Protein disulfide-isomerase

Overview
NameProtein disulfide-isomerase
Smed IDSMED30028496
Length (bp)1771
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein disulfide-isomerase (SMED30028496) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein disulfide-isomerase (SMED30028496) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein disulfide-isomerase (SMED30028496) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein disulfide-isomerase (SMED30028496) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30028496

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30028496SMESG000001159.1 dd_Smed_v4_1893_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30028496SMESG000001159.1 dd_Smed_v4_1893_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30028496SMESG000001159.1 dd_Smed_v4_1893_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30028496SMESG000001159.1 dd_Smed_v6_1893_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30028496SMESG000001159.1 OX_Smed_1.0.01977ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
reproductive organSMED30028496SMESG000001159.1 Contig52094newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30028496SMESG000001159.1 Contig52094uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein disulfide-isomerase vs. Ensembl Human
Match: PDIA2 (protein disulfide isomerase family A member 2 [Source:HGNC Symbol;Acc:HGNC:14180])

HSP 1 Score: 134.806 bits (338), Expect = 3.897e-33
Identity = 114/469 (24.31%), Postives = 199/469 (42.43%), Query Frame = 3
Query:  135 NGILNLNISNFQSALDEHKTVIALAYLKDAPEASSAVKLFGKVGNKLKNDNLNMVLAKLKLEYDNNIFSKYNLEGTFGLLALMDHGERF--VEYTQPVNDVDKIVEFIEKKLQEPVTEINDSAKLRSIIENRPCISVGFFNNFTSTDYEEYRSSADWFYECDHYATRDVELFKYFKVNETIPTVKFYKECIHEVFDYP--KQLPFDSNNVLKFFLVCMEPDVAEYGMNWLMKRVLKQPQFTLLLFVKKDDPKKENYIDIMKKYARRYREEINMAYIDIDGHEDVKSFLYTFDLSESDVPCLRAIETSNRYANNTRKYKP-KRKTINDASVKQFIGDVYYRQLSPYLISEKIPKDWNSQPVVTVVGDNFRNITEDPTKTVLIVFYNDEPKYELFVKEQLKQLAMDFQSKGHSDVVIGVSNYYSNEYYGWHPNRFPKMILFPKGKNTFGIEYQMNMTVEDLKAFIESDGKI 1526
            +GIL L+      AL EH  ++   Y        +    + K    L  +++ + LAK+       +  ++ +   +  L    +G R    EYT P  D + I E++ +++      + D A  +++I  R  + +GFF +    D   + + A    +     T    LF+ F +  T  TV  +K+      D+P  ++L  D  ++ +F +      V E+      K    +    LLLFV +        +    + A R+R ++    +D+    D +  L  F L     P LR +         T+KY P     +  AS+  F   V   Q+ PYL+S++IP DW+ +PV T+VG NF  +  D TK V + FY     +   +    + LA  +Q   H D++I   +  +NE   +  + FP +  FP G     IEY+    +E    F+++ G +
Sbjct:   42 DGILVLSRHTLGLALREHPALLVEFYAPWCGHCQALAPEYSKAAAVLAAESMVVTLAKVDGPAQRELAEEFGVT-EYPTLKFFRNGNRTHPEEYTGP-RDAEGIAEWLRRRVGPSAMRLEDEAAAQALIGGRDLVVIGFFQDLQDEDVATFLALAQDALDMTFGLTDRPRLFQQFGL--TKDTVVLFKKFDEGRADFPVDEELGLDLGDLSRFLVTHSMRLVTEFNSQTSAKIFAARILNHLLLFVNQTLAAHRELLAGFGEAAPRFRGQVLFVVVDVAA--DNEHVLQYFGLKAEAAPTLRLVNL-----ETTKKYAPVDGGPVTAASITAFCHAVLNGQVKPYLLSQEIPPDWDQRPVKTLVGKNFEQVAFDETKNVFVKFYAPWCTHCKEMAPAWEALAEKYQD--HEDIIIAELDATANELDAFAVHGFPTLKYFPAGPGRKVIEYKSTRDLETFSKFLDNGGVL 497          
BLAST of Protein disulfide-isomerase vs. Ensembl Human
Match: P4HB (prolyl 4-hydroxylase subunit beta [Source:HGNC Symbol;Acc:HGNC:8548])

HSP 1 Score: 131.339 bits (329), Expect = 5.983e-32
Identity = 111/472 (23.52%), Postives = 211/472 (44.70%), Query Frame = 3
Query:  129 DKNGILNLNISNFQSALDEHKTVIALAYLKDAPEASSAVKLFGKVGNKLKNDNLNMVLAKLKLEYDNNIFSKYNLEGTFGLLALMDHGERFV--EYTQPVNDVDKIVEFIEKKLQEPVTEINDSAKLRSIIENRPCISVGFFNNFTSTDYEEYRSSADWFYECDHYATRDVELFKYFKVNETIPTVKFYKECIHEVFDYPKQLPFDSNNVLKFFLVCMEPDVAEYGMNWLMKRVLKQPQFTLLLFVKKDDPKKENYIDIMKKYARRYREEINMAYIDIDGHEDVKSFLYTFDLSESDVPCLRAIETSNRYANNTRKYKPKRKTINDASVKQFIGDVYYRQLSPYLISEKIPKDWNSQPVVTVVGDNFRNITEDPTKTVLIVFYNDEPKYELFVKEQLKQLAMDFQSKG-----HSDVVIGVSNYYSNEYYGWHPNRFPKMILFPKGKNTFGIEYQMNMTVEDLKAFIESDGK 1523
            +++ +L L  SNF  AL  HK ++   Y        +    + K   KLK +   + LAK+    ++++  +Y + G +  +    +G+     EYT    + D IV +++K+     T + D A   S++E+     +GFF +  S   +++  +A+   +     T + ++F  +++++    V  +K+      ++  ++     N+L F      P V E+      K    + +  +LLF+ K     +  +   K  A  ++ +I   +ID D H D +  L  F L + + P +R I           KYKP+ + +    + +F       ++ P+L+S+++P+DW+ QPV  +VG NF ++  D  K V + FY     +        KQLA  +   G     H ++VI   +  +NE      + FP +  FP   +   I+Y    T++  K F+ES G+
Sbjct:   22 EEDHVLVLRKSNFAEALAAHKYLLVEFYAPWCGHCKALAPEYAKAAGKLKAEGSEIRLAKVDATEESDLAQQYGVRG-YPTIKFFRNGDTASPKEYTAG-READDIVNWLKKRTGPAATTLPDGAAAESLVESSEVAVIGFFKDVESDSAKQFLQAAEAIDDIPFGITSNSDVFSKYQLDKD--GVVLFKKFDEGRNNFEGEVT--KENLLDFIKHNQLPLVIEFTEQTAPKIFGGEIKTHILLFLPKSVSDYDGKLSNFKTAAESFKGKILFIFIDSD-HTDNQRILEFFGLKKEECPAVRLITLEEEMT----KYKPESEELTAERITEFCHRFLEGKIKPHLMSQELPEDWDKQPVKVLVGKNFEDVAFDEKKNVFVEFYAPWCGH-------CKQLAPIWDKLGETYKDHENIVIAKMDSTANEVEAVKVHSFPTLKFFPASADRTVIDYNGERTLDGFKKFLESGGQ 475          
BLAST of Protein disulfide-isomerase vs. Ensembl Human
Match: PDIA2 (protein disulfide isomerase family A member 2 [Source:HGNC Symbol;Acc:HGNC:14180])

HSP 1 Score: 130.183 bits (326), Expect = 1.473e-31
Identity = 114/469 (24.31%), Postives = 199/469 (42.43%), Query Frame = 3
Query:  135 NGILNLNISNFQSALDEHKTVIALAYLKDAPEASSAVKLFGKVGNKLKNDNLNMVLAKLKLEYDNNIFSKYNLEGTFGLLALMDHGERF--VEYTQPVNDVDKIVEFIEKKLQEPVTEINDSAKLRSIIENRPCISVGFFNNFTSTDYEEYRSSADWFYECDHYATRDVELFKYFKVNETIPTVKFYKECIHEVFDYP--KQLPFDSNNVLKFFLVCMEPDVAEYGMNWLMKRVLKQPQFTLLLFVKKDDPKKENYIDIMKKYARRYREEINMAYIDIDGHEDVKSFLYTFDLSESDVPCLRAIETSNRYANNTRKYKP-KRKTINDASVKQFIGDVYYRQLSPYLISEKIPKDWNSQPVVTVVGDNFRNITEDPTKTVLIVFYNDEPKYELFVKEQLKQLAMDFQSKGHSDVVIGVSNYYSNEYYGWHPNRFPKMILFPKGKNTFGIEYQMNMTVEDLKAFIESDGKI 1526
            +GIL L+      AL EH  ++   Y        +    + K    L  +++ + LAK+       +  ++ +   +  L    +G R    EYT P  D + I E++ +++      + D A  +++I  R  + +GFF +    D   + + A    +     T    LF+ F +  T  TV  +K+      D+P  ++L  D  ++ +F +      V E+      K    +    LLLFV +        +    + A R+R ++    +D+    D +  L  F L     P LR +         T+KY P     +  AS+  F   V   Q+ PYL+S++IP DW+ +PV T+VG NF  +  D TK V + FY     +   +    + LA  +Q   H D++I   +  +NE   +  + FP +  FP G     IEY+    +E    F+++ G +
Sbjct:   42 DGILVLSRHTLGLALREHPALLVEFYAPWCGHCQALAPEYSKAAAVLAAESMVVTLAKVDGPAQRELAEEFGVT-EYPTLKFFRNGNRTHPEEYTGP-RDAEGIAEWLRRRVGPSAMRLEDEAAAQALIGGRDLVVIGFFQD---EDVATFLALAQDALDMTFGLTDRPRLFQQFGL--TKDTVVLFKKFDEGRADFPVDEELGLDLGDLSRFLVTHSMRLVTEFNSQTSAKIFAARILNHLLLFVNQTLAAHRELLAGFGEAAPRFRGQVLFVVVDVAA--DNEHVLQYFGLKAEAAPTLRLVNL-----ETTKKYAPVDGGPVTAASITAFCHAVLNGQVKPYLLSQEIPPDWDQRPVKTLVGKNFEQVAFDETKNVFVKFYAPWCTHCKEMAPAWEALAEKYQD--HEDIIIAELDATANELDAFAVHGFPTLKYFPAGPGRKVIEYKSTRDLETFSKFLDNGGVL 494          
BLAST of Protein disulfide-isomerase vs. Ensembl Human
Match: P4HB (prolyl 4-hydroxylase subunit beta [Source:HGNC Symbol;Acc:HGNC:8548])

HSP 1 Score: 96.2857 bits (238), Expect = 1.576e-20
Identity = 111/465 (23.87%), Postives = 185/465 (39.78%), Query Frame = 3
Query:  150 LNISNFQSALDEHKTVIALAYLKDAPEASSAVKLFGKVGNKLKNDNLNMVLAKLKLEYDNNIFSKYNLEGTFGLLALMDHGERFV--EYTQPVNDVDKIVEFIEKKLQEPVTEINDSAKLRSIIENRPCISVGFFNNFTSTDYEEYRSSADWFYECDHYATRDVELFKYFKVNETIPTVKFYKECIHEVFDYPKQLPFDSNNVLKFFLVCMEPDVAEYGMNWLMKRVLKQPQFTLLLFVKKDDPKKENYIDIMKKYARRYREEINMAYIDIDGHEDVKSFLYTFDLSESDVPCLRAIETSNRYANNTRKYKPKRKTINDASVKQFIGDVYYRQLSPYLISEKIPKDWNSQPVVTVVGDNFRNITEDPTKTVLIVFYNDEPKYELFVKEQLKQLAMDFQSKG-----HSDVVIGVSNYYSNEYYGWHPNRFPKMILFPKGKNTFGIEYQMNMTVEDLKAFIESDGK 1523
            L  SNF  AL  HK ++   Y        +    + K   KLK +   + LAK+    ++++  +Y + G +  +    +G+     EYT  V + D   +F++         I+D             I  G  +N  S  + +Y+   D            V LFK F          F  E   E             N+L F      P V E+      K    + +  +LLF+ K     +  +   K  A  ++ +I   +ID D H D +  L  F L + + P +R I           KYKP+ + +    + +F       ++ P+L+S+++P+DW+ QPV  +VG NF ++  D  K V + FY     +        KQLA  +   G     H ++VI   +  +NE      + FP +  FP   +   I+Y    T++  K F+ES G+
Sbjct:   29 LRKSNFAEALAAHKYLLVEFYAPWCGHCKALAPEYAKAAGKLKAEGSEIRLAKVDATEESDLAQQYGVRG-YPTIKFFRNGDTASPKEYTGDV-ESDSAKQFLQ-----AAEAIDD-------------IPFGITSN--SDVFSKYQLDKD-----------GVVLFKKFDEGRN----NFEGEVTKE-------------NLLDFIKHNQLPLVIEFTEQTAPKIFGGEIKTHILLFLPKSVSDYDGKLSNFKTAAESFKGKILFIFIDSD-HTDNQRILEFFGLKKEECPAVRLITLEEEMT----KYKPESEELTAERITEFCHRFLEGKIKPHLMSQELPEDWDKQPVKVLVGKNFEDVAFDEKKNVFVEFYAPWCGH-------CKQLAPIWDKLGETYKDHENIVIAKMDSTANEVEAVKVHSFPTLKFFPASADRTVIDYNGERTLDGFKKFLESGGQ 431          
BLAST of Protein disulfide-isomerase vs. Ensembl Human
Match: P4HB (prolyl 4-hydroxylase subunit beta [Source:HGNC Symbol;Acc:HGNC:8548])

HSP 1 Score: 90.8929 bits (224), Expect = 1.099e-19
Identity = 59/212 (27.83%), Postives = 99/212 (46.70%), Query Frame = 3
Query:  903 KKYARRYREEINMAYIDIDGHEDVKSFLYTFDLSESDVPCLRAIETSNRYANNTRKYKPKRKTINDASVKQFIGDVYYRQLSPYLISEKIPKDWNSQPVVTVVGDNFRNITEDPTKTVLIVFYNDEPKYELFVKEQLKQLAMDFQSKG-----HSDVVIGVSNYYSNEYYGWHPNRFPKMILFPKGKNTFGIEYQMNMTVEDLKAFIESDGK 1523
            K  A  ++ +I   +ID D H D +  L  F L + + P +R I           KYKP+ + +    + +F       ++ P+L+S+++P+DW+ QPV  +VG NF ++  D  K V + FY     +        KQLA  +   G     H ++VI   +  +NE      + FP +  FP   +   I+Y    T++  K F+ES G+
Sbjct:   42 KTAAESFKGKILFIFIDSD-HTDNQRILEFFGLKKEECPAVRLITLEEEMT----KYKPESEELTAERITEFCHRFLEGKIKPHLMSQELPEDWDKQPVKVLVGKNFEDVAFDEKKNVFVEFYAPWCGH-------CKQLAPIWDKLGETYKDHENIVIAKMDSTANEVEAVKVHSFPTLKFFPASADRTVIDYNGERTLDGFKKFLESGGQ 241          
BLAST of Protein disulfide-isomerase vs. Ensembl Celegans
Match: pdi-2 (Protein disulfide-isomerase 2 [Source:UniProtKB/Swiss-Prot;Acc:Q17770])

HSP 1 Score: 98.2117 bits (243), Expect = 1.915e-21
Identity = 101/437 (23.11%), Postives = 189/437 (43.25%), Query Frame = 3
Query:  252 FGKVGNKLKNDNLNMVLAKLKLEYDNNIFSKYNLEGTFGLLALMDHGERFVEYTQPVNDVDKIVEFIEKKLQEPVTEINDSAKLRSIIENRPCISVGFFNNFTSTDYEEYRSSADWFYECD-HYATRDVELFKYFKVNETIPTVKFYKECIHEVFDYPKQLPFD---SNNVLKFFL----VCMEPDVAEYGMNWLMKRVLKQPQFTLLLFVKKDDPKKENYIDIMKKYARRYREEINMAYIDIDGHEDVKSFLYTFDLSESDVPCLRAIETSNRYANNTRKYKPKRKTINDASVKQFIGDVYYRQLSPYLISEKIPKDWNSQPVVTVVGDNFRNITEDPTKTVLIVFYNDEPKYELFVKEQLKQLAMDFQSKGH-----SDVVIGVSNYYSNEYYGWHPNRFPKMILFPKGKNTFGIEYQMNMTVEDLKAFIESDGK 1523
            + K   +LK +  ++ L KL       + SK+ + G +  L L  +G +  EY     D D I+ +++KK       + D+  ++ + E+   + +G+F + TS D + +   A    +     +T D    +     E I   K + +          ++ FD   + + LK ++    + +  +  +   + +    +K      LLFV K+  +        K  A++++ ++   YI+ D  E+ +   + F L + ++P +R I        +  K+KP  + I   ++ +F  +     + P+L+SE IP+DW+  PV  +VG NF  +  D TK VL+ FY     +        KQLA  +   G        +VI   +   NE        FP +  FP G N   ++Y  + T+E    F+E++GK
Sbjct:   62 YAKAATQLKEEGSDIKLGKLDATVHGEVSSKFEVRG-YPTLKLFRNG-KPQEYNGG-RDHDSIIAWLKKKTGPVAKPLADADAVKELQESADVVVIGYFKDTTSDDAKTFLEVAAGIDDVPFGISTEDAVKSEIELKGEGIVLFKKFDDG---------RVAFDEKLTQDGLKTWIQANRLALVSEFTQETASVIFGGEIKSHN---LLFVSKESSEFAKLEQEFKNAAKQFKGKVLFVYINTDVEENARIMEF-FGLKKDELPAIRLI----SLEEDMTKFKPDFEEITTENISKFTQNYLDGSVKPHLMSEDIPEDWDKNPVKILVGKNFEQVARDNTKNVLVEFYAPWCGH-------CKQLAPTWDKLGEKFADDESIVIAKMDSTLNEVEDVKIQSFPTIKFFPAGSNKV-VDYTGDRTIEGFTKFLETNGK 470          
BLAST of Protein disulfide-isomerase vs. Ensembl Celegans
Match: pdi-2 (Protein disulfide-isomerase 2 [Source:UniProtKB/Swiss-Prot;Acc:Q17770])

HSP 1 Score: 98.2117 bits (243), Expect = 1.915e-21
Identity = 101/437 (23.11%), Postives = 189/437 (43.25%), Query Frame = 3
Query:  252 FGKVGNKLKNDNLNMVLAKLKLEYDNNIFSKYNLEGTFGLLALMDHGERFVEYTQPVNDVDKIVEFIEKKLQEPVTEINDSAKLRSIIENRPCISVGFFNNFTSTDYEEYRSSADWFYECD-HYATRDVELFKYFKVNETIPTVKFYKECIHEVFDYPKQLPFD---SNNVLKFFL----VCMEPDVAEYGMNWLMKRVLKQPQFTLLLFVKKDDPKKENYIDIMKKYARRYREEINMAYIDIDGHEDVKSFLYTFDLSESDVPCLRAIETSNRYANNTRKYKPKRKTINDASVKQFIGDVYYRQLSPYLISEKIPKDWNSQPVVTVVGDNFRNITEDPTKTVLIVFYNDEPKYELFVKEQLKQLAMDFQSKGH-----SDVVIGVSNYYSNEYYGWHPNRFPKMILFPKGKNTFGIEYQMNMTVEDLKAFIESDGK 1523
            + K   +LK +  ++ L KL       + SK+ + G +  L L  +G +  EY     D D I+ +++KK       + D+  ++ + E+   + +G+F + TS D + +   A    +     +T D    +     E I   K + +          ++ FD   + + LK ++    + +  +  +   + +    +K      LLFV K+  +        K  A++++ ++   YI+ D  E+ +   + F L + ++P +R I        +  K+KP  + I   ++ +F  +     + P+L+SE IP+DW+  PV  +VG NF  +  D TK VL+ FY     +        KQLA  +   G        +VI   +   NE        FP +  FP G N   ++Y  + T+E    F+E++GK
Sbjct:   62 YAKAATQLKEEGSDIKLGKLDATVHGEVSSKFEVRG-YPTLKLFRNG-KPQEYNGG-RDHDSIIAWLKKKTGPVAKPLADADAVKELQESADVVVIGYFKDTTSDDAKTFLEVAAGIDDVPFGISTEDAVKSEIELKGEGIVLFKKFDDG---------RVAFDEKLTQDGLKTWIQANRLALVSEFTQETASVIFGGEIKSHN---LLFVSKESSEFAKLEQEFKNAAKQFKGKVLFVYINTDVEENARIMEF-FGLKKDELPAIRLI----SLEEDMTKFKPDFEEITTENISKFTQNYLDGSVKPHLMSEDIPEDWDKNPVKILVGKNFEQVARDNTKNVLVEFYAPWCGH-------CKQLAPTWDKLGEKFADDESIVIAKMDSTLNEVEDVKIQSFPTIKFFPAGSNKV-VDYTGDRTIEGFTKFLETNGK 470          
BLAST of Protein disulfide-isomerase vs. Ensembl Celegans
Match: pdi-2 (Protein disulfide-isomerase 2 [Source:UniProtKB/Swiss-Prot;Acc:Q17770])

HSP 1 Score: 91.2781 bits (225), Expect = 2.494e-19
Identity = 64/230 (27.83%), Postives = 107/230 (46.52%), Query Frame = 3
Query:  849 LLFVKKDDPKKENYIDIMKKYARRYREEINMAYIDIDGHEDVKSFLYTFDLSESDVPCLRAIETSNRYANNTRKYKPKRKTINDASVKQFIGDVYYRQLSPYLISEKIPKDWNSQPVVTVVGDNFRNITEDPTKTVLIVFYNDEPKYELFVKEQLKQLAMDFQSKGH-----SDVVIGVSNYYSNEYYGWHPNRFPKMILFPKGKNTFGIEYQMNMTVEDLKAFIESDGK 1523
            LLFV K+  +        K  A++++ ++   YI+ D  E+ +   + F L + ++P +R I        +  K+KP  + I   ++ +F  +     + P+L+SE IP+DW+  PV  +VG NF  +  D TK VL+ FY     +        KQLA  +   G        +VI   +   NE        FP +  FP G N   ++Y  + T+E    F+E++GK
Sbjct:  198 LLFVSKESSEFAKLEQEFKNAAKQFKGKVLFVYINTDVEENARIMEF-FGLKKDELPAIRLI----SLEEDMTKFKPDFEEITTENISKFTQNYLDGSVKPHLMSEDIPEDWDKNPVKILVGKNFEQVARDNTKNVLVEFYAPWCGH-------CKQLAPTWDKLGEKFADDESIVIAKMDSTLNEVEDVKIQSFPTIKFFPAGSNKV-VDYTGDRTIEGFTKFLETNGK 414          
BLAST of Protein disulfide-isomerase vs. Ensembl Celegans
Match: pdi-2 (Protein disulfide-isomerase 2 [Source:UniProtKB/Swiss-Prot;Acc:Q17770])

HSP 1 Score: 91.2781 bits (225), Expect = 2.494e-19
Identity = 64/230 (27.83%), Postives = 107/230 (46.52%), Query Frame = 3
Query:  849 LLFVKKDDPKKENYIDIMKKYARRYREEINMAYIDIDGHEDVKSFLYTFDLSESDVPCLRAIETSNRYANNTRKYKPKRKTINDASVKQFIGDVYYRQLSPYLISEKIPKDWNSQPVVTVVGDNFRNITEDPTKTVLIVFYNDEPKYELFVKEQLKQLAMDFQSKGH-----SDVVIGVSNYYSNEYYGWHPNRFPKMILFPKGKNTFGIEYQMNMTVEDLKAFIESDGK 1523
            LLFV K+  +        K  A++++ ++   YI+ D  E+ +   + F L + ++P +R I        +  K+KP  + I   ++ +F  +     + P+L+SE IP+DW+  PV  +VG NF  +  D TK VL+ FY     +        KQLA  +   G        +VI   +   NE        FP +  FP G N   ++Y  + T+E    F+E++GK
Sbjct:  198 LLFVSKESSEFAKLEQEFKNAAKQFKGKVLFVYINTDVEENARIMEF-FGLKKDELPAIRLI----SLEEDMTKFKPDFEEITTENISKFTQNYLDGSVKPHLMSEDIPEDWDKNPVKILVGKNFEQVARDNTKNVLVEFYAPWCGH-------CKQLAPTWDKLGEKFADDESIVIAKMDSTLNEVEDVKIQSFPTIKFFPAGSNKV-VDYTGDRTIEGFTKFLETNGK 414          
BLAST of Protein disulfide-isomerase vs. Ensembl Celegans
Match: pdi-2 (Protein disulfide-isomerase 2 [Source:UniProtKB/Swiss-Prot;Acc:Q17770])

HSP 1 Score: 80.1073 bits (196), Expect = 5.354e-16
Identity = 57/198 (28.79%), Postives = 90/198 (45.45%), Query Frame = 3
Query:  966 EDVKSFLYT-------FDLSESDVPCLRAIETSNRYANNTRKYKPKRKTINDASVKQFIGDVYYRQLSPYLISEKIPKDWNSQPVVTVVGDNFRNITEDPTKTVLIVFYNDEPKYELFVKEQLKQLAMDFQSKGH-----SDVVIGVSNYYSNEYYGWHPNRFPKMILFPKGKNTFGIEYQMNMTVEDLKAFIESDGK 1523
            +D K+FL         F L + ++P +R I        +  K+KP  + I   ++ +F  +     + P+L+SE IP+DW+  PV  +VG NF  +  D TK VL+ FY     +        KQLA  +   G        +VI   +   NE        FP +  FP G N   ++Y  + T+E    F+E++GK
Sbjct:  163 DDAKTFLEENARIMEFFGLKKDELPAIRLI----SLEEDMTKFKPDFEEITTENISKFTQNYLDGSVKPHLMSEDIPEDWDKNPVKILVGKNFEQVARDNTKNVLVEFYAPWCGH-------CKQLAPTWDKLGEKFADDESIVIAKMDSTLNEVEDVKIQSFPTIKFFPAGSNKV-VDYTGDRTIEGFTKFLETNGK 348          
BLAST of Protein disulfide-isomerase vs. Ensembl Fly
Match: Pdi (gene:FBgn0286818 transcript:FBtr0346644)

HSP 1 Score: 114.39 bits (285), Expect = 1.161e-26
Identity = 102/468 (21.79%), Postives = 211/468 (45.09%), Query Frame = 3
Query:  132 KNGILNLNISNFQSALDEHKTVIALAYLKDAPEASSAVKLFGKVGNKLKNDNLNMVLAKLKLEYDNNIFSKYNLEGTFGLLALMDHGERFVEYTQPVNDVDKIVEFIEKKLQEPVTEINDSAKLRSIIENRPCISVGFFNNFTSTDYEEYRSSADWFYECDHYATRDVELFKYFKVNETIPTVKFYKECIHEVFDYPKQL---PFDSNNVLKFFLVCMEPDVAEYGMNWLMKRVLKQPQFTLLLFVKKDDPKKENYIDIMKKYARRYREEINMAYIDIDGHEDVKSFLYTFDLSESDVPCLRAIETSNRYANNTRKYKPKRKTINDASVKQFIGDVYYRQLSPYLISEKIPKDWNSQPVVTVVGDNFRNITEDPTKTVLIVFYNDEPKYELFVKEQLKQLAMDFQSKGHSDVVIGVSNYYSNEYYGWHPNRFPKMILFPKGKNTFGIEYQMNMTVEDLKAFIESDGKI 1526
            + G+L   + NF+  + +++ V+   Y        +    + K   +L      + LAK+    +  +  +Y + G +  L     G   VEY+      D I+ ++ KK   P  ++   A     +++     +GFF +  S + + +   A+         + + ++   ++  +    V  +K      FD  K +     +  N+ KF  V   P + ++      K      +  LL FV ++    E Y+D +K+ A++YR++I    I  D  +  + F + F +++ +VP +R I+     A    KYKP+   ++  +++ F+      +L  +L+S+++P+DW+  PV  +V  NF ++  D +K+VL+ FY     +   +     QLA  +  K + D+VI   +  +NE      + FP +  F K  N   I++ ++ T++D   F++++G++
Sbjct:   26 EEGVLVATVDNFKQLIADNEFVLVEFYAPWCGHCKALAPEYAKAAQQLAEKESPIKLAKVDATVEGELAEQYAVRG-YPTLKFFRSGSP-VEYSGGRQAAD-IIAWVTKKTGPPAKDLTSVADAEQFLKDNEIAIIGFFKDLESEEAKTFTKVANALDSFVFGVSSNADVIAKYEAKDN--GVVLFKP-----FDDKKSVFEGELNEENLKKFAQVQSLPLIVDFNHESASKIFGGSIKSHLLFFVSREGGHIEKYVDPLKEIAKKYRDDILFVTISSDEEDHTRIFEF-FGMNKEEVPTIRLIKLEEDMA----KYKPESDDLSAETIEAFLKKFLDGKLKQHLLSQELPEDWDKNPVKVLVSSNFESVALDKSKSVLVEFYAPWCGHCKQLAPIYDQLAEKY--KDNEDIVIAKMDSTANELESIKISSFPTIKYFRKEDNKV-IDFNLDRTLDDFVKFLDANGEV 475          
BLAST of Protein disulfide-isomerase vs. Ensembl Fly
Match: Pdi (gene:FBgn0286818 transcript:FBtr0075648)

HSP 1 Score: 114.39 bits (285), Expect = 1.161e-26
Identity = 102/468 (21.79%), Postives = 211/468 (45.09%), Query Frame = 3
Query:  132 KNGILNLNISNFQSALDEHKTVIALAYLKDAPEASSAVKLFGKVGNKLKNDNLNMVLAKLKLEYDNNIFSKYNLEGTFGLLALMDHGERFVEYTQPVNDVDKIVEFIEKKLQEPVTEINDSAKLRSIIENRPCISVGFFNNFTSTDYEEYRSSADWFYECDHYATRDVELFKYFKVNETIPTVKFYKECIHEVFDYPKQL---PFDSNNVLKFFLVCMEPDVAEYGMNWLMKRVLKQPQFTLLLFVKKDDPKKENYIDIMKKYARRYREEINMAYIDIDGHEDVKSFLYTFDLSESDVPCLRAIETSNRYANNTRKYKPKRKTINDASVKQFIGDVYYRQLSPYLISEKIPKDWNSQPVVTVVGDNFRNITEDPTKTVLIVFYNDEPKYELFVKEQLKQLAMDFQSKGHSDVVIGVSNYYSNEYYGWHPNRFPKMILFPKGKNTFGIEYQMNMTVEDLKAFIESDGKI 1526
            + G+L   + NF+  + +++ V+   Y        +    + K   +L      + LAK+    +  +  +Y + G +  L     G   VEY+      D I+ ++ KK   P  ++   A     +++     +GFF +  S + + +   A+         + + ++   ++  +    V  +K      FD  K +     +  N+ KF  V   P + ++      K      +  LL FV ++    E Y+D +K+ A++YR++I    I  D  +  + F + F +++ +VP +R I+     A    KYKP+   ++  +++ F+      +L  +L+S+++P+DW+  PV  +V  NF ++  D +K+VL+ FY     +   +     QLA  +  K + D+VI   +  +NE      + FP +  F K  N   I++ ++ T++D   F++++G++
Sbjct:   26 EEGVLVATVDNFKQLIADNEFVLVEFYAPWCGHCKALAPEYAKAAQQLAEKESPIKLAKVDATVEGELAEQYAVRG-YPTLKFFRSGSP-VEYSGGRQAAD-IIAWVTKKTGPPAKDLTSVADAEQFLKDNEIAIIGFFKDLESEEAKTFTKVANALDSFVFGVSSNADVIAKYEAKDN--GVVLFKP-----FDDKKSVFEGELNEENLKKFAQVQSLPLIVDFNHESASKIFGGSIKSHLLFFVSREGGHIEKYVDPLKEIAKKYRDDILFVTISSDEEDHTRIFEF-FGMNKEEVPTIRLIKLEEDMA----KYKPESDDLSAETIEAFLKKFLDGKLKQHLLSQELPEDWDKNPVKVLVSSNFESVALDKSKSVLVEFYAPWCGHCKQLAPIYDQLAEKY--KDNEDIVIAKMDSTANELESIKISSFPTIKYFRKEDNKV-IDFNLDRTLDDFVKFLDANGEV 475          
BLAST of Protein disulfide-isomerase vs. Ensembl Zebrafish
Match: p4hb (prolyl 4-hydroxylase, beta polypeptide [Source:ZFIN;Acc:ZDB-GENE-080610-1])

HSP 1 Score: 126.716 bits (317), Expect = 1.110e-30
Identity = 116/467 (24.84%), Postives = 202/467 (43.25%), Query Frame = 3
Query:  141 ILNLNISNFQSALDEHKTVIALAYLKDAPEASSAVKLFGKVGNKLKNDNLNMVLAKLKLEYDNNIFSKYNLEGTFGLLALMDHGERF--VEYTQPVNDVDKIVEFIEKKLQEPVTEINDSAKLRSIIENRPCISVGFFNNFTSTDYEEYRSSADWFYECDHYATRDVELFKYFKVNETIPTVKFYKECIHEVFDYPKQLPFDSN----NVLKFFLVCMEPDVAEYGMNWLMKRVLKQPQFTLLLFVKKDDPKKENYIDIMKKYARRYREEINMAYIDIDGHEDVKSFLYTFDLSESDVPCLRAIETSNRYANNTRKYKPKRKTINDASVKQFIGDVYYRQLSPYLISEKIPKDWNSQPVVTVVGDNFRNITEDPTKTVLIVFYNDEPKYELFVKEQLKQLAMDFQSKGHSDVVIGVSNYYSNEYYGWHPNRFPKMILFPKGKNTFGIEYQMNMTVEDLKAFIESDGK 1523
            +L L  SNF+ AL  H  V+   Y        +    + K    LK +  ++ LAK+    ++ +  ++ + G +  +     GE+    EY+      + IV +++K+     T +ND  +  SII +     +GFF +  S D + +  +A+   +     T D  +F  F+V +   +V  +K+     FD  +   FD      ++L F      P V E+      K      +  +L+FV K     ++ +D  KK A  ++ +I   +ID D  +D +  L  F L + + P +R I           KYKP+   I   ++  F        L P+L+S+ IP+DW+  PV  +VG NF  +  +P   V + FY     +   +     QL   F  K ++++V+   +  +NE      + FP +  FP G     I+Y    T++    F+ES GK
Sbjct:   24 VLVLKKSNFEEALKAHPNVLVEFYAPWCGHCKALAPEYSKAAGMLKAEGSDIRLAKVDATEESELAQEFGVRG-YPTIKFFKGGEKGNPKEYSAG-RQAEDIVSWLKKRTGPAATTLNDVMQAESIIADNEVAVIGFFKDVESEDSKAFIKTAEAVDDIPFGITSDDSVFAKFEVAKD--SVVLFKK-----FDEGRNT-FDGEVSKESLLNFIKANQLPLVIEFTEQTAPKIFGGDIKSHILMFVPKAAKDFQDKMDQFKKAAEGFKGKILFIFIDSD-VDDNQRILEFFGLKKEECPVIRLITLEEEMT----KYKPESSEITAENIISFCTSFVEGTLKPHLMSQDIPEDWDKNPVKVLVGKNFEEVAFNPANNVFVEFYAPWCGHCKQLAPIWDQLGEKF--KDNANIVVAKMDSTANEIEAVKVHSFPTLKFFPAGDERKVIDYNGERTLDGFTKFLESGGK 473          
BLAST of Protein disulfide-isomerase vs. Ensembl Zebrafish
Match: p4hb (prolyl 4-hydroxylase, beta polypeptide [Source:ZFIN;Acc:ZDB-GENE-080610-1])

HSP 1 Score: 126.716 bits (317), Expect = 1.110e-30
Identity = 116/467 (24.84%), Postives = 202/467 (43.25%), Query Frame = 3
Query:  141 ILNLNISNFQSALDEHKTVIALAYLKDAPEASSAVKLFGKVGNKLKNDNLNMVLAKLKLEYDNNIFSKYNLEGTFGLLALMDHGERF--VEYTQPVNDVDKIVEFIEKKLQEPVTEINDSAKLRSIIENRPCISVGFFNNFTSTDYEEYRSSADWFYECDHYATRDVELFKYFKVNETIPTVKFYKECIHEVFDYPKQLPFDSN----NVLKFFLVCMEPDVAEYGMNWLMKRVLKQPQFTLLLFVKKDDPKKENYIDIMKKYARRYREEINMAYIDIDGHEDVKSFLYTFDLSESDVPCLRAIETSNRYANNTRKYKPKRKTINDASVKQFIGDVYYRQLSPYLISEKIPKDWNSQPVVTVVGDNFRNITEDPTKTVLIVFYNDEPKYELFVKEQLKQLAMDFQSKGHSDVVIGVSNYYSNEYYGWHPNRFPKMILFPKGKNTFGIEYQMNMTVEDLKAFIESDGK 1523
            +L L  SNF+ AL  H  V+   Y        +    + K    LK +  ++ LAK+    ++ +  ++ + G +  +     GE+    EY+      + IV +++K+     T +ND  +  SII +     +GFF +  S D + +  +A+   +     T D  +F  F+V +   +V  +K+     FD  +   FD      ++L F      P V E+      K      +  +L+FV K     ++ +D  KK A  ++ +I   +ID D  +D +  L  F L + + P +R I           KYKP+   I   ++  F        L P+L+S+ IP+DW+  PV  +VG NF  +  +P   V + FY     +   +     QL   F  K ++++V+   +  +NE      + FP +  FP G     I+Y    T++    F+ES GK
Sbjct:   24 VLVLKKSNFEEALKAHPNVLVEFYAPWCGHCKALAPEYSKAAGMLKAEGSDIRLAKVDATEESELAQEFGVRG-YPTIKFFKGGEKGNPKEYSAG-RQAEDIVSWLKKRTGPAATTLNDVMQAESIIADNEVAVIGFFKDVESEDSKAFIKTAEAVDDIPFGITSDDSVFAKFEVAKD--SVVLFKK-----FDEGRNT-FDGEVSKESLLNFIKANQLPLVIEFTEQTAPKIFGGDIKSHILMFVPKAAKDFQDKMDQFKKAAEGFKGKILFIFIDSD-VDDNQRILEFFGLKKEECPVIRLITLEEEMT----KYKPESSEITAENIISFCTSFVEGTLKPHLMSQDIPEDWDKNPVKVLVGKNFEEVAFNPANNVFVEFYAPWCGHCKQLAPIWDQLGEKF--KDNANIVVAKMDSTANEIEAVKVHSFPTLKFFPAGDERKVIDYNGERTLDGFTKFLESGGK 473          
BLAST of Protein disulfide-isomerase vs. Ensembl Zebrafish
Match: pdia2 (protein disulfide isomerase family A, member 2 [Source:ZFIN;Acc:ZDB-GENE-040426-705])

HSP 1 Score: 110.153 bits (274), Expect = 5.714e-25
Identity = 111/477 (23.27%), Postives = 201/477 (42.14%), Query Frame = 3
Query:  141 ILNLNISNFQSALDEHKTVIALAYLKDAPEASSAVKLFGKVGNKLKNDNLNMVLAKLKLEYDNNIFSKYNLEGTFGLLALMDHGER------FVEYTQPVNDVDKIVEFIEKKLQEPVTEINDSAKLRSIIENRPCISVGFFNNFTSTDYEEYRSSADWFYECDHYATRDVELFKYFKVNETIPTVKFYKECIHEVFDYP--KQLPFDSNNVLKFF----LVCMEPDVAEYGMNWLMKRVLKQPQFTLLLFVKKDDPKKENYIDIMKKYARRYREEINMAYIDIDGHEDVKSFLYTFDLSESDVPCLRAIETSNRYANNTRKYKPKRKTINDASVKQFIGDVYYRQLSPYLISEKIPKDWNSQPVVTVVGDNFRNITEDPTKTVLIVFYNDEPKYELFVKEQLKQLA-----MDFQSKGHSDVVIGVSNYYSNEYYGWHPNRFPKMILFPKGKNTFGIEYQMNMTVEDLKAFIESDG 1520
            +L L+  NF  AL E+K ++   Y        S   ++ +V  +LKN +  + LAK+    +  + S+++++ +F  L     G R      F + T     +  I  ++EK      T +ND     +++E    + VGFF +      + +        + +   T D ELFK ++V     ++  +K+      D P   +   D   ++ F     +  + P   E        +V K     LLLF+      +   ++  ++ A  ++E++    +D+   E V   L  F +SE DVP +R I T +        Y     TIN  +++ F   V+   + PYL S++IP+DW+  PV  +VG NF  +  D +K V + FY     +        +QLA     +  + K   +++I   +   N+        FP +  FP G     ++Y  N  +E    F+++ G
Sbjct:   58 VLILHSVNFDRALSENKYLLVEFYAPWCGHCRSLEPIYAEVAGQLKNASSEVRLAKVDAIEEKELASEFSVD-SFPTLKFFKEGNRQNATTFFGKRT-----LKGIKRWLEKHTAPSATVLNDVKSAEALLEANEVLVVGFFKDLEGEKAKTFYDVTLIAVDVNFGITSDPELFKKYEVK--TDSLVLFKKFDERRADMPLSDETKLDKGEMISFIHSNSMRLVVPFNEENAEQIFNSKVRKH----LLLFLNTTVDSQNALVEEFREVASEFKEKVIFITVDVTA-EKVNHVLKYFSISEDDVPTIRLINTEDVVT-----YAMDGSTINKDTLRTFCQGVFDGTVKPYLKSQEIPEDWDKNPVKVLVGKNFNEVAFDESKNVFVEFYAPWCGH-------CQQLAPVWDELGEKYKDQENIIIAKMDATENDVEDLTIQGFPTIKYFPAGTEKKIVDYDGNRDLETFSKFLDNGG 509          
BLAST of Protein disulfide-isomerase vs. Ensembl Zebrafish
Match: pdia2 (protein disulfide isomerase family A, member 2 [Source:ZFIN;Acc:ZDB-GENE-040426-705])

HSP 1 Score: 109.768 bits (273), Expect = 6.969e-25
Identity = 111/477 (23.27%), Postives = 201/477 (42.14%), Query Frame = 3
Query:  141 ILNLNISNFQSALDEHKTVIALAYLKDAPEASSAVKLFGKVGNKLKNDNLNMVLAKLKLEYDNNIFSKYNLEGTFGLLALMDHGER------FVEYTQPVNDVDKIVEFIEKKLQEPVTEINDSAKLRSIIENRPCISVGFFNNFTSTDYEEYRSSADWFYECDHYATRDVELFKYFKVNETIPTVKFYKECIHEVFDYP--KQLPFDSNNVLKFF----LVCMEPDVAEYGMNWLMKRVLKQPQFTLLLFVKKDDPKKENYIDIMKKYARRYREEINMAYIDIDGHEDVKSFLYTFDLSESDVPCLRAIETSNRYANNTRKYKPKRKTINDASVKQFIGDVYYRQLSPYLISEKIPKDWNSQPVVTVVGDNFRNITEDPTKTVLIVFYNDEPKYELFVKEQLKQLA-----MDFQSKGHSDVVIGVSNYYSNEYYGWHPNRFPKMILFPKGKNTFGIEYQMNMTVEDLKAFIESDG 1520
            +L L+  NF  AL E+K ++   Y        S   ++ +V  +LKN +  + LAK+    +  + S+++++ +F  L     G R      F + T     +  I  ++EK      T +ND     +++E    + VGFF +      + +        + +   T D ELFK ++V     ++  +K+      D P   +   D   ++ F     +  + P   E        +V K     LLLF+      +   ++  ++ A  ++E++    +D+   E V   L  F +SE DVP +R I T +        Y     TIN  +++ F   V+   + PYL S++IP+DW+  PV  +VG NF  +  D +K V + FY     +        +QLA     +  + K   +++I   +   N+        FP +  FP G     ++Y  N  +E    F+++ G
Sbjct:   58 VLILHSVNFDRALSENKYLLVEFYAPWCGHCRSLEPIYAEVAGQLKNASSEVRLAKVDAIEEKELASEFSVD-SFPTLKFFKEGNRQNATTFFGKRT-----LKGIKRWLEKHTAPSATVLNDVKSAEALLEANEVLVVGFFKDLEGEKAKTFYDVTLIAVDVNFGITSDPELFKKYEVK--TDSLVLFKKFDERRADMPLSDETKLDKGEMISFIHSNSMRLVVPFNEENAEQIFNSKVRKH----LLLFLNTTVDSQNALVEEFREVASEFKEKVIFITVDVTA-EKVNHVLKYFSISEDDVPTIRLINTEDVVT-----YAMDGSTINKDTLRTFCQGVFDGTVKPYLKSQEIPEDWDKNPVKVLVGKNFNEVAFDESKNVFVEFYAPWCGH-------CQQLAPVWDELGEKYKDQENIIIAKMDATENDVEDLTIQGFPTIKYFPAGTEKKIVDYDGNRDLETFSKFLDNGG 509          
BLAST of Protein disulfide-isomerase vs. Ensembl Zebrafish
Match: zgc:136472 (zgc:136472 [Source:ZFIN;Acc:ZDB-GENE-060421-2552])

HSP 1 Score: 74.7146 bits (182), Expect = 1.225e-13
Identity = 89/473 (18.82%), Postives = 201/473 (42.49%), Query Frame = 3
Query:   51 MIFALTIFFILTSFHHRFVSGDPFE--IDKNGILNLNISNFQSALDEHKTVIALAYLKDAPEASSAVKLFGKVGNKLKNDNLNMVLAKLKLEYDNNIFSKYNLEGTFGLLALMDHGERFVEYTQPVNDVDKIVEFIEKKLQEPVTEINDSAKLRSIIENRPCISVGFFNNFTSTDYEEYRSSADWFYECDHYATRDVELFKYFKVN-ETIPTVKFYKECIHEVFDYPKQLPFDSNNV---LKFFLVCMEPD-VAEYGMNWLMKRVLKQPQFTLLLFVKKDDPKKENYIDIMKKYARRYREEINMAYIDIDGHEDVKSFLYTFDLSESDVPCLRAIETSNRYANNTRKYKPKRKTINDASVKQFIGDVYYRQLSPYLISEKIPKDWNSQPVVTVVGDNFRNITEDPTKTVLIVFY---NDEPKYELFVKEQLKQLAMDFQSKGHSDVVIGVSNYYSNEYYGWHPNRFPKMILFP 1439
            M   +T+  I+  F H+ ++G   +  ++   +L L  SNF  AL +H+ ++   Y   + ++  ++  F +    LK  + ++ L  + ++ +  +    N+     +   +   +    Y   +     I+ +++++       I++  +L + +     + +G F +      + +  +A    +     TR  E+F  F+++ +++  ++  K          +Q   +S+ V   L  F+   E + V EY      K +       LLLF+ K +   E   +  +  A ++R ++    ID+    + +   Y F +   + P +R +  SN       +Y+      +  ++ +F  +    ++ P + SE +P +W++QPV  +VG NF  +  +    V+++FY   N E +    + E+L       Q     DVV+   +  +N+ +     ++P + LFP
Sbjct:    1 MKVEVTLCLIVCLFLHQTLAGSQSDSIVEDKDVLVLTKSNFHRALKQHEQLLVHFYAPLSGQSLGSILEFREAAGALKEADSDVKLGGVDVKKEKELAESLNITTLPSIRLYLSGDKNNPVYCPVLKSSASILTWLKRRAGPSADIISNVTQLENFLRREELVVLGLFKDLEEGAVKVFYETAADVADLPFGVTRHHEVFSKFEISRDSVLLIRKSK--------LDQQFEMESSTVKTDLVHFIRLYEMELVTEYNGVTASKILNSVILNHLLLFISKTEGGFEEIYNAYETTAEKFRGKVLFVLIDVSELRNGRMMEY-FHVRSEEAPQVRMVNLSNNL-----QYQLPSDQFDTHTLMEFCLNYLDGKVKPKMQSEPVPANWDTQPVKELVGMNFEKVAFNHNNNVIVLFYAPWNSECRALFPLWEELADHFSQTQ-----DVVVAKIDITANDIHLHLGEKYPSIKLFP 454          
BLAST of Protein disulfide-isomerase vs. Ensembl Xenopus
Match: dmd.2 (dystrophin, gene 2 [Source:Xenbase;Acc:XB-GENE-852843])

HSP 1 Score: 134.035 bits (336), Expect = 6.952e-33
Identity = 121/468 (25.85%), Postives = 204/468 (43.59%), Query Frame = 3
Query:  126 IDKNGILNLNISNFQSALDEHKTVIALAYLKDAPEASSAVKLFGKVGNKLKNDNLNMVLAKLKLEYDNNIFSKYNLEGTFGLLALMDHGER--FVEYTQPVNDVDKIVEFIEKKLQEPVTEINDSAKLRSIIENRPCISVGFFNNFTSTDYEEYRSSADWFYECDHYATRDVELFKYFKVNETIPTVKFYKECIHEV-FDYPKQLPFDSNNVLKFFLVCMEPDVAEYGMNWLMKRVLKQPQFTLLLFVKKDDPKKENYIDIMKKYARRYREEINMAYIDIDGHEDVKSFLYTFDLSESDVPCLRAIETSNRYANNTRKYKPKRKTINDASVKQFIGDVYYRQLSPYLISEKIPKDWNSQPVVTVVGDNFRNITEDPTKTVLIVFYNDEPKYELFVKEQLKQLAMDFQSKGHSDVVIGVSNYYSNEYYGWHPNRFPKMILFPKGKNTFGIEYQMNMTVEDLKAFIESDG 1520
            ++++ +L LN  NF  AL+ +K ++   Y             + K    LK+ +  + LAK+    ++ +  ++N+ G +  L     G R   ++Y     D D +V+++ ++L      ++          ++    +GFF N    D + +  +A+   +       D +LF+ F V E   TV F+K    +  F   + L  D + + KF  +     V EY      K    Q    LLLF+ K +  +   ++  +K A  ++ +I   +ID DG     S L  F L  SDVP LR I        + +KY      I + +++ F   V    +   L+SE+IP DW+  PV  +VG NF  +  D +K+V + FY     +   ++   ++L   +  K H  V+I   +  +NE  G     FP +  FP G     IEY    TVE   AFI+S G
Sbjct:   43 LEEDNVLVLNKKNFDKALETYKYLLVEFYAPWCGHCQELAPKYAKAAEILKDKSEEVRLAKVDATVESELSMEFNVNG-YPTLKFFKGGNRTGHIDYGGK-RDQDGLVKWMLRRLGPAAIVLDKVESAEKFTSSQESPVIGFFKNPEDADIKIFYEAAELNEDFTFALAHDAKLFEKFGVTED--TVIFFKNSEEKPEFKVDEDLGLDKDELSKFLKINNIDLVTEYSAETSDKIFAAQIPNHLLLFINKTEDSQLALLEHFRKAATHFKGKILFVFIDSDG--GFSSVLEYFGLKSSDVPTLRFINL-----ESVKKYAFDAPEITEDTIQTFCRTVLEGNVKQNLMSEEIPADWDKNPVKVLVGKNFEEVAYDESKSVFVEFYAPWCSHCKELEPVWEELGEKY--KDHESVIIAKMDATANEIDGLRVRGFPNLRFFPAGPGRKMIEYTKERTVELFSAFIDSGG 497          
BLAST of Protein disulfide-isomerase vs. Ensembl Xenopus
Match: dmd.2 (dystrophin, gene 2 [Source:Xenbase;Acc:XB-GENE-852843])

HSP 1 Score: 133.65 bits (335), Expect = 9.645e-33
Identity = 121/468 (25.85%), Postives = 204/468 (43.59%), Query Frame = 3
Query:  126 IDKNGILNLNISNFQSALDEHKTVIALAYLKDAPEASSAVKLFGKVGNKLKNDNLNMVLAKLKLEYDNNIFSKYNLEGTFGLLALMDHGER--FVEYTQPVNDVDKIVEFIEKKLQEPVTEINDSAKLRSIIENRPCISVGFFNNFTSTDYEEYRSSADWFYECDHYATRDVELFKYFKVNETIPTVKFYKECIHEV-FDYPKQLPFDSNNVLKFFLVCMEPDVAEYGMNWLMKRVLKQPQFTLLLFVKKDDPKKENYIDIMKKYARRYREEINMAYIDIDGHEDVKSFLYTFDLSESDVPCLRAIETSNRYANNTRKYKPKRKTINDASVKQFIGDVYYRQLSPYLISEKIPKDWNSQPVVTVVGDNFRNITEDPTKTVLIVFYNDEPKYELFVKEQLKQLAMDFQSKGHSDVVIGVSNYYSNEYYGWHPNRFPKMILFPKGKNTFGIEYQMNMTVEDLKAFIESDG 1520
            ++++ +L LN  NF  AL+ +K ++   Y             + K    LK+ +  + LAK+    ++ +  ++N+ G +  L     G R   ++Y     D D +V+++ ++L      ++          ++    +GFF N    D + +  +A+   +       D +LF+ F V E   TV F+K    +  F   + L  D + + KF  +     V EY      K    Q    LLLF+ K +  +   ++  +K A  ++ +I   +ID DG     S L  F L  SDVP LR I        + +KY      I + +++ F   V    +   L+SE+IP DW+  PV  +VG NF  +  D +K+V + FY     +   ++   ++L   +  K H  V+I   +  +NE  G     FP +  FP G     IEY    TVE   AFI+S G
Sbjct:   43 LEEDNVLVLNKKNFDKALETYKYLLVEFYAPWCGHCQELAPKYAKAAEILKDKSEEVRLAKVDATVESELSMEFNVNG-YPTLKFFKGGNRTGHIDYGGK-RDQDGLVKWMLRRLGPAAIVLDKVESAEKFTSSQESPVIGFFKNPEDADIKIFYEAAELNEDFTFALAHDAKLFEKFGVTED--TVIFFKNSEEKPEFKVDEDLGLDKDELSKFLKINNIDLVTEYSAETSDKIFAAQIPNHLLLFINKTEDSQLALLEHFRKAATHFKGKILFVFIDSDGG--FSSVLEYFGLKSSDVPTLRFINL-----ESVKKYAFDAPEITEDTIQTFCRTVLEGNVKQNLMSEEIPADWDKNPVKVLVGKNFEEVAYDESKSVFVEFYAPWCSHCKELEPVWEELGEKY--KDHESVIIAKMDATANEIDGLRVRGFPNLRFFPAGPGRKMIEYTKERTVELFSAFIDSGG 497          
BLAST of Protein disulfide-isomerase vs. Ensembl Xenopus
Match: dmd.2 (dystrophin, gene 2 [Source:Xenbase;Acc:XB-GENE-852843])

HSP 1 Score: 133.65 bits (335), Expect = 1.046e-32
Identity = 121/468 (25.85%), Postives = 204/468 (43.59%), Query Frame = 3
Query:  126 IDKNGILNLNISNFQSALDEHKTVIALAYLKDAPEASSAVKLFGKVGNKLKNDNLNMVLAKLKLEYDNNIFSKYNLEGTFGLLALMDHGER--FVEYTQPVNDVDKIVEFIEKKLQEPVTEINDSAKLRSIIENRPCISVGFFNNFTSTDYEEYRSSADWFYECDHYATRDVELFKYFKVNETIPTVKFYKECIHEV-FDYPKQLPFDSNNVLKFFLVCMEPDVAEYGMNWLMKRVLKQPQFTLLLFVKKDDPKKENYIDIMKKYARRYREEINMAYIDIDGHEDVKSFLYTFDLSESDVPCLRAIETSNRYANNTRKYKPKRKTINDASVKQFIGDVYYRQLSPYLISEKIPKDWNSQPVVTVVGDNFRNITEDPTKTVLIVFYNDEPKYELFVKEQLKQLAMDFQSKGHSDVVIGVSNYYSNEYYGWHPNRFPKMILFPKGKNTFGIEYQMNMTVEDLKAFIESDG 1520
            ++++ +L LN  NF  AL+ +K ++   Y             + K    LK+ +  + LAK+    ++ +  ++N+ G +  L     G R   ++Y     D D +V+++ ++L      ++          ++    +GFF N    D + +  +A+   +       D +LF+ F V E   TV F+K    +  F   + L  D + + KF  +     V EY      K    Q    LLLF+ K +  +   ++  +K A  ++ +I   +ID DG     S L  F L  SDVP LR I        + +KY      I + +++ F   V    +   L+SE+IP DW+  PV  +VG NF  +  D +K+V + FY     +   ++   ++L   +  K H  V+I   +  +NE  G     FP +  FP G     IEY    TVE   AFI+S G
Sbjct:   43 LEEDNVLVLNKKNFDKALETYKYLLVEFYAPWCGHCQELAPKYAKAAEILKDKSEEVRLAKVDATVESELSMEFNVNG-YPTLKFFKGGNRTGHIDYGGK-RDQDGLVKWMLRRLGPAAIVLDKVESAEKFTSSQESPVIGFFKNPEDADIKIFYEAAELNEDFTFALAHDAKLFEKFGVTED--TVIFFKNSEEKPEFKVDEDLGLDKDELSKFLKINNIDLVTEYSAETSDKIFAAQIPNHLLLFINKTEDSQLALLEHFRKAATHFKGKILFVFIDSDG--GFSSVLEYFGLKSSDVPTLRFINL-----ESVKKYAFDAPEITEDTIQTFCRTVLEGNVKQNLMSEEIPADWDKNPVKVLVGKNFEEVAYDESKSVFVEFYAPWCSHCKELEPVWEELGEKY--KDHESVIIAKMDATANEIDGLRVRGFPNLRFFPAGPGRKMIEYTKERTVELFSAFIDSGG 497          
BLAST of Protein disulfide-isomerase vs. Ensembl Xenopus
Match: p4hb (prolyl 4-hydroxylase subunit beta [Source:NCBI gene;Acc:395048])

HSP 1 Score: 102.064 bits (253), Expect = 2.655e-22
Identity = 102/481 (21.21%), Postives = 202/481 (42.00%), Query Frame = 3
Query:  102 FVSGDPFEIDKNGILNLNISNFQSALDEHKTVIALAYLKDAPEASSAVKLFGKVGNKLKNDNLNMVLAKLKLEYDNNIFSKYNLEGTFGLLALMDHGERFV--EYTQPVNDVDKIVEFIEKKLQEPVTEINDSAKLRSIIENRPCISVGFFNNFTSTDYEEYRSSADWFYECDHYATRDVELFKYFKVNETIPTVKFYKECIHEVFDYPKQLPFDSNNVLKFFLVCMEPDVAEYGMNWLMKRVLKQPQFTLLLFVKKDDPKKENYIDIMKKYARRYREEINMAYIDIDGHEDVKSFLYTFDLSESDVPCLRAIETSNRYANNTRKYKPKRKTINDASVKQFIGDVYYRQLSPYLISEKIPKDWNSQPVVTVVGDNFRNITEDPTKTVLIVFYNDEPKYELFVKEQLKQLA-----MDFQSKGHSDVVIGVSNYYSNEYYGWHPNRFPKMILFPKGKNTFGIEYQMNMTVEDLKAFIESDGK 1523
            F++  P E D   +L L   NF  AL ++  ++   Y        +    + K    LK++ L + L K+    ++++  ++ + G +  +    +G++    EY+      D IV +++K+     + + D A + +++++     +GFF +  S   + +  +A+   +     T     F  +++ +    +  +K+       Y   +      VL F      P V E+           + +  +L F+ K     +  ++  KK A  ++ +I   +ID D H D +  L  F L + + P +R I           KYKP+   ++  ++K+F       ++ P+L+S+ +  DW+  PV  +VG NF  +  +  K V + FY     +        KQLA     +  + K H +++I   +  +NE      + FP +  FP G      +Y    T+E    F+ES G+
Sbjct:    6 FLANIPEERD---VLVLKKDNFDEALKQYPFILVEFYAPWCGHCKALAPEYEKAAGVLKSEGLPIRLGKVDATEESDLAQEFGVRG-YPTIKFFKNGDKASPKEYSAGREAAD-IVNWLKKRTGPAASTLGDEAGVAALVDSSEVAVIGFFKDPASEPAKVFLQAAEAVDDIPFGITSSEAAFSKYELGKD--GIVLFKKFDEGRNAYEGDI--TKEEVLSFIKANRLPLVIEFTEQTAPMIFGGEIKTHILFFLPKSASDYKEKLEDFKKAAASFKGKILFIFIDSD-HTDNQRILEFFGLKKEECPAVRLITLEEEMT----KYKPESADLSAEAIKEFCDSFLEGKVKPHLMSQDVSDDWDKNPVKILVGKNFEEVVFNEEKNVFVEFYAPWCGH-------CKQLAPIWDQLGEKYKDHENIIIAKMDSTANEIEAVKIHSFPTLKFFPAGPGKNVADYNGERTLEGFSKFLESGGQ 465          
BLAST of Protein disulfide-isomerase vs. Ensembl Xenopus
Match: p4hb (prolyl 4-hydroxylase subunit beta [Source:NCBI gene;Acc:395048])

HSP 1 Score: 101.679 bits (252), Expect = 3.399e-22
Identity = 101/471 (21.44%), Postives = 197/471 (41.83%), Query Frame = 3
Query:  141 ILNLNISNFQSALDEHKTVIALAYLKDAPEASSAVKLFGKVGNKLKNDNLNMVLAKLKLEYDNNIFSKYNLEGTFGLLALMDHGERFV--EYTQPVNDVDKIVEFIEKKLQEPVTEINDSAKLRSIIENRPCISVGFFNNFTSTDYEEYRSSADWFYECDHYATRDVELFKYFKVNETIPTVKFYKECIHEVFDYPK---QLPFDSNNVLKFFLVCMEPDVAEYGMNWLMKRVLKQPQFTLLLFVKKDDPKKENYIDIMKKYARRYREEINMAYIDIDGHEDVKSFLYTFDLSESDVPCLRAIETSNRYANNTRKYKPKRKTINDASVKQFIGDVYYRQLSPYLISEKIPKDWNSQPVVTVVGDNFRNITEDPTKTVLIVFYNDEPKYELFVKEQLKQLA-----MDFQSKGHSDVVIGVSNYYSNEYYGWHPNRFPKMILFPKGKNTFGIEYQMNMTVEDLKAFIESDGK 1523
            +L L   NF  AL ++  ++   Y        +    + K    LK++ L + L K+    ++++  ++ + G +  +    +G++    EY+      D IV +++K+     + + D A + +++++     +GFF +  S   + +  +A+   +     T     F  +++ +    V F K      FD  +   +       VL F      P V E+           + +  +L F+ K     +  ++  KK A  ++ +I   +ID D H D +  L  F L + + P +R I           KYKP+   ++  ++K+F       ++ P+L+S+ +  DW+  PV  +VG NF  +  +  K V + FY     +        KQLA     +  + K H +++I   +  +NE      + FP +  FP G      +Y    T+E    F+ES G+
Sbjct:   43 VLVLKKDNFDEALKQYPFILVEFYAPWCGHCKALAPEYEKAAGVLKSEGLPIRLGKVDATEESDLAQEFGVRG-YPTIKFFKNGDKASPKEYSAGREAAD-IVNWLKKRTGPAASTLGDEAGVAALVDSSEVAVIGFFKDPASEPAKVFLQAAEAVDDIPFGITSSEAAFSKYELGKD-GIVLFKK------FDEGRNAYEGDITKEEVLSFIKANRLPLVIEFTEQTAPMIFGGEIKTHILFFLPKSASDYKEKLEDFKKAAASFKGKILFIFIDSD-HTDNQRILEFFGLKKEECPAVRLITLEEEMT----KYKPESADLSAEAIKEFCDSFLEGKVKPHLMSQDVSDDWDKNPVKILVGKNFEEVVFNEEKNVFVEFYAPWCGH-------CKQLAPIWDQLGEKYKDHENIIIAKMDSTANEIEAVKIHSFPTLKFFPAGPGKNVADYNGERTLEGFSKFLESGGQ 492          
BLAST of Protein disulfide-isomerase vs. Ensembl Mouse
Match: P4hb (prolyl 4-hydroxylase, beta polypeptide [Source:MGI Symbol;Acc:MGI:97464])

HSP 1 Score: 118.627 bits (296), Expect = 6.392e-28
Identity = 112/480 (23.33%), Postives = 213/480 (44.38%), Query Frame = 3
Query:  105 VSGDPFEIDKNGILNLNISNFQSALDEHKTVIALAYLKDAPEASSAVKLFGKVGNKLKNDNLNMVLAKLKLEYDNNIFSKYNLEGTFGLLALMDHGERFV--EYTQPVNDVDKIVEFIEKKLQEPVTEINDSAKLRSIIENRPCISVGFFNNFTSTDYEEYRSSADWFYECDHYATRDVELFKYFKVNETIPTVKFYKECIHEVFDYPKQLPFDSNNVLKFFLVCMEPDVAEYGMNWLMKRVLKQPQFTLLLFVKKDDPKKENYIDIMKKYARRYREEINMAYIDIDGHEDVKSFLYTFDLSESDVPCLRAIETSNRYANNTRKYKPKRKTINDASVKQFIGDVYYRQLSPYLISEKIPKDWNSQPVVTVVGDNFRNITEDPTKTVLIVFYNDEPKYELFVKEQLKQLAMDFQSKG-----HSDVVIGVSNYYSNEYYGWHPNRFPKMILFPKGKNTFGIEYQMNMTVEDLKAFIESDGK 1523
            V  D  E + N +L L  SNF+ AL  HK ++   Y        +    + K   KLK +   + LAK+    ++++  +Y + G +  +    +G+     EYT    + D IV +++K+     T ++D+A   S++++     +GFF +  S   +++  +A+   +     T +  +F  +++++    V  +K+      ++  ++      +L F      P V E+      K    + +  +LLF+ K     +  +   K+ A  ++ +I   +ID D H D +  L  F L + + P +R I           KYKP+   +    + +F       ++ P+L+S+++P+DW+ QPV  +VG NF  +  D  K V + FY     +        KQLA  +   G     H +++I   +  +NE      + FP +  FP   +   I+Y    T++  K F+ES G+
Sbjct:   17 VGADALEEEDN-VLVLKKSNFEEALAAHKYLLVEFYAPWCGHCKALAPEYAKAAAKLKAEGSEIRLAKVDATEESDLAQQYGVRG-YPTIKFFKNGDTASPKEYTAG-READDIVNWLKKRTGPAATTLSDTAAAESLVDSSEVTVIGFFKDVESDSAKQFLLAAEAIDDIPFGITSNSGVFSKYQLDKD--GVVLFKKFDEGRNNFEGEIT--KEKLLDFIKHNQLPLVIEFTEQTAPKIFGGEIKTHILLFLPKSVSDYDGKLSSFKRAAEGFKGKILFIFIDSD-HTDNQRILEFFGLKKEECPAVRLITLEEEMT----KYKPESDELTAEKITEFCHRFLEGKIKPHLMSQEVPEDWDKQPVKVLVGANFEEVAFDEKKNVFVEFYAPWCGH-------CKQLAPIWDKLGETYKDHENIIIAKMDSTANEVEAVKVHSFPTLKFFPASADRTVIDYNGERTLDGFKKFLESGGQ 477          
BLAST of Protein disulfide-isomerase vs. Ensembl Mouse
Match: Pdia2 (protein disulfide isomerase associated 2 [Source:MGI Symbol;Acc:MGI:1916441])

HSP 1 Score: 118.242 bits (295), Expect = 1.142e-27
Identity = 114/486 (23.46%), Postives = 204/486 (41.98%), Query Frame = 3
Query:  132 KNGILNLNISNFQSALDEHKTVIALAYLKDAPEASSAVKLFGKVGNKLKNDNLNMVLAKLKLEYDNNIFSKYNLEGTFGLLALMDHGERF--VEYTQPVNDVDKIVEFIEKKLQEPVTEINDSAKLRSIIENRPCISVGFFNNFTSTDYEEYRSSADWFYECDHYATRDVELFKYFKVNETIPTVKFYKECIHEVFDYP--KQLPFDSNNVLKFFLVCMEPDVAEYGMNWLMKRVLKQPQFTLLLFVKKDDPKKENYIDIMKKYARRYREEINMAYIDIDGHEDVKSFLYTFDLSESDVPCLRAIETSNRYANNTRKYKPKRK-TINDASVKQFIGDVYYRQLSPYLISEKIPKDWNSQPVVTVVGDNFRNITEDPTKTVLIVFYNDEPKYELFVKEQLKQLAMDFQSKGHSDVVIGVSNYYSNEYYGWHPNRFPKMILFPKGKNTFGIEYQMNMTVEDLKAFIESDGKINQIARFSSEINEPATS 1574
            ++GIL LN      AL EH  ++   Y             + K    L  ++  + LAK+    +  +  ++ + G +  L    +G R    EY  P    + I E++ +++    T + D   +++++     + +GFF +    D   + + A    +     T   +LF+ F +  T  TV  +K+      D+P  K+   D  ++ +F ++     V E+      K    +    LLLFV +   +    +   ++ A  +R ++    +D+    D    L  F L   + P LR I         T+KY P     I  ASV  F   V + ++  YL+S++IP DW+  PV T+V  NF  +  D TK V + FY     +   +    + LA  ++ +   D+VI   +  +NE   +    +P +  FP G +   I+Y+    +E    F++S G + +      E  EPA S
Sbjct:   44 EDGILVLNHRTLSLALQEHSALMVEFYAPWCGHCKELAPEYSKAAALLAAESAVVTLAKVDGPAEPELTKEFEVVG-YPTLKFFQNGNRTNPEEYAGP-KTAEGIAEWLRRRVGPSATHLEDEEGVQALMAKWDMVVIGFFQDLQGKDMATFLALAKDALDMTFGFTDQPQLFEKFGL--TKDTVVLFKKFDEGRADFPVDKETGLDLGDLSRFLVIHSMHLVTEFNSQTSPKIFAAKILNHLLLFVNQTLAQHRELLTDFREAAPPFRGQVLFVMVDVAA--DNSHVLNYFGLKAEEAPTLRLINV-----ETTKKYAPTGVIAITAASVAAFCQAVLHGEIKHYLLSQEIPPDWDQGPVKTLVSKNFEQVAFDETKNVFVKFYAPWCSHCKEMAPAWEALAEKYKDR--EDIVIAELDATANELEAFSVLGYPTLKFFPAGPDRKVIDYKSTRDLETFSKFLDSGGHLPK-----EEPKEPAAS 511          
BLAST of Protein disulfide-isomerase vs. Ensembl Mouse
Match: Pdia2 (protein disulfide isomerase associated 2 [Source:MGI Symbol;Acc:MGI:1916441])

HSP 1 Score: 112.849 bits (281), Expect = 6.733e-26
Identity = 114/486 (23.46%), Postives = 203/486 (41.77%), Query Frame = 3
Query:  132 KNGILNLNISNFQSALDEHKTVIALAYLKDAPEASSAVKLFGKVGNKLKNDNLNMVLAKLKLEYDNNIFSKYNLEGTFGLLALMDHGERF--VEYTQPVNDVDKIVEFIEKKLQEPVTEINDSAKLRSIIENRPCISVGFFNNFTSTDYEEYRSSADWFYECDHYATRDVELFKYFKVNETIPTVKFYKECIHEVFDYP--KQLPFDSNNVLKFFLVCMEPDVAEYGMNWLMKRVLKQPQFTLLLFVKKDDPKKENYIDIMKKYARRYREEINMAYIDIDGHEDVKSFLYTFDLSESDVPCLRAIETSNRYANNTRKYKPKRK-TINDASVKQFIGDVYYRQLSPYLISEKIPKDWNSQPVVTVVGDNFRNITEDPTKTVLIVFYNDEPKYELFVKEQLKQLAMDFQSKGHSDVVIGVSNYYSNEYYGWHPNRFPKMILFPKGKNTFGIEYQMNMTVEDLKAFIESDGKINQIARFSSEINEPATS 1574
            ++GIL LN      AL EH  ++   Y             + K    L  ++  + LAK+    +  +  ++ + G +  L    +G R    EY  P    + I E++ +++    T + D   +++++     + +GFF      D   + + A    +     T   +LF+ F +  T  TV  +K+      D+P  K+   D  ++ +F ++     V E+      K    +    LLLFV +   +    +   ++ A  +R ++    +D+    D    L  F L   + P LR I         T+KY P     I  ASV  F   V + ++  YL+S++IP DW+  PV T+V  NF  +  D TK V + FY     +   +    + LA  ++ +   D+VI   +  +NE   +    +P +  FP G +   I+Y+    +E    F++S G + +      E  EPA S
Sbjct:   44 EDGILVLNHRTLSLALQEHSALMVEFYAPWCGHCKELAPEYSKAAALLAAESAVVTLAKVDGPAEPELTKEFEVVG-YPTLKFFQNGNRTNPEEYAGP-KTAEGIAEWLRRRVGPSATHLEDEEGVQALMAKWDMVVIGFFQG---KDMATFLALAKDALDMTFGFTDQPQLFEKFGL--TKDTVVLFKKFDEGRADFPVDKETGLDLGDLSRFLVIHSMHLVTEFNSQTSPKIFAAKILNHLLLFVNQTLAQHRELLTDFREAAPPFRGQVLFVMVDVAA--DNSHVLNYFGLKAEEAPTLRLINV-----ETTKKYAPTGVIAITAASVAAFCQAVLHGEIKHYLLSQEIPPDWDQGPVKTLVSKNFEQVAFDETKNVFVKFYAPWCSHCKEMAPAWEALAEKYKDR--EDIVIAELDATANELEAFSVLGYPTLKFFPAGPDRKVIDYKSTRDLETFSKFLDSGGHLPK-----EEPKEPAAS 508          
BLAST of Protein disulfide-isomerase vs. Ensembl Mouse
Match: Pdilt (protein disulfide isomerase-like, testis expressed [Source:MGI Symbol;Acc:MGI:1919080])

HSP 1 Score: 77.411 bits (189), Expect = 1.948e-14
Identity = 106/454 (23.35%), Postives = 197/454 (43.39%), Query Frame = 3
Query:  216 KDAPEASSAVKLFGKVGNKLKNDNLNMVL-AKLKLEYDNNIFSKYNLEGTFGLLALMDHGERFVEYT-QPVNDVDKIVEFIEKKLQEPVTEINDSAKLRSIIENRPCISVGFFNNFTSTDYEEYRSSADWFYECDHYATRDVELFKYFKVNETIPTVKFYKECIHEVFDYPKQLPFDSNN----------VLKFFLVCMEPDVAE--YGMNWLMKRVLKQPQFTLLLFVKKDDPKKENYIDIMKKY---ARRYREEINMAYIDIDGHEDVKSFLYTFDLSESDVPCLRAIETSNRYANNTRKYKPKRKTINDASVKQFIGDVYYRQLSPYLISEKIPKDWNSQPVVTVVGDNFRNITEDPTKTVLIVFYNDEPKYELFVKEQLKQLAMDFQSKGHSDVVIGVSNYYSNEYYGWHPNRFPKMILFPKGKNTFGIEYQMNMTVEDLKAFIESDGKI 1526
            K A E   A ++FGK  N L    +++    +L+ E+D     +         L L   G R    + + V +   +V ++ +++ +     N+S ++   +++RP + VGFF +      E +  +   F E    A +    F  F V   + +V  +K+         ++L  DS N           L  F++ + P+  +  Y +N L           +LLF+ K     E Y  I + Y   A+ ++ +I    ++ D  ++ + F Y F +S  +VP ++ +  S     +  +YK     IN  S+K+F      +    +  SE+IPK W+  PV  +VG NF  +  D  K V ++FY    +    +   L++L + +Q+  HS V+I   +  +N+    +P ++P   LFP       + Y+   T++    F+ES  K+
Sbjct:   74 KLAKELGKAAEIFGKGKNGLGFGKVDITKETELQQEFDITHAPE---------LKLFFEGNRLKPISCKDVVESTALVVWLRRQISKKALLFNNSDEVADFVKSRPLVIVGFFQDLEEEVAELFYDTIKDFPELTFGAIQIKNSFGRFHV--ILDSVLVFKKG---KIVKRQELINDSTNKDHLNQVIKQQLTGFVIELNPENKDLIYELNILNH---------MLLFISKSS---EPYSTISRHYRQIAKEFQNKILFVLVNADEPKNKRIFEY-FQISRVNVPSVQILNLS-----SDGRYKMPTDDINFESLKKFCNSFLSKTAKKHKASEEIPKYWDQGPVKKLVGKNFNVVVLDKEKDVFVMFYAPWSEKCRVLLPLLEELGIKYQN--HSTVIIAKIDITANDIQLANPEQYPFFRLFPTDSQE-AVMYKGEHTMKGFCDFLESHVKV 492          
BLAST of Protein disulfide-isomerase vs. Ensembl Mouse
Match: Pdia2 (protein disulfide isomerase associated 2 [Source:MGI Symbol;Acc:MGI:1916441])

HSP 1 Score: 56.9954 bits (136), Expect = 3.364e-9
Identity = 39/136 (28.68%), Postives = 62/136 (45.59%), Query Frame = 3
Query: 1167 KIPKDWNSQPVVTVVGDNFRNITEDPTKTVLIVFYNDEPKYELFVKEQLKQLAMDFQSKGHSDVVIGVSNYYSNEYYGWHPNRFPKMILFPKGKNTFGIEYQMNMTVEDLKAFIESDGKINQIARFSSEINEPATS 1574
            +IP DW+  PV T+V  NF  +  D TK V + FY     +   +    + LA  +  K   D+VI   +  +NE   +    +P +  FP G +   I+Y+    +E    F++S G + +      E  EPA S
Sbjct:   10 EIPPDWDQGPVKTLVSKNFEQVAFDETKNVFVKFYAPWCSHCKEMAPAWEALAEKY--KDREDIVIAELDATANELEAFSVLGYPTLKFFPAGPDRKVIDYKSTRDLETFSKFLDSGGHLPK-----EEPKEPAAS 138          
BLAST of Protein disulfide-isomerase vs. UniProt/SwissProt
Match: sp|Q13087|PDIA2_HUMAN (Protein disulfide-isomerase A2 OS=Homo sapiens OX=9606 GN=PDIA2 PE=1 SV=2)

HSP 1 Score: 134.806 bits (338), Expect = 1.871e-32
Identity = 114/469 (24.31%), Postives = 199/469 (42.43%), Query Frame = 3
Query:  135 NGILNLNISNFQSALDEHKTVIALAYLKDAPEASSAVKLFGKVGNKLKNDNLNMVLAKLKLEYDNNIFSKYNLEGTFGLLALMDHGERF--VEYTQPVNDVDKIVEFIEKKLQEPVTEINDSAKLRSIIENRPCISVGFFNNFTSTDYEEYRSSADWFYECDHYATRDVELFKYFKVNETIPTVKFYKECIHEVFDYP--KQLPFDSNNVLKFFLVCMEPDVAEYGMNWLMKRVLKQPQFTLLLFVKKDDPKKENYIDIMKKYARRYREEINMAYIDIDGHEDVKSFLYTFDLSESDVPCLRAIETSNRYANNTRKYKP-KRKTINDASVKQFIGDVYYRQLSPYLISEKIPKDWNSQPVVTVVGDNFRNITEDPTKTVLIVFYNDEPKYELFVKEQLKQLAMDFQSKGHSDVVIGVSNYYSNEYYGWHPNRFPKMILFPKGKNTFGIEYQMNMTVEDLKAFIESDGKI 1526
            +GIL L+      AL EH  ++   Y        +    + K    L  +++ + LAK+       +  ++ +   +  L    +G R    EYT P  D + I E++ +++      + D A  +++I  R  + +GFF +    D   + + A    +     T    LF+ F +  T  TV  +K+      D+P  ++L  D  ++ +F +      V E+      K    +    LLLFV +        +    + A R+R ++    +D+    D +  L  F L     P LR +         T+KY P     +  AS+  F   V   Q+ PYL+S++IP DW+ +PV T+VG NF  +  D TK V + FY     +   +    + LA  +Q   H D++I   +  +NE   +  + FP +  FP G     IEY+    +E    F+++ G +
Sbjct:   42 DGILVLSRHTLGLALREHPALLVEFYAPWCGHCQALAPEYSKAAAVLAAESMVVTLAKVDGPAQRELAEEFGVT-EYPTLKFFRNGNRTHPEEYTGP-RDAEGIAEWLRRRVGPSAMRLEDEAAAQALIGGRDLVVIGFFQDLQDEDVATFLALAQDALDMTFGLTDRPRLFQQFGL--TKDTVVLFKKFDEGRADFPVDEELGLDLGDLSRFLVTHSMRLVTEFNSQTSAKIFAARILNHLLLFVNQTLAAHRELLAGFGEAAPRFRGQVLFVVVDVAA--DNEHVLQYFGLKAEAAPTLRLVNL-----ETTKKYAPVDGGPVTAASITAFCHAVLNGQVKPYLLSQEIPPDWDQRPVKTLVGKNFEQVAFDETKNVFVKFYAPWCTHCKEMAPAWEALAEKYQD--HEDIIIAELDATANELDAFAVHGFPTLKYFPAGPGRKVIEYKSTRDLETFSKFLDNGGVL 497          
BLAST of Protein disulfide-isomerase vs. UniProt/SwissProt
Match: sp|P21195|PDIA1_RABIT (Protein disulfide-isomerase OS=Oryctolagus cuniculus OX=9986 GN=P4HB PE=2 SV=1)

HSP 1 Score: 134.42 bits (337), Expect = 2.403e-32
Identity = 114/475 (24.00%), Postives = 209/475 (44.00%), Query Frame = 3
Query:  129 DKNGILNLNISNFQSALDEHKTVIALAYLKDAPEASSAVKLFGKVGNKLKNDNLNMVLAKLKLEYDNNIFSKYNLEGTFGLLALMDHGERFV--EYTQPVNDVDKIVEFIEKKLQEPVTEINDSAKLRSIIENRPCISVGFFNNFTSTDYEEYRSSADWFYECDHYATRDVELFKYFKVNETIPTVKFYKECIHEVFDYPK---QLPFDSNNVLKFFLVCMEPDVAEYGMNWLMKRVLKQPQFTLLLFVKKDDPKKENYIDIMKKYARRYREEINMAYIDIDGHEDVKSFLYTFDLSESDVPCLRAIETSNRYANNTRKYKPKRKTINDASVKQFIGDVYYRQLSPYLISEKIPKDWNSQPVVTVVGDNFRNITEDPTKTVLIVFYNDEPKYELFVKEQLKQLAMDFQSKG-----HSDVVIGVSNYYSNEYYGWHPNRFPKMILFPKGKNTFGIEYQMNMTVEDLKAFIESDGK 1523
            +++ +L L  SNF   L  HK ++   Y        +    + K   KLK +  ++ LAK+    ++++  +Y + G +  +    +G+     EYT    + D IV +++K+     T + DSA   S++E+     +GFF +  S   +++  +A+   +     T   ++F  ++V++    V  +K+     FD  +   +       +L F      P V E+      K    + +  +LLF+ +     +  +   K+ A  ++ +I   +ID D H D +  L  F L + + P +R I           KYKP+   +    + +F       ++ P+L+S+++P+DW+ QPV  +VG NF  +  D  K V + FY     +        KQLA  +   G     H D+VI   +  +NE      + FP +  FP G     I+Y    T++  K F+ES G+
Sbjct:   23 EEDNVLVLKSSNFAEELAAHKHLLVEFYAPWCGHCKALAPEYAKAAGKLKAEGSDIRLAKVDATEESDLAQQYGVRG-YPTIKFFKNGDTASPKEYTAG-READDIVNWLKKRTGPAATTLADSAAAESLVESSEVAVIGFFKDVESDAAKQFLLAAEATDDIPFGLTASSDVFSRYQVHQD--GVVLFKK-----FDEGRNNFEGEVTKEKLLDFIKHNQLPLVIEFTEQTAPKIFGGEIKTHILLFLPRSAADHDGKLSGFKQAAEGFKGKILFIFIDSD-HADNQRILEFFGLKKEECPAVRLITLEEEMT----KYKPESDELTAEGITEFCQRFLEGKIKPHLMSQELPEDWDRQPVKVLVGKNFEEVAFDEKKNVFVEFYAPWCGH-------CKQLAPIWDKLGETYKEHQDIVIAKMDSTANEVEAVKVHSFPTLKFFPAGPGRTVIDYNGERTLDGFKKFLESGGQ 476          
BLAST of Protein disulfide-isomerase vs. UniProt/SwissProt
Match: sp|P09102|PDIA1_CHICK (Protein disulfide-isomerase OS=Gallus gallus OX=9031 GN=P4HB PE=1 SV=3)

HSP 1 Score: 132.494 bits (332), Expect = 1.239e-31
Identity = 117/483 (24.22%), Postives = 217/483 (44.93%), Query Frame = 3
Query:  111 GDPFEIDKNGILNLNISNFQSALDEHKTVIALAYLKDAPEASSAVKLFGKVGNKLKNDNLNMVLAKLKLEYDNNIFSKYNLEGTFGLLALMDHGERFV--EYTQPVNDVDKIVEFIEKKLQEPVTEINDSAKLRSIIENRPCISVGFFNNFTSTDYEEYRSSADWFYECDHYATRDVELFKYFKVNETIPTVKFYKECIHEVFDYPKQLPFDSNNVLKFFLVCMEPDVAEYGMNWLMKRVLKQPQFTLLLFVKKDDPKKENYIDIMKKYARRYREEINMAYIDIDGHEDVKSFLYTFDLSESDVPCLRAIETSNRYANNTRKYKPKRKTINDASVKQFIGDVYYRQLSPYLISEKIPKDWNSQPVVTVVGDNFRNITEDPTKTVLIVFYNDEPKYELFVKEQLKQLAMDFQSKG-----HSDVVIGVSNYYSNEYYGWHPNRFPKMILFPKGKNTFGIEYQMNMTVEDLKAFIESDGKINQIA 1538
             +P E +++G+L L  +NF+ AL  H+ ++   Y        +    + K   +LK +   + LAK+    +  +  ++ + G +  +    +G++    EYT    + D IV +++K+     T + D+A   +++++   + +GFF + TS   +E+  +A+   +     +   ++F  +++++    V  +K+      ++   L  D  N+L F      P V E+      K    + +  +LLF+ K     E  +D  K  A  ++ +I   +ID D H D +  L  F L + + P +R I           KYKP+   +    +K+F       ++ P+L+S+ +P+DW+ QPV  +VG NF  +  D  K V + FY     +        KQLA  +   G     H ++VI   +  +NE      + FP +  FP G     I+Y    T+E  K F+ES G+    A
Sbjct:   22 AEPLE-EEDGVLVLRAANFEQALAAHRHLLVEFYAPWCGHCKALAPEYAKAAAQLKAEGSEIRLAKVDATEEAELAQQFGVRG-YPTIKFFRNGDKAAPREYTAG-READDIVSWLKKRTGPAATTLTDAAAAETLVDSSEVVVIGFFKDVTSDAAKEFLLAAESVDDIPFGISSSADVFSKYQLSQD--GVVLFKKFDEGRNNFEGDLTKD--NLLNFIKSNQLPLVIEFTEQTAPKIFGGEIKTHILLFLPKSVSDYEGKLDNFKTAAGNFKGKILFIFIDSD-HSDNQRILEFFGLKKEECPAVRLITLEEEMT----KYKPESDDLTADKIKEFCNKFLEGKIKPHLMSQDLPEDWDKQPVKVLVGKNFEEVAFDENKNVFVEFYAPWCGH-------CKQLAPIWDKLGETYRDHENIVIAKMDSTANEVEAVKIHSFPTLKFFPAGSGRNVIDYNGERTLEGFKKFLESGGQDGAAA 485          
BLAST of Protein disulfide-isomerase vs. UniProt/SwissProt
Match: sp|P07237|PDIA1_HUMAN (Protein disulfide-isomerase OS=Homo sapiens OX=9606 GN=P4HB PE=1 SV=3)

HSP 1 Score: 131.339 bits (329), Expect = 2.873e-31
Identity = 111/472 (23.52%), Postives = 211/472 (44.70%), Query Frame = 3
Query:  129 DKNGILNLNISNFQSALDEHKTVIALAYLKDAPEASSAVKLFGKVGNKLKNDNLNMVLAKLKLEYDNNIFSKYNLEGTFGLLALMDHGERFV--EYTQPVNDVDKIVEFIEKKLQEPVTEINDSAKLRSIIENRPCISVGFFNNFTSTDYEEYRSSADWFYECDHYATRDVELFKYFKVNETIPTVKFYKECIHEVFDYPKQLPFDSNNVLKFFLVCMEPDVAEYGMNWLMKRVLKQPQFTLLLFVKKDDPKKENYIDIMKKYARRYREEINMAYIDIDGHEDVKSFLYTFDLSESDVPCLRAIETSNRYANNTRKYKPKRKTINDASVKQFIGDVYYRQLSPYLISEKIPKDWNSQPVVTVVGDNFRNITEDPTKTVLIVFYNDEPKYELFVKEQLKQLAMDFQSKG-----HSDVVIGVSNYYSNEYYGWHPNRFPKMILFPKGKNTFGIEYQMNMTVEDLKAFIESDGK 1523
            +++ +L L  SNF  AL  HK ++   Y        +    + K   KLK +   + LAK+    ++++  +Y + G +  +    +G+     EYT    + D IV +++K+     T + D A   S++E+     +GFF +  S   +++  +A+   +     T + ++F  +++++    V  +K+      ++  ++     N+L F      P V E+      K    + +  +LLF+ K     +  +   K  A  ++ +I   +ID D H D +  L  F L + + P +R I           KYKP+ + +    + +F       ++ P+L+S+++P+DW+ QPV  +VG NF ++  D  K V + FY     +        KQLA  +   G     H ++VI   +  +NE      + FP +  FP   +   I+Y    T++  K F+ES G+
Sbjct:   22 EEDHVLVLRKSNFAEALAAHKYLLVEFYAPWCGHCKALAPEYAKAAGKLKAEGSEIRLAKVDATEESDLAQQYGVRG-YPTIKFFRNGDTASPKEYTAG-READDIVNWLKKRTGPAATTLPDGAAAESLVESSEVAVIGFFKDVESDSAKQFLQAAEAIDDIPFGITSNSDVFSKYQLDKD--GVVLFKKFDEGRNNFEGEVT--KENLLDFIKHNQLPLVIEFTEQTAPKIFGGEIKTHILLFLPKSVSDYDGKLSNFKTAAESFKGKILFIFIDSD-HTDNQRILEFFGLKKEECPAVRLITLEEEMT----KYKPESEELTAERITEFCHRFLEGKIKPHLMSQELPEDWDKQPVKVLVGKNFEDVAFDEKKNVFVEFYAPWCGH-------CKQLAPIWDKLGETYKDHENIVIAKMDSTANEVEAVKVHSFPTLKFFPASADRTVIDYNGERTLDGFKKFLESGGQ 475          
BLAST of Protein disulfide-isomerase vs. UniProt/SwissProt
Match: sp|Q5R5B6|PDIA1_PONAB (Protein disulfide-isomerase OS=Pongo abelii OX=9601 GN=P4HB PE=2 SV=1)

HSP 1 Score: 130.183 bits (326), Expect = 6.597e-31
Identity = 120/504 (23.81%), Postives = 219/504 (43.45%), Query Frame = 3
Query:   42 LRKMIFALTIFFILTSFHHRFVSGDPFEIDKNGILNLNISNFQSALDEHKTVIALAYLKDAPEASSAVKLFGKVGNKLKNDNLNMVLAKLKLEYDNNIFSKYNLEGTFGLLALMDHGERFV--EYTQPVNDVDKIVEFIEKKLQEPVTEINDSAKLRSIIENRPCISVGFFNNFTSTDYEEYRSSADWFYECDHYATRDVELFKYFKVNETIPTVKFYKECIHEVFDYPK---QLPFDSNNVLKFFLVCMEPDVAEYGMNWLMKRVLKQPQFTLLLFVKKDDPKKENYIDIMKKYARRYREEINMAYIDIDGHEDVKSFLYTFDLSESDVPCLRAIETSNRYANNTRKYKPKRKTINDASVKQFIGDVYYRQLSPYLISEKIPKDWNSQPVVTVVGDNFRNITEDPTKTVLIVFYNDEPKYELFVKEQLKQLAMDFQSKG-----HSDVVIGVSNYYSNEYYGWHPNRFPKMILFPKGKNTFGIEYQMNMTVEDLKAFIESDGK 1523
            LR+ +  L +           V  D  E +++ +L L  SNF  AL  HK ++   Y        +    + K   KLK +   + LAK+    ++++  +Y + G +  +    +G+     EYT    + D IV +++K+     T + D A   S++E+     VGFF +  S   +++  +A+   +     T + ++F  +++++    V  +K+     FD  +   +      N+L F      P V E+      K    + +  +LLF+ K     +  +   K  A  ++ +I   +ID D H D +  L  F L + + P +R I           KYKP+ + +    + +F       ++ P+L+S+++P DW+ QPV  +VG NF ++  D  K V + FY     +        KQLA  +   G     H ++VI   +  +NE      + FP +  FP   +   I+Y    T++  K F+ES G+
Sbjct:    2 LRRALLCLAV--------AGLVCADAPE-EEDHVLVLRKSNFAEALAAHKYLLVEFYAPWCGHCKALAPEYAKAAGKLKAEGSEIRLAKVDATEESDLAQQYGVRG-YPTIKFFRNGDTASPKEYTAG-READDIVNWLKKRTGPAATILPDGAAAESLVESSEVAVVGFFKDVESDSAKQFLQAAEAIDDIPFGITSNSDVFSKYQLDKD--GVVLFKK-----FDEGRNNFEGEVTKENLLDFIKHNQLPLVIEFTEQTAPKIFGGEIKTHILLFLPKSVSDYDGKLSNFKTAAESFKGKILFIFIDSD-HTDNQRILEFFGLKKEECPAVRLITLEEEMT----KYKPESEELTAERITEFCHRFLEGKIKPHLMSQELPDDWDKQPVKVLVGKNFEDVAFDEKKNVFVEFYAPWCGH-------CKQLAPIWDKLGETYKDHENIVIAKMDSTANEVEAVKVHSFPTLKFFPASADRTVIDYNGERTLDGFKKFLESGGQ 475          
BLAST of Protein disulfide-isomerase vs. TrEMBL
Match: A0A4X2JWR0 (Protein disulfide-isomerase OS=Vombatus ursinus OX=29139 GN=LOC114043909 PE=3 SV=1)

HSP 1 Score: 156.377 bits (394), Expect = 1.859e-37
Identity = 122/470 (25.96%), Postives = 221/470 (47.02%), Query Frame = 3
Query:  126 IDKNGILNLNISNFQSALDEHKTVIALAYLKDAPEASSAVKLFGKVGNKLKNDNLNMVLAKLKLEYDNNIFSKYNLEGTFGLLALMDHGERF--VEYTQPVNDVDKIVEFIEKKLQEPVTEINDSAKLRSIIENRPCISVGFFNNFTSTDYEEYRSSADWFYECDHYATRDVELFKYFKVNETIPTVKFYKECIHEVFDYP--KQLPFDSNNVLKFFLVCMEPDVAEYGMNWLMKRVLKQPQFTLLLFVKKD-DPKKENYIDIMKKYARRYREEINMAYIDIDGHEDVKSFLYTFDLSESDVPCLRAIETSNRYANNTRKYKPKRKTINDASVKQFIGDVYYRQLSPYLISEKIPKDWNSQPVVTVVGDNFRNITEDPTKTVLIVFYNDEPKYELFVKEQLKQLAMDFQSKGHSDVVIGVSNYYSNEYYGWHPNRFPKMILFPKGKNTFGIEYQMNMTVEDLKAFIESDG 1520
            ++++ IL L   NF  AL EH+ ++   Y        S    + K  + LKN++  + LAK+    +  +  ++ + G +  L     G+R   VE+T P  + + IV +++++L    T++   A+   +I+++  + +GFF +    D   + ++A+   +     T   ELF+ + +++   TV  +K+      DYP  ++L  D  ++ +F ++     V E+      K    +    LLLF+ +   P KE   D  ++ AR +R E+    +D+ G  D    L  F ++ +D P LR I         T+KY P    I  ASV  F  D+   ++ P+L S++IP DW+ +PV  +VG NF  +  D +K V + FY     +   + +  + LA  +  K H D++I   +  +NE   +    FP +  FP G     IEY+    +E    F+++ G
Sbjct:   53 LEEDNILVLTQHNFDRALREHRYLLVEFYAPWCGHCRSLAPEYAKAASLLKNESSELKLAKVDGPAEMKLVEEFGVNG-YPALKFFRDGDRSQPVEFTGP-REAEGIVRWLKRRLGPAATQLETEAETTQLIDSQDIVIIGFFKDLQDEDTAGFLATAEDAVDLTFGFTDRPELFQKYGLSQD--TVVLFKKFDEGRADYPVDEELGLDQADLSRFLIIHSMHLVTEFNSKTSSKIFRAKILNHLLLFINQTLTPHKELLAD-FQEAARPFRGEVLFVVVDVAGEND--HVLQYFGMNATDAPALRFINI-----ETTKKYLPTTGEITAASVTTFCQDILSGKVKPHLRSQEIPADWDQKPVKVLVGKNFEQVAFDESKNVFVKFYAPWCTHCKEMAQTWEDLAEKY--KDHEDIIIAELDSTANELEAFTVRGFPTLKYFPAGPGRKVIEYKSARDLETFSKFLDNGG 508          
BLAST of Protein disulfide-isomerase vs. TrEMBL
Match: A0A1I8JH11 (Protein disulfide-isomerase OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 152.525 bits (384), Expect = 1.855e-36
Identity = 133/479 (27.77%), Postives = 217/479 (45.30%), Query Frame = 3
Query:  129 DKNGILNLNISNFQSALDEHKTVIALAYLKDAPEASSAVKLFGKVGNKLKNDNLNMVLAKLKLEYDNNIFSKYNLEGTFGLLALMDHGERFVEYTQPV-----NDVDKIVEFIEKKLQEPVTEINDSAKLRSIIENRPCISVGFFNNFTSTDYEEYRSSADWFYE---CDHYATRDVELFKYFKVNETIPTVKFYKECIHEVFDYPKQLPFDSNNVLKFFLVCMEPDVAEYGMNWLMKRVLKQPQFTLLLFVKKDDPKK-ENYIDIMKKYARRYREEINMAYIDIDGHEDVKSFLYTFDLSESDVPCLRAIETSNRYANNTRKYKPKRKTINDASVKQFIGDVYYRQLSPYLISEKIPKDWNSQPVVTVVGDNFRNITEDPTKTVLIVFYNDEPKYELFVKEQLKQLA-----MDFQSKGHSDVVIGVSNYYSNEYYGWHPNRFPKMILFPKGKNTFGIEYQMNMTVEDLKAFIESDGK 1523
            ++ G+L L   NF SAL  +K ++ALA     PE       + K   +LK  N  + LAK+    +  +  KY ++G   +        +F +   P+        D I+ ++EKKL  P   ++     +  I ++    +GFF + TS   + Y  +A    E   C    + D+     FKV++   TV  +K+       Y    PF ++ V KF      P + E+             +  LL+F+KK D  +  N +D +K  A +++ +    Y+DI G ED +  L  F L + D P +R I        +  KYKP+   I   ++ QF+  V   +L P+L+S+++P DW+ +PV  +VG NF  +  D TK VL+ FY     +        KQLA     +  + K H ++VI   +  +NE        FP +  FP   +   I+Y+ + T+E  K F+ES GK
Sbjct:   19 EEEGVLVLTEKNFDSALQANKYILALA-----PE-------YAKAAQQLKEKNSEIKLAKVDATVEGKLAEKYGVQGYPTI--------KFFKEQTPIEYSGGRTADTIISWLEKKLGPPTQRLDSVDAAQKFINDKEITVIGFFKDTTSDSAKSYEDAAFSKLEDIPCGMADSADI--MAEFKVDQD--TVMLFKKTDGARIPYTG--PFTADEVAKFVKNNKLPLINEFTQETAGDIFGGDVKKHLLVFLKKSDEAQFSNIMDQLKAPAEQFKGKALFIYVDI-GVEDNERILEFFGLKKEDCPAVRFIALDE----DMVKYKPEFTDITADNLAQFVQSVLDGKLKPHLMSQEVPADWDKEPVKVLVGKNFNEVARDKTKNVLVEFYAPWCGH-------CKQLAPIWDKLGEEYKNHENIVIAKMDSTANEVEDVKVQSFPTIKFFPANSDEI-IDYEGDRTLEGFKKFLESGGK 458          
BLAST of Protein disulfide-isomerase vs. TrEMBL
Match: A0A1I8HRX2 (Protein disulfide-isomerase OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig011389g1 PE=3 SV=1)

HSP 1 Score: 150.599 bits (379), Expect = 1.281e-35
Identity = 133/499 (26.65%), Postives = 222/499 (44.49%), Query Frame = 3
Query:   54 IFALTIFFILTSFHHRFVSGDPFEIDKNGILNLNISNFQSALDEHKTVIALAYLKDAPEASSAVKLFGKVGNKLKNDNLNMVLAKLKLEYDNNIFSKYNLEGTFGLLALMDHGERFVEYTQPVNDVDKIVEFIEKKLQEPVTEINDSAKLRSIIENRPCISVGFFNNFTSTDYEEYRSSADWFYE---CDHYATRDVELFKYFKVNETIPTVKFYKECIHEVFDYPKQLPFDSNNVLKFFLVCMEPDVAEYGMNWLMKRVLKQPQFTLLLFVKKDDPKK-ENYIDIMKKYARRYREEINMAYIDIDGHEDVKSFLYTFDLSESDVPCLRAIETSNRYANNTRKYKPKRKTINDASVKQFIGDVYYRQLSPYLISEKIPKDWNSQPVVTVVGDNFRNITEDPTKTVLIVFYNDEPKYELFVKEQLKQLA-----MDFQSKGHSDVVIGVSNYYSNEYYGWHPNRFPKMILFPKGKNTFGIEYQMNMTVEDLKAFIESDGK 1523
            +F L +F ++          D    ++ G+L L   NF SAL  +K ++   Y        +    + K   +LK  N  + LAK+    +  +  KY ++G   +    +     +EY+      D I+ ++EKKL  P   ++     +  I ++    +GFF + TS   + Y  +A    E   C    + D+     FKV++   TV  +K+       Y    PF ++ V KF      P + E+             +  LL+F+KK D  +  N +D +K  A +++ +    Y+DI G ED +  L  F L + D P +R I        +  KYKP+   I   ++ QF+  V   +L P+L+S+++P DW+ +PV  +VG NF  +  D TK VL+ FY     +        KQLA     +  + K H ++VI   +  +NE        FP +  FP   +   I+Y+ + T+E  K F+ES GK
Sbjct:    3 MFKLALFSLVACVAF----ADEAITEEEGVLVLTEKNFDSALQANKYILVEFYAPWCGHCKALAPEYAKAAQQLKEKNSEIKLAKVDATVEGKLAEKYGVQGYPTIKFFKEQTP--IEYSGG-RTADTIISWLEKKLGPPTQRLDSVDAAQKFINDKEITVIGFFKDTTSDSAKSYEDAAFSKLEDIPCGMADSADI--MAEFKVDQD--TVMLFKKTDGARIPYTG--PFTADEVAKFVKNNKLPLINEFTQETAGDIFGGDVKKHLLVFLKKSDEAQFSNIMDQLKAPAEQFKGKALFIYVDI-GVEDNERILEFFGLKKEDCPAVRFIALDE----DMVKYKPEFTDITADNLAQFVQSVLDGKLKPHLMSQEVPADWDKEPVKVLVGKNFNEVARDKTKNVLVEFYAPWCGH-------CKQLAPIWDKLGEEYKNHENIVIAKMDSTANEVEDVKVQSFPTIKFFPANSDEI-IDYEGDRTLEGFKKFLESGGK 475          
BLAST of Protein disulfide-isomerase vs. TrEMBL
Match: A0A2H8TSD7 (Protein disulfide-isomerase OS=Melanaphis sacchari OX=742174 GN=Pdi_8 PE=3 SV=1)

HSP 1 Score: 147.132 bits (370), Expect = 2.787e-34
Identity = 121/467 (25.91%), Postives = 214/467 (45.82%), Query Frame = 3
Query:  138 GILNLNISNFQSALDEHKTVIALAYLKDAPEASSAVKLFGKVGNKLKNDNLNMVLAKLKLEYDNNIFSKYNLEGTFGLLALMDHGERFVEYTQPVNDVDKIVEFIEKKLQEPVTEINDSAKLRSIIENRPCISVGFFNNFTSTDYEEYRSSADWFYECDHYATRDVELFKYFKVNETIPTVKFYKECIHEVFDYPKQLPFDSNNVLKFFLVCMEPDVAEYGMNWLMKRVLKQPQFTLLLFVKKDDPKKENYIDIMKKYARRYREEINMAYIDIDGHEDVKSFLYTFDLSESDVPCLRAIETSNRYANNTRKYKPKRKTINDASVKQFIGDVYYRQLSPYLISEKIPKDWNSQPVVTVVGDNFRNITEDPTKTVLIVFYNDEPKYELFVKEQLKQLAMDFQSKGH-----SDVVIGVSNYYSNEYYGWHPNRFPKMILFPKGKNTFGIEYQMNMTVEDLKAFIESDGK 1523
            G+L L   NFQS +   + ++   Y             +      L  + L++ L K+    ++++  ++ + G +  L     G+  ++YT      D+I++++ KK       +    +L+S I+ +    VG+FNN  S   + +   AD     D +    V  +  F   E   T   YK+   +   Y +++  +   + KF  V   P + E+  +   K    Q +  LLLF+ K +   E +ID +K  A  +R  I    ID D  E+ +  L  F + +++VP +RAI    +  ++  K+KP+   +   +VK+F+ D    ++  +L+SE++P+DWN  PV T+   NF ++  D TK+VL+ FY     +        KQLA  F   G       D++I   +   NE      + FP +  +PKG +   IEY  + T+E +  F+E+DGK
Sbjct:   48 GVLVLTKDNFQSIVSSSEYLLVKFYAPWCGHCKQLAPEYANAAQHLAQNELSVKLGKVDATIESDLAEQFGIRG-YPTLKFFKSGKP-IDYTGGRTK-DEIIQWVLKKSGPAAKVLQSEEELKSFIDGKNVAIVGYFNNLESDAAKLFSELAD---SVDDHPFGLVSDYSKFSDLEHKDTFVLYKDFDEKKVAYDQEIS-NVEEIKKFIFVHSLPPIIEFNQDTAQKIFGGQIKSHLLLFLSKKEGHFEKFIDDIKPVALDFRGNIVFVTIDTD-EEEHQRILEFFGMKKNEVPSMRAI----KLEDDMTKFKPESPELTGENVKKFVTDFVEGKVKQHLLSEELPEDWNKTPVWTLTATNFDSVALDSTKSVLVEFYAPWCGH-------CKQLAPIFDKVGEHFADKDDIIIAKMDATVNELEHTKISSFPTLTYYPKGDSPKAIEYNGDRTLEAIIKFVEADGK 495          
BLAST of Protein disulfide-isomerase vs. TrEMBL
Match: G3VLI1 (Protein disulfide isomerase family A member 2 OS=Sarcophilus harrisii OX=9305 GN=PDIA2 PE=4 SV=1)

HSP 1 Score: 146.747 bits (369), Expect = 1.164e-33
Identity = 121/494 (24.49%), Postives = 223/494 (45.14%), Query Frame = 3
Query:  126 IDKNGILNLNISNFQSALDEHKTVIALAYLKDAPEASSAVKLFGKVGNKLKNDNLNMVLAKLKLEYDNNIFSKYNLEGTFGLLALMDHGERF--VEYTQPVNDVDKIVEFIEKKLQEPVTEINDSAKLRSIIENRPCISVGFFNNFTSTDYEEYRSSADWFYECDHYATRDVELFKYFKVNETIPTVKFYKECIHEVFDYP--KQLPFDSNNVLKFFLVCMEPDVAEYGMNWLMK----RVLKQPQFTLLLFVKKDDPKKENYIDIMKKYARRYREEINMAYIDIDGHEDVKSFLYTFDLSESDVPCLRAIETSNRYANNTRKYKPKRKTINDASVKQFIGDVYYRQLSPYLISEKIPKDWNSQPVVTVVGDNFRNITEDPTKTVLIVFYNDEPKYELFVKEQLKQLAMDFQSKGHSDVVIGVSNYYSNEYYGWHPNRFPKMILFPKGKNTFGIEYQMNMTVEDLKAFIESDGKINQIARFSSEINEPATSEKQ 1583
            ++++ IL L   NF  AL EH+ ++   Y        +    + K  + LKN++  + LAK+    +  +  ++ + G +  L     G R   V +T    + + IV +++++L    T +   A+   +I+++  + +GFF +    D   + + A+   +     T   ELF+ + +++   TV  +K+      D+P  ++L  D  ++  F +V     V E+      K    R+L      LLLF+ +     +  +   ++ A  +R E+    +D+ G  D    L  F ++ +D P LR I         T+KY P    I  ASV  F  DV   ++ P+L S++IP DW+ +PV  +VG NF  +  D +K V + FY     +   + +  + LA  +  K H D++I   +  +NE   +    FP +  FP G     IEY+    +E    F+++DG + +       + E  T+E +
Sbjct:  123 VEEDDILVLTQHNFARALREHRYLLVEFYAPWCGHCRALAPEYTKAASLLKNESSELKLAKVDGPAEKELVEEFGVTG-YPDLKFFRDGNRSHPVLFTAGPREAEGIVRWLKRRLGPSATRLETEAEAAQLIDSQDIVIIGFFKDLQDEDAAAFLAIAEDAVDLTFGLTDRPELFQKYGLSKD--TVVLFKKFDEGRADFPVDEELGLDQADLSHFLVVHSMHLVTEFNSQTSSKIFEVRILNH----LLLFINQTLSPHKELLTGFQEAAPLFRGEVLFVVVDVAGEND--HVLQYFGMNATDAPTLRFINV-----ETTKKYVPNTGEITAASVTAFCQDVLSGKIKPHLRSQEIPADWDQKPVKVLVGKNFEQVVFDESKKVFVKFYAPWCTHCKEMAQTWEDLAEKY--KDHEDIIIAELDSTANELEAFAIRGFPTLKYFPAGPGRKVIEYKSARDLETFSKFLDNDGVLPEPENPEVPLPEAGTNESK 600          
BLAST of Protein disulfide-isomerase vs. Ensembl Cavefish
Match: p4hb (prolyl 4-hydroxylase subunit beta [Source:NCBI gene;Acc:103023413])

HSP 1 Score: 133.265 bits (334), Expect = 6.969e-33
Identity = 120/472 (25.42%), Postives = 204/472 (43.22%), Query Frame = 3
Query:  141 ILNLNISNFQSALDEHKTVIALAYLKDAPEASSAVKLFGKVGNKLKNDNLNMVLAKLKLEYDNNIFSKYNLEGTFGLLALMDHGERFV--EYTQPVNDVDKIVEFIEKKLQEPVTEINDSAKLRSIIENRPCISVGFFNNFTSTDYEEYRSSADWFYECDHYATRDVELFKYFKVNETIPTVKFYKECIHEVFDYPKQLPFDSN----NVLKFFLVCMEPDVAEYGMNWLMKRVLKQPQFTLLLFVKKDDPKKENYIDIMKKYARRYREEINMAYIDIDGHEDVKSFLYTFDLSESDVPCLRAIETSNRYANNTRKYKPKRKTINDASVKQFIGDVYYRQLSPYLISEKIPKDWNSQPVVTVVGDNFRNITEDPTKTVLIVFYNDEPKYELFVKEQLKQLAMDFQSKGH-----SDVVIGVSNYYSNEYYGWHPNRFPKMILFPKGKNTFGIEYQMNMTVEDLKAFIESDGK 1523
            +L LN SNF+ AL  H  ++   Y        +    + K    LK +  ++ L K+    + ++  ++ + G +  +     GE+    EY+      D IV +++K+       + +  +  S+I +     +GFF +  S   + +  +A+   +     + D  +F  F+V E   +V  +K+     FD  +   FD       +L F      P V E+      K    + +  +LLFV K     ++ +D  +K A  ++ +I   +ID D  +D +  L  F L + + P LR I   +       KYKP+   I   ++  F       +L P+L+S+ IP+DW+  PV T+VG NF  +  DPTK V + FY     +        KQLA  +   G       DVVI   +  +NE      + FP +  FP G+    I+Y    T++    F+ES GK
Sbjct:   24 VLVLNKSNFEEALKAHPNILVEFYAPWCGHCKALAPEYAKAAGMLKAEGSDIRLGKVDATEEADLAQEFGVRG-YPTIKFFKGGEKSSPKEYSAG-RQADDIVNWLKKRTGPAAAALTEVTQAESLIADNEVAVIGFFKDVESDGAKAFIKAAEAVDDIPFGISSDDAVFSKFEVTED--SVVLFKK-----FDEGRNT-FDGELSKEGLLSFIKANQLPLVIEFTEQTAPKIFGGEIKSHILLFVPKASKDFQDKMDNFRKAAEGFKGKILFIFIDSD-VDDNQRILEFFGLKKEECPALRLITLEDEMT----KYKPEASEITAENIITFCTAFTEGKLKPHLMSQDIPEDWDKTPVKTLVGKNFEEVVFDPTKNVFVEFYAPWCGH-------CKQLAPIWDQLGEKYKDSKDVVIAKMDSTANEIEAVKVHSFPTLKFFPAGEEHKIIDYSGERTLDGFTKFLESGGK 473          
BLAST of Protein disulfide-isomerase vs. Ensembl Cavefish
Match: pdia2 (protein disulfide isomerase family A, member 2 [Source:ZFIN;Acc:ZDB-GENE-040426-705])

HSP 1 Score: 127.487 bits (319), Expect = 8.977e-31
Identity = 112/469 (23.88%), Postives = 212/469 (45.20%), Query Frame = 3
Query:  141 ILNLNISNFQSALDEHKTVIALAYLKDAPEASSAVKLFGKVGNKLKNDNLNMVLAKLKLEYDNNIFSKYNLEGTFGLLALMDHGER--FVEYTQPVNDVDKIVEFIEKKLQEPVTEINDSAKLRSIIENRPCISVGFFNNFTSTDYEEYRSSADWFYECDHYATRDVELFKYFKVNETIPTVKFYKECIHEVFD--YPKQLPFDSNNVLKFFLVCMEPDVAEYGMNWLMKRVLKQPQFTLLLFVKKDDPKKENYIDIMKKYARRYREEINMAYIDIDGHEDVKSFLYTFDLSESDVPCLRAIETSNRYANNTRKYKPKRKTINDASVKQFIGDVYYRQLSPYLISEKIPKDWNSQPVVTVVGDNFRNITEDPTKTVLIVFYNDEPKYELFVKEQLKQLAMDFQSKG-----HSDVVIGVSNYYSNEYYGWHPNRFPKMILFPKGKNTFGIEYQMNMTVEDLKAFIESDG 1520
            +L L+  NF  AL E K ++   Y            ++ +V  +LKN++  + LAK+    +  +  ++ ++G F  L     G R    ++T    +   I  +++++++ P T + ++   + +++    + VGFF++    + + + S A      +   T   ELFK + VN+   +V  +K+   +  D   P+    D +N++ F        +  +      K    +    +LLF+          +D  +  A  ++ ++   +I ID +E+V   +  F +S SD P LR I T     +  +KY  + +TIN  ++K F   V   ++ P+L+S++IP+DWN  PV  +VG NF +I  D +K V + FY     +        K+LA  ++  G     H D++I   +  +NE  G     FP +  FP G     ++Y     +E    F+++ G
Sbjct:   55 VLVLHSVNFDRALSESKYLLVEFYAPWCSHCRMLEPVYSQVARQLKNESSPIRLAKVDATEEKELAEEFGIDG-FPTLKFFKEGRRQNATDFTGKRTE-KGIKLWLQRQVEPPATVLKNTKDAQELLDAHDVVVVGFFDDLNGEEAKVFYSVAVDMVSLNFGITSSPELFKKYNVNKD--SVVLFKKFDDKRADISLPEDGKLDKDNLVTFIQNNSLELIITFSEENADKIFSSKVHNHILLFINTTIESHNALLDDYRAAAVEFKGKV--LFIKIDVNEEVSHVMKYFGISASDTPVLRFINT-----DTVKKYAMEEETINKDTLKTFCQGVLDGKIKPHLMSQEIPEDWNKNPVKVLVGKNFEHIAFDESKNVFVEFYAPWCGH-------CKELAPVWEKLGEKYKDHEDIIIANMDSTANEVEGVTVQGFPTLKFFPAGTERKIVDYNGKRDLETFSKFLDNGG 505          
BLAST of Protein disulfide-isomerase vs. Ensembl Cavefish
Match: zgc:136472 (protein disulfide-isomerase-like [Source:NCBI gene;Acc:103036532])

HSP 1 Score: 72.4034 bits (176), Expect = 5.186e-13
Identity = 97/472 (20.55%), Postives = 194/472 (41.10%), Query Frame = 3
Query:  114 DPFEIDKNGILNLNISNFQSALDEHKTVIALAYLKDAPEASSAVKLFGKVGNKLKNDNLNMVLAKLKLEYDNNIFSKYNLEGTFGLLALMDHGERFVEYTQPV-NDVDKIVEFIEKKLQEPVTEINDSAKLRSIIENRPCISVGFFNNFTSTDYEEYRSSADWFYECDHYATRDVELF-KYFKVNETIPTVKFYKECIHEVFDYPKQLPFDSNNVLKFFLVCMEPDVAEYGMNWLMKRVLKQPQFTLLLFVKKDDPKKENYIDIMKKYARRYREEINMAYIDIDGHEDVKSFLYTFDLSESDVPCLRAIETSNRYANNTRKYKPKRKTINDASVKQFIGDVYYRQLSPYLISEKIPKDWNSQPVVTVVGDNFRNITEDPTKTVLIVFYNDEPKYELFVKEQLKQLAMDFQSKGHSDVVIGVSNYYSNEYYGWHPNRFPKMILFPKGKNTFGIEYQMNMTVEDLKAFIESDGK 1523
            +P + DK+ +L L  SNF  AL  H  ++   Y   + E+  ++  F +  ++LK  N ++ L  L +    ++    N+  T   + L   G+++     PV      I+ +++++       I D ++L         + +G F +      + +   A    +     T + ++F KY +   ++  ++  K  + E F+   +   D  +V+ F  +   P V EY      K +    Q  L+LF+ K     +      K  A+ +R ++    ID  G       +  F + + D P +R +  ++ +     +Y+     ++  +   FI      +    L SE +P  W+ QPV  +VG NF  +  +  K VLI+FY+        +    + LA  F      DVV+   +  +N+      +R+P + +FP       + Y     +E +  F+ ++ +
Sbjct:   24 EPIQEDKD-VLVLTESNFNRALKLHSQLLVHFYAPLSGESLGSILEFAQAASELKEANSDVKLGGLDVSKQKDLAKTLNVT-TVPSVRLYLSGDKYNPVYCPVLKSSASIISWLKRRKGPSADLIKDLSQLEKFTAEDDLVILGLFKDVEEGAVKVFYEVAADVPDLPFGVTGNEQVFSKYGRTENSVLLLR--KSKMAEHFEMTSETVKD--DVILFIRIHEMPLVTEYNGKTSSKILSSVVQNHLILFMDKAGKGFKQTYRAFKSTAKEFRGKVLFVLID-SGEPRNGRIMEYFRVRKEDAPLVRMVNLTDSF-----QYQLPSDLMDIQTFTDFIESYLQGKAKLKLQSEPVPDGWDKQPVKELVGMNFERVAFNHEKNVLILFYSPWSSDSRALFPLWEDLAEHFSDS--EDVVVARIDITANDVNIRMMDRYPCIKVFPAVYAERVVSYSGEAKLEPIVEFVNAESE 481          
BLAST of Protein disulfide-isomerase vs. Ensembl Cavefish
Match: zgc:136472 (protein disulfide-isomerase-like [Source:NCBI gene;Acc:103036532])

HSP 1 Score: 72.0182 bits (175), Expect = 6.648e-13
Identity = 97/472 (20.55%), Postives = 194/472 (41.10%), Query Frame = 3
Query:  114 DPFEIDKNGILNLNISNFQSALDEHKTVIALAYLKDAPEASSAVKLFGKVGNKLKNDNLNMVLAKLKLEYDNNIFSKYNLEGTFGLLALMDHGERFVEYTQPV-NDVDKIVEFIEKKLQEPVTEINDSAKLRSIIENRPCISVGFFNNFTSTDYEEYRSSADWFYECDHYATRDVELF-KYFKVNETIPTVKFYKECIHEVFDYPKQLPFDSNNVLKFFLVCMEPDVAEYGMNWLMKRVLKQPQFTLLLFVKKDDPKKENYIDIMKKYARRYREEINMAYIDIDGHEDVKSFLYTFDLSESDVPCLRAIETSNRYANNTRKYKPKRKTINDASVKQFIGDVYYRQLSPYLISEKIPKDWNSQPVVTVVGDNFRNITEDPTKTVLIVFYNDEPKYELFVKEQLKQLAMDFQSKGHSDVVIGVSNYYSNEYYGWHPNRFPKMILFPKGKNTFGIEYQMNMTVEDLKAFIESDGK 1523
            +P + DK+ +L L  SNF  AL  H  ++   Y   + E+  ++  F +  ++LK  N ++ L  L +    ++    N+  T   + L   G+++     PV      I+ +++++       I D ++L         + +G F +      + +   A    +     T + ++F KY +   ++  ++  K  + E F+   +   D  +V+ F  +   P V EY      K +    Q  L+LF+ K     +      K  A+ +R ++    ID  G       +  F + + D P +R +  ++ +     +Y+     ++  +   FI      +    L SE +P  W+ QPV  +VG NF  +  +  K VLI+FY+        +    + LA  F      DVV+   +  +N+      +R+P + +FP       + Y     +E +  F+ ++ +
Sbjct:   27 EPIQEDKD-VLVLTESNFNRALKLHSQLLVHFYAPLSGESLGSILEFAQAASELKEANSDVKLGGLDVSKQKDLAKTLNVT-TVPSVRLYLSGDKYNPVYCPVLKSSASIISWLKRRKGPSADLIKDLSQLEKFTAEDDLVILGLFKDVEEGAVKVFYEVAADVPDLPFGVTGNEQVFSKYGRTENSVLLLR--KSKMAEHFEMTSETVKD--DVILFIRIHEMPLVTEYNGKTSSKILSSVVQNHLILFMDKAGKGFKQTYRAFKSTAKEFRGKVLFVLID-SGEPRNGRIMEYFRVRKEDAPLVRMVNLTDSF-----QYQLPSDLMDIQTFTDFIESYLQGKAKLKLQSEPVPDGWDKQPVKELVGMNFERVAFNHEKNVLILFYSPWSSDSRALFPLWEDLAEHFSD--SEDVVVARIDITANDVNIRMMDRYPCIKVFPAVYAERVVSYSGEAKLEPIVEFVNAESE 484          
BLAST of Protein disulfide-isomerase vs. Ensembl Cavefish
Match: zgc:136472 (protein disulfide-isomerase-like [Source:NCBI gene;Acc:103036532])

HSP 1 Score: 71.2478 bits (173), Expect = 1.272e-12
Identity = 94/444 (21.17%), Postives = 184/444 (41.44%), Query Frame = 3
Query:  114 DPFEIDKNGILNLNISNFQSALDEHKTVIALAYLKDAPEASSAVKLFGKVGNKLKNDNLNMVLAKLKLEYDNNIFSKYNLEGTFGLLALMDHGERFVEYTQPV-NDVDKIVEFIEKKLQEPVTEINDSAKLRSIIENRPCISVGFFNNFTSTDYEEYRSSADWFYECDHYATRDVELF-KYFKVNETIPTVKFYKECIHEVFDYPKQLPFDSNNVLKFFLVCMEPDVAEYGMNWLMKRVLKQPQFTLLLFVKKDDPKKENYIDIMKKYARRYREEINMAYIDIDGHEDVKSFLYTFDLSESDVPCLRAIETSNRYANNTRKYKPKRKTINDASVKQFIGDVYYRQLSPYLISEKIPKDWNSQPVVTVVGDNFRNITEDPTKTVLIVFYNDEPKYELFVKEQLKQLAMDFQSKGHSDVVIGVSNYYSNEYYGWHPNRFPKMILFP 1439
            +P + DK+ +L L  SNF  AL  H  ++   Y   + E+  ++  F +  ++LK  N ++ L  L +    ++    N+  T   + L   G+++     PV      I+ +++++       I D ++L         + +G F +      + +   A    +     T + ++F KY +   ++  ++  K  + E F+   +   D  +V+ F  +   P V EY      K +    Q  L+LF+ K     +      K  A+ +R ++    ID  G       +  F + + D P +R +  ++ +     +Y+     ++  +   FI      +    L SE +P  W+ QPV  +VG NF  +  +  K VLI+FY+        +    + LA  F      DVV+   +  +N+      +R+P + +FP
Sbjct:   27 EPIQEDKD-VLVLTESNFNRALKLHSQLLVHFYAPLSGESLGSILEFAQAASELKEANSDVKLGGLDVSKQKDLAKTLNVT-TVPSVRLYLSGDKYNPVYCPVLKSSASIISWLKRRKGPSADLIKDLSQLEKFTAEDDLVILGLFKDVEEGAVKVFYEVAADVPDLPFGVTGNEQVFSKYGRTENSVLLLR--KSKMAEHFEMTSETVKD--DVILFIRIHEMPLVTEYNGKTSSKILSSVVQNHLILFMDKAGKGFKQTYRAFKSTAKEFRGKVLFVLID-SGEPRNGRIMEYFRVRKEDAPLVRMVNLTDSF-----QYQLPSDLMDIQTFTDFIESYLQGKAKLKLQSEPVPDGWDKQPVKELVGMNFERVAFNHEKNVLILFYSPWSSDSRALFPLWEDLAEHFSD--SEDVVVARIDITANDVNIRMMDRYPCIKVFP 456          
BLAST of Protein disulfide-isomerase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002052.1 (pep scaffold:Pmarinus_7.0:GL480798:2613:20969:-1 gene:ENSPMAG00000001848.1 transcript:ENSPMAT00000002052.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 71.2478 bits (173), Expect = 1.499e-13
Identity = 87/371 (23.45%), Postives = 149/371 (40.16%), Query Frame = 3
Query:  378 LMDHGERF-VEYTQPVNDVDKIVEFIEKKLQEPVTEINDSAKLRSIIENRPCISVGFFNNFTSTDYEEYRSSADWFYECDHYATRDVELFKYFKVNETIPTVKFYKECIHEVFDYPKQ--LPFDSNNVLKFFLVCMEPDVAEYGMNWLMKRVLKQ--------PQFTLLLFVKKDDPKKENYIDIMKKYARRYREEINMAYIDIDGHEDVKSFLYTFDLSE-SDVPCLRAIETSNRYANNTRKYKPKRKTINDASVKQFIGDVYYRQLSPYLISEKIPKDWNSQPVVTVVGDNFRNITEDPTKTVLIVFYN---DEPKYELFVKEQLKQLAMDFQSKGHSDVVIGVSNYYSNEYYGWHPNRFPKMILFPKG 1445
            L D G R    +     + + + ++  ++   P   +  +A+ ++ +++   + +GFF +  S D + +   AD + E     T   E+F  + V+ T   V F K      FD  ++   P D    L F           +G   L    ++             +LLF            +  K  A  +R +I    ++    E+  + L  F+L++ + +P +R ++ +     +  K+ P       A++  F  D       P+  S++IPKDWN +PV  +VG NF     D TK V + FY    D  K    V EQL       Q K H ++VI   +   NE    H   +PK+  FP G
Sbjct:   52 LFDPGSRAKPRHYHAQREAEALAKWATRRAGPPAVTVATTAEAQAFVDSDSLVLLGFFKDTESRDLKTFLEIADTYDEVPFGVTSSEEVFAKYGVS-TDSIVLFKK------FDEGQKSFTPID----LNFRHGIKSHTAVVHGCECLCGCTVQTFPLLFSGLVNVHILLFANASSEGFPELFEQFKAAAPPFRGKILFVLLNSAVPEN-DNVLDLFELTDGARLPAIRLVKVNK----DMVKHVPSFSDFTTANITSFCQDYLDEHNKPFSKSQEIPKDWNKRPVKVLVGKNFDEFVFDETKNVFVEFYASWCDHCKKLAPVWEQL-----GVQYKDHDNIVIAKMDAEKNEVAAVHIPGYPKIKYFPAG 401          
BLAST of Protein disulfide-isomerase vs. Ensembl Yeast
Match: PDI1 (Protein disulfide isomerase; multifunctional oxidoreductase of the ER lumen, essential for disulfide bond formation in secretory and cell-surface proteins, processing of non-native disulfide bonds; Ero1p activator; complexes with exomannosidase, Mnl1p to facilitate the recognition of misfolded glycoproteins and the trimming of glycan Man8GlcNAc2 to Man7GlcNAc2 on substrates, thereby accelerating ERAD; PDI1 has a paralog, EUG1, that arose from the whole genome duplication [Source:SGD;Acc:S000000548])

HSP 1 Score: 54.6842 bits (130), Expect = 2.200e-8
Identity = 37/142 (26.06%), Postives = 73/142 (51.41%), Query Frame = 3
Query: 1104 SVKQFIGDVYYRQLSPYLISEKIPKDWNSQPVVTVVGDNFRNITEDPTKTVLIVFYNDEPKYELFVKEQLKQLAMDFQSKGHSDVVIGVSNYYSNEYYGWHPNRFPKMILFPKGKNTFGIEYQMNMTVEDLKAFIESDGKIN 1529
            +++  + D      SP + S++I ++ +S  V  +VG N   I  DP K VL+++Y     +   +    ++LA D  +   SDV+I   ++  N+  G     +P ++L+P GK +  + YQ + +++ L  FI+ +G  +
Sbjct:  348 AIESLVKDFLKGDASPIVKSQEIFENQDSS-VFQLVGKNHDEIVNDPKKDVLVLYYAPWCGHCKRLAPTYQELA-DTYANATSDVLIAKLDHTENDVRGVVIEGYPTIVLYPGGKKSESVVYQGSRSLDSLFDFIKENGHFD 487          
BLAST of Protein disulfide-isomerase vs. Ensembl Nematostella
Match: EDO36830 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SHH5])

HSP 1 Score: 116.701 bits (291), Expect = 7.055e-28
Identity = 116/485 (23.92%), Postives = 206/485 (42.47%), Query Frame = 3
Query:  141 ILNLNISNFQSALDEHKTVIALAYLKDAPEASSAVKLFGKVGNKLKNDNLNMVLAKLKLEYDNNIFSKYNLEG--TFGLLALMDHGERFVEYTQPVNDVDKIVEFIEKKLQEPVTEINDSAKLRSIIENRPCISVGFFNNFTSTDYEEYRSSADWFYECDHYATRDVELFKYFKV-NETIPTVKFYKECIHEVFDYPKQLPFDSNNVLKFFLVCMEPDVAEYGMNWLMKRVLKQPQFTLLLFVKKDDPKKENYIDIMKKYARRYREEINMAYIDIDGHEDVKSFLYTFDLSESDVPCLRAIETSNRYANNTRKYKPKRKTINDASVKQFIGDVYYRQLSPYLISEKIPKDWNSQPVVTVVGDNFRNITEDPTKTVLIVFYNDEPKYELFVKEQLKQLA-----MDFQSKGHSDVVIGVSNYYSNEYYGWHPNRFPKMILFPKGKNTFGIEYQMNMTVEDLKAFIESDGKINQIARFSSEINEPAT 1571
            +L L   NF  A+  +K V+   Y        +    + K   +LK++   + LAK+    +  +  K+ ++G  T          E     T P     +IV ++ KK   P  ++  +  ++  I     + VGFF +  S   + + S+AD   + +     D  +    KV  + I   K + E  +   DY  +  +D   + +F      P V E+      K      +  +LLF  K     +   +     A+ ++ ++   Y++ +  ED +  +  F +  S++P +R I   N   ++  KYKP    I   +VK+F+     ++L P+L+S +IP+DW+S+PV  + G NF  +  +  K V + FY     +        KQLA     +  + K H+D+V+   +  +NE  G   + FP +  FPK      ++Y    T++D   F+ES GK           NEPA 
Sbjct:   26 VLVLTEKNFDEAVAANKHVLVEFYAPWCGHCKALAPEYAKAAGQLKSEKSEIKLAKVDATAETKLGEKFQVQGYPTIKFFKDGKPSEYAGGRTAP-----EIVSWLNKKTGPPAKDLATADAMKDFITKEVAV-VGFFTDKESDAAKAFLSAADGIDDVEFGIVSDKAIASEHKVEGDKIVLFKKFDEGRN---DYDGE--YDFEKIQQFVKANQLPLVTEFSDETAPKIFGGDVKHHILLFTNKTSDGFKATHEAFTGGAKDFKGKVLFVYVNTE-VEDNQRIVEFFGIQSSELPTIRLI---NLADDDMTKYKPTAAEITSENVKEFVQAFLDKKLKPHLLSAEIPEDWDSKPVKVLCGKNFDEVARNKDKNVFVEFYAPWCGH-------CKQLAPIWDQLGEKYKDHADIVVAKMDSTANEVEGVKVHSFPTIKYFPKEGEA--VDYNGGRTLDDFVKFLESGGKAG---------NEPAA 477          
BLAST of Protein disulfide-isomerase vs. Ensembl Nematostella
Match: EDO31634 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SXD7])

HSP 1 Score: 54.6842 bits (130), Expect = 6.228e-8
Identity = 48/148 (32.43%), Postives = 68/148 (45.95%), Query Frame = 3
Query: 1104 SVKQFIGDVYYRQLSPYLISEKIPKDWNSQPVVTVVGDNFRNITEDPTKTVLIVFYND--------EPKYELFVKEQLKQLAMDFQSKGHSDVVIGVSNYYSNEYYGWHPN----RFPKMILFPKGKNTFGIEYQMNMTVEDLKAFIE 1511
            S KQF+ D +   L P++ SE +P+  N  PV  VVG+NF+ I  DPTK VLI FY          EPKY   + E+L+ +          D+VI   +  +N+     PN     FP +   P        +Y+    V D   FI+
Sbjct:  333 SFKQFLEDYFAGSLKPHIKSEPLPES-NDGPVKVVVGENFKEIVNDPTKDVLIEFYAPWCGHCKSLEPKYNE-LGEKLQDV---------KDIVIAKMDATANDA---PPNFSVQGFPTIYWAPANNKENPEKYEGGREVSDFVDFIK 466          
BLAST of Protein disulfide-isomerase vs. Ensembl Nematostella
Match: EDO32930 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STM8])

HSP 1 Score: 49.6766 bits (117), Expect = 2.683e-6
Identity = 48/199 (24.12%), Postives = 87/199 (43.72%), Query Frame = 3
Query:  954 IDGHEDVKSFLYTFDLSES----DVPCLRAIETSNRYANNTRKYK--PKRKTINDASVKQFIGDVYYRQLSPYLISEKIPKDWNSQPVVTVVGDNFRNITEDPTKTVLIVFYNDEPKYELFVKEQLKQLAMDFQSKGHSDVVIGVSNYYSNEYYGWHP-NRFPKMILFPKGKNTFGIEYQMNMTVEDLKAFIESDGKIN 1529
            I   E+ +  L  F L+ES    +V C         +    RK++  P  +  ++ S+++F+ +     L P + S+ +PK  N +PV  VVG  F  I  DP K VLI FY     +   ++   K+L   F++    ++VI   +  +N+    +    FP +           I++     ++DL  F+E    ++
Sbjct:  450 IANEEESEQELKDFGLAESGEEVNVGC---------FDKEGRKFRMDPDEEEFSEDSLREFVEEFKAGNLKPIIKSQPVPKS-NKEPVTVVVGKTFDEIVNDPKKDVLIEFYAPWCGHCKALEPTFKKLGKHFRN--DKNIVIAKIDATANDVPSTYAVEGFPTIYFATSKDKKNPIKFDGGRELKDLIKFVEEKATVS 636          
BLAST of Protein disulfide-isomerase vs. Ensembl Medaka
Match: p4hb (prolyl 4-hydroxylase subunit beta [Source:NCBI gene;Acc:101155742])

HSP 1 Score: 120.168 bits (300), Expect = 1.670e-28
Identity = 117/472 (24.79%), Postives = 201/472 (42.58%), Query Frame = 3
Query:  141 ILNLNISNFQSALDEHKTVIALAYLKDAPEASSAVKLFGKVGNKLKNDNLNMVLAKLKLEYDNNIFSKYNLEGTFGLLALMDHGERFV--EYTQPVNDVDKIVEFIEKKLQEPVTEINDSAKLRSIIENRPCISVGFFNNFTSTDYEEYRSSADWFYECDHYATRDVELFKYFKVNETIPTVKFYKECIHEVFDYPKQLPFDS----NNVLKFFLVCMEPDVAEYGMNWLMKRVLKQPQFTLLLFVKKDDPKKENYIDIMKKYARRYREEINMAYIDIDGHEDVKSFLYTFDLSESDVPCLRAIETSNRYANNTRKYKPKRKTINDASVKQFIGDVYYRQLSPYLISEKIPKDWNSQPVVTVVGDNFRNITEDPTKTVLIVFYNDEPKYELFVKEQLKQLA-----MDFQSKGHSDVVIGVSNYYSNEYYGWHPNRFPKMILFPKGKNTFGIEYQMNMTVEDLKAFIESDGK 1523
            +L L  SNF  AL  H  ++   Y        +    + K    LK +   + L K+    +  +  ++ + G +  +     G++    EY+      D +V +++K+    VT + +     S+I +     +GFF +  S D + Y  +A+   +     T    ++  F+V++    V  +K+     FD  +   FD     + +L F      P V E+      K      +  +L+F+ K     +  ++  KK A  ++ +I   +ID D  +D +  L  F L + + P +R I   +       KYKP+ K I   S+  F       +L P+L+S+ IP+DW+  PV  +VG NF  +  DP K V I FY     +        KQLA     +  + K  SD+V+   +  +NE      + FP +  FP G+    I+Y    T+E    F+ES GK
Sbjct:   24 VLVLKKSNFDEALQAHPNILVEFYAPWCGHCKALAPEYAKAAGMLKAEGSQIRLGKVDATEETELAQEFGVRG-YPTIKFFKGGDKESPKEYSAG-RQADDMVNWLKKRTGPAVTSLTEVTDAESLIADNEVAVIGFFKDANSDDAKAYEKAAEAMDDVPFAITSSDAVYSKFEVSKD--GVVLFKK-----FDEGRNT-FDGELTKDGLLAFVKANQLPLVIEFTEQTAPKIFGGDIKSHILMFLPKAASDFQEKMEQFKKAAAGFKGQILFIFIDSD-VDDNQRILEFFGLKKEECPAIRLITLEDEMT----KYKPESKDITAESIVAFCTQFVEGKLKPHLMSQDIPEDWDKNPVKVLVGKNFEEVAFDPKKNVFIEFYAPWCGH-------CKQLAPIWDKLGEKYKDSSDIVVAKMDSTANEIESVKVHSFPTLKFFPAGEERQVIDYNGERTLEGFTKFLESGGK 473          
BLAST of Protein disulfide-isomerase vs. Ensembl Medaka
Match: pdia2 (protein disulfide-isomerase [Source:NCBI gene;Acc:101164281])

HSP 1 Score: 113.235 bits (282), Expect = 4.613e-26
Identity = 119/479 (24.84%), Postives = 207/479 (43.22%), Query Frame = 3
Query:  129 DKNGILNLNISNFQSALDEHKTVIALAYLKDAPEASSAVKLFGKVGNKLKNDNLNMVLAKLKLEYDNNIFSKYNLEGTFGLLALMDHGERF--VEYTQPVNDVDKIVEFIEKKLQEPVTEINDSAKLRSIIENRPCISVGFFNNFTSTDYEEYRSSADWFYECDHYATRDVELFKYFKVNETIPTVKFYKEC--IHEVFDYPKQLPFDSNNVLKFF----LVCMEPDVAEYGMNWLMKRVLKQPQFTLLLFVKKDDPKKENYIDIMKKYARRYREEINMAYIDIDGHEDVKSFLYTFDLSESDVPCLRAIETSNRYANNTRKYKPKRKTINDASVKQFIGDVYYRQLSPYLISEKIPKDWNSQPVVTVVGDNFRNITEDPTKTVLIVFYN---DEPKYELFVKEQLKQLAMDFQSKGHSDVVIGVSNYYSNEYYGWHPNRFPKMILFPKGKNTFGIEYQMNMTVEDLKAFIESDGKINQ 1532
            ++ GI+ L+I+NF  AL E + ++   Y            ++ +    LK +   M LAK+    +  +  ++N++ +F  + L  +G+R   +EYT        IV++++++      ++N +      I       VGFF+N  S     ++  A    + +   T   E+FK ++V  T   V  +K+       F+  ++   D +N+  F     L  + P   E        RV    +   LLF+      + + ++  K  AR ++ ++   YI ID    V   L  F + E D P +R I    +     +K+K   +   D S++Q   +V      PYL SE+IP+DW+  PV  +V  NF  +  DPTK V + FY       K    + EQL ++  D     H D++I   +  +NE      + FP +  FP G       Y  N  +E L  F+++ G + Q
Sbjct:   63 EEQGIMVLHINNFDRALSETRHLMVEFYAPWCGYCRRFEPIYAEAAGMLKEEGSEMRLAKVDAIEEKELAEEFNVD-SFPTVKLFMNGDRKEPIEYTGK-RTPSGIVQWLKRRSGPGAADLNSADSAAEFINTHNVSVVGFFDNLESEAAAVFKEVAFDLTDVEFAVTASPEVFKEYEV--TANKVVLFKKFDDGRADFELSEEDKLDKHNLTNFIKENSLELIVPFNQETSDKIFTSRV----RLHCLLFINSTVESQMSLLEESKTVAREFKGKV--LYILIDMTTAVSHVLNYFGVLEKDSPTVRMINMDTQ-----KKFKIASEMTID-SLRQLSQEVVDDTAEPYLRSEEIPEDWDKGPVKVLVAKNFETVAMDPTKNVFVEFYAPWCGHCKELAPIWEQLGEIYAD-----HDDIIIAKMDATANEVESVAIDGFPTLKYFPAGDKEV---YTGNRDLETLSKFLDNGGVLPQ 517          
BLAST of Protein disulfide-isomerase vs. Ensembl Medaka
Match: pdia2 (protein disulfide-isomerase [Source:NCBI gene;Acc:101164281])

HSP 1 Score: 107.457 bits (267), Expect = 3.777e-24
Identity = 118/479 (24.63%), Postives = 202/479 (42.17%), Query Frame = 3
Query:  129 DKNGILNLNISNFQSALDEHKTVIALAYLKDAPEASSAVKLFGKVGNKLKNDNLNMVLAKLKLEYDNNIFSKYNLEGTFGLLALMDHGERF--VEYTQPVNDVDKIVEFIEKKLQEPVTEINDSAKLRSIIENRPCISVGFFNNFTSTDYEEYRSSADWFYECDHYATRDVELFKYFKVNETIPTVKFYK--ECIHEVFDYPKQLPFDSNNVLKFF----LVCMEPDVAEYGMNWLMKRVLKQPQFTLLLFVKKDDPKKENYIDIMKKYARRYREEINMAYIDIDGHEDVKSFLYTFDLSESDVPCLRAIETSNRYANNTRKYKPKRKTINDASVKQFIGDVYYRQLSPYLISEKIPKDWNSQPVVTVVGDNFRNITEDPTKTVLIVFYN---DEPKYELFVKEQLKQLAMDFQSKGHSDVVIGVSNYYSNEYYGWHPNRFPKMILFPKGKNTFGIEYQMNMTVEDLKAFIESDGKINQ 1532
            ++ GI+ L+I+NF  AL E + ++   Y            ++ +    LK +   M LAK+    +  +  ++N++ +F  + L  +G+R   +EYT        IV++++++      ++N +      I       VGFF+N  S     ++  A    + +   T   E+FK ++V  T   V  +K  +     F+  ++   D +N+  F     L  + P   E        RV    +   LLF+      + + ++  K  AR ++ ++   YI ID    V   L  F + E D P +R                     IN  + K+F  +V      PYL SE+IP+DW+  PV  +V  NF  +  DPTK V + FY       K    + EQL ++  D     H D++I   +  +NE      + FP +  FP G     I Y  N  +E L  F+++ G + Q
Sbjct:   67 EEQGIMVLHINNFDRALSETRHLMVEFYAPWCGYCRRFEPIYAEAAGMLKEEGSEMRLAKVDAIEEKELAEEFNVD-SFPTVKLFMNGDRKEPIEYTGK-RTPSGIVQWLKRRSGPGAADLNSADSAAEFINTHNVSVVGFFDNLESEAAAVFKEVAFDLTDVEFAVTASPEVFKEYEV--TANKVVLFKKFDDGRADFELSEEDKLDKHNLTNFIKENSLELIVPFNQETSDKIFTSRV----RLHCLLFINSTVESQMSLLEESKTVAREFKGKV--LYILIDMTTAVSHVLNYFGVLEKDSPTVR--------------------MINMDTQKKFKIEVVDDTAEPYLRSEEIPEDWDKGPVKVLVAKNFETVAMDPTKNVFVEFYAPWCGHCKELAPIWEQLGEIYAD-----HDDIIIAKMDATANEVESVAIDGFPTLKYFPAGDKEV-ISYTGNRDLETLSKFLDNGGVLPQ 509          
BLAST of Protein disulfide-isomerase vs. Ensembl Medaka
Match: pdia2 (protein disulfide-isomerase [Source:NCBI gene;Acc:101164281])

HSP 1 Score: 107.071 bits (266), Expect = 5.482e-24
Identity = 117/481 (24.32%), Postives = 201/481 (41.79%), Query Frame = 3
Query:  129 DKNGILNLNISNFQSALDEHKTVIALAYLKDAPEASSAVKLFGKVGNKLKNDNLNMVLAKLKLEYDNNIFSKYNLEGTFGLLALMDHGERF--VEYTQPVNDVDKIVEFIEKKLQEPVTEINDSAKLRSIIENRPCISVGFFNNFTSTDYEEYRSSADWFYECDHYATRDVELFKYFKVNETIPTVKFYKECIHEVFDYPKQLPFDSNNVLKFFLVCMEPDVAEYGMNWLMKRVLKQPQFT------LLLFVKKDDPKKENYIDIMKKYARRYREEINMAYIDIDGHEDVKSFLYTFDLSESDVPCLRAIETSNRYANNTRKYKPKRKTINDASVKQFIGDVYYRQLS--PYLISEKIPKDWNSQPVVTVVGDNFRNITEDPTKTVLIVFYN---DEPKYELFVKEQLKQLAMDFQSKGHSDVVIGVSNYYSNEYYGWHPNRFPKMILFPKGKNTFGIEYQMNMTVEDLKAFIESDGKINQ 1532
            ++ GI+ L+I+NF  AL E + ++   Y            ++ +    LK +   M LAK+    +  +  ++N++ +F  + L  +G+R   +EYT        IV++++++      ++N +      I       VGFF+N  S     ++  A    + +   T   E+FK ++V                           +N V+ F  V ++P     G+    ++      FT       LLF+      + + ++  K  AR ++ ++   YI ID    V   L  F + E D P +R I    +     +K+K   +   D+           RQLS  PYL SE+IP+DW+  PV  +V  NF  +  DPTK V + FY       K    + EQL ++  D     H D++I   +  +NE      + FP +  FP G     I Y  N  +E L  F+++ G + Q
Sbjct:   67 EEQGIMVLHINNFDRALSETRHLMVEFYAPWCGYCRRFEPIYAEAAGMLKEEGSEMRLAKVDAIEEKELAEEFNVD-SFPTVKLFMNGDRKEPIEYTGK-RTPSGIVQWLKRRSGPGAADLNSADSAAEFINTHNVSVVGFFDNLESEAAAVFKEVAFDLTDVEFAVTASPEVFKEYEVT--------------------------ANKVVLFKKVRLKPS---SGLLSTERQCNADKIFTSRVRLHCLLFINSTVESQMSLLEESKTVAREFKGKV--LYILIDMTTAVSHVLNYFGVLEKDSPTVRMINMDTQ-----KKFKIASEMTIDS----------LRQLSQEPYLRSEEIPEDWDKGPVKVLVAKNFETVAMDPTKNVFVEFYAPWCGHCKELAPIWEQLGEIYAD-----HDDIIIAKMDATANEVESVAIDGFPTLKYFPAGDKEV-ISYTGNRDLETLSKFLDNGGVLPQ 493          
BLAST of Protein disulfide-isomerase vs. Ensembl Medaka
Match: pdia2 (protein disulfide-isomerase [Source:NCBI gene;Acc:101164281])

HSP 1 Score: 102.834 bits (255), Expect = 6.468e-23
Identity = 110/431 (25.52%), Postives = 187/431 (43.39%), Query Frame = 3
Query:  273 LKNDNLNMVLAKLKLEYDNNIFSKYNLEGTFGLLALMDHGERF--VEYTQPVNDVDKIVEFIEKKLQEPVTEINDSAKLRSIIENRPCISVGFFNNFTSTDYEEYRSSADWFYECDHYATRDVELFKYFKVNETIPTVKFYK--ECIHEVFDYPKQLPFDSNNVLKFF----LVCMEPDVAEYGMNWLMKRVLKQPQFTLLLFVKKDDPKKENYIDIMKKYARRYREEINMAYIDIDGHEDVKSFLYTFDLSESDVPCLRAIETSNRYANNTRKYKPKRKTINDASVKQFIGDVYYRQLSPYLISEKIPKDWNSQPVVTVVGDNFRNITEDPTKTVLIVFYN---DEPKYELFVKEQLKQLAMDFQSKGHSDVVIGVSNYYSNEYYGWHPNRFPKMILFPKGKNTFGIEYQMNMTVEDLKAFIESDGKINQ 1532
            LK +   M LAK+    +  +  ++N++ +F  + L  +G+R   +EYT        IV++++++      ++N +      I       VGFF+N  S     ++  A    + +   T   E+FK ++V  T   V  +K  +     F+  ++   D +N+  F     L  + P   E        RV    +   LLF+      + + ++  K  AR ++ ++   YI ID    V   L  F + E D P +R I    +     +K+K   +   D S++Q   +V      PYL SE+IP+DW+  PV  +V  NF  +  DPTK V + FY       K    + EQL ++  D     H D++I   +  +NE      + FP +  FP G     I Y  N  +E L  F+++ G + Q
Sbjct:    2 LKEEGSEMRLAKVDAIEEKELAEEFNVD-SFPTVKLFMNGDRKEPIEYTGK-RTPSGIVQWLKRRSGPGAADLNSADSAAEFINTHNVSVVGFFDNLESEAAAVFKEVAFDLTDVEFAVTASPEVFKEYEV--TANKVVLFKKFDDGRADFELSEEDKLDKHNLTNFIKENSLELIVPFNQETSDKIFTSRV----RLHCLLFINSTVESQMSLLEESKTVAREFKGKV--LYILIDMTTAVSHVLNYFGVLEKDSPTVRMINMDTQ-----KKFKIASEMTID-SLRQLSQEVVDDTAEPYLRSEEIPEDWDKGPVKVLVAKNFETVAMDPTKNVFVEFYAPWCGHCKELAPIWEQLGEIYAD-----HDDIIIAKMDATANEVESVAIDGFPTLKYFPAGDKEV-ISYTGNRDLETLSKFLDNGGVLPQ 410          
BLAST of Protein disulfide-isomerase vs. Planmine SMEST
Match: SMESG000001159.1 (SMESG000001159.1)

HSP 1 Score: 1075.85 bits (2781), Expect = 0.000e+0
Identity = 545/547 (99.63%), Postives = 547/547 (100.00%), Query Frame = 3
Query:   51 MIFALTIFFILTSFHHRFVSGDPFEIDKNGILNLNISNFQSALDEHKTVIALAYLKDAPEASSAVKLFGKVGNKLKNDNLNMVLAKLKLEYDNNIFSKYNLEGTFGLLALMDHGERFVEYTQPVNDVDKIVEFIEKKLQEPVTEINDSAKLRSIIENRPCISVGFFNNFTSTDYEEYRSSADWFYECDHYATRDVELFKYFKVNETIPTVKFYKECIHEVFDYPKQLPFDSNNVLKFFLVCMEPDVAEYGMNWLMKRVLKQPQFTLLLFVKKDDPKKENYIDIMKKYARRYREEINMAYIDIDGHEDVKSFLYTFDLSESDVPCLRAIETSNRYANNTRKYKPKRKTINDASVKQFIGDVYYRQLSPYLISEKIPKDWNSQPVVTVVGDNFRNITEDPTKTVLIVFYNDEPKYELFVKEQLKQLAMDFQSKGHSDVVIGVSNYYSNEYYGWHPNRFPKMILFPKGKNTFGIEYQMNMTVEDLKAFIESDGKINQIARFSSEINEPATSEKQHISATXXXXXXXXXXXXXXXXXXXXXQNNTTDKIEL 1691
            MIFALTIFFILTSFHHRFVSGDPFEIDKNGILNLNISNFQSALDEHKTVIALAYLKDAPEASSAVKLFGKVGNKLKNDNLNMVLAKLKLEYDNNIFSKYNLEGTFGLLALMDHGERFVEYTQPVNDVDKIVEFIEKKLQEPVTEINDSAKLRSIIENRPCISVGFFNNFTSTDYEEYRSSADWFYECDHYATRDVELFKYFKVNETIPTVKFYKECIHEVFDYPKQLPFDSNNVLKFFLVCMEPDVAEYGMNWLMKRVLKQPQFTLLLFVKKDDPKKENYIDIMKKYARRYREEINMAYIDIDGHEDVKSFLYTFDLSESDVPCLRAIETSNRYANNTRKYKPKRKTINDASVKQFIGDVYYRQLSPYLISEKIPKDWNSQPVVTVVGDNFRNITEDPTKTVLIVFYNDEPKYELFVKEQLKQLA+DFQSKGHSDVVIGVSNYYSNEYYGWHPNRFPKMILFPKGKNTFGIEYQMNMTV+DLKAFIESDGKINQIARFSSEINEPATSEKQHISATENIESDEEGIVEEEIVNSESEQNNTTDKIEL
Sbjct:    1 MIFALTIFFILTSFHHRFVSGDPFEIDKNGILNLNISNFQSALDEHKTVIALAYLKDAPEASSAVKLFGKVGNKLKNDNLNMVLAKLKLEYDNNIFSKYNLEGTFGLLALMDHGERFVEYTQPVNDVDKIVEFIEKKLQEPVTEINDSAKLRSIIENRPCISVGFFNNFTSTDYEEYRSSADWFYECDHYATRDVELFKYFKVNETIPTVKFYKECIHEVFDYPKQLPFDSNNVLKFFLVCMEPDVAEYGMNWLMKRVLKQPQFTLLLFVKKDDPKKENYIDIMKKYARRYREEINMAYIDIDGHEDVKSFLYTFDLSESDVPCLRAIETSNRYANNTRKYKPKRKTINDASVKQFIGDVYYRQLSPYLISEKIPKDWNSQPVVTVVGDNFRNITEDPTKTVLIVFYNDEPKYELFVKEQLKQLAVDFQSKGHSDVVIGVSNYYSNEYYGWHPNRFPKMILFPKGKNTFGIEYQMNMTVDDLKAFIESDGKINQIARFSSEINEPATSEKQHISATENIESDEEGIVEEEIVNSESEQNNTTDKIEL 547          
BLAST of Protein disulfide-isomerase vs. Planmine SMEST
Match: SMESG000023147.1 (SMESG000023147.1)

HSP 1 Score: 135.191 bits (339), Expect = 8.960e-34
Identity = 118/474 (24.89%), Postives = 218/474 (45.99%), Query Frame = 3
Query:  129 DKNGILNLNISNFQSALDEHKTVIALAYLKDAPEASSAVKLFGKVGNKLKNDNLNMVLAKLKLEYDNNIFSKYNLEGTFGLLALMDHGERFVEYTQPVNDVDKIVEFIEKKLQEPVTEINDSAKLRSIIENRPCISVGFFNNFTSTDYEEYRSSADWFYECDHYATRDVELFKYFKVNETIPTVKFYKECIHEVFDYPKQ---LPFDSNNVLKFFLVCMEPDVAEYGMNWLMKRVLKQPQFTLLLFVKKDDPKKENYIDIMKKY---ARRYREEINMAYIDIDGHEDVKSFLYTFDLSESDVPCLRAIETSNRYANNTRKYKPKRKTINDASVKQFIGDVYYRQLSPYLISEKIPKDWNSQPVVTVVGDNFRNITEDPTKTVLIVFYNDEPKYELFVKEQLKQLAMDFQSKG-----HSDVVIGVSNYYSNEYYGWHPNRFPKMILFPKGKNTFGIEYQMNMTVEDLKAFIESD 1517
            ++ G+L L  SNF   ++++K V+   Y        +    +     KLK  N  + LAK+    +N++ SK+ ++G +  L     G + ++Y       D I+ ++EKK   P   +    + +++IE++  + VGFF +  S   + + S AD   +     T    +F  FKV+     V F K      FD  +     PF   ++  F      P V E+      K      +  +L F+ K   K E Y ++  ++   A+++  ++    I+ D  ED    L  F ++++D P  R I+  +    +  K+KP   TI+  ++  F+  V   ++ P++++++IP+DW+  PV  +VG NF ++  D +K V + FY     +        KQLA  +   G     ++D+VI   +  +NE  G     FP +  FPK  +   ++++ + T+E  K FI+S+
Sbjct:   22 EEEGVLVLTNSNFNEVIEKNKYVLVEFYAPWCGHCKALAPEYASAAEKLKEKNSIIKLAKVDATVENDLASKFKIQG-YPTLKFFKDG-KVMDYGGG-RTADTIISWLEKKTGPPAATLKSVEEAKALIESKDVVVVGFFKDQASAAAKAFESVADSKDDVVFGVTSQKAVFDEFKVSSDDSIVLFKK------FDEGRNDFTGPFVDKDIRTFIDKYQLPIVIEFNQETAGKIFGGSIKKHVLSFISK---KSEKYAELKGQFETSAKKFLGQVLFVIINTD-EEDNDRVLEFFGMAKTDTPSFRMIQLED----DMVKFKPDDATISSENLNLFVQSVLDGKVKPHMMTQEIPEDWDKNPVKVLVGKNFDSVARDKSKAVFVEFYAPWCGH-------CKQLAPIWDQLGETYKDNTDIVIAKMDSTANEVEGVRIQSFPTIKYFPKDSDEM-VDFEGDRTLETFKKFIDSN 470          
BLAST of Protein disulfide-isomerase vs. Planmine SMEST
Match: SMESG000009885.1 (SMESG000009885.1)

HSP 1 Score: 92.4337 bits (228), Expect = 1.744e-19
Identity = 86/383 (22.45%), Postives = 172/383 (44.91%), Query Frame = 3
Query:  414 QPVNDVDKIVEFIEKKLQEPVTEINDSAKLRSIIENRPCISVGFFNNFTSTDYEEYRSSADWFYECDHYATRDVELFKYFKVNETIPTVKFYKECIHEVFDYPK---QLPFDSNNVLKFFLVCMEPDVAEYGMNWLMKRVLKQPQF--TLLL--FVKKDDPKKENYI---DIMKKYARRYREEINMAYIDIDGHEDVKSFLYTFDLSESDVPCLRAIETSNRYANNTRKYKPKRKTINDASVKQFIGDVYYRQLSPYLISEKIPKDWNSQPVVTVVGDNFRNITEDPTKTVLIVFYNDEPKYELFVKEQLKQLAMDFQSKGHSDVVIGVSNYYSNEYYGWHPNRFPKMILFPKGKNTFGIEYQMNMTVEDLKAFIESDGKINQ 1532
            + V    +  +++ +++ E    ++    L+ ++E    ++VGFF N ++   + ++  A    +       +  LF  + +      V F +      FD P+    + F   NV +F +    P ++E+       R  K P+   T +L   V   D K + +     +++K A+ +  ++   Y+ +D +     FL    L++ D+P  R +E    Y   T  Y+P  + +    +  F+ +V    LSPY  SEK+ + WN  PV  +VG N+  + ++  ++V ++   ++ K    ++     LA+ FQ +   +V I   +   N+       +FP   L+PKG     IE+    T+ DLK F++S+G +++
Sbjct:  112 RAVESTLRFAQWVFERMDEEFIIVDRLEILKELVETELFMAVGFFKNISALKCKTFQKVAKSTEKLPWIIVTNETLFNVYSIRLDDSIVMFRQ------FDDPRIDFAVEFTEKNVKEFIIKYSSPLLSEFH-----NRKRKIPEIFDTAILNYLVSIIDEKHKKFTLHKMMLQKSAKLFLGKVKFVYVKLD-NPATHYFLTVLRLNKEDIPTYRFMELFPDY--RTVIYRPVDEKMTAKRIVTFVQNVLDGNLSPYYRSEKLHQRWNKYPVKMLVGSNYEEVVKNENRSVFVLLCAEKCKQCSKLRHMWHNLAIQFQDQ--PEVWIATIDVDKNDIRNARVEKFPTFFLYPKGSQK-AIEFDGERTLNDLKQFVDSNGTLSR 477          
BLAST of Protein disulfide-isomerase vs. Planmine SMEST
Match: SMESG000074835.1 (SMESG000074835.1)

HSP 1 Score: 79.7221 bits (195), Expect = 9.612e-16
Identity = 84/374 (22.46%), Postives = 165/374 (44.12%), Query Frame = 3
Query:  426 DVDKIVEFIEKKLQEPVTEINDSAKLRSIIENRPCISVGFFNNFTSTDYEEYRSSADW--FYECDHYATRDVELFKYFKVNETIPTVKFYKECIHEVFDYPKQLPFDSNNVLKFFLVCMEPDVAEYGMNWLMKRVLKQP-QFTLLLFVKKDDPKKENYIDIMKKYARRYREEINMAYIDIDGHEDVKSFLYTFDLSESDVPCLRAIETSNRYANNTRKYKPKRKTINDASVKQFIGDVYYRQLSPYLISEKIPKDWNSQPVVTVVGDNFRNITEDPTKTVLIVFYNDEPKYELFVKEQLKQLAMDFQSKGHSDVVIGVSNYYSNEYYGWHPNRFPKMILFPKGKNTFGIEYQMNMTVEDLKAFIESDGKINQIA 1538
            D +    FI +    PV  I +  +L  +I     + VG+F+N +S   + Y+++     + +C   +  DV+       +  I  VK + +   E  +Y       S  + +F  +   P +  Y  N    ++ + P +  LL+F+ K     +++++ +    +  R +      DI    D+   L   DL+ SD P    ++  +       KY    K+I    + +    +      P   SE +  +WN+  V+++VG+N++N+TE+   TVL+ FY+    +   + +  ++L   +++K  SD+VI   N   NE  G+     P + L+ K  N   + ++    + +   FIE+DGK ++I 
Sbjct:   18 DYEGFSNFINEIFINPVLRIRNKDELDVLIMKEESLVVGYFHNESSIPADSYKTACLLVNYTKCVITSNEDVKYILKTNEDNHINLVK-HNDQSTEFLNYNGNYT-SSKEISEFIQINDLPAIFLYN-NQTKSKIFQNPIKLHLLIFIDKSLLNFDDFLEGISLALKTIRGKAISILFDIKTSPDIDETLNILDLNISDTPTFAFVKVEDF---EELKYPSFTKSITSEHILKLFEKIRNGSRRPNFKSESLSPNWNTSNVISLVGENYKNVTENKNFTVLVNFYSPSCHHSGNLDKIWEELGEFYKNK--SDIVISKINSNLNEIDGFPIYSTPSVFLYRK-TNKIPLRFENERNLNNFIEFIENDGKHSEIT 382          
BLAST of Protein disulfide-isomerase vs. Planmine SMEST
Match: SMESG000069732.1 (SMESG000069732.1)

HSP 1 Score: 70.4774 bits (171), Expect = 1.403e-12
Identity = 108/493 (21.91%), Postives = 207/493 (41.99%), Query Frame = 3
Query:   63 LTIFFILTSFHHRFVSGDPFEIDKNGILNLNISNFQSALDEHKTVIALAYLKDAPEASSAVKLFGKVGNKLKN---DNLNMVLAKLKLEYDNNIFSKYNLEGTFGLLALMDHGERFVEYTQPVNDVDKIVEFIEKKLQEPVTEINDSAKLRSIIENRPCISVGFFNNFTSTDYEEYRSSADWFYECDHYATRDVELFKYFKVNETIPTVKFYKECIHEVFDYPKQLPFDSNNVLKFFLVCMEPDVAEYGMNWLMKRVLKQPQFTLLLFVKKDDPKKENYIDIMKKYARRYREEINMAYIDIDGHEDVKSFLYTFDLSESDVPCLRAIETSNRYANNTRKYKPKRKTINDASVKQFIGDVYYRQLSPYLISEKIPKDWNSQPVVTVVGDNFRNITEDPTKTVLIVFYND--------EPKYELFVKEQLKQLAMDFQSKGHSDVVIGVSNYYSNEYYGWHPNRFPKMILFPKGKNTFGIEYQMNMTVEDLKAFI 1508
            L IFF+  +        D  EI+ N +  +N   F+  +++HK ++   Y   AP    + KL     N  KN       + L K+ +  + ++ +K+ ++    ++   +  +R + Y++  + +  I+ ++  K+ + +  +N +  L  + +    + V   NN    D   +  +A+   +   +AT +  LF     N         ++  + +  + K    +  +V+KF      P V  Y  + +  +V +     +   V  DD  +E + ++  + A     EI     D+  +    S +  F++  S++P L   +     A + R + P    IN   + QF+ DV   ++  +L S+ IP++WNS+PV  +VG NF  +  +  KTV + FY          EP +E   KE L             D++I   +   N+   +    FP + LF K  N   ++Y    T E LK F+
Sbjct:    8 LLIFFLPAAIF------DELEIE-NDVFVVNNETFEELINDHKPILINFY---APWCKFSQKLLPHFENAAKNLLQMESRIKLGKVDVTVETDLANKFKIKSYPTIILFKE--DRQIPYSKAHHHL-TILNWLISKVDKLIISVNSTDSLDEVRQKTDVLFV--INNDIMGD--TFVGAAELIDDV-QFATMEKHLFHSLFSNTDQTKAILIRKIDNNLIPFGKG-EINQEDVIKFVRSNEIPSVVRYSFD-IGGKVFQNSHRFMHFMVFMDDKFEEAHKEL--EEAAINHPEITFVMTDVTDNT-TSSLIKHFNVDLSNLPHLVLSD-----AKHKRLFLPGFNEINGKRIDQFLMDVKNGKIGQFLKSQNIPENWNSEPVKILVGKNFEEVALNKQKTVFVEFYAPWCNYCKQLEPIWERLAKELLDV----------PDLIIAKLDKTENDIKNFEIKSFPTLKLFLKDSNEV-VDYSGPRTRERLKEFL 461          
The following BLAST results are available for this feature:
BLAST of Protein disulfide-isomerase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PDIA23.897e-3324.31protein disulfide isomerase family A member 2 [Sou... [more]
P4HB5.983e-3223.52prolyl 4-hydroxylase subunit beta [Source:HGNC Sym... [more]
PDIA21.473e-3124.31protein disulfide isomerase family A member 2 [Sou... [more]
P4HB1.576e-2023.87prolyl 4-hydroxylase subunit beta [Source:HGNC Sym... [more]
P4HB1.099e-1927.83prolyl 4-hydroxylase subunit beta [Source:HGNC Sym... [more]
back to top
BLAST of Protein disulfide-isomerase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pdi-21.915e-2123.11Protein disulfide-isomerase 2 [Source:UniProtKB/S... [more]
pdi-21.915e-2123.11Protein disulfide-isomerase 2 [Source:UniProtKB/S... [more]
pdi-22.494e-1927.83Protein disulfide-isomerase 2 [Source:UniProtKB/S... [more]
pdi-22.494e-1927.83Protein disulfide-isomerase 2 [Source:UniProtKB/S... [more]
pdi-25.354e-1628.79Protein disulfide-isomerase 2 [Source:UniProtKB/S... [more]
back to top
BLAST of Protein disulfide-isomerase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Pdi1.161e-2621.79gene:FBgn0286818 transcript:FBtr0346644[more]
Pdi1.161e-2621.79gene:FBgn0286818 transcript:FBtr0075648[more]
back to top
BLAST of Protein disulfide-isomerase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
p4hb1.110e-3024.84prolyl 4-hydroxylase, beta polypeptide [Source:ZFI... [more]
p4hb1.110e-3024.84prolyl 4-hydroxylase, beta polypeptide [Source:ZFI... [more]
pdia25.714e-2523.27protein disulfide isomerase family A, member 2 [So... [more]
pdia26.969e-2523.27protein disulfide isomerase family A, member 2 [So... [more]
zgc:1364721.225e-1318.82zgc:136472 [Source:ZFIN;Acc:ZDB-GENE-060421-2552][more]
back to top
BLAST of Protein disulfide-isomerase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dmd.26.952e-3325.85dystrophin, gene 2 [Source:Xenbase;Acc:XB-GENE-852... [more]
dmd.29.645e-3325.85dystrophin, gene 2 [Source:Xenbase;Acc:XB-GENE-852... [more]
dmd.21.046e-3225.85dystrophin, gene 2 [Source:Xenbase;Acc:XB-GENE-852... [more]
p4hb2.655e-2221.21prolyl 4-hydroxylase subunit beta [Source:NCBI gen... [more]
p4hb3.399e-2221.44prolyl 4-hydroxylase subunit beta [Source:NCBI gen... [more]
back to top
BLAST of Protein disulfide-isomerase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
P4hb6.392e-2823.33prolyl 4-hydroxylase, beta polypeptide [Source:MGI... [more]
Pdia21.142e-2723.46protein disulfide isomerase associated 2 [Source:M... [more]
Pdia26.733e-2623.46protein disulfide isomerase associated 2 [Source:M... [more]
Pdilt1.948e-1423.35protein disulfide isomerase-like, testis expressed... [more]
Pdia23.364e-928.68protein disulfide isomerase associated 2 [Source:M... [more]
back to top
BLAST of Protein disulfide-isomerase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q13087|PDIA2_HUMAN1.871e-3224.31Protein disulfide-isomerase A2 OS=Homo sapiens OX=... [more]
sp|P21195|PDIA1_RABIT2.403e-3224.00Protein disulfide-isomerase OS=Oryctolagus cunicul... [more]
sp|P09102|PDIA1_CHICK1.239e-3124.22Protein disulfide-isomerase OS=Gallus gallus OX=90... [more]
sp|P07237|PDIA1_HUMAN2.873e-3123.52Protein disulfide-isomerase OS=Homo sapiens OX=960... [more]
sp|Q5R5B6|PDIA1_PONAB6.597e-3123.81Protein disulfide-isomerase OS=Pongo abelii OX=960... [more]
back to top
BLAST of Protein disulfide-isomerase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4X2JWR01.859e-3725.96Protein disulfide-isomerase OS=Vombatus ursinus OX... [more]
A0A1I8JH111.855e-3627.77Protein disulfide-isomerase OS=Macrostomum lignano... [more]
A0A1I8HRX21.281e-3526.65Protein disulfide-isomerase OS=Macrostomum lignano... [more]
A0A2H8TSD72.787e-3425.91Protein disulfide-isomerase OS=Melanaphis sacchari... [more]
G3VLI11.164e-3324.49Protein disulfide isomerase family A member 2 OS=S... [more]
back to top
BLAST of Protein disulfide-isomerase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
p4hb6.969e-3325.42prolyl 4-hydroxylase subunit beta [Source:NCBI gen... [more]
pdia28.977e-3123.88protein disulfide isomerase family A, member 2 [So... [more]
zgc:1364725.186e-1320.55protein disulfide-isomerase-like [Source:NCBI gene... [more]
zgc:1364726.648e-1320.55protein disulfide-isomerase-like [Source:NCBI gene... [more]
zgc:1364721.272e-1221.17protein disulfide-isomerase-like [Source:NCBI gene... [more]
back to top
BLAST of Protein disulfide-isomerase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000002052.11.499e-1323.45pep scaffold:Pmarinus_7.0:GL480798:2613:20969:-1 g... [more]
back to top
BLAST of Protein disulfide-isomerase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
PDI12.200e-826.06Protein disulfide isomerase; multifunctional oxido... [more]
back to top
BLAST of Protein disulfide-isomerase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO368307.055e-2823.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO316346.228e-832.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO329302.683e-624.12Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein disulfide-isomerase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
p4hb1.670e-2824.79prolyl 4-hydroxylase subunit beta [Source:NCBI gen... [more]
pdia24.613e-2624.84protein disulfide-isomerase [Source:NCBI gene;Acc:... [more]
pdia23.777e-2424.63protein disulfide-isomerase [Source:NCBI gene;Acc:... [more]
pdia25.482e-2424.32protein disulfide-isomerase [Source:NCBI gene;Acc:... [more]
pdia26.468e-2325.52protein disulfide-isomerase [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Protein disulfide-isomerase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000001159.10.000e+099.63SMESG000001159.1[more]
SMESG000023147.18.960e-3424.89SMESG000023147.1[more]
SMESG000009885.11.744e-1922.45SMESG000009885.1[more]
SMESG000074835.19.612e-1622.46SMESG000074835.1[more]
SMESG000069732.11.403e-1221.91SMESG000069732.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30028496 ID=SMED30028496|Name=Protein disulfide-isomerase|organism=Schmidtea mediterranea sexual|type=transcript|length=1771bp
GAAAAATACTTGTCCTTTCAGAAACTAATTAATTATCCAAATTAAGGAAG
ATGATTTTTGCACTCACCATATTTTTTATTTTAACAAGTTTTCATCATCG
ATTTGTTAGTGGAGATCCATTTGAAATCGATAAAAACGGAATTTTGAATT
TGAACATCAGCAATTTTCAGAGTGCTCTAGATGAACATAAAACAGTCATT
GCTCTGGCATATCTAAAGGATGCTCCAGAAGCGTCATCGGCCGTAAAATT
ATTTGGGAAAGTTGGAAATAAATTGAAAAATGATAACTTGAATATGGTTC
TAGCAAAACTGAAATTAGAATATGACAACAATATTTTTTCAAAATATAAT
CTTGAAGGAACGTTTGGATTGTTGGCACTAATGGATCATGGAGAACGTTT
CGTAGAGTACACTCAACCGGTTAACGATGTGGATAAAATTGTCGAGTTTA
TTGAAAAGAAACTCCAAGAACCGGTCACGGAAATCAATGACAGTGCTAAA
TTAAGATCTATTATTGAGAATCGACCTTGTATATCGGTTGGGTTTTTTAA
CAATTTCACCAGTACAGATTACGAAGAATATCGATCCAGTGCTGACTGGT
TTTATGAATGCGACCATTATGCTACCAGAGATGTGGAGTTGTTTAAATAT
TTTAAAGTAAATGAAACGATTCCAACTGTAAAGTTTTACAAAGAGTGTAT
TCATGAAGTGTTTGATTATCCAAAGCAATTGCCATTTGACTCGAATAATG
TTTTGAAGTTCTTTCTCGTCTGCATGGAACCAGATGTTGCTGAATATGGA
ATGAATTGGTTGATGAAACGTGTACTGAAACAGCCTCAATTCACTTTGCT
ATTATTTGTGAAAAAAGATGATCCGAAAAAAGAAAATTATATTGATATTA
TGAAGAAGTACGCTAGGAGATACAGAGAAGAAATAAACATGGCATATATT
GACATTGATGGTCATGAAGATGTAAAATCATTTCTGTATACATTTGACTT
GTCAGAATCAGATGTCCCTTGCTTACGTGCTATTGAAACGTCAAACAGGT
ATGCAAATAACACTCGGAAGTATAAACCAAAACGAAAAACAATAAATGAT
GCTTCAGTCAAACAATTCATAGGGGACGTTTATTATCGACAATTGTCTCC
ATATTTAATTTCGGAAAAAATTCCAAAAGATTGGAATTCTCAACCAGTTG
TGACTGTTGTTGGTGATAATTTCAGAAATATAACAGAAGATCCAACAAAA
ACGGTTTTAATAGTGTTTTATAATGACGAACCAAAATACGAATTATTCGT
CAAAGAACAACTAAAACAATTAGCAATGGATTTTCAATCTAAAGGGCATT
CTGATGTGGTCATAGGAGTCTCCAATTACTATAGCAATGAATATTACGGT
TGGCACCCAAATCGATTTCCGAAAATGATTTTATTTCCTAAAGGAAAAAA
TACGTTTGGAATCGAATATCAAATGAATATGACAGTTGAGGACTTAAAAG
CATTTATTGAAAGTGATGGAAAGATAAATCAAATAGCGAGATTTTCCAGT
GAAATAAATGAGCCAGCAACGTCTGAAAAACAGCATATTTCAGCAACAGA
AAATATTGAAAGTGATGAAGAAGGAATTGTGGAAGAAGAAATTGTTAATA
GTGAAAGTGAACAAAACAATACAACGGATAAAATTGAATTATAAACTGTT
ACAGATAAATATATTAAGTTGGTTTAGAATTCTTTTTTGTTACAGTTAAT
AAATTTTTATGTAGTTTGAAA
back to top

protein sequence of SMED30028496-orf-1

>SMED30028496-orf-1 ID=SMED30028496-orf-1|Name=SMED30028496-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=548bp
MIFALTIFFILTSFHHRFVSGDPFEIDKNGILNLNISNFQSALDEHKTVI
ALAYLKDAPEASSAVKLFGKVGNKLKNDNLNMVLAKLKLEYDNNIFSKYN
LEGTFGLLALMDHGERFVEYTQPVNDVDKIVEFIEKKLQEPVTEINDSAK
LRSIIENRPCISVGFFNNFTSTDYEEYRSSADWFYECDHYATRDVELFKY
FKVNETIPTVKFYKECIHEVFDYPKQLPFDSNNVLKFFLVCMEPDVAEYG
MNWLMKRVLKQPQFTLLLFVKKDDPKKENYIDIMKKYARRYREEINMAYI
DIDGHEDVKSFLYTFDLSESDVPCLRAIETSNRYANNTRKYKPKRKTIND
ASVKQFIGDVYYRQLSPYLISEKIPKDWNSQPVVTVVGDNFRNITEDPTK
TVLIVFYNDEPKYELFVKEQLKQLAMDFQSKGHSDVVIGVSNYYSNEYYG
WHPNRFPKMILFPKGKNTFGIEYQMNMTVEDLKAFIESDGKINQIARFSS
EINEPATSEKQHISATENIESDEEGIVEEEIVNSESEQNNTTDKIEL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000499cell
PLANA:0000016pharynx
PLANA:0000418head
PLANA:0000420parapharyngeal region
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR036249Thioredoxin-like_sf
IPR012336Thioredoxin-like_fold
Vocabulary: molecular function
TermDefinition
GO:0003756protein disulfide isomerase activity
GO:0016853isomerase activity
Vocabulary: cellular component
TermDefinition
GO:0005783endoplasmic reticulum
GO:0005788endoplasmic reticulum lumen
GO:0005886plasma membrane
GO:0016020membrane
Vocabulary: biological process
TermDefinition
GO:0006457protein folding
GO:0019511peptidyl-proline hydroxylation
GO:0034976response to endoplasmic reticulum stress
GO:0045454cell redox homeostasis
GO:1902175regulation of oxidative stress-induced intrinsic apoptotic signaling pathway
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePFAMPF13848Thioredoxin_6coord: 168..357
e-value: 3.2E-17
score: 63.1
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 505..547
NoneNo IPR availablePANTHERPTHR18929PROTEIN DISULFIDE ISOMERASEcoord: 16..487
NoneNo IPR availableCDDcd02982PDI_b'_familycoord: 251..360
e-value: 4.2749E-10
score: 54.9702
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..21
score: 0.711
IPR036249Thioredoxin-like superfamilyGENE3DG3DSA:3.40.30.10coord: 142..248
e-value: 4.5E-8
score: 35.3
IPR036249Thioredoxin-like superfamilyGENE3DG3DSA:3.40.30.10coord: 376..492
e-value: 1.3E-12
score: 49.7
IPR036249Thioredoxin-like superfamilyGENE3DG3DSA:3.40.30.10coord: 249..375
e-value: 7.1E-22
score: 80.1
IPR036249Thioredoxin-like superfamilyGENE3DG3DSA:3.40.30.10coord: 24..141
e-value: 6.6E-7
score: 31.1
IPR036249Thioredoxin-like superfamilySUPERFAMILYSSF52833Thioredoxin-likecoord: 379..488
IPR036249Thioredoxin-like superfamilySUPERFAMILYSSF52833Thioredoxin-likecoord: 242..379
IPR036249Thioredoxin-like superfamilySUPERFAMILYSSF52833Thioredoxin-likecoord: 143..249
IPR036249Thioredoxin-like superfamilySUPERFAMILYSSF52833Thioredoxin-likecoord: 31..147