Transcriptional activator protein Pur-beta

Overview
NameTranscriptional activator protein Pur-beta
Smed IDSMED30028513
Length (bp)1132
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Transcriptional activator protein Pur-beta (SMED30028513) t-SNE clustered cells

Violin plots show distribution of expression levels for Transcriptional activator protein Pur-beta (SMED30028513) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Transcriptional activator protein Pur-beta (SMED30028513) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Transcriptional activator protein Pur-beta (SMED30028513) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30028513

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30028513 dd_Smed_v4_346_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30028513 dd_Smed_v4_346_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30028513 dd_Smed_v4_346_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30028513 dd_Smed_v4_346_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30028513 dd_Smed_v4_346_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30028513 dd_Smed_v4_346_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30028513 dd_Smed_v4_346_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 2 cellSMED30028513 dd_Smed_v6_346_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30028513 dd_Smed_v6_346_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 3 cellSMED30028513 dd_Smed_v6_346_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Transcriptional activator protein Pur-beta vs. Ensembl Human
Match: PURA (purine rich element binding protein A [Source:HGNC Symbol;Acc:HGNC:9701])

HSP 1 Score: 228.409 bits (581), Expect = 1.083e-71
Identity = 118/227 (51.98%), Postives = 151/227 (66.52%), Query Frame = 2
Query:  143 QSAEQELTSKTLMIQNKRFYLDVKQNLRGKFIKIAEVGMGGRKSRILMSMSTAAEFRDKLNDLSNLYNGLQPHNPENLA---DDGR--LKSDTIVKDTRRYYLDLKENARGRFLRVTM-------MAPSNRSQIAIPAQGIIELRNALTELIKEYGSEDNGSEDVELPEPKSIRIDNKMFYFDVGCNRRGVFLRVSEVRTNYRTAITIPEKSWASFKEIINEMSTQM 787
            Q   QEL SK + IQNKRFYLDVKQN +G+F+KIAEVG GG KSR+ +SMS A EFRD L D    Y  L P  P +LA   D+ R  LKS+ +V++ R+YY+DLKEN RGRFLR+         +  +    IA+PAQG+IE R+AL +LI +YG E+   E  ELPE  S+ +DNK F+FDVG N+ GVF+RVSEV+  YR +IT+P K WA F     + S +M
Sbjct:   55 QHETQELASKRVDIQNKRFYLDVKQNAKGRFLKIAEVGAGGNKSRLTLSMSVAVEFRDYLGDFIEHYAQLGPSQPPDLAQAQDEPRRALKSEFLVRENRKYYMDLKENQRGRFLRIRQTVNRGPGLGSTQGQTIALPAQGLIEFRDALAKLIDDYGVEE---EPAELPEGTSLTVDNKRFFFDVGSNKYGVFMRVSEVKPTYRNSITVPYKVWAKFGHTFCKYSEEM 278          
BLAST of Transcriptional activator protein Pur-beta vs. Ensembl Human
Match: PURA (purine rich element binding protein A [Source:HGNC Symbol;Acc:HGNC:9701])

HSP 1 Score: 228.409 bits (581), Expect = 1.083e-71
Identity = 118/227 (51.98%), Postives = 151/227 (66.52%), Query Frame = 2
Query:  143 QSAEQELTSKTLMIQNKRFYLDVKQNLRGKFIKIAEVGMGGRKSRILMSMSTAAEFRDKLNDLSNLYNGLQPHNPENLA---DDGR--LKSDTIVKDTRRYYLDLKENARGRFLRVTM-------MAPSNRSQIAIPAQGIIELRNALTELIKEYGSEDNGSEDVELPEPKSIRIDNKMFYFDVGCNRRGVFLRVSEVRTNYRTAITIPEKSWASFKEIINEMSTQM 787
            Q   QEL SK + IQNKRFYLDVKQN +G+F+KIAEVG GG KSR+ +SMS A EFRD L D    Y  L P  P +LA   D+ R  LKS+ +V++ R+YY+DLKEN RGRFLR+         +  +    IA+PAQG+IE R+AL +LI +YG E+   E  ELPE  S+ +DNK F+FDVG N+ GVF+RVSEV+  YR +IT+P K WA F     + S +M
Sbjct:   55 QHETQELASKRVDIQNKRFYLDVKQNAKGRFLKIAEVGAGGNKSRLTLSMSVAVEFRDYLGDFIEHYAQLGPSQPPDLAQAQDEPRRALKSEFLVRENRKYYMDLKENQRGRFLRIRQTVNRGPGLGSTQGQTIALPAQGLIEFRDALAKLIDDYGVEE---EPAELPEGTSLTVDNKRFFFDVGSNKYGVFMRVSEVKPTYRNSITVPYKVWAKFGHTFCKYSEEM 278          
BLAST of Transcriptional activator protein Pur-beta vs. Ensembl Human
Match: PURB (purine rich element binding protein B [Source:HGNC Symbol;Acc:HGNC:9702])

HSP 1 Score: 223.016 bits (567), Expect = 9.907e-70
Identity = 122/260 (46.92%), Postives = 153/260 (58.85%), Query Frame = 2
Query:  125 AKQQNNQSAEQELTSKTLMIQNKRFYLDVKQNLRGKFIKIAEVGMGGRKSRILMSMSTAAEFRDKLNDLSNLYNGLQPHNPENLADDGR--------LKSDTIVKDTRRYYLDLKENARGRFLRVTMMAPSNRSQ-----------------IAIPAQGIIELRNALTELIKEYGSEDNGSEDV--------------ELPEPKSIRIDNKMFYFDVGCNRRGVFLRVSEVRTNYRTAITIPEKSWASFKEIINEMSTQM 787
            A +   +   QEL SK L IQNKRFYLDVKQN +G+F+KIAEVG GG KSR+ +SM+ AAEFRD L D    Y  L P +PE LA            LKS+ +V++ R+YYLDLKEN RGRFLR+      NR                   IA+PAQG+IE R+AL +LI +YG ED+                   ELPE  SI +D+K F+FDVGCN+ GVFLRVSEV+ +YR AIT+P K+W  F       + +M
Sbjct:   22 ASRGGGEQETQELASKRLDIQNKRFYLDVKQNAKGRFLKIAEVGAGGSKSRLTLSMAVAAEFRDSLGDFIEHYAQLGPSSPEQLAAGAEEGGGPRRALKSEFLVRENRKYYLDLKENQRGRFLRIRQTV--NRGGGGFGAGPGPGGLQSGQTIALPAQGLIEFRDALAKLIDDYGGEDDELAGGPGGGAGGPGGGLYGELPEGTSITVDSKRFFFDVGCNKYGVFLRVSEVKPSYRNAITVPFKAWGKFGGAFCRYADEM 279          
BLAST of Transcriptional activator protein Pur-beta vs. Ensembl Human
Match: PURG (purine rich element binding protein G [Source:HGNC Symbol;Acc:HGNC:17930])

HSP 1 Score: 190.274 bits (482), Expect = 1.099e-56
Identity = 117/263 (44.49%), Postives = 150/263 (57.03%), Query Frame = 2
Query:  134 QNNQSAE-QELTSKTLMIQNKRFYLDVKQNLRGKFIKIAEVGMGG------RKSRILMSMSTAAEFRDKLNDLSNLYN--GLQPHNPENLADDGR--------------------------LKSDTIVKDTRRYYLDLKENARGRFLRV--TMM-----------APSNRSQIAIPAQGIIELRNALTELIKEYGSED-----NGSED-VELPEPKSIRIDNKMFYFDVGCNRRGVFLRVSEVRTNYRTAITIPEKSWASFKE 760
            Q   +AE QEL SK + IQ KRFYLDVKQ+ RG+F+KIAEV +G       RKS++ +S+S AAE +D L D    Y   GL+ H  E+     +                          LK+D I +D R+YYLDLKEN RGRFLR+  TMM           +      I +PAQG+IE R+AL +LI++YG  D      G +D +ELPE  S R+DNK FYFDVG N+ G+FL+VSEVR  YR  IT+P K+W  F E
Sbjct:   50 QAGGAAEIQELASKRVDIQKKRFYLDVKQSSRGRFLKIAEVWIGRGRQDNIRKSKLTLSLSVAAELKDCLGDFIEHYAHLGLKGHRQEHGHSKEQGSRRRQKHSAPSPPVSVGSEEHPHSVLKTDYIERDNRKYYLDLKENQRGRFLRIRQTMMRGTGMIGYFGHSLGQEQTIVLPAQGMIEFRDALVQLIEDYGEGDIEERRGGDDDPLELPEGTSFRVDNKRFYFDVGSNKYGIFLKVSEVRPPYRNTITVPFKAWTRFGE 312          
BLAST of Transcriptional activator protein Pur-beta vs. Ensembl Human
Match: PURG (purine rich element binding protein G [Source:HGNC Symbol;Acc:HGNC:17930])

HSP 1 Score: 162.54 bits (410), Expect = 2.662e-46
Identity = 106/247 (42.91%), Postives = 138/247 (55.87%), Query Frame = 2
Query:  134 QNNQSAE-QELTSKTLMIQNKRFYLDVKQNLRGKFIKIAEVGMGG------RKSRILMSMSTAAEFRDKLNDLSNLYN--GLQPHNPENLADDGR--------------------------LKSDTIVKDTRRYYLDLKENARGRFLRV--TMM-----------APSNRSQIAIPAQGIIELRNALTELIKEYGSED-----NGSED-VELPEPKSIRIDNKMFYFDVGCNRRGVFLRVSEVRTNY 712
            Q   +AE QEL SK + IQ KRFYLDVKQ+ RG+F+KIAEV +G       RKS++ +S+S AAE +D L D    Y   GL+ H  E+     +                          LK+D I +D R+YYLDLKEN RGRFLR+  TMM           +      I +PAQG+IE R+AL +LI++YG  D      G +D +ELPE  S R+DNK FYFDVG N+ G+FL++    TNY
Sbjct:   50 QAGGAAEIQELASKRVDIQKKRFYLDVKQSSRGRFLKIAEVWIGRGRQDNIRKSKLTLSLSVAAELKDCLGDFIEHYAHLGLKGHRQEHGHSKEQGSRRRQKHSAPSPPVSVGSEEHPHSVLKTDYIERDNRKYYLDLKENQRGRFLRIRQTMMRGTGMIGYFGHSLGQEQTIVLPAQGMIEFRDALVQLIEDYGEGDIEERRGGDDDPLELPEGTSFRVDNKRFYFDVGSNKYGIFLKL----TNY 292          
BLAST of Transcriptional activator protein Pur-beta vs. Ensembl Celegans
Match: plp-1 (Pur alpha Like Protein [Source:UniProtKB/TrEMBL;Acc:Q94230])

HSP 1 Score: 146.362 bits (368), Expect = 1.096e-41
Identity = 90/226 (39.82%), Postives = 136/226 (60.18%), Query Frame = 2
Query:  131 QQNNQSAEQELTSKTLMIQNKRFYLDVKQNLRGKFIKIAEVGMGGRKSRILMSMSTAAEFRDKLNDLSNLYNGLQPHNPENLADDGRL-KSDTIVKDTRRYYLDLKENARGRFLRVTMMAPSN----RSQIAIPAQGIIELRNALTELIKEYGSEDNGSEDVELPEPKSIRIDNKMFYFDVGCNRRGVFLRVSEVRTN--YRTAITIPEKSWASF-KEIINEMSTQ 784
            ++  + AE  L +  L +Q KR+Y+DV +N RG++IKIAE+G    KSRI++S+  A     +++ +  L +  +P   E+   +  L KS+T+  D R++Y+DLKEN RGRFLR+  M P N    R QIAIP+ GI E+   LTE + ++G E +  E+   P+   I  +NK F F  G N RG F+R+SE++ N  YR AIT+P  +   F KE+ N ++ Q
Sbjct:    7 ERGTKRAEDSLATHQLTVQYKRYYIDVNENTRGRYIKIAELGT-NYKSRIILSIVAAKAIVSEISKMLALID--EPSTGEHAPKESSLIKSETLNVDGRKFYVDLKENVRGRFLRIAQM-PMNPRQTRQQIAIPSDGIAEIHKVLTEYLAKFG-EGHEQENTNTPK---ITAENKSFLFHSGKNDRGEFVRISEIKLNSGYRNAITVPMSALVDFRKELDNIIANQ 224          
BLAST of Transcriptional activator protein Pur-beta vs. Ensembl Celegans
Match: plp-2 (Pur alpha Like Protein [Source:UniProtKB/TrEMBL;Acc:Q93537])

HSP 1 Score: 82.8037 bits (203), Expect = 2.061e-18
Identity = 43/95 (45.26%), Postives = 60/95 (63.16%), Query Frame = 2
Query:  416 DTRRYYLDLKENARGRFLRVTMMAP-SNRSQIAIPAQGIIELRNALTELIKEYGSEDNGSEDVELPEPKSIRIDNKMFYFDVGCNRRGVFLRVSE 697
            + R++Y+DLKEN RGRFLR+  M P   R QIAIP+ GI E+   LTE + ++G E +  E+   P+   I  +N+ F F  G N RG F+R+SE
Sbjct:   40 NQRKFYVDLKENDRGRFLRIAPMNPRQTRQQIAIPSDGIAEIHKVLTEYLAKFG-EGHEQENTNTPK---ITAENRTFLFHSGKNDRGEFVRISE 130          
BLAST of Transcriptional activator protein Pur-beta vs. Ensembl Fly
Match: Pur-alpha (gene:FBgn0022361 transcript:FBtr0089993)

HSP 1 Score: 270.011 bits (689), Expect = 3.450e-89
Identity = 125/214 (58.41%), Postives = 168/214 (78.50%), Query Frame = 2
Query:  152 EQELTSKTLMIQNKRFYLDVKQNLRGKFIKIAEVGMGGRKSRILMSMSTAAEFRDKLNDLSNLYNGLQPHNPENLADDGRLKSDTIVKDTRRYYLDLKENARGRFLRV--TMMAPSNRSQIAIPAQGIIELRNALTELIKEYGSEDNGSEDVELPEPKSIRIDNKMFYFDVGCNRRGVFLRVSEVRTNYRTAITIPEKSWASFKEIINEMSTQM 787
            EQEL +K L IQ+KRFYLDVKQN RG+FIK+AE+G  GR+S+I +++STAAEFRD L+  S+ Y  L P N +NL +DG+LKS+ ++KD RRYYLDLKENARGRFLRV  T+     RSQIA+PAQG+IE R+ALT+L++E+G+ D G    +LPE + +++DNK FYFD+G N RGV++R+SEV+ N+RT+ITIPEK W  F++I N+   +M
Sbjct:   26 EQELATKMLQIQSKRFYLDVKQNRRGRFIKVAEIGADGRRSQIYLALSTAAEFRDHLSSFSDYYASLGPPNTDNLPEDGKLKSEMMIKDYRRYYLDLKENARGRFLRVSQTITRGGPRSQIALPAQGMIEFRDALTDLLEEFGANDGGRFKGDLPEERHMKVDNKNFYFDIGQNNRGVYMRISEVKNNFRTSITIPEKCWIRFRDIFNDYCEKM 239          
BLAST of Transcriptional activator protein Pur-beta vs. Ensembl Fly
Match: Pur-alpha (gene:FBgn0022361 transcript:FBtr0310639)

HSP 1 Score: 269.626 bits (688), Expect = 9.013e-89
Identity = 125/220 (56.82%), Postives = 169/220 (76.82%), Query Frame = 2
Query:  134 QNNQSAEQELTSKTLMIQNKRFYLDVKQNLRGKFIKIAEVGMGGRKSRILMSMSTAAEFRDKLNDLSNLYNGLQPHNPENLADDGRLKSDTIVKDTRRYYLDLKENARGRFLRV--TMMAPSNRSQIAIPAQGIIELRNALTELIKEYGSEDNGSEDVELPEPKSIRIDNKMFYFDVGCNRRGVFLRVSEVRTNYRTAITIPEKSWASFKEIINEMSTQM 787
            +     EQEL +K L IQ+KRFYLDVKQN RG+FIK+AE+G  GR+S+I +++STAAEFRD L+  S+ Y  L P N +NL +DG+LKS+ ++KD RRYYLDLKENARGRFLRV  T+     RSQIA+PAQG+IE R+ALT+L++E+G+ D G    +LPE + +++DNK FYFD+G N RGV++R+SEV+ N+RT+ITIPEK W  F++I N+   +M
Sbjct:   35 KGGSGVEQELATKMLQIQSKRFYLDVKQNRRGRFIKVAEIGADGRRSQIYLALSTAAEFRDHLSSFSDYYASLGPPNTDNLPEDGKLKSEMMIKDYRRYYLDLKENARGRFLRVSQTITRGGPRSQIALPAQGMIEFRDALTDLLEEFGANDGGRFKGDLPEERHMKVDNKNFYFDIGQNNRGVYMRISEVKNNFRTSITIPEKCWIRFRDIFNDYCEKM 254          
BLAST of Transcriptional activator protein Pur-beta vs. Ensembl Fly
Match: Pur-alpha (gene:FBgn0022361 transcript:FBtr0089995)

HSP 1 Score: 269.626 bits (688), Expect = 9.013e-89
Identity = 125/220 (56.82%), Postives = 169/220 (76.82%), Query Frame = 2
Query:  134 QNNQSAEQELTSKTLMIQNKRFYLDVKQNLRGKFIKIAEVGMGGRKSRILMSMSTAAEFRDKLNDLSNLYNGLQPHNPENLADDGRLKSDTIVKDTRRYYLDLKENARGRFLRV--TMMAPSNRSQIAIPAQGIIELRNALTELIKEYGSEDNGSEDVELPEPKSIRIDNKMFYFDVGCNRRGVFLRVSEVRTNYRTAITIPEKSWASFKEIINEMSTQM 787
            +     EQEL +K L IQ+KRFYLDVKQN RG+FIK+AE+G  GR+S+I +++STAAEFRD L+  S+ Y  L P N +NL +DG+LKS+ ++KD RRYYLDLKENARGRFLRV  T+     RSQIA+PAQG+IE R+ALT+L++E+G+ D G    +LPE + +++DNK FYFD+G N RGV++R+SEV+ N+RT+ITIPEK W  F++I N+   +M
Sbjct:   35 KGGSGVEQELATKMLQIQSKRFYLDVKQNRRGRFIKVAEIGADGRRSQIYLALSTAAEFRDHLSSFSDYYASLGPPNTDNLPEDGKLKSEMMIKDYRRYYLDLKENARGRFLRVSQTITRGGPRSQIALPAQGMIEFRDALTDLLEEFGANDGGRFKGDLPEERHMKVDNKNFYFDIGQNNRGVYMRISEVKNNFRTSITIPEKCWIRFRDIFNDYCEKM 254          
BLAST of Transcriptional activator protein Pur-beta vs. Ensembl Fly
Match: Pur-alpha (gene:FBgn0022361 transcript:FBtr0310640)

HSP 1 Score: 267.314 bits (682), Expect = 3.885e-88
Identity = 125/214 (58.41%), Postives = 169/214 (78.97%), Query Frame = 2
Query:  152 EQELTSKTLMIQNKRFYLDVKQNLRGKFIKIAEVGMGGRKSRILMSMSTAAEFRDKLNDLSNLYNGLQPHNPENLADDGRLKSDTIVKDTRRYYLDLKENARGRFLRV--TMMAPSNRSQIAIPAQGIIELRNALTELIKEYGSEDNGSEDVELPEPKSIRIDNKMFYFDVGCNRRGVFLRVSEVRTNYRTAITIPEKSWASFKEIINEMSTQM 787
            EQEL +K L IQ+KRFYLDVKQN RG+FIK+AE+G  GR+S+I +++STAAEFRD L+  S+ Y  L P N +NL +DG+LKS+ ++KD RRYYLDLKENARGRFLRV  T+     RSQIA+PAQG+IE R+ALT+L++E+G+ D G +  +LPE + +++DNK FYFD+G N RGV++R+SEV+ N+RT+ITIPEK W  F++I N+   +M
Sbjct:   26 EQELATKMLQIQSKRFYLDVKQNRRGRFIKVAEIGADGRRSQIYLALSTAAEFRDHLSSFSDYYASLGPPNTDNLPEDGKLKSEMMIKDYRRYYLDLKENARGRFLRVSQTITRGGPRSQIALPAQGMIEFRDALTDLLEEFGANDGGFKG-DLPEERHMKVDNKNFYFDIGQNNRGVYMRISEVKNNFRTSITIPEKCWIRFRDIFNDYCEKM 238          
BLAST of Transcriptional activator protein Pur-beta vs. Ensembl Fly
Match: Pur-alpha (gene:FBgn0022361 transcript:FBtr0089996)

HSP 1 Score: 266.929 bits (681), Expect = 8.616e-88
Identity = 125/220 (56.82%), Postives = 170/220 (77.27%), Query Frame = 2
Query:  134 QNNQSAEQELTSKTLMIQNKRFYLDVKQNLRGKFIKIAEVGMGGRKSRILMSMSTAAEFRDKLNDLSNLYNGLQPHNPENLADDGRLKSDTIVKDTRRYYLDLKENARGRFLRV--TMMAPSNRSQIAIPAQGIIELRNALTELIKEYGSEDNGSEDVELPEPKSIRIDNKMFYFDVGCNRRGVFLRVSEVRTNYRTAITIPEKSWASFKEIINEMSTQM 787
            +     EQEL +K L IQ+KRFYLDVKQN RG+FIK+AE+G  GR+S+I +++STAAEFRD L+  S+ Y  L P N +NL +DG+LKS+ ++KD RRYYLDLKENARGRFLRV  T+     RSQIA+PAQG+IE R+ALT+L++E+G+ D G +  +LPE + +++DNK FYFD+G N RGV++R+SEV+ N+RT+ITIPEK W  F++I N+   +M
Sbjct:   35 KGGSGVEQELATKMLQIQSKRFYLDVKQNRRGRFIKVAEIGADGRRSQIYLALSTAAEFRDHLSSFSDYYASLGPPNTDNLPEDGKLKSEMMIKDYRRYYLDLKENARGRFLRVSQTITRGGPRSQIALPAQGMIEFRDALTDLLEEFGANDGGFKG-DLPEERHMKVDNKNFYFDIGQNNRGVYMRISEVKNNFRTSITIPEKCWIRFRDIFNDYCEKM 253          
BLAST of Transcriptional activator protein Pur-beta vs. Ensembl Zebrafish
Match: puraa (purine-rich element binding protein Aa [Source:ZFIN;Acc:ZDB-GENE-040624-8])

HSP 1 Score: 229.565 bits (584), Expect = 7.584e-73
Identity = 117/232 (50.43%), Postives = 151/232 (65.09%), Query Frame = 2
Query:  119 GKAKQQNNQSAEQELTSKTLMIQNKRFYLDVKQNLRGKFIKIAEVGMGGRKSRILMSMSTAAEFRDKLNDLSNLYNGLQPHNPENLADDGR--LKSDTIVKDTRRYYLDLKENARGRFLRVTM-------MAPSNRSQIAIPAQGIIELRNALTELIKEYGSEDNGSEDVELPEPKSIRIDNKMFYFDVGCNRRGVFLRVSEVRTNYRTAITIPEKSWASFKEIINEMSTQM 787
            G       Q   QEL SK + IQNKRFYLDVKQN +G+F+KIAEVG GG KSR+ +SMS A EFRD L D    Y  L P NP+   D+ R  LKS+ +V++ R+YY+DLKEN RGRFLR+         +  +    IA+PAQG+IE R+AL +LI +YG ED   E  ELPE  S+ +DNK F+FDVG N+ GVF+RVSEV+  YR +IT+P K W+ F     + + +M
Sbjct:   28 GAGSASGLQHETQELASKRVDIQNKRFYLDVKQNAKGRFLKIAEVGAGGNKSRLTLSMSVAVEFRDYLGDFIEHYAQLGPSNPDMPQDEPRRALKSEFLVRENRKYYMDLKENQRGRFLRIRQTVNRGPGLGSTQGQTIALPAQGLIEFRDALAKLIDDYGVED---EPAELPEGTSLTVDNKRFFFDVGSNKYGVFMRVSEVKPTYRNSITVPYKVWSKFGSTFCKYADEM 256          
BLAST of Transcriptional activator protein Pur-beta vs. Ensembl Zebrafish
Match: puraa (purine-rich element binding protein Aa [Source:ZFIN;Acc:ZDB-GENE-040624-8])

HSP 1 Score: 229.565 bits (584), Expect = 7.584e-73
Identity = 117/232 (50.43%), Postives = 151/232 (65.09%), Query Frame = 2
Query:  119 GKAKQQNNQSAEQELTSKTLMIQNKRFYLDVKQNLRGKFIKIAEVGMGGRKSRILMSMSTAAEFRDKLNDLSNLYNGLQPHNPENLADDGR--LKSDTIVKDTRRYYLDLKENARGRFLRVTM-------MAPSNRSQIAIPAQGIIELRNALTELIKEYGSEDNGSEDVELPEPKSIRIDNKMFYFDVGCNRRGVFLRVSEVRTNYRTAITIPEKSWASFKEIINEMSTQM 787
            G       Q   QEL SK + IQNKRFYLDVKQN +G+F+KIAEVG GG KSR+ +SMS A EFRD L D    Y  L P NP+   D+ R  LKS+ +V++ R+YY+DLKEN RGRFLR+         +  +    IA+PAQG+IE R+AL +LI +YG ED   E  ELPE  S+ +DNK F+FDVG N+ GVF+RVSEV+  YR +IT+P K W+ F     + + +M
Sbjct:   28 GAGSASGLQHETQELASKRVDIQNKRFYLDVKQNAKGRFLKIAEVGAGGNKSRLTLSMSVAVEFRDYLGDFIEHYAQLGPSNPDMPQDEPRRALKSEFLVRENRKYYMDLKENQRGRFLRIRQTVNRGPGLGSTQGQTIALPAQGLIEFRDALAKLIDDYGVED---EPAELPEGTSLTVDNKRFFFDVGSNKYGVFMRVSEVKPTYRNSITVPYKVWSKFGSTFCKYADEM 256          
BLAST of Transcriptional activator protein Pur-beta vs. Ensembl Zebrafish
Match: purbb (purine-rich element binding protein Bb [Source:NCBI gene;Acc:393519])

HSP 1 Score: 224.172 bits (570), Expect = 1.077e-70
Identity = 124/247 (50.20%), Postives = 152/247 (61.54%), Query Frame = 2
Query:  155 QELTSKTLMIQNKRFYLDVKQNLRGKFIKIAEVGMGGRKSRILMSMSTAAEFRDKLNDLSNLYNGLQPHNPENLA-----DDG----RLKSDTIVKDTRRYYLDLKENARGRFLRVTMMAPSNRSQ-------------------IAIPAQGIIELRNALTELIKEYGSEDN--------GSEDVELPEPKSIRIDNKMFYFDVGCNRRGVFLRVSEVRTNYRTAITIPEKSWASFKEIINEMSTQM 787
            QEL SK L IQNKRFYLDVKQN +G+FIKIAEVG GG KSR+ +SMS AAEFRD L D    Y  L P +PE +A     DDG     LKS+ +V++ R+YYLDLKEN RGRFLR+      NR                     IA+PAQG+IE R+AL +LI +YG ED              ELPE  SI +D+K F+FDVG N+ GVFLRVSEV+ +YR +ITIP K+W  F    +  + +M
Sbjct:   27 QELASKRLDIQNKRFYLDVKQNAKGRFIKIAEVGAGGSKSRLTLSMSVAAEFRDYLGDFIEHYAQLGPSSPEQIAQSSGGDDGGPRRALKSEFLVRENRKYYLDLKENQRGRFLRIRQTV--NRGPGFGVGGGGGPGGGVQAGQTIALPAQGLIEFRDALAKLIDDYGGEDEELSGGPGAAGGYGELPEGTSIMVDSKRFFFDVGSNKYGVFLRVSEVKPSYRNSITIPFKAWGKFGGAFSRYAEEM 271          
BLAST of Transcriptional activator protein Pur-beta vs. Ensembl Zebrafish
Match: purab (purine-rich element binding protein Ab [Source:ZFIN;Acc:ZDB-GENE-141216-78])

HSP 1 Score: 222.246 bits (565), Expect = 3.842e-70
Identity = 112/224 (50.00%), Postives = 151/224 (67.41%), Query Frame = 2
Query:  143 QSAEQELTSKTLMIQNKRFYLDVKQNLRGKFIKIAEVGMGGRKSRILMSMSTAAEFRDKLNDLSNLYNGLQPHNPENLADDGR--LKSDTIVKDTRRYYLDLKENARGRFLRVTM-------MAPSNRSQIAIPAQGIIELRNALTELIKEYGSEDNGSEDVELPEPKSIRIDNKMFYFDVGCNRRGVFLRVSEVRTNYRTAITIPEKSWASFKEIINEMSTQM 787
            Q   +EL SK + IQNKRFYLDVKQN +G+F+KIAEVG GG KSR+ +SMS A EFRD L D    Y  L P NP+ + D+ R  LKS+ +V++ R+YY+DLKEN RGRFLR+         +  S    IA+PAQG+IE R+AL +LI ++G +++     ELPE  S+ +DNK F+FDVG N+ GVF+RVSEV+  YR +IT+P K W+ F     + + +M
Sbjct:   31 QHDTEELASKRVDIQNKRFYLDVKQNAKGRFLKIAEVGAGGNKSRLTLSMSVAVEFRDYLGDFIEHYAQLGPSNPDLVQDEPRRALKSEFLVRENRKYYMDLKENQRGRFLRIRQTVNRGPGLGTSQGQTIALPAQGLIEFRDALAKLIDDFGVDED---PAELPEGTSLTVDNKRFFFDVGSNKYGVFMRVSEVKPTYRNSITVPCKVWSKFGATFCKYADEM 251          
BLAST of Transcriptional activator protein Pur-beta vs. Ensembl Zebrafish
Match: purba (purine-rich element binding protein Ba [Source:ZFIN;Acc:ZDB-GENE-060531-100])

HSP 1 Score: 218.779 bits (556), Expect = 2.436e-68
Identity = 123/246 (50.00%), Postives = 152/246 (61.79%), Query Frame = 2
Query:  155 QELTSKTLMIQNKRFYLDVKQNLRGKFIKIAEVGMGGRKSRILMSMSTAAEFRDKLNDLSNLYNGLQPHNPENLA-----DDG----RLKSDTIVKDTRRYYLDLKENARGRFLRVTMMAPSNRSQ-------------------IAIPAQGIIELRNALTELIKEYGSED-----NGSEDV--ELPEPKSIRIDNKMFYFDVGCNRRGVFLRVSEVRTNYRTAITIPEKSWASFKEIINEMSTQM 787
            QEL SK L IQNKRFYLDVKQN +G+FIKIAEVG GG KSR+ +SMS AAEFRD L D    Y  L P  PE +A     +DG     LKS+ +V++ R+YYLDLKEN RGRFLR+      NR                     IA+PAQG+IE R+AL +LI +YG +D      G      ELPE  SI +D+K F+FDVG N+ GVFLRVSEV+ +YR +ITIP K+W+ F       + +M
Sbjct:   43 QELASKRLDIQNKRFYLDVKQNSKGRFIKIAEVGAGGSKSRLTLSMSVAAEFRDYLGDFIEHYAQLGPSTPEQIAQSSGGEDGGPRRALKSEFLVRENRKYYLDLKENQRGRFLRIRQTV--NRGPGGFGAGGGVPGGGMQSGQTIALPAQGLIEFRDALAKLIDDYGGDDEELVGGGCSGAYGELPEGTSITVDSKRFFFDVGSNKYGVFLRVSEVKPSYRNSITIPFKAWSKFGGAFCRYAEEM 286          
BLAST of Transcriptional activator protein Pur-beta vs. Ensembl Xenopus
Match: unc13a (unc-13 homolog A [Source:Xenbase;Acc:XB-GENE-6039664])

HSP 1 Score: 228.794 bits (582), Expect = 1.887e-72
Identity = 115/224 (51.34%), Postives = 149/224 (66.52%), Query Frame = 2
Query:  143 QSAEQELTSKTLMIQNKRFYLDVKQNLRGKFIKIAEVGMGGRKSRILMSMSTAAEFRDKLNDLSNLYNGLQPHNPENLADDGR--LKSDTIVKDTRRYYLDLKENARGRFLRVTM-------MAPSNRSQIAIPAQGIIELRNALTELIKEYGSEDNGSEDVELPEPKSIRIDNKMFYFDVGCNRRGVFLRVSEVRTNYRTAITIPEKSWASFKEIINEMSTQM 787
            Q   QEL SK + IQNKRFYLDVKQN +G+F+KIAEVG GG KSR+ +SMS A EFRD L D    Y  L P NP+   D+ R  LKS+ +V++ R+YY+DLKEN RGRFLR+         +  +    IA+PAQG+IE R+AL +LI +YG E+   E  ELPE  S+ +DNK F+FDVG N+ GVF+RVSEV+  YR +IT+P K W  F     + + +M
Sbjct:   34 QHETQELASKRVDIQNKRFYLDVKQNAKGRFLKIAEVGAGGNKSRLTLSMSVAVEFRDYLGDFIEHYAQLGPSNPDMAQDEPRRALKSEFLVRENRKYYMDLKENQRGRFLRIRQTVNRGPGLGSTQGQTIALPAQGLIEFRDALAKLIDDYGVEE---EPAELPEGTSLTVDNKRFFFDVGSNKYGVFMRVSEVKPTYRNSITVPYKVWGKFGHTFCKYAEEM 254          
BLAST of Transcriptional activator protein Pur-beta vs. Ensembl Xenopus
Match: PURB (purine rich element binding protein B [Source:HGNC Symbol;Acc:HGNC:9702])

HSP 1 Score: 219.55 bits (558), Expect = 1.647e-68
Identity = 119/253 (47.04%), Postives = 150/253 (59.29%), Query Frame = 2
Query:  155 QELTSKTLMIQNKRFYLDVKQNLRGKFIKIAEVGMGGRKSRILMSMSTAAEFRDKLNDLSNLYNGLQPHNPENLADDG-------------RLKSDTIVKDTRRYYLDLKENARGRFLRV---------------TMMAPSNRSQIAIPAQGIIELRNALTELIKEYGSEDN--------------GSEDVELPEPKSIRIDNKMFYFDVGCNRRGVFLRVSEVRTNYRTAITIPEKSWASFKEIINEMSTQM 787
            QEL SK L IQNKRFYLDVKQN +G+FIKIAEVG GG KSR+ +SM+ AAEFRD L D    Y  L P +PE +A                 LKS+ +V++ R+YYLDLKEN RGRFLR+                     +   IA+PAQG+IE R+AL +LI +YG ED+              G    ELPE  SI +D+K F+FDVGCN+ GVFLRVSEV+ +YR +IT+P K+W  F       + +M
Sbjct:   32 QELASKRLDIQNKRFYLDVKQNAKGRFIKIAEVGAGGSKSRLTLSMAVAAEFRDYLGDFIEHYAQLGPSSPEQIAQSSGEDGAGGPGGPRRALKSEFLVRENRKYYLDLKENQRGRFLRIRQTINRGPGFSGGAGGGAGLQSGQTIALPAQGLIEFRDALAKLIDDYGGEDDEGVGLGPGGAGGGAGGMYGELPEGTSITVDSKRFFFDVGCNKYGVFLRVSEVKPSYRNSITVPLKAWGKFGGAFCRYAEEM 284          

HSP 2 Score: 54.299 bits (129), Expect = 1.282e-7
Identity = 41/177 (23.16%), Postives = 72/177 (40.68%), Query Frame = 2
Query:  110 QETGKAKQQNNQSAEQELTSKTLMIQNKRFYLDVKQNLRGKFIKIAEV--------------GMGGRKSRILMSMSTAAEFRDKLNDLSNLYNGLQPHNPENLADDGRL----------KSDTIVKDTRRYYLDLKENARGRFLRVTMMAPSNRSQIAIPAQGIIELRNALTELIKE 568
            Q +G+          + L S+ L+ +N+++YLD+K+N RG+F++I +                       I +      EFRD L  L + Y G                         +  +I  D++R++ D+  N  G FLRV+ + PS R+ I +P +   +   A     +E
Sbjct:  107 QSSGEDGAGGPGGPRRALKSEFLVRENRKYYLDLKENQRGRFLRIRQTINRGPGFSGGAGGGAGLQSGQTIALPAQGLIEFRDALAKLIDDYGGEDDEGVGLGPGGAGGGAGGMYGELPEGTSITVDSKRFFFDVGCNKYGVFLRVSEVKPSYRNSITVPLKAWGKFGGAFCRYAEE 283          
BLAST of Transcriptional activator protein Pur-beta vs. Ensembl Xenopus
Match: rps6kl1 (ribosomal protein S6 kinase like 1 [Source:Xenbase;Acc:XB-GENE-991864])

HSP 1 Score: 184.882 bits (468), Expect = 7.327e-55
Identity = 115/262 (43.89%), Postives = 143/262 (54.58%), Query Frame = 2
Query:  137 NNQSAE-QELTSKTLMIQNKRFYLDVKQNLRGKFIKIAEVGMGG------RKSRILMSMSTAAEFRDKLNDLSNLYNGL---------------QPHNP---------------ENLADDGRLKSDTIVKDTRRYYLDLKENARGRFLRV--TM-----------MAPSNRSQIAIPAQGIIELRNALTELIKEYGSED------NGSEDVELPEPKSIRIDNKMFYFDVGCNRRGVFLRVSEVRTNYRTAITIPEKSWASF 754
            ++QS E QEL SK + IQ KRFYLDVKQ+ RG+F+KIAEV +G       RKS++ +S+S AAE +D L D    Y  L               + H P               E       LK++ I +D R+YYLDLKEN RGRFLR+  TM            +      I +PAQG+IE R+AL +LI++YG  D         E  ELPE  S R+DNK FYFDVG NR G+FLRVSEVR  YR  IT+P K W  F
Sbjct:   32 SSQSLEIQELASKRVDIQKKRFYLDVKQSARGRFLKIAEVWIGRGRQDNIRKSKLTLSLSVAAELKDCLGDFIEHYAHLGLRSSHAQRSEHGSDKEHEPRRRPHPSSPSGSVGSEEPMTHSVLKTEYIERDNRKYYLDLKENQRGRFLRIRQTMTRGPGMIGYFGQSLGQEQTIVLPAQGMIEFRDALVQLIEDYGEGDIEERRGGNEEPPELPEGTSFRVDNKRFYFDVGSNRYGIFLRVSEVRPPYRNTITVPYKVWTRF 293          
BLAST of Transcriptional activator protein Pur-beta vs. Ensembl Mouse
Match: Pura (purine rich element binding protein A [Source:MGI Symbol;Acc:MGI:103079])

HSP 1 Score: 228.024 bits (580), Expect = 8.483e-72
Identity = 118/227 (51.98%), Postives = 151/227 (66.52%), Query Frame = 2
Query:  143 QSAEQELTSKTLMIQNKRFYLDVKQNLRGKFIKIAEVGMGGRKSRILMSMSTAAEFRDKLNDLSNLYNGLQPHNPENLA---DDGR--LKSDTIVKDTRRYYLDLKENARGRFLRVTM-------MAPSNRSQIAIPAQGIIELRNALTELIKEYGSEDNGSEDVELPEPKSIRIDNKMFYFDVGCNRRGVFLRVSEVRTNYRTAITIPEKSWASFKEIINEMSTQM 787
            Q   QEL SK + IQNKRFYLDVKQN +G+F+KIAEVG GG KSR+ +SMS A EFRD L D    Y  L P  P +LA   D+ R  LKS+ +V++ R+YY+DLKEN RGRFLR+         +  +    IA+PAQG+IE R+AL +LI +YG E+   E  ELPE  S+ +DNK F+FDVG N+ GVF+RVSEV+  YR +IT+P K WA F     + S +M
Sbjct:   54 QHETQELASKRVDIQNKRFYLDVKQNAKGRFLKIAEVGAGGNKSRLTLSMSVAVEFRDYLGDFIEHYAQLGPSQPPDLAQAQDEPRRALKSEFLVRENRKYYMDLKENQRGRFLRIRQTVNRGPGLGSTQGQTIALPAQGLIEFRDALAKLIDDYGVEE---EPAELPEGTSLTVDNKRFFFDVGSNKYGVFMRVSEVKPTYRNSITVPYKVWAKFGHTFCKYSEEM 277          
BLAST of Transcriptional activator protein Pur-beta vs. Ensembl Mouse
Match: Purb (purine rich element binding protein B [Source:MGI Symbol;Acc:MGI:1338779])

HSP 1 Score: 218.394 bits (555), Expect = 5.308e-68
Identity = 122/254 (48.03%), Postives = 150/254 (59.06%), Query Frame = 2
Query:  155 QELTSKTLMIQNKRFYLDVKQNLRGKFIKIAEVGMGGRKSRILMSMSTAAEFRDKLNDLSNLYNGLQPHNPENLADDGR--------LKSDTIVKDTRRYYLDLKENARGRFLRVTMMAPSNRSQ-----------------IAIPAQGIIELRNALTELIKEYGSEDNGSED------------------VELPEPKSIRIDNKMFYFDVGCNRRGVFLRVSEVRTNYRTAITIPEKSWASFKEIINEMSTQM 787
            QEL SK L IQNKRFYLDVKQN +G+F+KIAEVG GG KSR+ +SM+ AAEFRD L D    Y  L P +PE LA            LKS+ +V++ R+YYLDLKEN RGRFLR+      NR                   IA+PAQG+IE R+AL +LI +YG    G ED                   ELPE  SI +D+K F+FDVGCN+ GVFLRVSEV+ +YR AIT+P K+W  F       + +M
Sbjct:   44 QELASKRLDIQNKRFYLDVKQNAKGRFLKIAEVGAGGSKSRLTLSMAVAAEFRDSLGDFIEHYAQLGPSSPEQLAAGAEEGGGPRRALKSEFLVRENRKYYLDLKENQRGRFLRIRQTV--NRGGGGFGGGPGPGGLQSGQTIALPAQGLIEFRDALAKLIDDYG----GDEDELAGGPGGGAGGPGGGLYGELPEGTSITVDSKRFFFDVGCNKYGVFLRVSEVKPSYRNAITVPFKAWGKFGGAFCRYADEM 291          
BLAST of Transcriptional activator protein Pur-beta vs. Ensembl Mouse
Match: Purg (purine-rich element binding protein G [Source:MGI Symbol;Acc:MGI:1922279])

HSP 1 Score: 189.119 bits (479), Expect = 2.129e-56
Identity = 116/263 (44.11%), Postives = 148/263 (56.27%), Query Frame = 2
Query:  131 QQNNQSAEQELTSKTLMIQNKRFYLDVKQNLRGKFIKIAEVGMGG------RKSRILMSMSTAAEFRDKLNDLSNLYN--GLQPHNPENLADDGR--------------------------LKSDTIVKDTRRYYLDLKENARGRFLRV--TMM-----------APSNRSQIAIPAQGIIELRNALTELIKEYGSED-----NGSED-VELPEPKSIRIDNKMFYFDVGCNRRGVFLRVSEVRTNYRTAITIPEKSWASFKE 760
            Q    S  QEL SK + IQ KRFYLDVKQ+ RG+F+KIAEV +G       RKS++ +S+S AAE +D L D    Y   GL+ H  E+     +                          LK+D I +D R+YYLDLKEN RGRFLR+  TMM           +      I +PAQG+IE R+AL +LI++YG  D      G +D +ELPE  S R+DNK FYFDVG N+ G+FL+VSEVR  YR  IT+P K+W  F E
Sbjct:   53 QSGGTSEIQELASKRVDIQKKRFYLDVKQSSRGRFLKIAEVWIGRGRQDNIRKSKLTLSLSVAAELKDCLGDFIEHYAHLGLKGHRQEHGQSKEQVSRRRQKHSAPSPPVSVGSEEHPHSVLKTDYIERDNRKYYLDLKENQRGRFLRIRQTMMRGTGMIGYFGHSLGQDQTIVLPAQGMIEFRDALVQLIEDYGEGDIEERRCGDDDPLELPEGTSFRVDNKRFYFDVGSNKYGIFLKVSEVRPPYRNTITVPFKAWTRFGE 315          
BLAST of Transcriptional activator protein Pur-beta vs. Ensembl Mouse
Match: Purg (purine-rich element binding protein G [Source:MGI Symbol;Acc:MGI:1922279])

HSP 1 Score: 160.999 bits (406), Expect = 5.962e-46
Identity = 105/247 (42.51%), Postives = 136/247 (55.06%), Query Frame = 2
Query:  131 QQNNQSAEQELTSKTLMIQNKRFYLDVKQNLRGKFIKIAEVGMGG------RKSRILMSMSTAAEFRDKLNDLSNLYN--GLQPHNPENLADDGR--------------------------LKSDTIVKDTRRYYLDLKENARGRFLRV--TMM-----------APSNRSQIAIPAQGIIELRNALTELIKEYGSED-----NGSED-VELPEPKSIRIDNKMFYFDVGCNRRGVFLRVSEVRTNY 712
            Q    S  QEL SK + IQ KRFYLDVKQ+ RG+F+KIAEV +G       RKS++ +S+S AAE +D L D    Y   GL+ H  E+     +                          LK+D I +D R+YYLDLKEN RGRFLR+  TMM           +      I +PAQG+IE R+AL +LI++YG  D      G +D +ELPE  S R+DNK FYFDVG N+ G+FL++    TNY
Sbjct:   53 QSGGTSEIQELASKRVDIQKKRFYLDVKQSSRGRFLKIAEVWIGRGRQDNIRKSKLTLSLSVAAELKDCLGDFIEHYAHLGLKGHRQEHGQSKEQVSRRRQKHSAPSPPVSVGSEEHPHSVLKTDYIERDNRKYYLDLKENQRGRFLRIRQTMMRGTGMIGYFGHSLGQDQTIVLPAQGMIEFRDALVQLIEDYGEGDIEERRCGDDDPLELPEGTSFRVDNKRFYFDVGSNKYGIFLKL----TNY 295          
BLAST of Transcriptional activator protein Pur-beta vs. UniProt/SwissProt
Match: sp|Q00577|PURA_HUMAN (Transcriptional activator protein Pur-alpha OS=Homo sapiens OX=9606 GN=PURA PE=1 SV=2)

HSP 1 Score: 228.409 bits (581), Expect = 5.201e-71
Identity = 118/227 (51.98%), Postives = 151/227 (66.52%), Query Frame = 2
Query:  143 QSAEQELTSKTLMIQNKRFYLDVKQNLRGKFIKIAEVGMGGRKSRILMSMSTAAEFRDKLNDLSNLYNGLQPHNPENLA---DDGR--LKSDTIVKDTRRYYLDLKENARGRFLRVTM-------MAPSNRSQIAIPAQGIIELRNALTELIKEYGSEDNGSEDVELPEPKSIRIDNKMFYFDVGCNRRGVFLRVSEVRTNYRTAITIPEKSWASFKEIINEMSTQM 787
            Q   QEL SK + IQNKRFYLDVKQN +G+F+KIAEVG GG KSR+ +SMS A EFRD L D    Y  L P  P +LA   D+ R  LKS+ +V++ R+YY+DLKEN RGRFLR+         +  +    IA+PAQG+IE R+AL +LI +YG E+   E  ELPE  S+ +DNK F+FDVG N+ GVF+RVSEV+  YR +IT+P K WA F     + S +M
Sbjct:   55 QHETQELASKRVDIQNKRFYLDVKQNAKGRFLKIAEVGAGGNKSRLTLSMSVAVEFRDYLGDFIEHYAQLGPSQPPDLAQAQDEPRRALKSEFLVRENRKYYMDLKENQRGRFLRIRQTVNRGPGLGSTQGQTIALPAQGLIEFRDALAKLIDDYGVEE---EPAELPEGTSLTVDNKRFFFDVGSNKYGVFMRVSEVKPTYRNSITVPYKVWAKFGHTFCKYSEEM 278          
BLAST of Transcriptional activator protein Pur-beta vs. UniProt/SwissProt
Match: sp|P42669|PURA_MOUSE (Transcriptional activator protein Pur-alpha OS=Mus musculus OX=10090 GN=Pura PE=1 SV=1)

HSP 1 Score: 228.024 bits (580), Expect = 5.934e-71
Identity = 118/227 (51.98%), Postives = 151/227 (66.52%), Query Frame = 2
Query:  143 QSAEQELTSKTLMIQNKRFYLDVKQNLRGKFIKIAEVGMGGRKSRILMSMSTAAEFRDKLNDLSNLYNGLQPHNPENLA---DDGR--LKSDTIVKDTRRYYLDLKENARGRFLRVTM-------MAPSNRSQIAIPAQGIIELRNALTELIKEYGSEDNGSEDVELPEPKSIRIDNKMFYFDVGCNRRGVFLRVSEVRTNYRTAITIPEKSWASFKEIINEMSTQM 787
            Q   QEL SK + IQNKRFYLDVKQN +G+F+KIAEVG GG KSR+ +SMS A EFRD L D    Y  L P  P +LA   D+ R  LKS+ +V++ R+YY+DLKEN RGRFLR+         +  +    IA+PAQG+IE R+AL +LI +YG E+   E  ELPE  S+ +DNK F+FDVG N+ GVF+RVSEV+  YR +IT+P K WA F     + S +M
Sbjct:   54 QHETQELASKRVDIQNKRFYLDVKQNAKGRFLKIAEVGAGGNKSRLTLSMSVAVEFRDYLGDFIEHYAQLGPSQPPDLAQAQDEPRRALKSEFLVRENRKYYMDLKENQRGRFLRIRQTVNRGPGLGSTQGQTIALPAQGLIEFRDALAKLIDDYGVEE---EPAELPEGTSLTVDNKRFFFDVGSNKYGVFMRVSEVKPTYRNSITVPYKVWAKFGHTFCKYSEEM 277          
BLAST of Transcriptional activator protein Pur-beta vs. UniProt/SwissProt
Match: sp|Q6PHK6|PURB_DANRE (Transcriptional activator protein Pur-beta OS=Danio rerio OX=7955 GN=purb PE=2 SV=3)

HSP 1 Score: 224.172 bits (570), Expect = 8.133e-70
Identity = 124/247 (50.20%), Postives = 152/247 (61.54%), Query Frame = 2
Query:  155 QELTSKTLMIQNKRFYLDVKQNLRGKFIKIAEVGMGGRKSRILMSMSTAAEFRDKLNDLSNLYNGLQPHNPENLA-----DDG----RLKSDTIVKDTRRYYLDLKENARGRFLRVTMMAPSNRSQ-------------------IAIPAQGIIELRNALTELIKEYGSEDN--------GSEDVELPEPKSIRIDNKMFYFDVGCNRRGVFLRVSEVRTNYRTAITIPEKSWASFKEIINEMSTQM 787
            QEL SK L IQNKRFYLDVKQN +G+FIKIAEVG GG KSR+ +SMS AAEFRD L D    Y  L P +PE +A     DDG     LKS+ +V++ R+YYLDLKEN RGRFLR+      NR                     IA+PAQG+IE R+AL +LI +YG ED              ELPE  SI +D+K F+FDVG N+ GVFLRVSEV+ +YR +ITIP K+W  F    +  + +M
Sbjct:   27 QELASKRLDIQNKRFYLDVKQNAKGRFIKIAEVGAGGSKSRLTLSMSVAAEFRDYLGDFIEHYAQLGPSSPEQIAQSSGGDDGGPRRALKSEFLVRENRKYYLDLKENQRGRFLRIRQTV--NRGPGFGVGGGGGPGGGVQAGQTIALPAQGLIEFRDALAKLIDDYGGEDEELSGGPGAAGGYGELPEGTSIMVDSKRFFFDVGSNKYGVFLRVSEVKPSYRNSITIPFKAWGKFGGAFSRYAEEM 271          
BLAST of Transcriptional activator protein Pur-beta vs. UniProt/SwissProt
Match: sp|Q96QR8|PURB_HUMAN (Transcriptional activator protein Pur-beta OS=Homo sapiens OX=9606 GN=PURB PE=1 SV=3)

HSP 1 Score: 223.016 bits (567), Expect = 4.758e-69
Identity = 122/260 (46.92%), Postives = 153/260 (58.85%), Query Frame = 2
Query:  125 AKQQNNQSAEQELTSKTLMIQNKRFYLDVKQNLRGKFIKIAEVGMGGRKSRILMSMSTAAEFRDKLNDLSNLYNGLQPHNPENLADDGR--------LKSDTIVKDTRRYYLDLKENARGRFLRVTMMAPSNRSQ-----------------IAIPAQGIIELRNALTELIKEYGSEDNGSEDV--------------ELPEPKSIRIDNKMFYFDVGCNRRGVFLRVSEVRTNYRTAITIPEKSWASFKEIINEMSTQM 787
            A +   +   QEL SK L IQNKRFYLDVKQN +G+F+KIAEVG GG KSR+ +SM+ AAEFRD L D    Y  L P +PE LA            LKS+ +V++ R+YYLDLKEN RGRFLR+      NR                   IA+PAQG+IE R+AL +LI +YG ED+                   ELPE  SI +D+K F+FDVGCN+ GVFLRVSEV+ +YR AIT+P K+W  F       + +M
Sbjct:   22 ASRGGGEQETQELASKRLDIQNKRFYLDVKQNAKGRFLKIAEVGAGGSKSRLTLSMAVAAEFRDSLGDFIEHYAQLGPSSPEQLAAGAEEGGGPRRALKSEFLVRENRKYYLDLKENQRGRFLRIRQTV--NRGGGGFGAGPGPGGLQSGQTIALPAQGLIEFRDALAKLIDDYGGEDDELAGGPGGGAGGPGGGLYGELPEGTSITVDSKRFFFDVGCNKYGVFLRVSEVKPSYRNAITVPFKAWGKFGGAFCRYADEM 279          
BLAST of Transcriptional activator protein Pur-beta vs. UniProt/SwissProt
Match: sp|Q68A21|PURB_RAT (Transcriptional activator protein Pur-beta OS=Rattus norvegicus OX=10116 GN=Purb PE=1 SV=3)

HSP 1 Score: 221.476 bits (563), Expect = 1.611e-68
Identity = 121/250 (48.40%), Postives = 150/250 (60.00%), Query Frame = 2
Query:  155 QELTSKTLMIQNKRFYLDVKQNLRGKFIKIAEVGMGGRKSRILMSMSTAAEFRDKLNDLSNLYNGLQPHNPENLADDGR--------LKSDTIVKDTRRYYLDLKENARGRFLRVTMMAPSNRSQ-----------------IAIPAQGIIELRNALTELIKEYGSEDNGSEDV--------------ELPEPKSIRIDNKMFYFDVGCNRRGVFLRVSEVRTNYRTAITIPEKSWASFKEIINEMSTQM 787
            QEL SK L IQNKRFYLDVKQN +G+F+KIAEVG GG KSR+ +SM+ AAEFRD L D    Y  L P +PE LA            LKS+ +V++ R+YYLDLKEN RGRFLR+      NR                   IA+PAQG+IE R+AL +LI +YG ED+                   ELPE  SI +D+K F+FDVGCN+ GVFLRVSEV+ +YR AIT+P K+W  F       + +M
Sbjct:   35 QELASKRLDIQNKRFYLDVKQNAKGRFLKIAEVGAGGSKSRLTLSMAVAAEFRDSLGDFIEHYAQLGPSSPEQLAAGAEEGGGPRRALKSEFLVRENRKYYLDLKENQRGRFLRIRQTV--NRGGGGFGGGPGPGGLQSGQTIALPAQGLIEFRDALAKLIDDYGGEDDELAGGPGGGAGGPGGGLYGELPEGTSITVDSKRFFFDVGCNKYGVFLRVSEVKPSYRNAITVPFKAWGKFGGAFCRYADEM 282          
BLAST of Transcriptional activator protein Pur-beta vs. TrEMBL
Match: R7V3Q6 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_179772 PE=4 SV=1)

HSP 1 Score: 303.523 bits (776), Expect = 6.561e-99
Identity = 140/222 (63.06%), Postives = 183/222 (82.43%), Query Frame = 2
Query:  110 QETGKAKQQNNQSAEQELTSKTLMIQNKRFYLDVKQNLRGKFIKIAEVGMGGRKSRILMSMSTAAEFRDKLNDLSNLYNGLQPHNPENLADDGRLKSDTIVKDTRRYYLDLKENARGRFLRVTMMAPS--NRSQIAIPAQGIIELRNALTELIKEYGSEDNGSEDVELPEPKSIRIDNKMFYFDVGCNRRGVFLRVSEVRTNYRTAITIPEKSWASFKEIIN 769
            +E+G  +     S EQEL +KTL IQ+KRFYLDVKQN RG+FIKIAEVG GG+KSR+L++MSTAAEFRD L D S+ Y  L P + E++ +DG+LKS+++VKD RRYYLDLKEN RGRFLRV+ + P   NRSQIAIPAQG+IE R+ALT+L++E+G++D+     ELPEPKS+R+++KMFYFDVG NRRG F+R+SEVRTN+RTAITIPE+SW  F+++++
Sbjct:    4 RESGDEQLMAQGSQEQELATKTLQIQSKRFYLDVKQNRRGRFIKIAEVGAGGKKSRLLLAMSTAAEFRDHLTDFSDHYASLGPPSQESVPEDGKLKSESMVKDNRRYYLDLKENQRGRFLRVSQIFPRSVNRSQIAIPAQGMIEFRDALTDLLEEFGTDDHAESQGELPEPKSMRVEHKMFYFDVGQNRRGTFMRISEVRTNFRTAITIPERSWGRFRDVLS 225          

HSP 2 Score: 67.781 bits (164), Expect = 3.796e-9
Identity = 41/152 (26.97%), Postives = 82/152 (53.95%), Query Frame = 2
Query:  161 LTSKTLMIQNKRFYLDVKQNLRGKFIKIAEV-GMGGRKSRILMSMSTAAEFRDKLNDLSNLYNGLQPHNPENLADDGRLKSDTIVK-DTRRYYLDLKENARGRFLRVTMMAPSNRSQIAIPAQGIIELRNALTELIKEYGSEDNGSEDVELP 610
            L S++++  N+R+YLD+K+N RG+F++++++      +S+I +      EFRD L DL   +        ++    G L     ++ + + +Y D+ +N RG F+R++ +  + R+ I IP +     R+ L+  +     E + S++VE P
Sbjct:   98 LKSESMVKDNRRYYLDLKENQRGRFLRVSQIFPRSVNRSQIAIPAQGMIEFRDALTDLLEEFG-----TDDHAESQGELPEPKSMRVEHKMFYFDVGQNRRGTFMRISEVRTNFRTAITIPERSWGRFRDVLSSFV-----ESSASKEVEGP 239          
BLAST of Transcriptional activator protein Pur-beta vs. TrEMBL
Match: A0A0B6YUZ6 (Uncharacterized protein (Fragment) OS=Arion vulgaris OX=1028688 GN=ORF36905 PE=4 SV=1)

HSP 1 Score: 297.36 bits (760), Expect = 1.603e-96
Identity = 142/219 (64.84%), Postives = 180/219 (82.19%), Query Frame = 2
Query:  146 SAEQELTSKTLMIQNKRFYLDVKQNLRGKFIKIAEVGMGGRKSRILMSMSTAAEFRDKLNDLSNLYNGLQPHNPENLADDGRLKSDTIVKDTRRYYLDLKENARGRFLRVTMMAPSN--RSQIAIPAQGIIELRNALTELIKEYGSEDNGSEDVELPEPKSIRIDNKMFYFDVGCNRRGVFLRVSEVRTNYRTAITIPEKSWASFKEIINEMSTQMTIK 796
            SAEQEL ++TL IQ+KRFYLDVKQN RG+FIK+AEVG GG+KSR+L++MS+AAEFRD L+D S+ Y  L P N E   +DG+LKS+ IVKD RRYYLDLKEN RGRFLRV+   P    RSQIAIPAQG+IE R+ALTEL++E+G++D   ++ ELPE +S+R++NKMFYFDVG NRRGV+LRVSEVR N+RTAITIPE+SW  F++II+E + + + K
Sbjct:   36 SAEQELATRTLHIQSKRFYLDVKQNRRGRFIKVAEVGAGGKKSRLLLAMSSAAEFRDFLSDFSDHYASLGPTNSETPPEDGKLKSEMIVKDNRRYYLDLKENQRGRFLRVSQTIPRGGPRSQIAIPAQGMIEFRDALTELLEEFGTDDQEPQN-ELPESRSMRVENKMFYFDVGSNRRGVYLRVSEVRNNFRTAITIPERSWGRFRDIISEFADKSSAK 253          
BLAST of Transcriptional activator protein Pur-beta vs. TrEMBL
Match: A0A210QPQ7 (Transcriptional activator protein Pur-alpha OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT18351 PE=4 SV=1)

HSP 1 Score: 295.819 bits (756), Expect = 5.136e-96
Identity = 144/240 (60.00%), Postives = 185/240 (77.08%), Query Frame = 2
Query:  110 QETGKAKQQ-NNQSAEQELTSKTLMIQNKRFYLDVKQNLRGKFIKIAEVGMGGRKSRILMSMSTAAEFRDKLNDLSNLYNGLQPHNPENLADDGRLKSDTIVKDTRRYYLDLKENARGRFLRVTMMAPSN----RSQIAIPAQGIIELRNALTELIKEYGSEDNGSED---VELPEPKSIRIDNKMFYFDVGCNRRGVFLRVSEVRTNYRTAITIPEKSWASFKEIINEMSTQMTIKANG 805
             E+G   QQ    S EQEL +KTL IQ+KRFYLDVKQN RG+FIKIAEVG GG+K+R+L++MS AAEFRD L D S  Y  L P NP++L +DG+LKS+T+VKD RRYYLDLKEN RGRFLRV++         RSQIAIPAQG+IE R++LT+++ E+G++D+G  D    ELP+ K +R++NK+FYFDVG NRRGV+LRVSEVRTNYRTAITIPE+SW  F+++++E + +    A G
Sbjct:    4 HESGDETQQAQGGSVEQELCTKTLQIQSKRFYLDVKQNRRGRFIKIAEVGAGGKKTRLLLAMSIAAEFRDYLTDFSEHYASLGPPNPDSLPEDGKLKSETMVKDNRRYYLDLKENQRGRFLRVSVSQTRTRGGPRSQIAIPAQGMIEFRDSLTDILDEFGTDDHGESDEGQSELPDSKYLRVENKVFYFDVGSNRRGVYLRVSEVRTNYRTAITIPERSWGRFRDMLSEYADRPGSSAKG 243          
BLAST of Transcriptional activator protein Pur-beta vs. TrEMBL
Match: A0A2C9KGA8 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106065491 PE=4 SV=1)

HSP 1 Score: 293.893 bits (751), Expect = 2.563e-95
Identity = 142/219 (64.84%), Postives = 178/219 (81.28%), Query Frame = 2
Query:  146 SAEQELTSKTLMIQNKRFYLDVKQNLRGKFIKIAEVGMGGRKSRILMSMSTAAEFRDKLNDLSNLYNGLQPHNPENLADDGRLKSDTIVKDTRRYYLDLKENARGRFLRVTMMAPSN--RSQIAIPAQGIIELRNALTELIKEYGSEDNGSEDVELPEPKSIRIDNKMFYFDVGCNRRGVFLRVSEVRTNYRTAITIPEKSWASFKEIINEMSTQMTIK 796
            SAEQEL ++TL IQ+KRFYLDVKQN RG+FIK+AEVG GG+KSR+L++MS+AAEFRD L+D S  Y  L P N E   +DG+LKS+ IVKD RRYYLDLKEN RGRFLRV+   P    RSQIAIPAQG+IE R+ALTEL++E+G++D   ++ ELPE +S+R++NKMFYFDVG NRRGV+LRVSEVR N+RTAITIPE+SW  F++II+E   + + K
Sbjct:   24 SAEQELATRTLHIQSKRFYLDVKQNKRGRFIKVAEVGAGGKKSRLLLAMSSAAEFRDFLSDFSEHYASLGPTNSETPPEDGKLKSEMIVKDNRRYYLDLKENQRGRFLRVSQTIPRGGPRSQIAIPAQGMIEFRDALTELLEEFGTDDQEPQN-ELPESRSMRVENKMFYFDVGSNRRGVYLRVSEVRNNFRTAITIPERSWGRFRDIISEFVDKSSAK 241          
BLAST of Transcriptional activator protein Pur-beta vs. TrEMBL
Match: A0A2T7PJY0 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_04951 PE=4 SV=1)

HSP 1 Score: 296.204 bits (757), Expect = 3.498e-95
Identity = 141/222 (63.51%), Postives = 180/222 (81.08%), Query Frame = 2
Query:  146 SAEQELTSKTLMIQNKRFYLDVKQNLRGKFIKIAEVGMGGRKSRILMSMSTAAEFRDKLNDLSNLYNGLQPHNPENLADDGRLKSDTIVKDTRRYYLDLKENARGRFLRVTMMAPSN--RSQIAIPAQGIIELRNALTELIKEYGSEDNGSEDVELPEPKSIRIDNKMFYFDVGCNRRGVFLRVSEVRTNYRTAITIPEKSWASFKEIINEMSTQMTIKANG 805
            S EQEL ++TL IQ+KRFYLDVKQN RG+FIK+AEVG GG+KSR+L++MS+AAEFRD L D +  Y  L P N E+  +DG+LKS+TIVKD RRYYLDLKEN RGRFLRV+   P    RSQIAIPAQG+IE R+ALTEL+ E+G++D   ++ ELPE +S+R++NKMFYFDVG NRRGV+LRVSEVR N+RTA+TIPE+SWA F+++++E   + +IK  G
Sbjct:   41 SGEQELATRTLHIQSKRFYLDVKQNRRGRFIKVAEVGAGGKKSRLLLAMSSAAEFRDYLTDFTEHYASLGPTNTESPPEDGKLKSETIVKDNRRYYLDLKENQRGRFLRVSQTIPRGGPRSQIAIPAQGMIEFRDALTELLDEFGTDDQEPQN-ELPESRSMRVENKMFYFDVGSNRRGVYLRVSEVRNNFRTAVTIPERSWARFRDVLSEFVDKSSIKDRG 261          

HSP 2 Score: 78.5666 bits (192), Expect = 1.347e-12
Identity = 43/147 (29.25%), Postives = 85/147 (57.82%), Query Frame = 2
Query:  158 ELTSKTLMIQNKRFYLDVKQNLRGKFIKIAE-VGMGGRKSRILMSMSTAAEFRDKLNDLSNLYNGLQPHNPENLADDGRLKSDTIVKDTRRYYLDLKENARGRFLRVTMMAPSNRSQIAIPAQGIIELRNALTELIKEYGSEDNGSE 595
            +L S+T++  N+R+YLD+K+N RG+F+++++ +  GG +S+I +      EFRD L +L + + G     P+N   + R    ++  + + +Y D+  N RG +LRV+ +  + R+ + IP +     R+ L+E + +   +D G+ 
Sbjct:  122 KLKSETIVKDNRRYYLDLKENQRGRFLRVSQTIPRGGPRSQIAIPAQGMIEFRDALTELLDEF-GTDDQEPQNELPESR----SMRVENKMFYFDVGSNRRGVYLRVSEVRNNFRTAVTIPERSWARFRDVLSEFVDKSSIKDRGNH 263          
BLAST of Transcriptional activator protein Pur-beta vs. Ensembl Cavefish
Match: puraa (purine rich element binding protein A [Source:NCBI gene;Acc:103044982])

HSP 1 Score: 231.876 bits (590), Expect = 7.035e-74
Identity = 117/224 (52.23%), Postives = 150/224 (66.96%), Query Frame = 2
Query:  143 QSAEQELTSKTLMIQNKRFYLDVKQNLRGKFIKIAEVGMGGRKSRILMSMSTAAEFRDKLNDLSNLYNGLQPHNPENLADDGR--LKSDTIVKDTRRYYLDLKENARGRFLRVTM-------MAPSNRSQIAIPAQGIIELRNALTELIKEYGSEDNGSEDVELPEPKSIRIDNKMFYFDVGCNRRGVFLRVSEVRTNYRTAITIPEKSWASFKEIINEMSTQM 787
            Q   QEL SK + IQNKRFYLDVKQN +G+F+KIAEVG GG KSR+ +SMS A EFRD L D    Y  L P NP+   D+ R  LKS+ +V++ R+YY+DLKEN RGRFLR+         +  +    IA+PAQG+IE R+AL +LI +YG ED   E  ELPE  S+ +DNK F+FDVG N+ GVF+RVSEV+  YR +IT+P K WA F     + + +M
Sbjct:   35 QHDTQELASKRVDIQNKRFYLDVKQNAKGRFLKIAEVGAGGNKSRLTLSMSVAVEFRDYLGDFIEHYAQLGPSNPDAAQDEPRRALKSEFLVRENRKYYMDLKENQRGRFLRIRQTVNRGPGLGSAQGQTIALPAQGLIEFRDALAKLIDDYGVED---EPAELPEGTSLTVDNKRFFFDVGSNKYGVFMRVSEVKPTYRNSITVPYKVWAKFGSTFCKYAEEM 255          
BLAST of Transcriptional activator protein Pur-beta vs. Ensembl Cavefish
Match: purab (transcriptional activator protein Pur-alpha-like [Source:NCBI gene;Acc:103043921])

HSP 1 Score: 224.172 bits (570), Expect = 1.437e-70
Identity = 113/224 (50.45%), Postives = 150/224 (66.96%), Query Frame = 2
Query:  143 QSAEQELTSKTLMIQNKRFYLDVKQNLRGKFIKIAEVGMGGRKSRILMSMSTAAEFRDKLNDLSNLYNGLQPHNPENLADDGR--LKSDTIVKDTRRYYLDLKENARGRFLRVTM-------MAPSNRSQIAIPAQGIIELRNALTELIKEYGSEDNGSEDVELPEPKSIRIDNKMFYFDVGCNRRGVFLRVSEVRTNYRTAITIPEKSWASFKEIINEMSTQM 787
            Q   +EL SK + IQNKRFYLDVKQN +G+F+KIAEVG GG KSR+ +SMS A EFRD L D    Y  L P +P+   D+ R  LKS+ +V++ R+YY+DLKEN RGRFLRV         +  +    IA+PAQG+IE R+AL +LI +YG ++   E  ELPE  S+ +DNK F+FDVG N+ GVF+RVSEV+  YR +IT+P K W+ F     + + +M
Sbjct:   54 QHDTEELASKRVDIQNKRFYLDVKQNAKGRFLKIAEVGAGGNKSRLTLSMSVAVEFRDYLGDFIEHYAQLGPSHPDTAQDEPRRALKSEFLVRENRKYYMDLKENQRGRFLRVRQTVNRGPGLGTAQGQTIALPAQGLIEFRDALAKLIDDYGVDE---EPAELPEGTSLAVDNKRFFFDVGANKYGVFMRVSEVKPAYRNSITVPCKVWSKFGATFCKYADEM 274          
BLAST of Transcriptional activator protein Pur-beta vs. Ensembl Cavefish
Match: purba (purine-rich element binding protein Ba [Source:ZFIN;Acc:ZDB-GENE-060531-100])

HSP 1 Score: 216.468 bits (550), Expect = 1.918e-67
Identity = 121/248 (48.79%), Postives = 151/248 (60.89%), Query Frame = 2
Query:  155 QELTSKTLMIQNKRFYLDVKQNLRGKFIKIAEVGMGGRKSRILMSMSTAAEFRDKLNDLSNLYNGLQPHNPENLA-----DDG----RLKSDTIVKDTRRYYLDLKENARGRFLRVTMMA------------------PSNRSQIAIPAQGIIELRNALTELIKEYGSEDN----------GSEDVELPEPKSIRIDNKMFYFDVGCNRRGVFLRVSEVRTNYRTAITIPEKSWASFKEIINEMSTQM 787
            QEL SK L IQNKRFYLDVKQN +G+FIKIAEVG GG KSR+ +SMS AAEFRD L D    Y  L P   E +A     +DG     LKS+ +V++ R+YYLDLKEN RGRFLR+                        +   IA+PAQG+IE R+AL +LI +YG ED+          G    ELPE  SI +D+K F+FDVG N+ GVFLRVSEV+ +YR +ITIP K+W+ F       + +M
Sbjct:   35 QELASKRLDIQNKRFYLDVKQNSKGRFIKIAEVGAGGSKSRLTLSMSVAAEFRDYLGDFIEHYAQLGPSTAEQIAQSSGGEDGGPRRALKSEFLVRENRKYYLDLKENQRGRFLRIRQTVNRGPGFGVGGGGGVPGGGVQSGQTIALPAQGLIEFRDALAKLIDDYGGEDDELVGGGGCGGGGGYGELPEGTSITVDSKRFFFDVGSNKYGVFLRVSEVKPSYRNSITIPFKAWSKFGGAFCRYAEEM 282          
BLAST of Transcriptional activator protein Pur-beta vs. Ensembl Cavefish
Match: purbb (purine-rich element binding protein Bb [Source:NCBI gene;Acc:393519])

HSP 1 Score: 208.379 bits (529), Expect = 1.490e-64
Identity = 121/248 (48.79%), Postives = 149/248 (60.08%), Query Frame = 2
Query:  155 QELTSKTLMIQNKRFYLDVKQNLRGKFIKIAEVGMGGRKSRILMSMSTAAEFRDKLNDLSNLYNGLQPHNPENLA-------DDG---RLKSDTIVKDTRRYYLDLKENARGRFLRVTMMAPSNRSQ----------------IAIPAQGIIELRNALTELIKEY-----------GSEDNGSEDVELPEPKSIRIDNKMFYFDVGCNRRGVFLRVSEVRTNYRTAITIPEKSWASFKEIINEMSTQM 787
            QEL SK L IQNKRFYLDVKQN +G+FIKIAEVG GG KSR+ +SMS AAEFRD L D    Y  L P +PE +A       D G    LKS+ +V++ R+YYLDLKEN RGRFLR+      NR                  IA+PAQG+IE R+AL +LI +Y           G         ELPE  SI +D+K F+FDVG N+ GVFLRVSEV+ +YR +ITIP K+W+ F       + +M
Sbjct:   22 QELASKRLDIQNKRFYLDVKQNSKGRFIKIAEVGAGGSKSRLTLSMSVAAEFRDYLGDFIEHYAQLGPSSPEQIAQSSGGGEDSGPRRALKSEFLVRENRKYYLDLKENQRGRFLRIRQTV--NRGPGFGVAGPGGGMQAGQTIALPAQGLIEFRDALAKLIDDYGGEDEELSGGGGGGPGAGGYGELPEGTSIMVDSKRFFFDVGANKYGVFLRVSEVKPSYRNSITIPFKAWSKFGGAFCRYAEEM 267          
BLAST of Transcriptional activator protein Pur-beta vs. Ensembl Sea Lamprey
Match: puraa (purine-rich element binding protein Aa [Source:ZFIN;Acc:ZDB-GENE-040624-8])

HSP 1 Score: 212.231 bits (539), Expect = 1.420e-66
Identity = 115/245 (46.94%), Postives = 152/245 (62.04%), Query Frame = 2
Query:  155 QELTSKTLMIQNKRFYLDVKQNLRGKFIKIAEVGMGGRKSRILMSMSTAAEFRDKLNDLSNLYNGLQP--------------------------HNPENLADDGR--LKSDTIVKDTRRYYLDLKENARGRFLRVTMM---APSNRSQ---IAIPAQGIIELRNALTELIKEYGSEDNGSEDVELPEPKSIRIDNKMFYFDVGCNRRGVFLRVSEVRTNYRTAITIPEKSWASFKEIINEMSTQM 787
            QEL SK + IQNKRFYLDVKQN +G+F+KIAEVG GG KSR+ +SMS A EFRD L D    Y  L P                          H+ +   D+ R  LKS+ +V++ R+YY+DLKEN RGRFLRV       P   +Q   IA+PAQG+IE R+AL +LI ++G ++   E  ELPE  ++ +DNK F+FDVG N+ GVF+RVSEV+ +YR +IT+P K+WA F    +  S +M
Sbjct:   35 QELASKRVDIQNKRFYLDVKQNAKGRFLKIAEVGAGGSKSRLTLSMSVAVEFRDYLGDFIEHYAQLGPSSAMSGGGGGGGGGGGGIGSGGDHQSHHQQLQPDEPRRALKSEFLVRENRKYYMDLKENQRGRFLRVRQTVSRGPGLGAQGQTIALPAQGMIEFRDALAKLIDDFGVDE---EPAELPEGTAVTVDNKRFFFDVGSNKYGVFMRVSEVKPSYRNSITVPLKAWAKFGATFSRYSDEM 276          
BLAST of Transcriptional activator protein Pur-beta vs. Ensembl Nematostella
Match: EDO39605 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9M7])

HSP 1 Score: 204.527 bits (519), Expect = 1.090e-64
Identity = 99/210 (47.14%), Postives = 147/210 (70.00%), Query Frame = 2
Query:  152 EQELTSKTLMIQNKRFYLDVKQNLRGKFIKIAEVGMG-GRKSRILMSMSTAAEFRDKLNDLSNLYNGLQPHNPENLADDGRLKSDTIVKDTRRYYLDLKENARGRFLRVTMMAPSNRS----QIAIPAQGIIELRNALTELIKEYGSEDNGSEDVELPEPKSIRIDNKMFYFDVGCNRRGVFLRVSEVRTNYRTAITIPEKSWASFKEII 766
            ++EL SK+L IQ+KRFY+D+K+N RGK+IKI+EV      K ++++S++ + EFRDKL   +          P N + DGRLKS+ I  + ++YYLDLKEN+RGRFL+V       R     +IAIPAQGI+++RN L+E+++E  S+++    +ELP  + +R++ K FYFDVG N RGVFLR+SEV  NYRT+IT+P++ WA  +++I
Sbjct:    1 DEELCSKSLQIQSKRFYIDLKRNRRGKYIKISEVSTNKSTKRKVILSLAVSREFRDKLTTFAEFLAQQGNSIPHNDSHDGRLKSERIDGENKKYYLDLKENSRGRFLKVCTQICDRRGPMRKEIAIPAQGIVDIRNNLSEVLEECSSDEDA---LELPASRELRVEQKRFYFDVGSNARGVFLRISEVTANYRTSITVPKRGWAQIRDVI 207          

HSP 2 Score: 62.7734 bits (151), Expect = 1.459e-11
Identity = 38/141 (26.95%), Postives = 78/141 (55.32%), Query Frame = 2
Query:  137 NNQSAEQELTSKTLMIQNKRFYLDVKQNLRGKFIKIAEVGMGGRKSRILMSMSTAAEFRDKLNDLSNLYNGLQPHNPENLADDGRLK---SDTIVKDTRRYYLDLKENARGRFLRVTMMAPSNRSQIAIPAQGIIELRNAL 550
            +N S +  L S+ +  +NK++YLD+K+N RG+F+K+    +  R+  +   ++  A+       + ++ N L     E  +D+  L+   S  +  + +R+Y D+  NARG FLR++ +  + R+ I +P +G  ++R+ +
Sbjct:   74 HNDSHDGRLKSERIDGENKKYYLDLKENSRGRFLKVC-TQICDRRGPMRKEIAIPAQ------GIVDIRNNLSEVLEECSSDEDALELPASRELRVEQKRFYFDVGSNARGVFLRISEVTANYRTSITVPKRGWAQIRDVI 207          
BLAST of Transcriptional activator protein Pur-beta vs. Ensembl Medaka
Match: puraa (transcriptional activator protein Pur-alpha [Source:NCBI gene;Acc:101168390])

HSP 1 Score: 229.95 bits (585), Expect = 3.734e-73
Identity = 116/224 (51.79%), Postives = 150/224 (66.96%), Query Frame = 2
Query:  143 QSAEQELTSKTLMIQNKRFYLDVKQNLRGKFIKIAEVGMGGRKSRILMSMSTAAEFRDKLNDLSNLYNGLQPHNPENLADDGR--LKSDTIVKDTRRYYLDLKENARGRFLRVTM-------MAPSNRSQIAIPAQGIIELRNALTELIKEYGSEDNGSEDVELPEPKSIRIDNKMFYFDVGCNRRGVFLRVSEVRTNYRTAITIPEKSWASFKEIINEMSTQM 787
            Q   QEL SK + IQNKRFYLDVKQN +G+F+KIAEVG GG KSR+ +SMS A EFRD L D    Y  L P NP  + D+ R  LKS+ +V++ R+YY+DLKEN RGRFLR+         +  +    IA+PAQG+IE R+AL +LI +YG ED   E  ELPE  S+ +DNK F+FDVG N+ GVF+RVSEV+  YR +IT+P K W+ F     + + +M
Sbjct:   36 QHETQELASKRVDIQNKRFYLDVKQNAKGRFLKIAEVGAGGNKSRLTLSMSVAVEFRDYLGDFIEHYAQLGPSNPGMIQDEPRRALKSEFLVRENRKYYMDLKENQRGRFLRIRQTVNRGPGLGSTQGQTIALPAQGLIEFRDALAKLIDDYGVED---EPAELPEGSSLTVDNKRFFFDVGSNKYGVFMRVSEVKPTYRNSITVPYKVWSKFGTTFCKYAEEM 256          
BLAST of Transcriptional activator protein Pur-beta vs. Ensembl Medaka
Match: purab (transcriptional activator protein Pur-alpha-like [Source:NCBI gene;Acc:101161901])

HSP 1 Score: 225.713 bits (574), Expect = 1.412e-71
Identity = 113/224 (50.45%), Postives = 153/224 (68.30%), Query Frame = 2
Query:  143 QSAEQELTSKTLMIQNKRFYLDVKQNLRGKFIKIAEVGMGGRKSRILMSMSTAAEFRDKLNDLSNLYNGLQPHNPENLADDGR--LKSDTIVKDTRRYYLDLKENARGRFLRVTM-------MAPSNRSQIAIPAQGIIELRNALTELIKEYGSEDNGSEDVELPEPKSIRIDNKMFYFDVGCNRRGVFLRVSEVRTNYRTAITIPEKSWASFKEIINEMSTQM 787
            Q   +EL SK + IQNKRFYLDVKQN++G+F+KIAEVG GG KSR+ +SMS A EFRD L D    Y  L P NP+ + D+ R  LKS+ +V++ R+YY+DLKEN RGRFLR+         +  +    IA+PAQG+IE R+AL +LI +YG ++   E  ELPE  S+ +DNK F+FDVG N+ GVF+RVSEV+  YR +IT+P K W+ F    ++ + +M
Sbjct:   32 QHDTEELASKRIDIQNKRFYLDVKQNVKGRFLKIAEVGAGGNKSRLTLSMSVAVEFRDYLGDFIEHYAQLGPTNPDMVQDEPRRALKSEFLVRENRKYYMDLKENQRGRFLRIRQTVNRGPGLGSAQGQTIALPAQGLIEFRDALAKLIDDYGVDE---EPAELPEGTSLTVDNKRFFFDVGSNKYGVFMRVSEVKPTYRNSITVPCKVWSKFGNTFSKYAEEM 252          
BLAST of Transcriptional activator protein Pur-beta vs. Ensembl Medaka
Match: PURB (purine rich element binding protein B [Source:NCBI gene;Acc:101164417])

HSP 1 Score: 223.016 bits (567), Expect = 2.254e-69
Identity = 124/243 (51.03%), Postives = 156/243 (64.20%), Query Frame = 2
Query:  155 QELTSKTLMIQNKRFYLDVKQNLRGKFIKIAEVGMGGRKSRILMSMSTAAEFRDKLNDLSNLYNGLQPHNPENLA-----DDG----RLKSDTIVKDTRRYYLDLKENARGRFLRVTMMAPSNRSQ----------------IAIPAQGIIELRNALTELIKEYGSEDN----GSE---DVELPEPKSIRIDNKMFYFDVGCNRRGVFLRVSEVRTNYRTAITIPEKSWASFKEIINEMSTQM 787
            QEL SK L IQNKRFYLDVKQN +G+FIKIAEVG GG KSR+ +S+S AAEFRD L D    Y  L P +PE +A     +DG     LKS+ +V++ R+YYLDLKEN RGRFLR+   A  NR                  IA+PAQG+IE R+AL +LI +YG +D+    GS      ELPE  SI +D+K F+FDVG N+ GVFLRVSEV+ +YR +ITIP K+W+ F       + +M
Sbjct:   95 QELASKRLDIQNKRFYLDVKQNSKGRFIKIAEVGAGGSKSRLTLSLSVAAEFRDYLGDFIEHYAQLGPSSPEQIAQATAGEDGGPRRALKSEFLVRENRKYYLDLKENQRGRFLRIRQTA--NRGPGFGVGGPMGGMVSGQTIALPAQGLIEFRDALAKLIDDYGGDDDELTGGSAAGGPAELPEGTSITVDSKRFFFDVGSNKYGVFLRVSEVKPSYRNSITIPLKAWSKFGGAFCRYAEEM 335          
BLAST of Transcriptional activator protein Pur-beta vs. Ensembl Medaka
Match: ENSORLT00000032236.1 (transcriptional activator protein Pur-beta [Source:NCBI gene;Acc:101169999])

HSP 1 Score: 211.075 bits (536), Expect = 7.646e-65
Identity = 122/247 (49.39%), Postives = 151/247 (61.13%), Query Frame = 2
Query:  155 QELTSKTLMIQNKRFYLDVKQNLRGKFIKIAEVGMGGRKSRILMSMSTAAEFRDKLNDLSNLYNGLQPHNPENLA------DDG---RLKSDTIVKDTRRYYLDLKENARGRFLRVTMMAPSNRSQ-------------------IAIPAQGIIELRNALTELIKEYGSEDNGSEDV--------ELPEPKSIRIDNKMFYFDVGCNRRGVFLRVSEVRTNYRTAITIPEKSWASFKEIINEMSTQM 787
            QEL SK L IQNKRFYLDVKQN +G+FIKIAEVG GG KSR+ +SMS AAEFRD L D    Y  L P  PE +A      D G    LKS+ +V++ R+YYLDLKEN RGRFLR+      NR                     IA+PAQG+IE R+AL +LI +YG +D              ELPE  SI +D+K F+FDVG N+ GVFLRVSEV+ +YR +ITIP K+W+ F    +  + +M
Sbjct:   91 QELASKRLDIQNKRFYLDVKQNAKGRFIKIAEVGAGGSKSRLTLSMSVAAEFRDYLGDFIEHYAQLGPSTPEQIAQSSGGDDTGPRRALKSEFLVRENRKYYLDLKENQRGRFLRIRQTV--NRGPGFGVGVGGIPGAGLQAGQTIALPAQGLIEFRDALAKLIDDYGGDDEDLAGGGGGAGAYSELPEGTSIMVDSKRFFFDVGSNKYGVFLRVSEVKPSYRNSITIPFKAWSKFGGAFSRYAEEM 335          
BLAST of Transcriptional activator protein Pur-beta vs. Ensembl Medaka
Match: purg (purine rich element binding protein G [Source:NCBI gene;Acc:111948310])

HSP 1 Score: 188.348 bits (477), Expect = 2.172e-56
Identity = 113/254 (44.49%), Postives = 146/254 (57.48%), Query Frame = 2
Query:  155 QELTSKTLMIQNKRFYLDVKQNLRGKFIKIAEVGMGG------RKSRILMSMSTAAEFRDKLNDLSNLYN--GLQ-------------PHNPENLADDGR----------LKSDTIVKDTRRYYLDLKENARGRFLRVTMMAPSNRSQ-----------IAIPAQGIIELRNALTELIKEYGSED---NG-------SEDVELPEPKSIRIDNKMFYFDVGCNRRGVFLRVSEVRTNYRTAITIPEKSWASFKE 760
            QEL SK + IQ KRFYLDVKQ++RG+F+KIAEV +G       RKS++ +SMSTA   R  L D  + Y   GL+             P  P  L+  G           LKS+ I +D R+Y+LDLKEN RGRFLR+                     I +PAQG+IE R+AL++LI+++GSE+   +G       +   ELPE  S R+DNK FYFDVG NR GVFL++SEVR  YR  IT+P K+WA F E
Sbjct:   50 QELASKRVDIQKKRFYLDVKQSVRGRFLKIAEVWIGRGRHDNVRKSKLTLSMSTAPALRYCLGDFIDYYARIGLRGLAEEHGERRRKAPEQPAALSPVGSTGSDEHGHRVLKSEFIERDNRKYFLDLKENQRGRFLRIRQTVGRGHGTMGYYGQGIEQTIVLPAQGLIEFRDALSQLIEDFGSEEADEHGRASSRCRAHSPELPEAASFRVDNKRFYFDVGSNRYGVFLKISEVRQPYRNTITVPLKAWARFGE 303          
The following BLAST results are available for this feature:
BLAST of Transcriptional activator protein Pur-beta vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PURA1.083e-7151.98purine rich element binding protein A [Source:HGNC... [more]
PURA1.083e-7151.98purine rich element binding protein A [Source:HGNC... [more]
PURB9.907e-7046.92purine rich element binding protein B [Source:HGNC... [more]
PURG1.099e-5644.49purine rich element binding protein G [Source:HGNC... [more]
PURG2.662e-4642.91purine rich element binding protein G [Source:HGNC... [more]
back to top
BLAST of Transcriptional activator protein Pur-beta vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
plp-11.096e-4139.82Pur alpha Like Protein [Source:UniProtKB/TrEMBL;A... [more]
plp-22.061e-1845.26Pur alpha Like Protein [Source:UniProtKB/TrEMBL;A... [more]
back to top
BLAST of Transcriptional activator protein Pur-beta vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pur-alpha3.450e-8958.41gene:FBgn0022361 transcript:FBtr0089993[more]
Pur-alpha9.013e-8956.82gene:FBgn0022361 transcript:FBtr0310639[more]
Pur-alpha9.013e-8956.82gene:FBgn0022361 transcript:FBtr0089995[more]
Pur-alpha3.885e-8858.41gene:FBgn0022361 transcript:FBtr0310640[more]
Pur-alpha8.616e-8856.82gene:FBgn0022361 transcript:FBtr0089996[more]
back to top
BLAST of Transcriptional activator protein Pur-beta vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
puraa7.584e-7350.43purine-rich element binding protein Aa [Source:ZFI... [more]
puraa7.584e-7350.43purine-rich element binding protein Aa [Source:ZFI... [more]
purbb1.077e-7050.20purine-rich element binding protein Bb [Source:NCB... [more]
purab3.842e-7050.00purine-rich element binding protein Ab [Source:ZFI... [more]
purba2.436e-6850.00purine-rich element binding protein Ba [Source:ZFI... [more]
back to top
BLAST of Transcriptional activator protein Pur-beta vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
unc13a1.887e-7251.34unc-13 homolog A [Source:Xenbase;Acc:XB-GENE-60396... [more]
PURB1.647e-6847.04purine rich element binding protein B [Source:HGNC... [more]
rps6kl17.327e-5543.89ribosomal protein S6 kinase like 1 [Source:Xenbase... [more]
back to top
BLAST of Transcriptional activator protein Pur-beta vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Pura8.483e-7251.98purine rich element binding protein A [Source:MGI ... [more]
Purb5.308e-6848.03purine rich element binding protein B [Source:MGI ... [more]
Purg2.129e-5644.11purine-rich element binding protein G [Source:MGI ... [more]
Purg5.962e-4642.51purine-rich element binding protein G [Source:MGI ... [more]
back to top
BLAST of Transcriptional activator protein Pur-beta vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q00577|PURA_HUMAN5.201e-7151.98Transcriptional activator protein Pur-alpha OS=Hom... [more]
sp|P42669|PURA_MOUSE5.934e-7151.98Transcriptional activator protein Pur-alpha OS=Mus... [more]
sp|Q6PHK6|PURB_DANRE8.133e-7050.20Transcriptional activator protein Pur-beta OS=Dani... [more]
sp|Q96QR8|PURB_HUMAN4.758e-6946.92Transcriptional activator protein Pur-beta OS=Homo... [more]
sp|Q68A21|PURB_RAT1.611e-6848.40Transcriptional activator protein Pur-beta OS=Ratt... [more]
back to top
BLAST of Transcriptional activator protein Pur-beta vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
R7V3Q66.561e-9963.06Uncharacterized protein OS=Capitella teleta OX=283... [more]
A0A0B6YUZ61.603e-9664.84Uncharacterized protein (Fragment) OS=Arion vulgar... [more]
A0A210QPQ75.136e-9660.00Transcriptional activator protein Pur-alpha OS=Miz... [more]
A0A2C9KGA82.563e-9564.84Uncharacterized protein OS=Biomphalaria glabrata O... [more]
A0A2T7PJY03.498e-9563.51Uncharacterized protein OS=Pomacea canaliculata OX... [more]
back to top
BLAST of Transcriptional activator protein Pur-beta vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
puraa7.035e-7452.23purine rich element binding protein A [Source:NCBI... [more]
purab1.437e-7050.45transcriptional activator protein Pur-alpha-like [... [more]
purba1.918e-6748.79purine-rich element binding protein Ba [Source:ZFI... [more]
purbb1.490e-6448.79purine-rich element binding protein Bb [Source:NCB... [more]
back to top
BLAST of Transcriptional activator protein Pur-beta vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
puraa1.420e-6646.94purine-rich element binding protein Aa [Source:ZFI... [more]
back to top
BLAST of Transcriptional activator protein Pur-beta vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transcriptional activator protein Pur-beta vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO396051.090e-6447.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Transcriptional activator protein Pur-beta vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
puraa3.734e-7351.79transcriptional activator protein Pur-alpha [Sourc... [more]
purab1.412e-7150.45transcriptional activator protein Pur-alpha-like [... [more]
PURB2.254e-6951.03purine rich element binding protein B [Source:NCBI... [more]
ENSORLT00000032236.17.646e-6549.39transcriptional activator protein Pur-beta [Source... [more]
purg2.172e-5644.49purine rich element binding protein G [Source:NCBI... [more]
back to top
BLAST of Transcriptional activator protein Pur-beta vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30028513 ID=SMED30028513|Name=Transcriptional activator protein Pur-beta|organism=Schmidtea mediterranea sexual|type=transcript|length=1132bp
AGATGCGTGTTTAAATTATCTTATAAACAGTTTCGTTTACAAGTAACACT
TTATTGGAGTTGGTTTGGATTGGTTTTTATAGTGAACGTTAAAGAAAGTA
GTTAAGATGCAAGAGACTGGAAAGGCTAAGCAACAAAACAATCAATCTGC
AGAGCAGGAATTGACTTCGAAGACGTTAATGATTCAAAACAAGCGTTTCT
ATCTTGATGTCAAACAAAATTTACGTGGAAAATTTATCAAAATTGCTGAA
GTTGGTATGGGAGGAAGAAAGTCTAGGATTTTAATGTCTATGTCAACAGC
CGCTGAATTTAGAGATAAATTAAATGACTTAAGCAATTTGTACAATGGTT
TACAGCCACATAATCCAGAAAATCTGGCTGATGATGGCAGATTAAAGTCA
GATACGATTGTCAAGGATACGAGAAGATATTATTTGGATTTGAAAGAAAA
TGCCAGAGGTAGGTTTTTGCGAGTGACAATGATGGCTCCTTCCAATCGTT
CACAGATAGCAATTCCAGCCCAAGGAATTATAGAATTAAGAAATGCATTG
ACAGAATTGATCAAAGAATATGGAAGTGAAGACAATGGAAGTGAGGATGT
AGAACTTCCTGAACCAAAGTCAATTCGTATTGATAATAAAATGTTTTATT
TCGATGTTGGGTGTAACAGAAGAGGTGTGTTTTTAAGAGTATCCGAAGTG
CGTACTAATTACCGCACTGCAATTACCATACCTGAAAAATCTTGGGCTAG
CTTTAAAGAAATCATCAACGAAATGTCTACACAAATGACAATTAAAGCAA
ATGGTTTGATAAAAACTGAGCCTGACACTGCAGCTCAGGGAGATGGTAAA
TAACAGTTTTGTTTTTAATGGTTTTTGTATGTATTTTTGAATTTTGCTAA
ATTTCATCTATCGTGTTTACCGATATAATATTGTATAATTATGCACGGCG
AGGTTCATTGTTTAATGTTATAATGTTACTCTGTTAGCTGCTTTAATCGA
AATATATTTATTAGTGAGTGTTTGTATTTATTGTCAATTTTGTTTGTTTT
TTATATTTTATGCAAATTTTTTGGTGTCTGTTTGCTTAATTCTTAACAAT
ACTTTTGAATAAATAATTTAACTTAAAAACAA
back to top

protein sequence of SMED30028513-orf-1

>SMED30028513-orf-1 ID=SMED30028513-orf-1|Name=SMED30028513-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=249bp
MQETGKAKQQNNQSAEQELTSKTLMIQNKRFYLDVKQNLRGKFIKIAEVG
MGGRKSRILMSMSTAAEFRDKLNDLSNLYNGLQPHNPENLADDGRLKSDT
IVKDTRRYYLDLKENARGRFLRVTMMAPSNRSQIAIPAQGIIELRNALTE
LIKEYGSEDNGSEDVELPEPKSIRIDNKMFYFDVGCNRRGVFLRVSEVRT
NYRTAITIPEKSWASFKEIINEMSTQMTIKANGLIKTEPDTAAQGDGK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0000977RNA polymerase II regulatory region sequence-specific DNA binding
GO:0000900translation repressor activity, nucleic acid binding
GO:0003677DNA binding
GO:0003697single-stranded DNA binding
GO:0003700transcription factor activity, sequence-specific DNA binding
GO:0003729mRNA binding
GO:0008134transcription factor binding
GO:0032422purine-rich negative regulatory element binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000028Category 2 cell
PLANA:0000034epidermis
PLANA:0000035Category 3 cell
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR006628PUR-bd_fam
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005662DNA replication factor A complex
Vocabulary: biological process
TermDefinition
GO:0006351transcription, DNA-templated
GO:0006355regulation of transcription, DNA-templated
GO:0008283cell proliferation
GO:0017148negative regulation of translation
GO:0030154cell differentiation
GO:0045892negative regulation of transcription, DNA-templated
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006628Purine-rich element binding protein familySMARTSM00712purcoord: 18..80
e-value: 3.4E-26
score: 103.0
coord: 95..156
e-value: 3.1E-24
score: 96.5
coord: 167..228
e-value: 1.5E-21
score: 87.6
IPR006628Purine-rich element binding protein familyPFAMPF04845PurAcoord: 16..227
e-value: 8.8E-94
score: 312.9
IPR006628Purine-rich element binding protein familyPANTHERPTHR12611PUR-TRANSCRIPTIONAL ACTIVATORcoord: 6..233
NoneNo IPR availableGENE3DG3DSA:2.30.31.60coord: 10..157
e-value: 6.7E-64
score: 215.9
NoneNo IPR availableGENE3DG3DSA:3.10.450.700coord: 158..231
e-value: 3.6E-25
score: 89.3