Glyco_hydro_19_cat domain-containing protein

Overview
NameGlyco_hydro_19_cat domain-containing protein
Smed IDSMED30028495
Length (bp)778
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Glyco_hydro_19_cat domain-containing protein (SMED30028495) t-SNE clustered cells

Violin plots show distribution of expression levels for Glyco_hydro_19_cat domain-containing protein (SMED30028495) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Glyco_hydro_19_cat domain-containing protein (SMED30028495) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Glyco_hydro_19_cat domain-containing protein (SMED30028495) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30028495

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymaSMED30028495SMESG000047827.1 SMESG000047826.1 dd_Smed_v4_208_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30028495SMESG000047827.1 SMESG000047826.1 OX_Smed_1.0.03435ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
body wall musculatureSMED30028495SMESG000047827.1 SMESG000047826.1 dd_Smed_v4_208_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Glyco_hydro_19_cat domain-containing protein vs. UniProt/SwissProt
Match: sp|P42820|CHIP_BETVU (Acidic endochitinase SP2 OS=Beta vulgaris OX=161934 GN=SP2 PE=1 SV=1)

HSP 1 Score: 93.9745 bits (232), Expect = 1.799e-21
Identity = 63/152 (41.45%), Postives = 78/152 (51.32%), Query Frame = 3
Query:  282 RELAMFLANILHESDGLRAKSEYQ-------CQKDGCKGQYDSGPKGVVYYGRGYMQLSWSYNYKAASKALYGDENKLLNNPDLVANDENVAWDTTFWYWKANVHIAPGVTAGKFGASIKAINGALECGGPN-ERAKKRFVNYGKILKAFNV 713
            RE+A F A+I HE+  L    E         C +D    QY     G  YYGRG +QLSW+YNY  A +A+  D    L NP+ VA D N ++    W+W  NVH    V    FGA+ KAINGALEC G N ++A  R   Y K    F V
Sbjct:  137 REIAAFFAHISHETTNLCHIEERDGDVGDAYCDQDK-AAQYPCA-AGKKYYGRGPLQLSWNYNYALAGQAIGFDG---LGNPEKVATDVNTSFKAAMWFWMTNVH---SVMNQGFGATTKAINGALECNGQNQDQANDRIQFYKKYCADFGV 280          
BLAST of Glyco_hydro_19_cat domain-containing protein vs. UniProt/SwissProt
Match: sp|Q5NTA4|CHI4_CRYJA (Endochitinase 4 OS=Cryptomeria japonica OX=3369 PE=1 SV=1)

HSP 1 Score: 92.0485 bits (227), Expect = 9.446e-21
Identity = 58/159 (36.48%), Postives = 80/159 (50.31%), Query Frame = 3
Query:  252 GIPKSDIATVRELAMFLANILHESDGLRAKSEYQCQKDGCKGQYDSGP--KGVVYYGRGYMQLSWSYNYKAASKALYGDENKLLNNPDLVANDENVAWDTTFWYWKANVHIAPGVTAGK-FGASIKAINGALECGGPNERAKKRFVN-YGKILKAFNVN 716
            G   S     RE+A F AN  HE+ G     E       C       P   G  Y+GRG +QLSW+YNY AA   +  D    LNNP++V  D  +++ T  W+W  N +    +T+G+ FGA+I+AIN ++EC G N       VN Y K  +  NV+
Sbjct:  120 GTSGSSDVNKREIAAFFANAAHETGGFCYIEEQNPTSIYCDASNTQYPCASGKTYHGRGPLQLSWNYNYGAAGSYIQFDG---LNNPEIVGTDSTISFKTAVWFWMVNSNCHTAITSGQGFGATIRAIN-SMECDGGNAATVASRVNYYQKFCQQLNVD 274          
BLAST of Glyco_hydro_19_cat domain-containing protein vs. UniProt/SwissProt
Match: sp|Q7Y1Z0|CHI5_ORYSJ (Chitinase 5 OS=Oryza sativa subsp. japonica OX=39947 GN=Cht5 PE=2 SV=1)

HSP 1 Score: 90.5077 bits (223), Expect = 3.377e-20
Identity = 58/150 (38.67%), Postives = 82/150 (54.67%), Query Frame = 3
Query:  261 KSDIATVRELAMFLANILHES------DGLRAKSEYQCQKDGCKGQYDSGPKGVVYYGRGYMQLSWSYNYKAASKALYGDENKLLNNPDLVANDENVAWDTTFWYWKANVHIAPGVTAGKFGASIKAINGALECGGPNERAKKRFVNYGK 692
            +++  + RE+A F A++ HE+      + +   S   C K+    Q+   P G  YYGRG +Q+SW+YNY  A + +  D    L +PD VA D  +++ T  W+W  NVH    V    FGA+I+AINGALEC G N  A    VNY K
Sbjct:  132 RTNDDSKREIAAFFAHVTHETGHMCYINEINGASMDYCDKN--NKQWPCQP-GKKYYGRGPLQISWNYNYGPAGQNIGFDG---LRDPDRVAQDPTISFKTALWFWMNNVHQ---VMLQGFGATIRAINGALECNGKNPGAVNARVNYYK 272          
BLAST of Glyco_hydro_19_cat domain-containing protein vs. UniProt/SwissProt
Match: sp|O04138|CHI4_ORYSJ (Chitinase 4 OS=Oryza sativa subsp. japonica OX=39947 GN=Cht4 PE=2 SV=2)

HSP 1 Score: 90.1225 bits (222), Expect = 4.703e-20
Identity = 57/147 (38.78%), Postives = 80/147 (54.42%), Query Frame = 3
Query:  261 KSDIATVRELAMFLANILHESDGLRAKSEYQ-CQKDGCKGQYDSGP--KGVVYYGRGYMQLSWSYNYKAASKALYGDENKLLNNPDLVANDENVAWDTTFWYWKANVHIAPGVTAGKFGASIKAINGALECGGPNERAKKRFVNYGK 692
            +++  + RE+A F A++ HE+  +   +E      D C       P   G  YYGRG +Q+SW++NY  A K +  D    L +PD VA D  +++ T  W+W  NVH    V +  FGA+I+AINGALEC G N  A    VNY K
Sbjct:  129 RTNDDSKREIAAFFAHVTHETGHMCYINEINGANMDYCDKSNKQWPCQPGKKYYGRGPLQISWNFNYGPAGKNIGFDG---LRDPDKVAQDPTISFKTALWFWMNNVHQ---VMSQGFGATIRAINGALECNGKNPGAVNARVNYYK 269          
BLAST of Glyco_hydro_19_cat domain-containing protein vs. UniProt/SwissProt
Match: sp|P29022|CHIA_MAIZE (Endochitinase A OS=Zea mays OX=4577 GN=CHIA PE=1 SV=1)

HSP 1 Score: 89.7373 bits (221), Expect = 7.395e-20
Identity = 64/188 (34.04%), Postives = 89/188 (47.34%), Query Frame = 3
Query:  171 TEKQFQSAVTSCGYPSPPSVKYKAFIQGIPKSDIATVRELAMFLANILHESDGLRAKSEYQCQKDGCKGQYDSGP--KGVVYYGRGYMQLSWSYNYKAASKALYGDENKLLNNPDLVANDENVAWDTTFWYWKANVHIAPGVTAGKFGASIKAINGALECGGPN-ERAKKRFVNYGKILKAFNVNESP 725
            T   F SAV +          Y  F  G   +++   RE+A F A++ HE+      SE       C       P   G  YYGRG +Q+SW+YNY  A + +  +    L +P+ VA D  +A+ T  W+W  NVH   GV    FGA+I+AINGALEC G N  +   R   Y +  +   V+  P
Sbjct:  107 TRSAFLSAVNA----------YPGFAHG--GTEVEGKREIAAFFAHVTHETGHFCYISEINKSNAYCDASNRQWPCAAGQKYYGRGPLQISWNYNYGPAGRDIGFNG---LADPNRVAQDAVIAFKTALWFWMNNVH---GVMPQGFGATIRAINGALECNGNNPAQMNARVGYYKQYCQQLRVDPGP 276          
BLAST of Glyco_hydro_19_cat domain-containing protein vs. TrEMBL
Match: A0A098VVG6 (Glyco_hydro_19_cat domain-containing protein (Fragment) OS=Mitosporidium daphniae OX=1485682 GN=DI09_129p80 PE=4 SV=1)

HSP 1 Score: 291.582 bits (745), Expect = 1.609e-94
Identity = 135/196 (68.88%), Postives = 158/196 (80.61%), Query Frame = 3
Query:  162 VTVTEKQFQSAVTSCGYPSPPSVKYKAFIQGIPKSDIATVRELAMFLANILHESDGLRAKSEYQCQKDGCKGQYDSGPKGVVYYGRGYMQLSWSYNYKAASKALYGDENKLLNNPDLVANDENVAWDTTFWYWKANVHIAPGVTAGKFGASIKAINGALEC-GGPNERAKKRFVNYGKILKAFNVNESPIESGCYN 746
            VT TE++F SAV++CG+P P S KYKAFI GIP S I + RELAMFLAN+LHESDGL+AKSE QCQ +GCKGQYD+   G V++GRGY+QL+W  NY AASK LYGDE  LL+NP+ VA DE VAW T FWYWK  VH APGVT GKFGA+IKAINGALEC GG N++A +RF  Y KI+KAF +NE+PIESGCYN
Sbjct:  172 VTATEQEFTSAVSACGFPQPSSEKYKAFIAGIPFSAINSKRELAMFLANVLHESDGLQAKSEIQCQANGCKGQYDAAADGTVFFGRGYIQLTWKANYAAASKDLYGDEKILLSNPNSVATDEKVAWATAFWYWKTRVHTAPGVTEGKFGATIKAINGALECGGGRNQKAVRRFEMYSKIMKAFGINETPIESGCYN 367          
BLAST of Glyco_hydro_19_cat domain-containing protein vs. TrEMBL
Match: A0A1R1PP58 (Acidic endochitinase SP2 OS=Zancudomyces culisetae OX=1213189 GN=AX774_g3734 PE=4 SV=1)

HSP 1 Score: 218.779 bits (556), Expect = 2.915e-66
Identity = 108/201 (53.73%), Postives = 138/201 (68.66%), Query Frame = 3
Query:  153 SGPVTVTEKQFQSAVTSCGYPSPPSVKYKAFIQGIPKSDIATVRELAMFLANILHESDGLRAKSEYQCQKDGCKGQYDS--GPKGVVYYGRGYMQLSWSYNYKAASKALYGDENKLLNNPDLVANDENVAWDTTFWYWKANVHIAPGVTAGKFGASIKAINGALECGGPNE-RAKKRFVNYGKILKAFNVNESPIESGCYN 746
            +G + +   +F +AV + GYP P   + KAF+ G+P   IA++RE AMFL  IL ESDGLRAK EY C+ + CK  Y S     G +YYGRGY+QL+W+ NY+AASKALYGD+ +LL NP+ V  DE  AWD +FW+W+  V   PGV AGKFG+S   INGALEC G  + +AKKRF NY KIL   + + +PIESGCYN
Sbjct:  141 AGGLNIDCNKFYNAVQAAGYPKPTEAQCKAFLAGLPTGKIASLREAAMFLTQILWESDGLRAKEEYYCKTNDCKAAYGSPLDVPGKIYYGRGYIQLTWAANYQAASKALYGDD-RLLKNPETVGTDEKTAWDVSFWFWRDRVRTDPGVMAGKFGSSTNMINGALECRGAYQAKAKKRFENYKKILPVLDPSATPIESGCYN 340          
BLAST of Glyco_hydro_19_cat domain-containing protein vs. TrEMBL
Match: A0A1W0WMH0 (Putative Acidic endochitinase SP2 OS=Hypsibius dujardini OX=232323 GN=BV898_09538 PE=4 SV=1)

HSP 1 Score: 212.616 bits (540), Expect = 1.725e-65
Identity = 111/199 (55.78%), Postives = 139/199 (69.85%), Query Frame = 3
Query:  168 VTEKQFQSAVTSCGYPSPPSVKYKAFIQGIPKS-DIATVRELAMFLANILHESDGLRAKSEYQCQKDGCKGQYDS--GPKGVVYYGRGYMQLSWSYNYKAASKALYGDENKLLNNPDLVANDENVAWDTTFWYWKANVHIAPGVTAGKFGASIKAINGALECGGP---NERAKKRFVNYGKILKAFNVNESPIESGCYN 746
            +T+ +  +A+TS G+P+P   +YK  +    KS  I T RELAMFLAN+  ESDGLRAK EY    +   G Y +  G  G  YYGRGY+QLSW YNYKAAS+ALY D ++L+ +PD VA  ++VAWDT FWYW ANVH APGV+ GKFGA+ KAINGALECGG     E+AK+RF  Y KI  AF ++  P+E+GCYN
Sbjct:   26 ITKAELTAALTSSGFPAPSDEQYKNIVTRCEKSGKITTKRELAMFLANVFQESDGLRAKKEY----NPPAGAYQAPGGAPGKRYYGRGYLQLSWVYNYKAASQALYKD-DRLVKDPDQVATKDDVAWDTAFWYWSANVHSAPGVSEGKFGATTKAINGALECGGAAVGTEQAKRRFEFYKKISAAFKLSGKPVENGCYN 219          
BLAST of Glyco_hydro_19_cat domain-containing protein vs. TrEMBL
Match: A0A443SFN7 (Glyco_hydro_19_cat domain-containing protein OS=Leptotrombidium deliense OX=299467 GN=B4U80_05562 PE=4 SV=1)

HSP 1 Score: 213.001 bits (541), Expect = 1.459e-63
Identity = 110/203 (54.19%), Postives = 140/203 (68.97%), Query Frame = 3
Query:  150 ISGPVTVTEKQFQSAVTSCGYPSPPSVKYKAFI-QGIPKSDIATVRELAMFLANILHESDGLRAKSEYQCQKDGCKGQYDS--GPKGVVYYGRGYMQLSWSYNYKAASKALYGDENKLLNNPDLVANDENVAWDTTFWYWKANVHIAPGVTAGKFGASIKAINGALECGGPN-ERAKKRFVNYGKILKAFNVNESPIESGCYN 746
            +S PV +  ++FQ AV  CGY +P  V+YKA I Q   K  I + RELAMFLA IL ES GL+ K E  C+  GC G YDS  G  G  YYGRGY+QL+ S+NYKAAS+ LY D ++L+ NP+LV++DE +AW T FW+WK NVH  P V  G FGAS  AING LEC G + +RA++RF  Y  +LKAF++ E+ IE+GCYN
Sbjct:  184 LSLPVDMNFQEFQKAVVDCGYDTPTQVQYKALISQATSKGAITSKRELAMFLAQILWESGGLKYKKEIACEATGCPGVYDSSVGVPGKNYYGRGYIQLTHSFNYKAASQELYSD-DRLIRNPELVSDDEQIAWATAFWFWKRNVHNRPKVQQGFFGASTNAINGDLECAGDHKDRARRRFELYQIVLKAFHITETAIENGCYN 385          
BLAST of Glyco_hydro_19_cat domain-containing protein vs. TrEMBL
Match: A0A1R1PP56 (Chitinase 4 OS=Zancudomyces culisetae OX=1213189 GN=AX774_g3793 PE=4 SV=1)

HSP 1 Score: 208.764 bits (530), Expect = 2.819e-61
Identity = 101/193 (52.33%), Postives = 130/193 (67.36%), Query Frame = 3
Query:  180 QFQSAVTSCGYPSPPSVKYKAFIQGIPKSDIATVRELAMFLANILHESDGLRAKSEYQCQKDGCKGQYDSGP---KGVVYYGRGYMQLSWSYNYKAASKALYGDENKLLNNPDLVANDENVAWDTTFWYWKANVHIAPGVTAGKFGASIKAINGALECGGPNERAKK-RFVNYGKILKAFNVNESPIESGCYN 746
            +F  AV   GYP+P   +  AF+ G+   +I++ RE AMFLA I+HESDGL+AKSEY+C  + C   Y + P    G  YYGRGY+QLSW+ NYKAASKALYGD ++L  NPD VA DE +AW  +FWYWK+ V     V +G+FGAS + INGALEC G N  A K R+  Y ++L  F+ + +P ESGCYN
Sbjct:  243 KFVKAVMGSGYPTPTDSQCNAFLSGLQTGEISSAREAAMFLAQIMHESDGLKAKSEYRCATEDCTADY-AAPGDYPGKAYYGRGYIQLSWADNYKAASKALYGD-DRLYTNPDSVAQDETIAWQVSFWYWKSRVRTNKDVLSGEFGASTRMINGALECTGSNIVASKTRYDIYKQVLSVFDPSSTPTESGCYN 433          
BLAST of Glyco_hydro_19_cat domain-containing protein vs. Planmine SMEST
Match: SMESG000047827.1 (SMESG000047827.1)

HSP 1 Score: 457.218 bits (1175), Expect = 1.399e-165
Identity = 220/220 (100.00%), Postives = 220/220 (100.00%), Query Frame = 3
Query:   87 MDNYRILSAFVCLFIVLNEGVISGPVTVTEKQFQSAVTSCGYPSPPSVKYKAFIQGIPKSDIATVRELAMFLANILHESDGLRAKSEYQCQKDGCKGQYDSGPKGVVYYGRGYMQLSWSYNYKAASKALYGDENKLLNNPDLVANDENVAWDTTFWYWKANVHIAPGVTAGKFGASIKAINGALECGGPNERAKKRFVNYGKILKAFNVNESPIESGCYN 746
            MDNYRILSAFVCLFIVLNEGVISGPVTVTEKQFQSAVTSCGYPSPPSVKYKAFIQGIPKSDIATVRELAMFLANILHESDGLRAKSEYQCQKDGCKGQYDSGPKGVVYYGRGYMQLSWSYNYKAASKALYGDENKLLNNPDLVANDENVAWDTTFWYWKANVHIAPGVTAGKFGASIKAINGALECGGPNERAKKRFVNYGKILKAFNVNESPIESGCYN
Sbjct:    1 MDNYRILSAFVCLFIVLNEGVISGPVTVTEKQFQSAVTSCGYPSPPSVKYKAFIQGIPKSDIATVRELAMFLANILHESDGLRAKSEYQCQKDGCKGQYDSGPKGVVYYGRGYMQLSWSYNYKAASKALYGDENKLLNNPDLVANDENVAWDTTFWYWKANVHIAPGVTAGKFGASIKAINGALECGGPNERAKKRFVNYGKILKAFNVNESPIESGCYN 220          
BLAST of Glyco_hydro_19_cat domain-containing protein vs. Planmine SMEST
Match: SMESG000047826.1 (SMESG000047826.1)

HSP 1 Score: 457.218 bits (1175), Expect = 1.399e-165
Identity = 220/220 (100.00%), Postives = 220/220 (100.00%), Query Frame = 3
Query:   87 MDNYRILSAFVCLFIVLNEGVISGPVTVTEKQFQSAVTSCGYPSPPSVKYKAFIQGIPKSDIATVRELAMFLANILHESDGLRAKSEYQCQKDGCKGQYDSGPKGVVYYGRGYMQLSWSYNYKAASKALYGDENKLLNNPDLVANDENVAWDTTFWYWKANVHIAPGVTAGKFGASIKAINGALECGGPNERAKKRFVNYGKILKAFNVNESPIESGCYN 746
            MDNYRILSAFVCLFIVLNEGVISGPVTVTEKQFQSAVTSCGYPSPPSVKYKAFIQGIPKSDIATVRELAMFLANILHESDGLRAKSEYQCQKDGCKGQYDSGPKGVVYYGRGYMQLSWSYNYKAASKALYGDENKLLNNPDLVANDENVAWDTTFWYWKANVHIAPGVTAGKFGASIKAINGALECGGPNERAKKRFVNYGKILKAFNVNESPIESGCYN
Sbjct:    1 MDNYRILSAFVCLFIVLNEGVISGPVTVTEKQFQSAVTSCGYPSPPSVKYKAFIQGIPKSDIATVRELAMFLANILHESDGLRAKSEYQCQKDGCKGQYDSGPKGVVYYGRGYMQLSWSYNYKAASKALYGDENKLLNNPDLVANDENVAWDTTFWYWKANVHIAPGVTAGKFGASIKAINGALECGGPNERAKKRFVNYGKILKAFNVNESPIESGCYN 220          
The following BLAST results are available for this feature:
BLAST of Glyco_hydro_19_cat domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Glyco_hydro_19_cat domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Glyco_hydro_19_cat domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Glyco_hydro_19_cat domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Glyco_hydro_19_cat domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Glyco_hydro_19_cat domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Glyco_hydro_19_cat domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P42820|CHIP_BETVU1.799e-2141.45Acidic endochitinase SP2 OS=Beta vulgaris OX=16193... [more]
sp|Q5NTA4|CHI4_CRYJA9.446e-2136.48Endochitinase 4 OS=Cryptomeria japonica OX=3369 PE... [more]
sp|Q7Y1Z0|CHI5_ORYSJ3.377e-2038.67Chitinase 5 OS=Oryza sativa subsp. japonica OX=399... [more]
sp|O04138|CHI4_ORYSJ4.703e-2038.78Chitinase 4 OS=Oryza sativa subsp. japonica OX=399... [more]
sp|P29022|CHIA_MAIZE7.395e-2034.04Endochitinase A OS=Zea mays OX=4577 GN=CHIA PE=1 S... [more]
back to top
BLAST of Glyco_hydro_19_cat domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A098VVG61.609e-9468.88Glyco_hydro_19_cat domain-containing protein (Frag... [more]
A0A1R1PP582.915e-6653.73Acidic endochitinase SP2 OS=Zancudomyces culisetae... [more]
A0A1W0WMH01.725e-6555.78Putative Acidic endochitinase SP2 OS=Hypsibius duj... [more]
A0A443SFN71.459e-6354.19Glyco_hydro_19_cat domain-containing protein OS=Le... [more]
A0A1R1PP562.819e-6152.33Chitinase 4 OS=Zancudomyces culisetae OX=1213189 G... [more]
back to top
BLAST of Glyco_hydro_19_cat domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Glyco_hydro_19_cat domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Glyco_hydro_19_cat domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Glyco_hydro_19_cat domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Glyco_hydro_19_cat domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Glyco_hydro_19_cat domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000047827.11.399e-165100.00SMESG000047827.1[more]
SMESG000047826.11.399e-165100.00SMESG000047826.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30028495 ID=SMED30028495|Name=Glyco_hydro_19_cat domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=778bp
AGTGTGATTAAATGAGATTTTTGGTTTGTTTCCATTTGTATAAATTCGCT
GTTGGAAAGAGTTGAAAATCATTATTTATTTTGTCAATGGATAATTATCG
AATCCTTTCGGCATTTGTCTGTTTGTTTATTGTACTCAACGAGGGGGTCA
TTTCTGGACCGGTGACAGTAACGGAGAAACAATTTCAATCGGCTGTCACT
TCCTGTGGATATCCATCTCCTCCATCGGTCAAATACAAAGCTTTCATTCA
GGGAATTCCAAAATCTGATATTGCTACTGTGAGAGAGCTGGCAATGTTTC
TAGCAAATATTCTTCACGAGTCTGATGGATTGAGGGCAAAGAGCGAATAC
CAATGTCAAAAGGACGGCTGTAAAGGTCAATATGACTCGGGGCCAAAAGG
TGTCGTTTATTATGGAAGAGGATACATGCAATTGTCATGGTCATACAATT
ATAAAGCCGCTAGTAAAGCTTTATATGGAGACGAAAATAAACTCCTCAAT
AACCCTGATCTAGTGGCAAATGATGAGAATGTTGCTTGGGATACGACATT
CTGGTATTGGAAAGCCAATGTTCATATTGCTCCCGGAGTGACTGCTGGAA
AATTCGGAGCATCAATCAAAGCTATCAATGGTGCACTGGAATGTGGGGGA
CCAAACGAGAGAGCGAAAAAGCGATTTGTTAATTATGGAAAGATTTTGAA
AGCGTTCAATGTCAACGAATCTCCCATCGAATCAGGATGCTATAACTAGT
TCAAAGTTAAATAAATTTTTTTTGATTT
back to top

protein sequence of SMED30028495-orf-1

>SMED30028495-orf-1 ID=SMED30028495-orf-1|Name=SMED30028495-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=221bp
MDNYRILSAFVCLFIVLNEGVISGPVTVTEKQFQSAVTSCGYPSPPSVKY
KAFIQGIPKSDIATVRELAMFLANILHESDGLRAKSEYQCQKDGCKGQYD
SGPKGVVYYGRGYMQLSWSYNYKAASKALYGDENKLLNNPDLVANDENVA
WDTTFWYWKANVHIAPGVTAGKFGASIKAINGALECGGPNERAKKRFVNY
GKILKAFNVNESPIESGCYN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000240body wall musculature
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR000726Glyco_hydro_19_cat
IPR023346Lysozyme-like_dom_sf
Vocabulary: biological process
TermDefinition
GO:0016998cell wall macromolecule catabolic process
GO:0006032chitin catabolic process
Vocabulary: molecular function
TermDefinition
GO:0004568chitinase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:1.10.530.70coord: 27..207
e-value: 2.0E-41
score: 143.9
NoneNo IPR availablePANTHERPTHR22595CHITINASE-RELATEDcoord: 64..212
NoneNo IPR availablePANTHERPTHR22595:SF79coord: 64..212
NoneNo IPR availableCDDcd00325chitinase_GH19coord: 28..210
e-value: 1.52891E-46
score: 151.815
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..23
score: 0.677
NoneNo IPR availableTMHMMTMhelixcoord: 7..29
IPR000726Glycoside hydrolase, family 19, catalyticPFAMPF00182Glyco_hydro_19coord: 65..168
e-value: 9.1E-16
score: 58.4
IPR023346Lysozyme-like domain superfamilySUPERFAMILYSSF53955Lysozyme-likecoord: 27..210