEQYVGGNKVIDVIDVARQADSKMKLSEFVKYYYQPE-RPKVLNLISLEFSDTKMAELVEVPDIARKMSWVENYWPDDSFFP---KPFVQKYCLMGVKNSYTDFHIDFGGTSVWYHVLWGEKIFYLIEPTKANLALYESWSSSPNQSEVFFGEKVEK--------CYKCVVKQGTTVLLPTGWIHAVLTSQDCMAFGGNFLHNLNIGMQLRCYEMERRLKTPDLFKFPYFEAISWYVAKNLLETLK 383          
BLAST of Lysine-specific demethylase 7A vs. Ensembl Cavefish
Match: ENSAMXT00000006558.2 (lysine-specific demethylase 7B [Source:NCBI gene;Acc:103040257])

HSP 1 Score: 281.182 bits (718), Expect = 8.709e-83
Identity = 144/317 (45.43%), Postives = 210/317 (66.25%), Query Frame = 1
Query:  145 TMPL-SGTKEFLEYLQEKQCLPIGDQ-LKELRGKEVTEDYFIKNGFNKPIMIRRKKGLRIVLPESPFSVEDVGRNLGKDYILDVIDVVQQDQYKMRFGEFLDYFRESEPRSKLLNVLSLEISHTKIAHLVEPPYVIKEMSIVEKLWPCDNLYQRANKPSVQKYCLMSMKDSWTDFHIDFGGSSVWYHMYSGHKIFYLIPPKRRYIKAYTSWMGEYNNRMLFFPDQIKKFSLNDQAEVYRLEIKSGDTILLPAGWIHAVHTLEDSLVFGGNFVHSLSIPLQLKIYKIERFLQTEDRFLFPYFEKLHWFVAEYILHKLE 1089
            T+P+ +GT  F++ LQE+   P  D+ L +++G +VT+ +    GF+ PI +   +GL + LP   FSV DV + +G + ++DVIDV +Q   KM+  EF+ Y+ + E R K+LN++SLE S TK+A LVE P + ++MS VE  WP D+ +    KP VQKYCLM +K+S+TDFHIDFGG+SVWYH+  G KIFYLI P +  +  Y SW    N   +FF ++++K         Y+  +K G T+LLP GWIHAV T +D + FGGNF+H+L+I +QL+ Y++ER L+T D F FPYFE + W+VA+ +L  L+
Sbjct:   80 TLPVQAGTAVFIKELQERT-FPSADEILVQMQGSQVTQHFLETEGFHYPITVADMEGLGLKLPPLSFSVTDVEQYVGGNKVIDVIDVARQADSKMKLSEFVKYYYQPE-RPKVLNLISLEFSDTKMAELVEVPDIARKMSWVENYWPDDSFFP---KPFVQKYCLMGVKNSYTDFHIDFGGTSVWYHVLWGEKIFYLIEPTKANLALYESWSSSPNQSEVFFGEKVEK--------CYKCVVKQGTTVLLPTGWIHAVLTSQDCMAFGGNFLHNLNIGMQLRCYEMERRLKTPDLFKFPYFEAISWYVAKNLLETLK 383          
BLAST of Lysine-specific demethylase 7A vs. Ensembl Cavefish
Match: phf8 (PHD finger protein 8 [Source:NCBI gene;Acc:103038657])

HSP 1 Score: 273.478 bits (698), Expect = 1.452e-78
Identity = 135/308 (43.83%), Postives = 201/308 (65.26%), Query Frame = 1
Query:  157 SGTKEFLEYLQEKQCLPIGDQ-LKELRGKEVTEDYFIKNGFNKPIMIRRKKGLRIVLPESPFSVEDVGRNLGKDYILDVIDVVQQDQYKMRFGEFLDYFRESEPRSKLLNVLSLEISHTKIAHLVEPPYVIKEMSIVEKLWPCDNLYQRANKPSVQKYCLMSMKDSWTDFHIDFGGSSVWYHMYSGHKIFYLIPPKRRYIKAYTSWMGEYNNRMLFFPDQIKKFSLNDQAEVYRLEIKSGDTILLPAGWIHAVHTLEDSLVFGGNFVHSLSIPLQLKIYKIERFLQTEDRFLFPYFEKLHWFVAEYIL 1077
            +G+ +F+  L+ +   P  D+ L +  G ++T D+  +  F+ P+++ R+ GL + LP S FSV D+   +G +  +DVIDVV+Q   KM+ G+F  Y+  S  R ++LNV+SLE S T++++LVE P +++++S VE LWP +++++R   P+VQKYCLM +KDS+TDFHIDFGG+SVWYH+  G KIFYLI P    +  +  W    N   LFF DQ+           Y+  +K G+T+ +P GWIHAV T  D L FGGNF+HSL+I +QL+ Y+IE+ L T D F FP FE + W+V ++IL
Sbjct:   87 TGSAQFVRELRSR-TFPSADEVLLKPTGAQLTVDFLEERSFSVPVLVLRRDGLGMSLPPSSFSVSDIEHYIGAEKEIDVIDVVRQADLKMKLGDFATYY-NSPNRDRVLNVISLEFSDTRLSNLVETPKIVRKLSWVENLWPEESVFER---PNVQKYCLMGVKDSYTDFHIDFGGTSVWYHVLRGEKIFYLIRPTPANLSLFERWSSSSNQNELFFGDQVDM--------CYKCSVKQGNTLFIPTGWIHAVLTPVDCLAFGGNFLHSLNIDMQLRAYEIEKRLSTADLFKFPNFETVCWYVGKHIL 381          
BLAST of Lysine-specific demethylase 7A vs. Ensembl Cavefish
Match: phf8 (PHD finger protein 8 [Source:NCBI gene;Acc:103038657])

HSP 1 Score: 273.478 bits (698), Expect = 1.452e-78
Identity = 135/308 (43.83%), Postives = 201/308 (65.26%), Query Frame = 1
Query:  157 SGTKEFLEYLQEKQCLPIGDQ-LKELRGKEVTEDYFIKNGFNKPIMIRRKKGLRIVLPESPFSVEDVGRNLGKDYILDVIDVVQQDQYKMRFGEFLDYFRESEPRSKLLNVLSLEISHTKIAHLVEPPYVIKEMSIVEKLWPCDNLYQRANKPSVQKYCLMSMKDSWTDFHIDFGGSSVWYHMYSGHKIFYLIPPKRRYIKAYTSWMGEYNNRMLFFPDQIKKFSLNDQAEVYRLEIKSGDTILLPAGWIHAVHTLEDSLVFGGNFVHSLSIPLQLKIYKIERFLQTEDRFLFPYFEKLHWFVAEYIL 1077
            +G+ +F+  L+ +   P  D+ L +  G ++T D+  +  F+ P+++ R+ GL + LP S FSV D+   +G +  +DVIDVV+Q   KM+ G+F  Y+  S  R ++LNV+SLE S T++++LVE P +++++S VE LWP +++++R   P+VQKYCLM +KDS+TDFHIDFGG+SVWYH+  G KIFYLI P    +  +  W    N   LFF DQ+           Y+  +K G+T+ +P GWIHAV T  D L FGGNF+HSL+I +QL+ Y+IE+ L T D F FP FE + W+V ++IL
Sbjct:   87 TGSAQFVRELRSR-TFPSADEVLLKPTGAQLTVDFLEERSFSVPVLVLRRDGLGMSLPPSSFSVSDIEHYIGAEKEIDVIDVVRQADLKMKLGDFATYY-NSPNRDRVLNVISLEFSDTRLSNLVETPKIVRKLSWVENLWPEESVFER---PNVQKYCLMGVKDSYTDFHIDFGGTSVWYHVLRGEKIFYLIRPTPANLSLFERWSSSSNQNELFFGDQVDM--------CYKCSVKQGNTLFIPTGWIHAVLTPVDCLAFGGNFLHSLNIDMQLRAYEIEKRLSTADLFKFPNFETVCWYVGKHIL 381          
BLAST of Lysine-specific demethylase 7A vs. Ensembl Cavefish
Match: kdm7ab (lysine demethylase 7A [Source:NCBI gene;Acc:103031714])

HSP 1 Score: 265.003 bits (676), Expect = 2.217e-76
Identity = 136/311 (43.73%), Postives = 198/311 (63.67%), Query Frame = 1
Query:  157 SGTKEFLEYLQEKQCLPIGDQLKELRGKEVTEDYFIKNGFNKPIMIRRKKGLRIVLPESPFSVEDVGRNLGKDYILDVIDVVQQDQYKMRFGEFLDYFRESEPRSKLLNVLSLEISHTKIAHLVEPPYVIKEMSIVEKLWPCDNLYQRANKPSVQKYCLMSMKDSWTDFHIDFGGSSVWYHMYSGHKIFYLIPPKRRYIKAYTSWMGEYNNRMLFFPDQIKKFSLNDQAEVYRLEIKSGDTILLPAGWIHAVHTLEDSLVFGGNFVHSLSIPLQLKIYKIERFLQTEDRFLFPYFEKLHWFVAEYILHKLE 1089
            +GT  F++ LQ +      + L  ++G +VT+ Y  ++GF  PI + +  GL + LP S FSV+DV R +G D ++DVIDV +Q   KM+  EF+ Y+  S  R K+LNV+SLE S TK++ LV  P + ++MS VE  WP D+ +    KP VQKYCLM +K+S+TDFHIDFGG+SVWYH+  G KIFYLI P    +  Y  W    N   +FF +++           Y+  ++ G T+ +P GWIHAV T +D + FGGNF+H+L+I +QL+ Y++ER L+T + F FPYFE + W+VA+ +L  L+
Sbjct:   85 AGTFVFVQELQNRTFASGDELLVRMQGSQVTQRYLERHGFRYPIAVAQLDGLGLRLPPSDFSVKDVERYVGGDKVIDVIDVARQADSKMKLKEFVKYYY-SPQRPKVLNVISLEFSDTKMSELVVVPDIAQKMSWVENYWPDDSYFP---KPFVQKYCLMGVKNSYTDFHIDFGGTSVWYHVLWGEKIFYLIKPTPTNLALYEEWSSSPNQSEVFFGEKVDT--------CYKCVVRQGTTLFIPTGWIHAVLTSQDCMAFGGNFLHNLNIGMQLRCYEMERRLKTPELFKFPYFEAICWYVAKNLLEALK 383          
BLAST of Lysine-specific demethylase 7A vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010170.1 (pep scaffold:Pmarinus_7.0:GL480870:8586:17942:-1 gene:ENSPMAG00000009200.1 transcript:ENSPMAT00000010170.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 261.151 bits (666), Expect = 6.166e-80
Identity = 135/326 (41.41%), Postives = 194/326 (59.51%), Query Frame = 1
Query:  214 DQLKELRGKEVTEDYFIKNGFNKPIMIRRKKGLRIVLPESPFSVEDVGRNLGKDYILDVIDVVQQDQYKMRFGEFLDYFRESEPRSKLLNVLSLEISHTKIAHLVEPPYVIKEMSIVEKLWPCDNLYQRANKPSVQKYCLMSMKDSWTDFHIDFGGSSVWYHMYSGHKIFYLIPPKRRYIKAYTSWMGEYNNRMLFFPDQIKKFSLNDQAEVYRLEIKSGDTILLPAGWIHAVHTLEDSLVFGGNFVHSLSIPLQLKIYKIERFLQTEDRFLFPYFEKLHWFVAEYILHKLEANLTHNXXXXXXXXXXXXXXXETLPDWLSKYHTC 1191
            D L +  G ++T  Y  + GF  PI++ +K GL +++P + F+V DV + +G + ++DVIDV +Q   KM  GEF+ Y+  S    +++NV+SLE S+T+++ LVEPP V++ +S VE  WP D+ +     P V KYCLM +KDS+TDFHIDFGG+SVWYH+  G KIFYLI P    +  Y  W    N   +FF DQ+ K         YR  +K G T+L+P GWIH V T  D + FGGNF+H+L+I +QL++ ++E+ L+T D F FP FE L W+    +L            P   + +GA  L  TL  W+ K   C
Sbjct:  103 DVLLKPHGSQLTLQYLEQAGFETPILVAKKDGLGMMVPPTSFTVSDVEQYVGSERLIDVIDVPRQASVKMTLGEFVQYY-NSPNHGQVMNVISLEFSNTRLSALVEPPEVVRNLSWVENYWPLDSQFP---TPHVDKYCLMGVKDSYTDFHIDFGGTSVWYHVLKGEKIFYLIKPTNANLALYERWSLSSNQNEMFFGDQVDK--------CYRCTVKQGQTLLIPTGWIHGVLTPVDCIAFGGNFLHNLNIGMQLRVSEMEKRLKTADLFSFPNFETLLWYTGRSLLETFRELRARGNQPPAYLTQGAKALNSTLRSWMRKEVRC 416          
BLAST of Lysine-specific demethylase 7A vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010169.1 (pep scaffold:Pmarinus_7.0:GL480870:6363:17942:-1 gene:ENSPMAG00000009200.1 transcript:ENSPMAT00000010169.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 260.381 bits (664), Expect = 2.387e-79
Identity = 139/351 (39.60%), Postives = 203/351 (57.83%), Query Frame = 1
Query:  214 DQLKELRGKEVTEDYFIKNGFNKPIMIRRKKGLRIVLPESPFSVEDVGRNLGKDYILDVIDVVQQDQYKMRFGEFLDYFRESEPRSKLLNVLSLEISHTKIAHLVEPPYVIKEMSIVEKLWPCDNLYQRANKPSVQKYCLMSMKDSWTDFHIDFGGSSVWYHMYSGHKIFYLIPPKRRYIKAYTSWMGEYNNRMLFFPDQIKKFSLNDQAEVYRLEIKSGDTILLPAGWIHAVHTLEDSLVFGGNFVHSLSIPLQLKIYKIERFLQTEDRFLFPYFEKLHWFVAEYILHKLEANLTHNXXXXXXXXXXXXXXXETLPDWLSK-----YHTCTPDEREYNYPEKGLMESSKV 1251
            D L +  G ++T  Y  + GF  PI++ +K GL +++P + F+V DV + +G + ++DVIDV +Q   KM  GEF+ Y+  S    +++NV+SLE S+T+++ LVEPP V++ +S VE  WP D+ +     P V KYCLM +KDS+TDFHIDFGG+SVWYH+  G KIFYLI P    +  Y  W    N   +FF DQ+ K         YR  +K G T+L+P GWIH V T  D + FGGNF+H+L+I +QL++ ++E+ L+T D F FP FE L W+    +L            P   + +GA  L  TL  W+ K     +    PD+  Y    K L +  ++
Sbjct:  108 DVLLKPHGSQLTLQYLEQAGFETPILVAKKDGLGMMVPPTSFTVSDVEQYVGSERLIDVIDVPRQASVKMTLGEFVQYY-NSPNHGQVMNVISLEFSNTRLSALVEPPEVVRNLSWVENYWPLDSQFP---TPHVDKYCLMGVKDSYTDFHIDFGGTSVWYHVLKGEKIFYLIKPTNANLALYERWSLSSNQNEMFFGDQVDK--------CYRCTVKQGQTLLIPTGWIHGVLTPVDCIAFGGNFLHNLNIGMQLRVSEMEKRLKTADLFSFPNFETLLWYTGRSLLETFRELRARGNQPPAYLTQGAKALNSTLRSWMRKEVLGDHEPDIPDDINYGQLTKDLAKEIRI 446          
BLAST of Lysine-specific demethylase 7A vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003484.1 (pep scaffold:Pmarinus_7.0:GL479346:7845:35819:-1 gene:ENSPMAG00000003183.1 transcript:ENSPMAT00000003484.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 226.098 bits (575), Expect = 3.662e-67
Identity = 118/312 (37.82%), Postives = 187/312 (59.94%), Query Frame = 1
Query:  157 SGTKEFLEYLQEKQCLPIGDQLKELRGKEVTEDYFIKNGFNKPIMIRRKKGLRIVLPESPFSVEDVGRNLGKDYILDVIDVVQQDQYKMRFGEFLDYFRESEPRSKLLNVLSLEISHTKIAHLVEPPYVIKEMSIVEKLWPCDNLYQRANKPSVQKYCLMSMKDSWTDFHIDFGGSSVWYHMYSGHKIFYLIPPKRRYIKA-YTSWMGEYNNRMLFFPDQIKKFSLNDQAEVYRLEIKSGDTILLPAGWIHAVHTLEDSLVFGGNFVHSLSIPLQLKIYKIERFLQTEDRFLFPYFEKLHWFVAEYILHKLE 1089
            +GT  F++ LQ +      + ++ + G ++T DY I+NGF  PI++ +K GL + +P   F+V DV R +G D ++DVIDV +Q  +K+   EF +Y+  S  R K+LN++SLE S T+++ LV+ P ++ ++S VE  WP D ++ R   P VQKYCLM ++DS+TDFHIDFGG+SVWYH+      F+ +      + A +  +   ++    FF D     +   ++ V R+ +    T     GWIHAV T  D + FGGNF+HSL++ +Q++ Y IE  L+T + F FP FE + W+  + +L  L+
Sbjct:   39 TGTPVFVKKLQGRSFPSAEEVVRRMPGSQLTADYIIENGFTSPIIVSKKDGLGMTVPPPSFTVSDVERYVGSDRMIDVIDVNRQADFKVTMKEFCEYY-NSTSRQKVLNIISLEFSDTRLSDLVKAPELVHKLSWVENYWPEDAVFPR---PYVQKYCLMGVRDSYTDFHIDFGGTSVWYHLLKAEFFFFFLETTAISLNARFVCYCSSFSQNRQFFSDVAVHCT---RSPVARVGVMCART-----GWIHAVLTPYDCIAFGGNFLHSLNVEMQIRAYDIETRLKTPEVFKFPNFESMCWYAGKSLLEMLK 338          
BLAST of Lysine-specific demethylase 7A vs. Ensembl Sea Lamprey
Match: jmjd4 (jumonji domain containing 4 [Source:NCBI gene;Acc:767690])

HSP 1 Score: 55.4546 bits (132), Expect = 2.474e-8
Identity = 61/247 (24.70%), Postives = 102/247 (41.30%), Query Frame = 1
Query:  313 RIVLPESPFSVEDVGRNLGKDYILDVIDVVQQD-----QYKMRFGEFLDYFRES---EPRSKLLNVLSLEISHTKIAHLVEPPYVIKEMSIVEKLWPCDNLYQRANKPSVQKYCLMSMKDSWTDFHIDFGGSSVWYHMYSGHKIFYLIPPKRRYIKAYTSWMGEYNNRMLFFPDQIKKFSLNDQAEVYRLEI--KSGDTILLPAGWIHAVHTLEDSLVFGGNFVHSLSIPLQLKIYKIERFLQTEDR 1023
            R V P     +  + R+ G D ++ V D  +++     + +M   EFL Y++E+   +  S     L L+  H          Y   E    + L    N Y  A      ++  M  + SWT FH D   S  W     G K++ L PP +   +A    +G     +       +      Q     +E+  ++G+ I +P+GW H VH LED++    N+++  +I L      +  FLQ+E R
Sbjct:   55 RWVTPRGEPDLGALHRDFG-DAVVPVADCAEREYNSNPKKQMPMREFLSYWQETMSQDHSSSPRPCLYLKDWHMCKEFPDYDAYSTPECFSSDWL----NEYWDAVHSDDYRFVYMGPRGSWTPFHADVFRSYSWSANVCGRKLWLLYPPGQE--EALRDHLGNLPYDVTAPDPWPQDAPAKKQRGQKPMEVIQEAGEIIFIPSGWHHQVHNLEDTISINHNWLNGCNIDL------VWSFLQSELR 288          
BLAST of Lysine-specific demethylase 7A vs. Ensembl Sea Lamprey
Match: jmjd6 (jumonji domain containing 6, arginine demethylase and lysine hydroxylase [Source:NCBI gene;Acc:266962])

HSP 1 Score: 49.2914 bits (116), Expect = 2.190e-6
Identity = 36/124 (29.03%), Postives = 54/124 (43.55%), Query Frame = 1
Query:  622 KYCLMSMKDSWTDFHIDFGGSSVWYHMYSGHKIFYLIPPK--RRYIKAYTSWMGEYNNRMLFFPDQIKKFSLNDQ--AEVYRLEI--KSGDTILLPAGWIHAVHTLEDSLVFGGNFVHSLSIPL 975
            ++ +M    S T  HID  G+S W  +  GHK + L P    R  IK      G   +  + +   I   +       E   LEI  K G+T+ +P GW H V  LE+++    NF    + P+
Sbjct:  175 RWFVMGPARSGTGIHIDPLGTSAWNALVKGHKRWCLFPTNTPRELIKVAREEGGIQQDEAITWFSVIYPRTQEPSWPPEFRPLEILQKPGETVFVPGGWWHVVLNLENTIAVTQNFASVTNFPV 298          
BLAST of Lysine-specific demethylase 7A vs. Ensembl Yeast
Match: JHD1 (JmjC domain family histone demethylase specific for H3-K36; similar to proteins found in human, mouse, drosophila, X. laevis, C. elegans, and S. pombe [Source:SGD;Acc:S000000853])

HSP 1 Score: 168.703 bits (426), Expect = 1.160e-45
Identity = 91/248 (36.69%), Postives = 145/248 (58.47%), Query Frame = 1
Query:  364 LGKDYILDVIDVVQQDQYKMRFGEFLDYFRESEP--RSKLLNVLSLEISHTKIAHLVEPPYVIKEMSIVEKLWPCDNLYQRAN---------KPSVQKYCLMSMKDSWTDFHIDFGGSSVWYHMYSGHKIFYLIPPKRRYIKAYTSWMGEYNNRMLFFPDQIKKFSLNDQAEVYRLEIKSGDTILLPAGWIHAVHTLEDSLVFGGNFVHSLSIPLQLKIYKIERFLQTEDRFLFPYFEKLHWFVAEYI 1074
            +G+DY +DV+DV  Q       G + +YF  +EP  R ++ NV+SLE+S+ +   L E P  +++  +V+K+W  +   ++ N         KP V KY LMS+KD++TDFH+DF G+SV+Y++ SG K F L PP +  I  Y  W  + +   +F  D ++        +   +E+ +GD  ++PAG+IHAV+T  DSLVFGGNF+    +   LKI +IE+  +   RF FP F+++   + EY+
Sbjct:  195 IGEDYHVDVMDVQSQMNENWNLGSWNEYFTNTEPDRRDRIRNVISLEVSNIEGLEL-ERPTAVRQNDLVDKIWSFNGHLEKVNGEKAEENDPKPKVTKYILMSVKDAYTDFHLDFAGTSVYYNVISGQKKFLLFPPTQSNIDKYIEWSLKEDQNSVFLGDILE--------DGIAMELDAGDLFMIPAGYIHAVYTPVDSLVFGGNFLTIRDLETHLKIVEIEKLTKVPRRFTFPKFDQVMGKLCEYL 433          
BLAST of Lysine-specific demethylase 7A vs. Ensembl Nematostella
Match: EDO39503 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9X9])

HSP 1 Score: 265.388 bits (677), Expect = 4.052e-81
Identity = 133/313 (42.49%), Postives = 201/313 (64.22%), Query Frame = 1
Query:  157 SGTKEFLEYLQEKQCLPIGDQLKELRGKEVTEDYFIKNGFNKPIMIRRKKGLRIVLPESPFSVEDVGRNLGKDYILDVIDVVQQDQYKMRFGEFLDYFRESEPRSKLLNVLSLEISHTKIAHLVEPPYVIKEMSIVEKLWPCDNLYQRANK-PSVQKYCLMSMKDSWTDFHIDFGGSSVWYHMYSGHKIFYLIPPKRRYIKAYTSWMGEYNNRMLFFPDQIKKFSLNDQAEVYRLEIKSGDTILLPAGWIHAVHTLEDSLVFGGNFVHSLSIPLQLKIYKIERFLQTEDRFLFPYFEKLHWFVAEYILHKLEA 1092
            +GT  F+  L+ K+     + + E+ G+++T DYF +NGF KP++I +  GL IV+P+  F + DV + +G    LDVIDV +Q+  KMR  E+ +Y+  +  R K LNV+SLE S+T ++ LV  P ++KE+     +WP D      +K P VQKYCLMS+ + +TDFH+DFGG+SVWYH++ G K+FY + P    ++ Y  W+       +FF D +KK         Y+++IK G T+ +P GWIHAV+T  DSLVFGGNF+HS +I LQL+IY +E  L+T ++F  P++E ++WF A ++L KL+ 
Sbjct:   86 TGTVLFINTLKTKKFGSPKESVIEVHGRDLTVDYFERNGFQKPLLIDKTDGLNIVVPKPGFDIPDVEKYVGSMRELDVIDVCKQEDIKMRMREWTEYYM-NPVRKKTLNVISLEFSNTPMSSLVHVPAIVKELDWANHVWPTDLPEDSPHKKPYVQKYCLMSVSNCYTDFHVDFGGTSVWYHVFKGEKVFYFVEPTPANLEKYHQWVMSSTQSEIFFGDMVKK--------CYKVQIKQGQTLFIPTGWIHAVYTPVDSLVFGGNFLHSFNIGLQLEIYDLELKLKTPNKFQHPFYETINWFAAVFLLDKLKG 389          
BLAST of Lysine-specific demethylase 7A vs. Ensembl Nematostella
Match: EDO41168 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S527])

HSP 1 Score: 244.202 bits (622), Expect = 1.032e-68
Identity = 121/289 (41.87%), Postives = 180/289 (62.28%), Query Frame = 1
Query:  229 LRGKEVTEDYFIKNGFNKPIMIRRKKGLRIVLPESPFSVEDVGRNLGKDYILDVIDVVQQDQYKMRFGEFLDYFRESEPRSKLLNVLSLEISHTKIAHLVEPPYVIKEMSIVEKLWPCDNLYQRANK---------PSVQKYCLMSMKDSWTDFHIDFGGSSVWYHMYSGHKIFYLIPPKRRYIKAYTSWMGEYNNRMLFFPDQIKKFSLNDQAEVYRLEIKSGDTILLPAGWIHAVHTLEDSLVFGGNFVHSLSIPLQLKIYKIERFLQTEDRFLFPYFEKLHWFVAE 1068
            L G E +  Y   NGF  PI+ +  +GL + +P++ F+V DV   +G   ++DVIDV  Q   ++    ++ YF   E R K+ NV+SLE SHTK+  LVE P V++++  V+ +WP + + ++ +          P V+KYCLMS+   +TDFHIDFGG+SVWYH+  G KIF+LIPP  R ++ Y  W+     +  FF DQ++K S        R+ + SGDT L+P GWIHAV+T +DSLVFGGNF+HS SI  Q++I +IE   +   +F +P++ ++ W+VAE
Sbjct:   54 LDGNEFSLKYVQSNGFKTPILFKSTEGLDMKIPDAEFTVTDVKNFVGARRLVDVIDVNTQQPLELTLQNWVKYFTNPE-REKIYNVISLEFSHTKLQDLVESPLVVRQIDWVDTVWPRNLIEEQRDSTNSMADMKYPKVKKYCLMSVGGCYTDFHIDFGGTSVWYHLMKGKKIFWLIPPTERNLQQYERWVLSGKQQDFFFGDQVEKCS--------RVTLVSGDTFLIPTGWIHAVYTPDDSLVFGGNFIHSYSISEQIRISQIEDNTKVPQKFRYPFYAEMMWYVAE 333          
BLAST of Lysine-specific demethylase 7A vs. Ensembl Nematostella
Match: EDO41023 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5J7])

HSP 1 Score: 51.6026 bits (122), Expect = 6.993e-7
Identity = 34/124 (27.42%), Postives = 61/124 (49.19%), Query Frame = 1
Query:  622 KYCLMSMKDSWTDFHIDFGGSSVWYHMYSGHKIFYLIPP--KRRYIKAYTSWMGEYNNRML-FFPDQIKKFSLNDQAEVYR-LEI--KSGDTILLPAGWIHAVHTLEDSLVFGGNFVHSLSIPL 975
            ++ +M    S T  HID  G+S W  + SGHK + + P    +  +K  +S  G+  +  + +F     K  L+   E Y+ +E+    G+T+ +P GW H V  L+ ++    NF   ++ P+
Sbjct:  173 RWFVMGPARSGTGIHIDPLGTSAWNSVVSGHKRWAMFPTFVPQEMLKVPSSEGGKQRDEAITWFTHVYPKTQLSSWPEEYKPVEVLQGPGETVFVPGGWWHVVVNLDAAIAVTQNFSSPVNFPV 296          
BLAST of Lysine-specific demethylase 7A vs. Ensembl Medaka
Match: kdm7ab (lysine demethylase 7A [Source:NCBI gene;Acc:101156787])

HSP 1 Score: 281.567 bits (719), Expect = 7.471e-83
Identity = 143/316 (45.25%), Postives = 204/316 (64.56%), Query Frame = 1
Query:  145 TMPL-SGTKEFLEYLQEKQCLPIGDQLKELRGKEVTEDYFIKNGFNKPIMIRRKKGLRIVLPESPFSVEDVGRNLGKDYILDVIDVVQQDQYKMRFGEFLDYFRESEPRSKLLNVLSLEISHTKIAHLVEPPYVIKEMSIVEKLWPCDNLYQRANKPSVQKYCLMSMKDSWTDFHIDFGGSSVWYHMYSGHKIFYLIPPKRRYIKAYTSWMGEYNNRMLFFPDQIKKFSLNDQAEVYRLEIKSGDTILLPAGWIHAVHTLEDSLVFGGNFVHSLSIPLQLKIYKIERFLQTEDRFLFPYFEKLHWFVAEYILHKLE 1089
            T P+ +GT +F++ LQ +      + L  ++G++VT  +  ++GFN PI +   +GL + LP S FSV DV + +G D ++DVIDV +Q   KM+ G F+ YF     R K+LN++SLE S TK+A LVE P V ++MS VE  WP D+ +    KP VQKYCLM +KDS+TDFHIDFGG+SVWYH+  G KIFYLI P    +  Y +W    N   +FF D+++K         Y+  +  G T+L+P GWIH V T +D + FGGNF+H+L+I +QL+ Y++ER L+T D F FPYFE + W+VA+ +L  L+
Sbjct:   80 TQPVQAGTSKFVKELQNRTFPSAEEILIRMKGEQVTTRFLERHGFNYPIAVTEMEGLGLKLPPSTFSVRDVEQYVGGDKVIDVIDVARQADSKMKLGAFVKYFTNPH-RPKVLNLISLEFSDTKMAELVEVPIVAQKMSWVENYWPDDSFFP---KPFVQKYCLMGVKDSYTDFHIDFGGTSVWYHVLWGEKIFYLIKPTSTNLALYEAWSSSPNQSEVFFGDKVEK--------CYKCVVSQGTTLLIPTGWIHGVLTSQDCMAFGGNFLHNLNIGMQLRCYEMERRLKTPDLFKFPYFEAICWYVAKNLLEMLK 383          
BLAST of Lysine-specific demethylase 7A vs. Ensembl Medaka
Match: phf8 (PHD finger protein 8 [Source:NCBI gene;Acc:101166128])

HSP 1 Score: 272.707 bits (696), Expect = 1.859e-78
Identity = 131/313 (41.85%), Postives = 204/313 (65.18%), Query Frame = 1
Query:  157 SGTKEFLEYLQEKQCLPIGDQ-LKELRGKEVTEDYFIKNGFNKPIMIRRKKGLRIVLPESPFSVEDVGRNLGKDYILDVIDVVQQDQYKMRFGEFLDYFRESEPRSKLLNVLSLEISHTKIAHLVEPPYVIKEMSIVEKLWPCDNLYQRANKPSVQKYCLMSMKDSWTDFHIDFGGSSVWYHMYSGHKIFYLIPPKRRYIKAYTSWMGEYNNRMLFFPDQIKKFSLNDQAEVYRLEIKSGDTILLPAGWIHAVHTLEDSLVFGGNFVHSLSIPLQLKIYKIERFLQTEDRFLFPYFEKLHWFVAEYILHKLEA 1092
            +G+ +F+  L+ +   P  D+ L +  G ++T ++  ++ F+ P+M+ R+ GL + LP + FSV D+  ++G D  +DVIDV +Q   KMR G+F++Y+  S  R ++LNV+SLE S T++++LVE P +++++S VE LWP +++++R   P+VQKYCLM +KDS+TDFHIDFGG+SVWYH+  G KIFYLI P    +  +  W    N   +FF DQ+           Y+  +K G+T+ +P GWIHAV T  D L FGGNF+HSL+I +Q++ Y+IE+ L T + F FP FE + W+  +++L  L  
Sbjct:   88 TGSPQFVRELRSR-TFPNADEILLKPSGAQLTVEFLEEHSFSVPVMVLRRDGLGMTLPPASFSVSDIEHHIGPDKEIDVIDVCRQCDLKMRLGDFVEYY-NSPNRDRVLNVISLEFSETRLSNLVETPKIVRKLSWVENLWPEESVFER---PNVQKYCLMGVKDSYTDFHIDFGGTSVWYHVLRGEKIFYLISPTPANLALFEQWNSSSNQNEMFFGDQVDM--------CYKCSVKQGNTLFIPTGWIHAVLTPVDCLAFGGNFLHSLNIDMQIRAYEIEKRLSTAELFKFPNFETVCWYAGKHLLDTLRG 387          
BLAST of Lysine-specific demethylase 7A vs. Ensembl Medaka
Match: phf2 (PHD finger protein 2 [Source:NCBI gene;Acc:101157612])

HSP 1 Score: 237.269 bits (604), Expect = 8.290e-66
Identity = 120/314 (38.22%), Postives = 197/314 (62.74%), Query Frame = 1
Query:  157 SGTKEFLEYLQEKQCLPIGDQLKELRGKEVTEDYFIKNGFNKPIMIRRKKGLRIVLPESPFSVEDVGRNLGKDYILDVIDVVQQDQYKMRFGEFLDYFRESEPRSKLLNVLSLEISHTKIAHLVEPPYVIKEMSIVEKLWPCDNLYQRANKPSVQKYCLMSMKDSWTDFHIDFGGSSVWYHMYSGHKIFYLIPPKRRYIKAYTSWMGEYNNRMLFFPDQIKKFSLNDQAEVYRLEIKSGDTILLPAGWIHAVHTLEDSLVFGGNFVHSLSIPLQLKIYKIERFLQTEDRFLFPYFEKLHWFVAEYILHKLEANL 1098
            +G++ F++ L+ +      D L +L G ++T ++  +NGF++PI++++K GL + +P   F + DV   +G D  +DV+DV +Q   KM+  EF+DY+  +  R K+LNV++LE S T+++++VE P++++++S VE  WP D L     KP V KYCL+ +KDS+TDFHI+ GG+SVWYH+  G KIF+LI P    +  +  W    ++  +FF DQ+ K         Y+  +K G T+ +P+GWI+A+ T  DSL F G+FVH+LS+ +Q++ Y+IE+ L+      FP FE   W+V  + L + +  L
Sbjct:   84 NGSQVFIKELRSRTFPSADDILVKLSGCQLTLEFLEENGFDQPILVQKKDGLGMSMPAPTFYISDVENYVGPDVSVDVVDVTKQTDSKMKLKEFVDYYYSTN-RKKVLNVINLEFSDTRMSNIVESPHIVRQLSWVENYWPDDALL---GKPKVTKYCLICVKDSYTDFHIECGGASVWYHILKGEKIFFLIKPTSANLSLFERWRSSSSHSEMFFADQVDK--------CYKCTLKQGQTLFIPSGWINAILTPVDSLSFSGHFVHNLSVEMQMRAYEIEKRLKVRSLTPFPNFETACWYVGRHFLERFKGEL 385          
BLAST of Lysine-specific demethylase 7A vs. Ensembl Medaka
Match: kdm2ab (lysine demethylase 2A [Source:NCBI gene;Acc:101164160])

HSP 1 Score: 238.039 bits (606), Expect = 1.014e-65
Identity = 129/321 (40.19%), Postives = 196/321 (61.06%), Query Frame = 1
Query:  184 LQEK-QCLPIGDQL-KELRGKEVTEDYFIKNGFNKPIMIRRKKGLRIVLPESPFSVEDVGRNLGKDYILDVIDVVQQDQYKMRFGEFLDYFRESEP--RSKLLNVLSLEISHTKIAHLVEPPYVIKEMSIVEKLWPCDNLYQRANK----------PSVQKYCLMSMKDSWTDFHIDFGGSSVWYHMYSGHKIFYLIPPKRRYIKAYTSWMGEYNNRMLFFPDQIKKFSLNDQAEVYRLEIKSGDTILLPAGWIHAVHTLEDSLVFGGNFVHSLSIPLQLKIYKIERFLQTEDRFLFPYFEKLHWFVAEYILHKLEANLTH 1104
            L+EK QC   G +L K ++GK+ T +Y  + G   PI+     GL + +P+S FSV DV   +G   I+DV+DV  Q   +M   ++  Y+ E+ P  R KL NV+SLE SHT++ +LV+ P  +  +  V+ +WP  +L +R             P VQKYCLMS++  +TDFHIDFGG+SVWYH+  G K+F+LIPP  + ++ Y +W+       +F  D+          +  R+E+K G+T ++P+GWIHAV+T ED+LVFGGNF+HS +IP+QL IY IE   +   +F +P++ ++ W+V E  L+ L  N++H
Sbjct:   38 LEEKLQCGKFGSELIKYMKGKDFTFEYIQREGLRDPIVFETSDGLGLQMPDSDFSVSDVKLFVGSRRIVDVMDVNTQKGIEMSMAQWRRYY-ETPPSEREKLYNVISLEFSHTRLENLVKRPASVDLIDWVDNMWP-RHLKERQRDSTNAIIDMHYPKVQKYCLMSVQGCFTDFHIDFGGTSVWYHILRGGKVFWLIPPTPQNLEMYENWVLSGKQGDIFLGDKC--------CDCQRIELKQGNTFIIPSGWIHAVYTPEDTLVFGGNFLHSFNIPMQLNIYNIEDRTRVPAKFRYPFYYEMCWYVLERYLYCL-TNISH 347          
BLAST of Lysine-specific demethylase 7A vs. Ensembl Medaka
Match: phf2 (PHD finger protein 2 [Source:NCBI gene;Acc:101157612])

HSP 1 Score: 234.958 bits (598), Expect = 5.668e-65
Identity = 119/312 (38.14%), Postives = 196/312 (62.82%), Query Frame = 1
Query:  157 SGTKEFLEYLQEKQCLPIGDQLKELRGKEVTEDYFIKNGFNKPIMIRRKKGLRIVLPESPFSVEDVGRNLGKDYILDVIDVVQQDQYKMRFGEFLDYFRESEPRSKLLNVLSLEISHTKIAHLVEPPYVIKEMSIVEKLWPCDNLYQRANKPSVQKYCLMSMKDSWTDFHIDFGGSSVWYHMYSGHKIFYLIPPKRRYIKAYTSWMGEYNNRMLFFPDQIKKFSLNDQAEVYRLEIKSGDTILLPAGWIHAVHTLEDSLVFGGNFVHSLSIPLQLKIYKIERFLQTEDRFLFPYFEKLHWFVAEYILHKLEA 1092
            +G++ F++ L+ +      D L +L G ++T ++  +NGF++PI++++K GL + +P   F + DV   +G D  +DV+DV +Q   KM+  EF+DY+  +  R K+LNV++LE S T+++++VE P++++++S VE  WP D L     KP V KYCL+ +KDS+TDFHI+ GG+SVWYH+  G KIF+LI P    +  +  W    ++  +FF DQ+ K         Y+  +K G T+ +P+GWI+A+ T  DSL F G+FVH+LS+ +Q++ Y+IE+ L+      FP FE   W+V  + L + + 
Sbjct:   84 NGSQVFIKELRSRTFPSADDILVKLSGCQLTLEFLEENGFDQPILVQKKDGLGMSMPAPTFYISDVENYVGPDVSVDVVDVTKQTDSKMKLKEFVDYYYSTN-RKKVLNVINLEFSDTRMSNIVESPHIVRQLSWVENYWPDDALL---GKPKVTKYCLICVKDSYTDFHIECGGASVWYHILKGEKIFFLIKPTSANLSLFERWRSSSSHSEMFFADQVDK--------CYKCTLKQGQTLFIPSGWINAILTPVDSLSFSGHFVHNLSVEMQMRAYEIEKRLKVRSLTPFPNFETACWYVGRHFLERFKG 383          
BLAST of Lysine-specific demethylase 7A vs. Planmine SMEST
Match: SMESG000017771.1 (SMESG000017771.1)

HSP 1 Score: 825.469 bits (2131), Expect = 0.000e+0
Identity = 437/437 (100.00%), Postives = 437/437 (100.00%), Query Frame = 1
Query:  148 MPLSGTKEFLEYLQEKQCLPIGDQLKELRGKEVTEDYFIKNGFNKPIMIRRKKGLRIVLPESPFSVEDVGRNLGKDYILDVIDVVQQDQYKMRFGEFLDYFRESEPRSKLLNVLSLEISHTKIAHLVEPPYVIKEMSIVEKLWPCDNLYQRANKPSVQKYCLMSMKDSWTDFHIDFGGSSVWYHMYSGHKIFYLIPPKRRYIKAYTSWMGEYNNRMLFFPDQIKKFSLNDQAEVYRLEIKSGDTILLPAGWIHAVHTLEDSLVFGGNFVHSLSIPLQLKIYKIERFLQTEDRFLFPYFEKLHWFVAEYILHKLEANLTHNXXXXXXXXXXXXXXXETLPDWLSKYHTCTPDEREYNYPEKGLMESSKVHLIRKLSDVVKTLITASIIDDPLPQTQVXXXXXXXXXXXXXXTLMSMKFVKRKPSDISAECSEEKQNKL 1458
            MPLSGTKEFLEYLQEKQCLPIGDQLKELRGKEVTEDYFIKNGFNKPIMIRRKKGLRIVLPESPFSVEDVGRNLGKDYILDVIDVVQQDQYKMRFGEFLDYFRESEPRSKLLNVLSLEISHTKIAHLVEPPYVIKEMSIVEKLWPCDNLYQRANKPSVQKYCLMSMKDSWTDFHIDFGGSSVWYHMYSGHKIFYLIPPKRRYIKAYTSWMGEYNNRMLFFPDQIKKFSLNDQAEVYRLEIKSGDTILLPAGWIHAVHTLEDSLVFGGNFVHSLSIPLQLKIYKIERFLQTEDRFLFPYFEKLHWFVAEYILHKLEANLTHNIPPIKLILKGALKLIETLPDWLSKYHTCTPDEREYNYPEKGLMESSKVHLIRKLSDVVKTLITASIIDDPLPQTQVSSSQSSIFNNISSSTLMSMKFVKRKPSDISAECSEEKQNKL
Sbjct:    1 MPLSGTKEFLEYLQEKQCLPIGDQLKELRGKEVTEDYFIKNGFNKPIMIRRKKGLRIVLPESPFSVEDVGRNLGKDYILDVIDVVQQDQYKMRFGEFLDYFRESEPRSKLLNVLSLEISHTKIAHLVEPPYVIKEMSIVEKLWPCDNLYQRANKPSVQKYCLMSMKDSWTDFHIDFGGSSVWYHMYSGHKIFYLIPPKRRYIKAYTSWMGEYNNRMLFFPDQIKKFSLNDQAEVYRLEIKSGDTILLPAGWIHAVHTLEDSLVFGGNFVHSLSIPLQLKIYKIERFLQTEDRFLFPYFEKLHWFVAEYILHKLEANLTHNIPPIKLILKGALKLIETLPDWLSKYHTCTPDEREYNYPEKGLMESSKVHLIRKLSDVVKTLITASIIDDPLPQTQVSSSQSSIFNNISSSTLMSMKFVKRKPSDISAECSEEKQNKL 437          
BLAST of Lysine-specific demethylase 7A vs. Planmine SMEST
Match: SMESG000053144.1 (SMESG000053144.1)

HSP 1 Score: 237.654 bits (605), Expect = 1.369e-69
Identity = 115/284 (40.49%), Postives = 174/284 (61.27%), Query Frame = 1
Query:  268 NGFNKPIMIRRKKGLRIVLPESPFSVEDVGRNLGKDYILDVIDVVQQDQYKMRFGEFLDYFRESEPRSKLLNVLSLEISHTKIAHLVEPPYVIKEMSIVEKLWP--CDNLY-------QRANKPSVQKYCLMSMKDSWTDFHIDFGGSSVWYHMYSGHKIFYLIPPKRRYIKAYTSWMGEYNNRMLFFPDQIKKFSLNDQAEVYRLEIKSGDTILLPAGWIHAVHTLEDSLVFGGNFVHSLSIPLQLKIYKIERFLQTEDRFLFPYFEKLHWFVAEYILHKLEA 1092
            NGF+KPI+   K GL + LP   FSV+DV  N+GK  ILDV+DV  Q+   M   ++ +Y++    +++LLNV+SLE S +K+  +V  P V+ ++  +E  WP  C +++       +    P V+KYCLMS+   +TDFHID GG+SVWYH++ G KIF++ PP    +  Y  W        LFFPD I        AE  ++ +K G+T ++P+GWIH V+T  DSLVFGGNF+HS SIPLQL I+ +E  ++   ++ +P+F ++HW+V    + ++  
Sbjct:   64 NGFSKPILFVNKDGLGLKLPHDDFSVDDVSINVGKSRILDVVDVETQNAIGMTMKDWCEYYKNPN-KTQLLNVISLEYSQSKLDAIVRAPDVVLQLDWLESCWPEKCRDIHVDNKSYLKTLTYPKVRKYCLMSVAGCYTDFHIDLGGTSVWYHIFKGEKIFWIAPPTPDNLSLYEKWCLSSEQSSLFFPDLI--------AECEKVHLKPGNTFMIPSGWIHGVYTPVDSLVFGGNFLHSFSIPLQLAIWDVEEKIKVGTKYRYPFFIEMHWYVLAAFVGRING 338          
BLAST of Lysine-specific demethylase 7A vs. Planmine SMEST
Match: SMESG000053144.1 (SMESG000053144.1)

HSP 1 Score: 237.269 bits (604), Expect = 1.508e-69
Identity = 115/284 (40.49%), Postives = 174/284 (61.27%), Query Frame = 1
Query:  268 NGFNKPIMIRRKKGLRIVLPESPFSVEDVGRNLGKDYILDVIDVVQQDQYKMRFGEFLDYFRESEPRSKLLNVLSLEISHTKIAHLVEPPYVIKEMSIVEKLWP--CDNLY-------QRANKPSVQKYCLMSMKDSWTDFHIDFGGSSVWYHMYSGHKIFYLIPPKRRYIKAYTSWMGEYNNRMLFFPDQIKKFSLNDQAEVYRLEIKSGDTILLPAGWIHAVHTLEDSLVFGGNFVHSLSIPLQLKIYKIERFLQTEDRFLFPYFEKLHWFVAEYILHKLEA 1092
            NGF+KPI+   K GL + LP   FSV+DV  N+GK  ILDV+DV  Q+   M   ++ +Y++    +++LLNV+SLE S +K+  +V  P V+ ++  +E  WP  C +++       +    P V+KYCLMS+   +TDFHID GG+SVWYH++ G KIF++ PP    +  Y  W        LFFPD I        AE  ++ +K G+T ++P+GWIH V+T  DSLVFGGNF+HS SIPLQL I+ +E  ++   ++ +P+F ++HW+V    + ++  
Sbjct:   64 NGFSKPILFVNKDGLGLKLPHDDFSVDDVSINVGKSRILDVVDVETQNAIGMTMKDWCEYYKNPN-KTQLLNVISLEYSQSKLDAIVRAPDVVLQLDWLESCWPEKCRDIHVDNKSYLKTLTYPKVRKYCLMSVAGCYTDFHIDLGGTSVWYHIFKGEKIFWIAPPTPDNLSLYEKWCLSSEQSSLFFPDLI--------AECEKVHLKPGNTFMIPSGWIHGVYTPVDSLVFGGNFLHSFSIPLQLAIWDVEEKIKVGTKYRYPFFIEMHWYVLAAFVGRING 338          
BLAST of Lysine-specific demethylase 7A vs. Planmine SMEST
Match: SMESG000022043.1 (SMESG000022043.1)

HSP 1 Score: 53.5286 bits (127), Expect = 4.025e-7
Identity = 34/124 (27.42%), Postives = 55/124 (44.35%), Query Frame = 1
Query:  622 KYCLMSMKDSWTDFHIDFGGSSVWYHMYSGHKIFYLIPPKRRY----IKAYTSWMGEYNNRMLFFPDQIKKFSLNDQAEVYRLEI--KSGDTILLPAGWIHAVHTLEDSLVFGGNFVHSLSIPL 975
            ++ +M    S T  HID  G+S W  +  GHK + L PP        + +   W       + F     +  + N  +E   +EI    G+T+ +P GW H V  L+D++    NF  S + P+
Sbjct:  183 RWFVMGSARSGTGIHIDPLGTSAWNALVKGHKRWCLFPPSTPKELLKLNSNEGWKNRSEAIVWFSIVYPRCKAPNWPSEFKMIEILQNPGETVFVPGGWWHVVLNLDDTVAVTQNFCSSSNFPV 306          
The following BLAST results are available for this feature:
BLAST of Lysine-specific demethylase 7A vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PHF82.413e-7943.65PHD finger protein 8 [Source:HGNC Symbol;Acc:HGNC:... [more]
PHF85.431e-7946.26PHD finger protein 8 [Source:HGNC Symbol;Acc:HGNC:... [more]
PHF86.791e-7946.26PHD finger protein 8 [Source:HGNC Symbol;Acc:HGNC:... [more]
PHF81.277e-7846.26PHD finger protein 8 [Source:HGNC Symbol;Acc:HGNC:... [more]
PHF81.979e-7846.26PHD finger protein 8 [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of Lysine-specific demethylase 7A vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
jmjd-1.21.015e-5538.64Lysine-specific demethylase 7 homolog [Source:Uni... [more]
jmjd-1.21.264e-5538.64Lysine-specific demethylase 7 homolog [Source:Uni... [more]
jmjd-1.21.342e-5538.64Lysine-specific demethylase 7 homolog [Source:Uni... [more]
jhdm-13.295e-5539.73JmjC domain-containing histone demethylation prote... [more]
jhdm-14.132e-5340.07JmjC domain-containing histone demethylation prote... [more]
back to top
BLAST of Lysine-specific demethylase 7A vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Kdm21.579e-6338.01gene:FBgn0037659 transcript:FBtr0336759[more]
Kdm21.579e-6338.01gene:FBgn0037659 transcript:FBtr0300691[more]
Kdm21.579e-6338.01gene:FBgn0037659 transcript:FBtr0336760[more]
Kdm21.579e-6338.01gene:FBgn0037659 transcript:FBtr0336758[more]
PSR5.059e-828.06gene:FBgn0038948 transcript:FBtr0330378[more]
back to top
BLAST of Lysine-specific demethylase 7A vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kdm7aa1.079e-8546.20lysine (K)-specific demethylase 7Aa [Source:NCBI g... [more]
kdm7aa8.846e-8446.20lysine (K)-specific demethylase 7Aa [Source:NCBI g... [more]
kdm7aa1.979e-8346.20lysine (K)-specific demethylase 7Aa [Source:NCBI g... [more]
kdm7ab1.116e-8244.41pep chromosome:GRCz11:CHR_ALT_CTG25_1_10:17244337:... [more]
kdm7ab1.941e-7944.34lysine (K)-specific demethylase 7Ab [Source:NCBI g... [more]
back to top
BLAST of Lysine-specific demethylase 7A vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kdm7a1.372e-7940.99lysine (K)-specific demethylase 7A [Source:NCBI ge... [more]
kdm7a2.893e-7944.94lysine (K)-specific demethylase 7A [Source:NCBI ge... [more]
gan3.612e-7842.67gigaxonin [Source:Xenbase;Acc:XB-GENE-1013088][more]
gan3.799e-7845.39gigaxonin [Source:Xenbase;Acc:XB-GENE-1013088][more]
gan6.645e-7842.67gigaxonin [Source:Xenbase;Acc:XB-GENE-1013088][more]
back to top
BLAST of Lysine-specific demethylase 7A vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Phf81.197e-8243.65PHD finger protein 8 [Source:MGI Symbol;Acc:MGI:24... [more]
Phf81.182e-8143.65PHD finger protein 8 [Source:MGI Symbol;Acc:MGI:24... [more]
Phf83.754e-8046.62PHD finger protein 8 [Source:MGI Symbol;Acc:MGI:24... [more]
Phf83.754e-8046.62PHD finger protein 8 [Source:MGI Symbol;Acc:MGI:24... [more]
Phf85.438e-8046.62PHD finger protein 8 [Source:MGI Symbol;Acc:MGI:24... [more]
back to top
BLAST of Lysine-specific demethylase 7A vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5RHD1|KDM7A_DANRE1.494e-8246.20Lysine-specific demethylase 7A OS=Danio rerio OX=7... [more]
sp|P0CF52|KDM7B_DANRE2.854e-8140.26Lysine-specific demethylase 7B OS=Danio rerio OX=7... [more]
sp|Q08D35|KDM7A_XENTR2.839e-7840.99Lysine-specific demethylase 7A OS=Xenopus tropical... [more]
sp|Q80TJ7|PHF8_MOUSE4.777e-7846.26Histone lysine demethylase PHF8 OS=Mus musculus OX... [more]
sp|Q9UPP1|PHF8_HUMAN9.503e-7846.26Histone lysine demethylase PHF8 OS=Homo sapiens OX... [more]
back to top
BLAST of Lysine-specific demethylase 7A vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4S2M0988.450e-9944.22JmjC domain-containing protein OS=Opisthorchis fel... [more]
A0A4S2LZH13.212e-9844.22JmjC domain-containing protein OS=Opisthorchis fel... [more]
A0A5K3F6B61.149e-9644.59Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A419QFI91.253e-9643.66Lysine-specific demethylase 7B (Fragment) OS=Clono... [more]
G4V5L11.389e-9543.11Putative phd/f-box containing protein OS=Schistoso... [more]
back to top
BLAST of Lysine-specific demethylase 7A vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000056168.17.748e-8345.43lysine-specific demethylase 7B [Source:NCBI gene;A... [more]
ENSAMXT00000006558.28.709e-8345.43lysine-specific demethylase 7B [Source:NCBI gene;A... [more]
phf81.452e-7843.83PHD finger protein 8 [Source:NCBI gene;Acc:1030386... [more]
phf81.452e-7843.83PHD finger protein 8 [Source:NCBI gene;Acc:1030386... [more]
kdm7ab2.217e-7643.73lysine demethylase 7A [Source:NCBI gene;Acc:103031... [more]
back to top
BLAST of Lysine-specific demethylase 7A vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000010170.16.166e-8041.41pep scaffold:Pmarinus_7.0:GL480870:8586:17942:-1 g... [more]
ENSPMAT00000010169.12.387e-7939.60pep scaffold:Pmarinus_7.0:GL480870:6363:17942:-1 g... [more]
ENSPMAT00000003484.13.662e-6737.82pep scaffold:Pmarinus_7.0:GL479346:7845:35819:-1 g... [more]
jmjd42.474e-824.70jumonji domain containing 4 [Source:NCBI gene;Acc:... [more]
jmjd62.190e-629.03jumonji domain containing 6, arginine demethylase ... [more]
back to top
BLAST of Lysine-specific demethylase 7A vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
JHD11.160e-4536.69JmjC domain family histone demethylase specific fo... [more]
back to top
BLAST of Lysine-specific demethylase 7A vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO395034.052e-8142.49Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO411681.032e-6841.87Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO410236.993e-727.42Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Lysine-specific demethylase 7A vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kdm7ab7.471e-8345.25lysine demethylase 7A [Source:NCBI gene;Acc:101156... [more]
phf81.859e-7841.85PHD finger protein 8 [Source:NCBI gene;Acc:1011661... [more]
phf28.290e-6638.22PHD finger protein 2 [Source:NCBI gene;Acc:1011576... [more]
kdm2ab1.014e-6540.19lysine demethylase 2A [Source:NCBI gene;Acc:101164... [more]
phf25.668e-6538.14PHD finger protein 2 [Source:NCBI gene;Acc:1011576... [more]
back to top
BLAST of Lysine-specific demethylase 7A vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000017771.10.000e+0100.00SMESG000017771.1[more]
SMESG000053144.11.369e-6940.49SMESG000053144.1[more]
SMESG000053144.11.508e-6940.49SMESG000053144.1[more]
SMESG000022043.14.025e-727.42SMESG000022043.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30028546 ID=SMED30028546|Name=Lysine-specific demethylase 7A|organism=Schmidtea mediterranea sexual|type=transcript|length=2230bp
ATTTTAAACATAAAATCATAAATTTTTTATTTAAAAATTAAAAAAATTCT
TTTTTTGTACTCAAAACTTGTTTTTATTTTGGAATCGTTTTTAGAAATTA
CAAATTTTAGCATATATCAAATTTATCTTAGTCGATTTAAATTAACAATG
CCATTATCTGGAACTAAAGAATTTTTAGAATATTTGCAAGAAAAACAATG
TTTGCCGATTGGAGATCAGTTAAAAGAATTGCGAGGCAAAGAAGTTACTG
AAGATTATTTTATTAAAAATGGATTTAATAAACCGATAATGATTCGCCGA
AAAAAAGGACTTCGAATAGTTTTACCAGAATCACCATTTTCCGTTGAAGA
TGTTGGACGTAACTTAGGAAAAGACTATATTCTAGATGTGATTGATGTCG
TACAACAAGATCAATACAAAATGAGGTTCGGTGAGTTTCTAGACTACTTT
CGTGAATCGGAACCTCGTTCAAAGCTTTTAAACGTTTTGAGTTTAGAAAT
TTCTCATACAAAAATTGCTCATCTTGTTGAGCCGCCATATGTGATTAAAG
AAATGAGTATCGTTGAAAAGTTATGGCCATGTGATAATTTATATCAACGA
GCAAATAAACCCTCAGTTCAAAAGTATTGTTTAATGAGCATGAAAGATAG
TTGGACTGATTTTCATATCGATTTTGGCGGTTCATCCGTTTGGTATCACA
TGTACTCAGGGCATAAGATTTTCTATTTAATTCCTCCAAAAAGAAGATAT
ATCAAGGCGTACACAAGTTGGATGGGAGAATACAATAATCGAATGCTCTT
TTTCCCAGACCAAATCAAGAAATTCTCCTTAAATGATCAGGCTGAAGTGT
ATAGATTGGAAATCAAATCAGGCGATACTATTTTGTTGCCCGCTGGCTGG
ATTCACGCGGTGCATACATTAGAAGACAGTCTGGTATTTGGTGGGAATTT
CGTACATTCACTAAGCATTCCATTACAGCTCAAAATCTACAAAATTGAGA
GATTCCTTCAAACTGAAGACAGATTTCTATTTCCATATTTTGAAAAACTT
CATTGGTTCGTTGCGGAATATATTCTACACAAGCTAGAAGCAAATCTTAC
TCACAACATTCCACCAATCAAGCTCATTCTCAAAGGTGCTCTAAAGTTAA
TCGAAACTCTGCCTGATTGGCTCAGTAAATATCACACATGCACTCCTGAT
GAACGAGAATATAATTATCCAGAGAAAGGCCTAATGGAATCATCGAAAGT
CCATTTAATTCGTAAATTAAGTGATGTAGTAAAGACACTCATTACGGCTT
CTATAATTGATGATCCCTTACCTCAAACTCAGGTTTCATCATCACAATCA
TCTATTTTCAACAACATCTCATCAAGCACTTTAATGTCTATGAAATTTGT
CAAAAGAAAACCCTCTGATATTTCTGCAGAATGCAGCGAAGAGAAGCAGA
ATAAACTTTAAGTACATGATTATACATGTGTGTGTATTATAGCATTTCTC
AACAGGCAGCCTCATTTATATTAACGCACAAAAAATATCATTGCAAATAT
CGCTTATTGAAATTTTGTTCAAGTTCATTATTGAATTGTTTTAAATGTTT
TTTTCTTTCTTATGAAATATAATTAATTATGTTGATAAAACACATGTTAA
ATGAATTTTTTGAAAATCCGATTTCACAATGTTATATCATATATTTATCA
TGTTTTGTATAAAGTTGTGTGTTTAGCCAATTAGAATGAGATTTGCGTGT
GTATGCGTGTTGAAATTATTTCATTAGATTTATACAATCATAACTGTAAT
AATTGCATGTATAAATGATCGGTGTGACTATTGAATTAGGATGGTTTTTT
GTCCAAAGAAAGGGGGGACATCTCCTCTCATTTCGATTCTAGCGTCGAAA
GTGTAACTGTGTTAGCATGTTTTACTATTTATTTACCTGTGGCCTTTTAT
CAGTACATGTTGCATTTCTACAACTTATCTACAACAATGGCTTGTCCAGC
TCGAAGCTCATTGGTCAATAAGTCTTCTCAGTGTGATAAAAATTTATTTG
TATTTTTTAAATAATATTTGTATATTGAGTTTCAACAATGTTATTTGGAA
ATTTTATTATTGCTTTCAATCAGTTAATTTCTGTGCTGCTGCTCTTTATT
TTTTCTCTGAGTAATAATAATTGTCAATGTCAAATTTAAATGTTTTAGTA
TATTTGTATATATTATATATATATATATAT
back to top

protein sequence of SMED30028546-orf-1

>SMED30028546-orf-1 ID=SMED30028546-orf-1|Name=SMED30028546-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=438bp
MPLSGTKEFLEYLQEKQCLPIGDQLKELRGKEVTEDYFIKNGFNKPIMIR
RKKGLRIVLPESPFSVEDVGRNLGKDYILDVIDVVQQDQYKMRFGEFLDY
FRESEPRSKLLNVLSLEISHTKIAHLVEPPYVIKEMSIVEKLWPCDNLYQ
RANKPSVQKYCLMSMKDSWTDFHIDFGGSSVWYHMYSGHKIFYLIPPKRR
YIKAYTSWMGEYNNRMLFFPDQIKKFSLNDQAEVYRLEIKSGDTILLPAG
WIHAVHTLEDSLVFGGNFVHSLSIPLQLKIYKIERFLQTEDRFLFPYFEK
LHWFVAEYILHKLEANLTHNIPPIKLILKGALKLIETLPDWLSKYHTCTP
DEREYNYPEKGLMESSKVHLIRKLSDVVKTLITASIIDDPLPQTQVSSSQ
SSIFNNISSSTLMSMKFVKRKPSDISAECSEEKQNKL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0005506iron ion binding
GO:0035064methylated histone binding
GO:0008270zinc ion binding
GO:0016491oxidoreductase activity
GO:0016706oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, 2-oxoglutarate as one donor, and incorporation of one atom each of oxygen into both donors
GO:0032454histone demethylase activity (H3-K9 specific)
GO:0035575histone demethylase activity (H4-K20 specific)
GO:0046872metal ion binding
GO:0051213dioxygenase activity
GO:0051864histone demethylase activity (H3-K36 specific)
GO:0071558histone demethylase activity (H3-K27 specific)
Vocabulary: biological process
TermDefinition
GO:0006325chromatin organization
GO:0006351transcription, DNA-templated
GO:0006355regulation of transcription, DNA-templated
GO:0007399nervous system development
GO:0016569covalent chromatin modification
GO:0030901midbrain development
GO:0033169histone H3-K9 demethylation
GO:0035574histone H4-K20 demethylation
GO:0055114oxidation-reduction process
GO:0070544histone H3-K36 demethylation
GO:0071557histone H3-K27 demethylation
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR041070JHD
IPR003347JmjC_dom
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003347JmjC domainSMARTSM00558cupin_9coord: 118..285
e-value: 4.3E-29
score: 112.6
IPR003347JmjC domainPFAMPF02373JmjCcoord: 160..268
e-value: 1.4E-14
score: 54.5
IPR003347JmjC domainPROSITEPS51184JMJCcoord: 131..285
score: 28.963
NoneNo IPR availableGENE3DG3DSA:1.20.58.1360coord: 137..379
e-value: 1.8E-125
score: 420.5
NoneNo IPR availableGENE3DG3DSA:2.60.120.650coord: 4..296
e-value: 1.8E-125
score: 420.5
NoneNo IPR availablePANTHERPTHR23123PHD/F-BOX CONTAINING PROTEINcoord: 25..347
NoneNo IPR availableSUPERFAMILYSSF51197Clavaminate synthase-likecoord: 31..304
IPR041070Jumonji, helical domainPFAMPF17811JHDcoord: 272..359
e-value: 8.5E-17
score: 61.6