START domain-containing protein

Overview
NameSTART domain-containing protein
Smed IDSMED30028489
Length (bp)2052
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of START domain-containing protein (SMED30028489) t-SNE clustered cells

Violin plots show distribution of expression levels for START domain-containing protein (SMED30028489) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of START domain-containing protein (SMED30028489) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for START domain-containing protein (SMED30028489) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30028489

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 25

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30028489SMESG000057111.1 SMESG000045326.1 SMESG000021912.1 Contig4857newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30028489SMESG000026849.1 Contig4857newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
pharynxSMED30028489SMESG000028630.1 dd_Smed_v4_3237_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30028489SMESG000028630.1 dd_Smed_v4_3237_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30028489SMESG000028630.1 dd_Smed_v4_3237_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynxSMED30028489SMESG000078713.1 SMESG000060505.1 SMESG000055485.1 SMESG000051367.1 SMESG000073216.1 SMESG000045326.1 SMESG000032032.1 SMESG000021912.1 SMESG000017091.1 dd_Smed_v4_12660_2_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30028489SMESG000078713.1 SMESG000060505.1 SMESG000055485.1 SMESG000051367.1 SMESG000073216.1 SMESG000045326.1 SMESG000032032.1 SMESG000021912.1 SMESG000017091.1 dd_Smed_v4_12660_2_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30028489SMESG000078713.1 SMESG000060505.1 SMESG000055485.1 SMESG000051367.1 SMESG000073216.1 SMESG000045326.1 SMESG000032032.1 SMESG000021912.1 SMESG000017091.1 dd_Smed_v4_12660_2_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30028489SMESG000078713.1 SMESG000060505.1 SMESG000055485.1 SMESG000051367.1 SMESG000073216.1 SMESG000045326.1 SMESG000032032.1 SMESG000021912.1 SMESG000017091.1 dd_Smed_v4_12660_2_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30028489SMESG000078713.1 SMESG000060505.1 SMESG000055485.1 SMESG000051367.1 SMESG000073216.1 SMESG000045326.1 SMESG000032032.1 SMESG000021912.1 SMESG000017091.1 dd_Smed_v4_12660_2_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30028489SMESG000045326.1 SMESG000021912.1 SMESG000002927.1 Contig15254uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30028489SMESG000045326.1 SMESG000021912.1 SMESG000002927.1 Contig15254newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30028489SMESG000045326.1 SMESG000037418.1 SMESG000021912.1 Contig20490newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30028489SMESG000045326.1 SMESG000037418.1 SMESG000021912.1 Contig20490uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30028489SMESG000060958.1 SMESG000045326.1 SMESG000021912.1 Contig51077newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30028489SMESG000060958.1 SMESG000045326.1 SMESG000021912.1 Contig51077uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30028489SMESG000045326.1 SMESG000034055.1 SMESG000034048.1 SMESG000021912.1 Contig49369uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30028489SMESG000045326.1 SMESG000034055.1 SMESG000034048.1 SMESG000021912.1 Contig49369newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30028489SMESG000028630.1 dd_Smed_v6_3237_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
oocyteSMED30028489SMESG000045326.1 SMESG000021912.1 Contig21831newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
vitelline glandSMED30028489SMESG000045326.1 SMESG000021912.1 Contig21831newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
oocyteSMED30028489SMESG000045326.1 SMESG000021912.1 Contig21831uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
vitelline glandSMED30028489SMESG000045326.1 SMESG000021912.1 Contig21831uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30028489SMESG000060505.1 SMESG000055485.1 SMESG000073216.1 SMESG000032032.1 SMESG000017091.1 Contig6138newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
epidermisSMED30028489SMESG000028630.1 dd_Smed_v4_3237_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of START domain-containing protein vs. Ensembl Human
Match: STARD10 (StAR related lipid transfer domain containing 10 [Source:NCBI gene;Acc:10809])

HSP 1 Score: 187.963 bits (476), Expect = 2.925e-54
Identity = 92/222 (41.44%), Postives = 130/222 (58.56%), Query Frame = 1
Query:   82 LKVPTDEIFDEALKLFKDNSSDWETKYNKKNIYIGVKNTSYSDFKIIKTTSKFE---IAAETLYDVLHDEEYRKLWDRNMLEGFQIGSVSENSDITYYALKSPFVFKNRDFITQRCWRVKGNEFFIFNHSVFHKKYPPKKDFVRGLSYVTGYLIKKISENLSEFTYLTQSDPRGYIPAWAINKGAEVFIPKVTKRLAKAGEDYPEWKKTHNPDYKPWLNPSQ 738
            ++VP D+ F  + +   +    W   Y++  + + V+     D  + K   + E   + AETLYDVLHD EYRK WD N++E F I  ++ N+D+ YY+ + P   KNRD IT R W   G ++ I N+SV H KYPP+KD VR +S  TGYLI+         TYL Q DP+G +P W +NK ++   PK  K++ KA   YPEWK+ H P +KPWL+P Q
Sbjct:   22 VQVPDDQDF-RSFRSECEAEVGWNLTYSRAGVSVWVQAVEM-DRTLHKIKCRMECCDVPAETLYDVLHDIEYRKKWDSNVIETFDIARLTVNADVGYYSWRCPKPLKNRDVITLRSWLPMGADYIIMNYSVKHPKYPPRKDLVRAVSIQTGYLIQSTGPKSCVITYLAQVDPKGSLPKWVVNKSSQFLAPKAMKKMYKACLKYPEWKQKHLPHFKPWLHPEQ 241          
BLAST of START domain-containing protein vs. Ensembl Human
Match: STARD10 (StAR related lipid transfer domain containing 10 [Source:NCBI gene;Acc:10809])

HSP 1 Score: 187.963 bits (476), Expect = 1.024e-53
Identity = 92/222 (41.44%), Postives = 130/222 (58.56%), Query Frame = 1
Query:   82 LKVPTDEIFDEALKLFKDNSSDWETKYNKKNIYIGVKNTSYSDFKIIKTTSKFE---IAAETLYDVLHDEEYRKLWDRNMLEGFQIGSVSENSDITYYALKSPFVFKNRDFITQRCWRVKGNEFFIFNHSVFHKKYPPKKDFVRGLSYVTGYLIKKISENLSEFTYLTQSDPRGYIPAWAINKGAEVFIPKVTKRLAKAGEDYPEWKKTHNPDYKPWLNPSQ 738
            ++VP D+ F  + +   +    W   Y++  + + V+     D  + K   + E   + AETLYDVLHD EYRK WD N++E F I  ++ N+D+ YY+ + P   KNRD IT R W   G ++ I N+SV H KYPP+KD VR +S  TGYLI+         TYL Q DP+G +P W +NK ++   PK  K++ KA   YPEWK+ H P +KPWL+P Q
Sbjct:   22 VQVPDDQDF-RSFRSECEAEVGWNLTYSRAGVSVWVQAVEM-DRTLHKIKCRMECCDVPAETLYDVLHDIEYRKKWDSNVIETFDIARLTVNADVGYYSWRCPKPLKNRDVITLRSWLPMGADYIIMNYSVKHPKYPPRKDLVRAVSIQTGYLIQSTGPKSCVITYLAQVDPKGSLPKWVVNKSSQFLAPKAMKKMYKACLKYPEWKQKHLPHFKPWLHPEQ 241          
BLAST of START domain-containing protein vs. Ensembl Human
Match: STARD10 (StAR related lipid transfer domain containing 10 [Source:NCBI gene;Acc:10809])

HSP 1 Score: 187.963 bits (476), Expect = 1.024e-53
Identity = 92/222 (41.44%), Postives = 130/222 (58.56%), Query Frame = 1
Query:   82 LKVPTDEIFDEALKLFKDNSSDWETKYNKKNIYIGVKNTSYSDFKIIKTTSKFE---IAAETLYDVLHDEEYRKLWDRNMLEGFQIGSVSENSDITYYALKSPFVFKNRDFITQRCWRVKGNEFFIFNHSVFHKKYPPKKDFVRGLSYVTGYLIKKISENLSEFTYLTQSDPRGYIPAWAINKGAEVFIPKVTKRLAKAGEDYPEWKKTHNPDYKPWLNPSQ 738
            ++VP D+ F  + +   +    W   Y++  + + V+     D  + K   + E   + AETLYDVLHD EYRK WD N++E F I  ++ N+D+ YY+ + P   KNRD IT R W   G ++ I N+SV H KYPP+KD VR +S  TGYLI+         TYL Q DP+G +P W +NK ++   PK  K++ KA   YPEWK+ H P +KPWL+P Q
Sbjct:   22 VQVPDDQDF-RSFRSECEAEVGWNLTYSRAGVSVWVQAVEM-DRTLHKIKCRMECCDVPAETLYDVLHDIEYRKKWDSNVIETFDIARLTVNADVGYYSWRCPKPLKNRDVITLRSWLPMGADYIIMNYSVKHPKYPPRKDLVRAVSIQTGYLIQSTGPKSCVITYLAQVDPKGSLPKWVVNKSSQFLAPKAMKKMYKACLKYPEWKQKHLPHFKPWLHPEQ 241          
BLAST of START domain-containing protein vs. Ensembl Human
Match: STARD10 (StAR related lipid transfer domain containing 10 [Source:NCBI gene;Acc:10809])

HSP 1 Score: 183.341 bits (464), Expect = 1.133e-52
Identity = 82/166 (49.40%), Postives = 108/166 (65.06%), Query Frame = 1
Query:  241 EIAAETLYDVLHDEEYRKLWDRNMLEGFQIGSVSENSDITYYALKSPFVFKNRDFITQRCWRVKGNEFFIFNHSVFHKKYPPKKDFVRGLSYVTGYLIKKISENLSEFTYLTQSDPRGYIPAWAINKGAEVFIPKVTKRLAKAGEDYPEWKKTHNPDYKPWLNPSQ 738
            ++ AETLYDVLHD EYRK WD N++E F I  ++ N+D+ YY+ + P   KNRD IT R W   G ++ I N+SV H KYPP+KD VR +S  TGYLI+         TYL Q DP+G +P W +NK ++   PK  K++ KA   YPEWK+ H P +KPWL+P Q
Sbjct:   30 DVPAETLYDVLHDIEYRKKWDSNVIETFDIARLTVNADVGYYSWRCPKPLKNRDVITLRSWLPMGADYIIMNYSVKHPKYPPRKDLVRAVSIQTGYLIQSTGPKSCVITYLAQVDPKGSLPKWVVNKSSQFLAPKAMKKMYKACLKYPEWKQKHLPHFKPWLHPEQ 195          
BLAST of START domain-containing protein vs. Ensembl Human
Match: STARD10 (StAR related lipid transfer domain containing 10 [Source:NCBI gene;Acc:10809])

HSP 1 Score: 183.341 bits (464), Expect = 2.185e-52
Identity = 82/166 (49.40%), Postives = 108/166 (65.06%), Query Frame = 1
Query:  241 EIAAETLYDVLHDEEYRKLWDRNMLEGFQIGSVSENSDITYYALKSPFVFKNRDFITQRCWRVKGNEFFIFNHSVFHKKYPPKKDFVRGLSYVTGYLIKKISENLSEFTYLTQSDPRGYIPAWAINKGAEVFIPKVTKRLAKAGEDYPEWKKTHNPDYKPWLNPSQ 738
            ++ AETLYDVLHD EYRK WD N++E F I  ++ N+D+ YY+ + P   KNRD IT R W   G ++ I N+SV H KYPP+KD VR +S  TGYLI+         TYL Q DP+G +P W +NK ++   PK  K++ KA   YPEWK+ H P +KPWL+P Q
Sbjct:   47 DVPAETLYDVLHDIEYRKKWDSNVIETFDIARLTVNADVGYYSWRCPKPLKNRDVITLRSWLPMGADYIIMNYSVKHPKYPPRKDLVRAVSIQTGYLIQSTGPKSCVITYLAQVDPKGSLPKWVVNKSSQFLAPKAMKKMYKACLKYPEWKQKHLPHFKPWLHPEQ 212          
BLAST of START domain-containing protein vs. Ensembl Celegans
Match: T28D6.7 (pep chromosome:WBcel235:III:11344255:11346789:-1 gene:WBGene00012127.1 transcript:T28D6.7.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:T28D6.7)

HSP 1 Score: 179.104 bits (453), Expect = 1.533e-50
Identity = 92/237 (38.82%), Postives = 141/237 (59.49%), Query Frame = 1
Query:  112 EALKLFKDNSSDWETKYNKKNIYIGVKNTSYSDFKIIKTTSKF-EIAAETLYDVLHDEEYRKLWDRNMLEGFQIGSVSENSDITYYALKSPFVFKNRDFITQRCWRVKGNEFFIFNHSVFHKKYPPKKDFVRGLSYVTGYLIKKISENLSEFTYLTQSDPRGYIPAWAINKGAEVFIPKVTKRLAKAGEDYPEWKKTHNPDYKPWLNP-SQVKISKYDPADILCQP-DFDMAFKIDE 813
            E +K   ++S  W   Y KK+I I  +N   S +++IK  ++  +++A  +YDVLHD  YR  WD+ M++   IG+++ N+D+ YY+L S    + RDF+ QR W     +  I +HSV H+ YPP K  +R    ++GYLIK+  E   E  Y++ SDP+G +P W +N+  +V  PKV K+L KA   YPEWK+ H+P +KPW  P  Q+ + + D   + CQP D++    IDE
Sbjct:   69 EKVKNLCEDSEGWVEVYKKKDITICTQNIEKSSYQMIKAIAQLPDVSATVVYDVLHDSAYRAKWDKYMIKQETIGTINPNNDVCYYSLNSVSPIRPRDFVMQRSWLETDKDRLICSHSVCHEDYPPAKGCIRATVLISGYLIKE-KEQGCEVIYISHSDPKGKLPTWLVNRVTKVVAPKVIKKLHKACLGYPEWKEKHHPTWKPWSVPEQQMDLPRVDL--LKCQPKDYEQEI-IDE 301          
BLAST of START domain-containing protein vs. Ensembl Celegans
Match: strl-1 (Steroidogenic acute regulatory-like protein 1 [Source:UniProtKB/Swiss-Prot;Acc:O17883])

HSP 1 Score: 51.6026 bits (122), Expect = 6.118e-7
Identity = 47/198 (23.74%), Postives = 87/198 (43.94%), Query Frame = 1
Query:  100 EIFDEALKLFKDNS----SDW-ETKYNKKNIYIGVKNTSYSDFKIIKTTSKFEIAAETLYDVLHDEEYRKLWDRNMLEGFQIGSVSENSDITYYALKSPFVFKNRDFITQRCWRVKGNEFFIFNHSVFHKKYPPK-KDFVRGLSYVTGYLIKKISEN----LSEFTYLTQSDPRGYIPAWAINK--GAEVFIPKVTKR 657
            E+F E   +F D +    + W + + N +   +  K+T +     I T     +  + + +  +  E    W++N+    +I + + N DI  Y      V   R+F++ R WR  G+ F + + SV    +  K K  VR   ++ G   +   EN    L++   L  +D +GY+P   +N+  G  + +  VT R
Sbjct:   34 EVFAEVEAIFNDENYLSHAGWFKDESNNEGDVVYAKDTPHGRMVTISTELPMPVE-DVMKETWNGMEALPEWNQNINFAARIAAPTSNFDIVTYGNNDVLVVSGREFVSARIWRKVGDGFILASRSVTVPSFKSKHKGKVRAHLHLAGARFRPNPENPETTLTDVVML--ADLKGYLPKMIVNQVIGRIMIMDTVTNR 228          
BLAST of START domain-containing protein vs. Ensembl Celegans
Match: strl-1 (Steroidogenic acute regulatory-like protein 1 [Source:UniProtKB/Swiss-Prot;Acc:O17883])

HSP 1 Score: 51.6026 bits (122), Expect = 6.118e-7
Identity = 47/198 (23.74%), Postives = 87/198 (43.94%), Query Frame = 1
Query:  100 EIFDEALKLFKDNS----SDW-ETKYNKKNIYIGVKNTSYSDFKIIKTTSKFEIAAETLYDVLHDEEYRKLWDRNMLEGFQIGSVSENSDITYYALKSPFVFKNRDFITQRCWRVKGNEFFIFNHSVFHKKYPPK-KDFVRGLSYVTGYLIKKISEN----LSEFTYLTQSDPRGYIPAWAINK--GAEVFIPKVTKR 657
            E+F E   +F D +    + W + + N +   +  K+T +     I T     +  + + +  +  E    W++N+    +I + + N DI  Y      V   R+F++ R WR  G+ F + + SV    +  K K  VR   ++ G   +   EN    L++   L  +D +GY+P   +N+  G  + +  VT R
Sbjct:   34 EVFAEVEAIFNDENYLSHAGWFKDESNNEGDVVYAKDTPHGRMVTISTELPMPVE-DVMKETWNGMEALPEWNQNINFAARIAAPTSNFDIVTYGNNDVLVVSGREFVSARIWRKVGDGFILASRSVTVPSFKSKHKGKVRAHLHLAGARFRPNPENPETTLTDVVML--ADLKGYLPKMIVNQVIGRIMIMDTVTNR 228          
BLAST of START domain-containing protein vs. Ensembl Celegans
Match: strl-1 (Steroidogenic acute regulatory-like protein 1 [Source:UniProtKB/Swiss-Prot;Acc:O17883])

HSP 1 Score: 51.2174 bits (121), Expect = 8.703e-7
Identity = 47/198 (23.74%), Postives = 87/198 (43.94%), Query Frame = 1
Query:  100 EIFDEALKLFKDNS----SDW-ETKYNKKNIYIGVKNTSYSDFKIIKTTSKFEIAAETLYDVLHDEEYRKLWDRNMLEGFQIGSVSENSDITYYALKSPFVFKNRDFITQRCWRVKGNEFFIFNHSVFHKKYPPK-KDFVRGLSYVTGYLIKKISEN----LSEFTYLTQSDPRGYIPAWAINK--GAEVFIPKVTKR 657
            E+F E   +F D +    + W + + N +   +  K+T +     I T     +  + + +  +  E    W++N+    +I + + N DI  Y      V   R+F++ R WR  G+ F + + SV    +  K K  VR   ++ G   +   EN    L++   L  +D +GY+P   +N+  G  + +  VT R
Sbjct:   52 EVFAEVEAIFNDENYLSHAGWFKDESNNEGDVVYAKDTPHGRMVTISTELPMPVE-DVMKETWNGMEALPEWNQNINFAARIAAPTSNFDIVTYGNNDVLVVSGREFVSARIWRKVGDGFILASRSVTVPSFKSKHKGKVRAHLHLAGARFRPNPENPETTLTDVVML--ADLKGYLPKMIVNQVIGRIMIMDTVTNR 246          
BLAST of START domain-containing protein vs. Ensembl Zebrafish
Match: stard10 (StAR-related lipid transfer (START) domain containing 10 [Source:ZFIN;Acc:ZDB-GENE-040426-1797])

HSP 1 Score: 207.223 bits (526), Expect = 2.597e-61
Identity = 104/234 (44.44%), Postives = 142/234 (60.68%), Query Frame = 1
Query:   61 MTLKVG--ELKVPTDEIFDEALKLFKDNSSDWETKYNKKNI--YIGVKNTSYSDFKIIKTTSKFEIAAETLYDVLHDEEYRKLWDRNMLEGFQIGSVSENSDITYYALKSPFVFKNRDFITQRCWRVKGNEFFIFNHSVFHKKYPPKKDFVRGLSYVTGYLIKKISENLSEFTYLTQSDPRGYIPAWAINKGAEVFIPKVTKRLAKAGEDYPEWKKTHNPDYKPWLNPSQVKIS 750
            M +K G  E+ +P D  F    K   +  + W   +NK NI  +I +     S  KI    +  +I AET+YDVLHD EYR+ WD N++E F IG ++ N+D+ YY+ K P   KNRD IT R W   GN++ I N+SV H KYPPKKD VR +S  TGYLI++   +    TYL Q DP+G +P W +NK +++  PK  KR++KA   YPEWK+ H+P +KPWL P Q  +S
Sbjct:    1 MMMKTGDEEVLIPDDRAFSR-FKHECEAEAGWTVTHNKSNICVWIQLLEEDKSLHKIKCRMTCKDIPAETMYDVLHDIEYRRKWDANVIETFDIGKLTVNADVGYYSWKCPKPLKNRDVITLRSWLPMGNDYIIMNYSVKHSKYPPKKDLVRAVSIQTGYLIQRTGPSSCTLTYLAQVDPKGSLPKWVVNKSSQLLAPKAMKRISKACARYPEWKQKHSPGFKPWLFPEQNPLS 233          
BLAST of START domain-containing protein vs. Ensembl Zebrafish
Match: stard14 (START domain containing 14 [Source:ZFIN;Acc:ZDB-GENE-040426-963])

HSP 1 Score: 206.068 bits (523), Expect = 6.555e-61
Identity = 100/249 (40.16%), Postives = 148/249 (59.44%), Query Frame = 1
Query:   67 LKVGELKVPTDEIFDEALKLFKDNSSDWETKYNKKNIYIGVKNT----------SYSDFKIIKTTSKF-EIAAETLYDVLHDEEYRKLWDRNMLEGFQIGSVSENSDITYYALKSPFVFKNRDFITQRCWRVKGNEFFIFNHSVFHKKYPPKKDFVRGLSYVTGYLIKKISENLSEFTYLTQSDPRGYIPAWAINKGAEVFIPKVTKRLAKAGEDYPEWKKTHNPDYKPWLNPSQVKISKYDPADILCQ 780
            +  G   +P + +F E  K    ++ +W  KY+K ++ + V+            +YS    I+      +++A T+YDVLHD +YRK WD  MLE F I  ++ N+D+ YY+   P   KNRD +T R W+   NE+ I N SV H KYPP+KD VR +S +TGYLIK        FTYL+Q+DP+G +P W +NK ++V  PKV +   KAG++YP WK  ++PD+KPWL P Q +++  DPA++  Q
Sbjct:    1 MSRGSGILPDESMFAE-FKRQCLSTENWVNKYDKNDMEVWVEQAPLSASINNKGNYSKVHKIRCQINIKDVSAATMYDVLHDGQYRKTWDPTMLESFDIARLAHNADVGYYSWICPKPLKNRDVVTLRSWQASENEYVIINFSVKHPKYPPRKDLVRAVSLMTGYLIKPTGPQSCTFTYLSQADPKGSLPKWVVNKASQVLAPKVLRSAHKAGQNYPAWKAANSPDHKPWLYPIQSELAMMDPAELSIQ 248          
BLAST of START domain-containing protein vs. Ensembl Zebrafish
Match: stard14 (START domain containing 14 [Source:ZFIN;Acc:ZDB-GENE-040426-963])

HSP 1 Score: 206.068 bits (523), Expect = 6.555e-61
Identity = 100/249 (40.16%), Postives = 148/249 (59.44%), Query Frame = 1
Query:   67 LKVGELKVPTDEIFDEALKLFKDNSSDWETKYNKKNIYIGVKNT----------SYSDFKIIKTTSKF-EIAAETLYDVLHDEEYRKLWDRNMLEGFQIGSVSENSDITYYALKSPFVFKNRDFITQRCWRVKGNEFFIFNHSVFHKKYPPKKDFVRGLSYVTGYLIKKISENLSEFTYLTQSDPRGYIPAWAINKGAEVFIPKVTKRLAKAGEDYPEWKKTHNPDYKPWLNPSQVKISKYDPADILCQ 780
            +  G   +P + +F E  K    ++ +W  KY+K ++ + V+            +YS    I+      +++A T+YDVLHD +YRK WD  MLE F I  ++ N+D+ YY+   P   KNRD +T R W+   NE+ I N SV H KYPP+KD VR +S +TGYLIK        FTYL+Q+DP+G +P W +NK ++V  PKV +   KAG++YP WK  ++PD+KPWL P Q +++  DPA++  Q
Sbjct:    1 MSRGSGILPDESMFAE-FKRQCLSTENWVNKYDKNDMEVWVEQAPLSASINNKGNYSKVHKIRCQINIKDVSAATMYDVLHDGQYRKTWDPTMLESFDIARLAHNADVGYYSWICPKPLKNRDVVTLRSWQASENEYVIINFSVKHPKYPPRKDLVRAVSLMTGYLIKPTGPQSCTFTYLSQADPKGSLPKWVVNKASQVLAPKVLRSAHKAGQNYPAWKAANSPDHKPWLYPIQSELAMMDPAELSIQ 248          
BLAST of START domain-containing protein vs. Ensembl Zebrafish
Match: stard14 (START domain containing 14 [Source:ZFIN;Acc:ZDB-GENE-040426-963])

HSP 1 Score: 205.682 bits (522), Expect = 7.347e-61
Identity = 100/249 (40.16%), Postives = 148/249 (59.44%), Query Frame = 1
Query:   67 LKVGELKVPTDEIFDEALKLFKDNSSDWETKYNKKNIYIGVKNT----------SYSDFKIIKTTSKF-EIAAETLYDVLHDEEYRKLWDRNMLEGFQIGSVSENSDITYYALKSPFVFKNRDFITQRCWRVKGNEFFIFNHSVFHKKYPPKKDFVRGLSYVTGYLIKKISENLSEFTYLTQSDPRGYIPAWAINKGAEVFIPKVTKRLAKAGEDYPEWKKTHNPDYKPWLNPSQVKISKYDPADILCQ 780
            +  G   +P + +F E  K    ++ +W  KY+K ++ + V+            +YS    I+      +++A T+YDVLHD +YRK WD  MLE F I  ++ N+D+ YY+   P   KNRD +T R W+   NE+ I N SV H KYPP+KD VR +S +TGYLIK        FTYL+Q+DP+G +P W +NK ++V  PKV +   KAG++YP WK  ++PD+KPWL P Q +++  DPA++  Q
Sbjct:    1 MSRGSGILPDESMFAE-FKRQCLSTENWVNKYDKNDMEVWVEQAPLSASINNKGNYSKVHKIRCQINIKDVSAATMYDVLHDGQYRKTWDPTMLESFDIARLAHNADVGYYSWICPKPLKNRDVVTLRSWQASENEYVIINFSVKHPKYPPRKDLVRAVSLMTGYLIKPTGPQSCTFTYLSQADPKGSLPKWVVNKASQVLAPKVLRSAHKAGQNYPAWKAANSPDHKPWLYPIQSELAMMDPAELSIQ 248          
BLAST of START domain-containing protein vs. Ensembl Zebrafish
Match: stard15 (StAR-related lipid transfer (START) domain containing 15 [Source:ZFIN;Acc:ZDB-GENE-070424-267])

HSP 1 Score: 202.986 bits (515), Expect = 5.640e-60
Identity = 99/233 (42.49%), Postives = 139/233 (59.66%), Query Frame = 1
Query:  148 WETKYNKKNIYIGVKNTSYSDFKIIKTTSKF-EIAAETLYDVLHDEEYRKLWDRNMLEGFQIGSVSENSDITYYALKSPFVFKNRDFITQRCWRVKGNEFFIFNHSVFHKKYPPKKDFVRGLSYVTGYLIKKISENLSEFTYLTQSDPRGYIPAWAINKGAEVFIPKVTKRLAKAGEDYPEWKKTHNPDYKPWLNPSQVKISKYDPADILCQPDFDMAFKIDERQHKEEVVKH 843
            W ++YNK ++ +  ++      + +K      ++ AETLYDVLHD  YRK WD NM++ F IG ++ N+D+ YY+ K P   KNRDF+T R W   GN++ I N+SV H +YPPKKD+VR +S +TGYLI+    N     YLTQ DPRG +P W +N+ ++   PK  K++ KA   YPEWK+ H P+ KPW  P Q  +   + AD+  Q   D    IDE    EE  +H
Sbjct:   24 WVSRYNKGSVTVWCRDEECKSVQKLKMRIVCKDVTAETLYDVLHDTSYRKKWDTNMIDTFDIGRLTVNADVGYYSWKCPTPLKNRDFVTMRSWLPLGNDYLIINYSVKHPEYPPKKDYVRAVSLLTGYLIQSNGANSCTLYYLTQVDPRGSLPKWVVNRVSQFVAPKAMKKIYKACLKYPEWKRKHEPNLKPWRYPEQNTLPCINVADLTVQ-RADSLENIDESGVSEEKAQH 255          
BLAST of START domain-containing protein vs. Ensembl Xenopus
Match: nr2f6 (nuclear receptor subfamily 2 group F member 6 [Source:Xenbase;Acc:XB-GENE-480818])

HSP 1 Score: 204.142 bits (518), Expect = 4.003e-60
Identity = 100/235 (42.55%), Postives = 144/235 (61.28%), Query Frame = 1
Query:   82 LKVPTDEIFDEALKLFKDNSSDWETKYNKKNIYIGV--KNTSYSDFKIIKTTSKFEIAAETLYDVLHDEEYRKLWDRNMLEGFQIGSVSENSDITYYALKSPFVFKNRDFITQRCWRVKGNEFFIFNHSVFHKKYPPKKDFVRGLSYVTGYLIKKISENLSEFTYLTQSDPRGYIPAWAINKGAEVFIPKVTKRLAKAGEDYPEWKKTHNPDYKPWLNPSQVKISKYDPADILCQ 780
            + +P D  F+ + +   +N   W  +YNK  + +    ++++ +  K+    +  ++ AE LYDVLHD  YRK WD NM+E + IG ++ N+DI YY+ K P   KNRDF+T R W   GN++ I N+SV H K+PP+KD+VR +S  TGYLIK    N     YLTQ DPRG +P W +NK ++   PK  K++ KAG  YPEWK+ H+PDYKPW+ P Q  +   + AD+  Q
Sbjct:    2 VHIPDDADFN-SFREQCENHEGWHCQYNKGGVTVWSEEQDSTKAVKKLKMCITCKDVPAEILYDVLHDTSYRKKWDSNMIETYDIGRLTVNADIGYYSWKCPSPLKNRDFVTLRSWLPLGNDYMIINYSVKHPKHPPRKDYVRAVSLQTGYLIKANGSNSCSLYYLTQVDPRGSLPKWVVNKVSQFVAPKAMKKIYKAGIKYPEWKRKHDPDYKPWVYPEQNTLPTVNLADLSIQ 235          
BLAST of START domain-containing protein vs. Ensembl Xenopus
Match: stard10 (StAR related lipid transfer domain containing 10 [Source:NCBI gene;Acc:100145047])

HSP 1 Score: 199.134 bits (505), Expect = 3.855e-58
Identity = 107/251 (42.63%), Postives = 141/251 (56.18%), Query Frame = 1
Query:   82 LKVPTDEIFDEALKLFKDNSSDWETKYNKKNI--YIGVKNTSYSDFKIIKTTSKFEIAAETLYDVLHDEEYRKLWDRNMLEGFQIGSVSENSDITYYALKSPFVFKNRDFITQRCWRVKGNEFFIFNHSVFHKKYPPKKDFVRGLSYVTGYLIKKISENLSEFTYLTQSDPRGYIPAWAINKGAEVFIPKVTKRLAKAGEDYPEWKKTHNPDYKPWLNPSQVKISKYDPADILCQPDFDMAFKIDERQHKE 828
            +++P D  F +  +    + + W   Y+K  I  +I +     +  KI       +++AE LYDVLHD EYRK WD N++E F IG ++ N+DI YYA K P   KNRD IT R W   GN++ I N+SV H KYPPKKD VR +S  TGYLI+      +   YL Q DPRG +P W +NK ++   PK  K++ KA   YPEWKK HNP +KPWL P Q  +     AD+  Q   D    IDE    E
Sbjct:   17 VQIPDDRDF-QTFRTECYSDAGWTMTYSKSGITVWIQILEEERALHKIKCKMECKDVSAEVLYDVLHDIEYRKKWDSNVIETFDIGKLTVNADIGYYAWKCPKPLKNRDVITLRSWLPFGNDYIIMNYSVKHAKYPPKKDLVRAVSIQTGYLIQSGGPKSATLIYLAQVDPRGSLPKWVVNKSSQFLAPKAMKKMYKACVKYPEWKKKHNPHHKPWLYPEQSTLPTISLADVSIQ-HADSLENIDESSATE 265          
BLAST of START domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000038456.1 (uncharacterized LOC100145115 [Source:NCBI gene;Acc:100145115])

HSP 1 Score: 190.274 bits (482), Expect = 5.530e-55
Identity = 95/221 (42.99%), Postives = 131/221 (59.28%), Query Frame = 1
Query:   85 KVPTDEIFDEALKLFKDNSSDWETKYNKKNIYIGVKNTS--YSDFKIIKTTSKF-EIAAETLYDVLHDEEYRKLWDRNMLEGFQIGSVSENSDITYYALKSPFVFKNRDFITQRCWRVKGNEFFIFNHSVFHKKYPPKKDFVRGLSYVTGYLIKKISENLSEFTYLTQSDPRGYIPAWAINKGAEVFIPKVTKRLAKAGEDYPEWKKTHNPDYKPWLNPSQ 738
            +VP D +F  + +   +++  W   YNK +I + +K ++   S    +K    F +++A+T+YDVLHD EYRK WD NM+E   I  +S N+D+ YY+ K P   KNRD +T R W V  + F I N SV HK YPP+KD VR +S V GY I     N    TYL Q DPRG +P W +NK ++   PK+ ++L KA   YP WK  + P +KPWLNP Q
Sbjct:    7 QVPDDSVF-LSFREQCESTDGWVCSYNKADIGVWMKPSAGKTSLVHTVKGRMTFPDVSADTVYDVLHDTEYRKKWDINMIETKDIALLSANADVGYYSWKCPKPLKNRDVVTLRSWLVLPDSFMIINFSVKHKLYPPRKDLVRAVSLVAGYYIHSTGSNTCTLTYLAQVDPRGSLPKWVVNKSSKYLAPKILRKLHKACLQYPSWKNKNQPAFKPWLNPEQ 226          
BLAST of START domain-containing protein vs. Ensembl Xenopus
Match: DLC1 (DLC1 Rho GTPase activating protein [Source:NCBI gene;Acc:100488460])

HSP 1 Score: 55.8398 bits (133), Expect = 2.231e-7
Identity = 38/118 (32.20%), Postives = 58/118 (49.15%), Query Frame = 1
Query:  265 DVLHDE-EYRKLWDRNMLEGFQIGSVSENSDITYYALKSPFVFKNRDFITQRCWR--VKGNEFFIFNHSVFHKKYPPKKDFVRGLSYVTGYLIKKISENLSEFTYLTQSDPRGYIPAW 609
            DVLH     + LWD ++L+   I S+ + +DI  Y          RDF+  R WR  +      +   SV H + P  +  VR    ++ YLI+  S   S+ TYL ++D RG++P W
Sbjct:  927 DVLHRLLREQHLWDEDLLDSKVIESLDDQTDIYQYVQNYMAPHPARDFVVLRTWRTNLAKGACVLSCTSVDHDRAP--QLGVRVNVLMSRYLIEPGSSGKSKLTYLCRADLRGHMPEW 1042          
BLAST of START domain-containing protein vs. Ensembl Xenopus
Match: DLC1 (DLC1 Rho GTPase activating protein [Source:NCBI gene;Acc:100488460])

HSP 1 Score: 55.8398 bits (133), Expect = 2.290e-7
Identity = 38/118 (32.20%), Postives = 58/118 (49.15%), Query Frame = 1
Query:  265 DVLHDE-EYRKLWDRNMLEGFQIGSVSENSDITYYALKSPFVFKNRDFITQRCWR--VKGNEFFIFNHSVFHKKYPPKKDFVRGLSYVTGYLIKKISENLSEFTYLTQSDPRGYIPAW 609
            DVLH     + LWD ++L+   I S+ + +DI  Y          RDF+  R WR  +      +   SV H + P  +  VR    ++ YLI+  S   S+ TYL ++D RG++P W
Sbjct:  928 DVLHRLLREQHLWDEDLLDSKVIESLDDQTDIYQYVQNYMAPHPARDFVVLRTWRTNLAKGACVLSCTSVDHDRAP--QLGVRVNVLMSRYLIEPGSSGKSKLTYLCRADLRGHMPEW 1043          
BLAST of START domain-containing protein vs. Ensembl Mouse
Match: Stard10 (START domain containing 10 [Source:MGI Symbol;Acc:MGI:1860093])

HSP 1 Score: 189.889 bits (481), Expect = 1.111e-54
Identity = 93/222 (41.89%), Postives = 130/222 (58.56%), Query Frame = 1
Query:   82 LKVPTDEIFDEALKLFKDNSSDWETKYNKKNIYIGVKNTSYSDFKIIKTTSKFE---IAAETLYDVLHDEEYRKLWDRNMLEGFQIGSVSENSDITYYALKSPFVFKNRDFITQRCWRVKGNEFFIFNHSVFHKKYPPKKDFVRGLSYVTGYLIKKISENLSEFTYLTQSDPRGYIPAWAINKGAEVFIPKVTKRLAKAGEDYPEWKKTHNPDYKPWLNPSQ 738
            ++VP D+ F  + +   +    W   Y+K  + + V+     D  + K   + E   + AETLYDVLHD EYRK WD N++E F I  ++ N+D+ YY+ + P   KNRD IT R W   G ++ I N+SV H KYPP+KD VR +S  TGYLI+         TYL Q DP+G +P W +NK ++   PK  K++ KA   YPEWK+ H P +KPWL+P Q
Sbjct:   22 VQVPDDQDF-RSFRSECEAEVGWNLTYSKAGVSVWVQAVEM-DRTLHKIKCRMECCDVPAETLYDVLHDIEYRKKWDSNVIETFDIARLTVNADVGYYSWRCPKPLKNRDVITLRSWLPMGADYIIMNYSVKHPKYPPRKDLVRAVSIQTGYLIQSTGPKSCVITYLAQVDPKGSLPKWVVNKSSQFLAPKAMKKMYKACIKYPEWKQKHQPHFKPWLHPEQ 241          
BLAST of START domain-containing protein vs. Ensembl Mouse
Match: Stard10 (START domain containing 10 [Source:MGI Symbol;Acc:MGI:1860093])

HSP 1 Score: 189.889 bits (481), Expect = 1.111e-54
Identity = 93/222 (41.89%), Postives = 130/222 (58.56%), Query Frame = 1
Query:   82 LKVPTDEIFDEALKLFKDNSSDWETKYNKKNIYIGVKNTSYSDFKIIKTTSKFE---IAAETLYDVLHDEEYRKLWDRNMLEGFQIGSVSENSDITYYALKSPFVFKNRDFITQRCWRVKGNEFFIFNHSVFHKKYPPKKDFVRGLSYVTGYLIKKISENLSEFTYLTQSDPRGYIPAWAINKGAEVFIPKVTKRLAKAGEDYPEWKKTHNPDYKPWLNPSQ 738
            ++VP D+ F  + +   +    W   Y+K  + + V+     D  + K   + E   + AETLYDVLHD EYRK WD N++E F I  ++ N+D+ YY+ + P   KNRD IT R W   G ++ I N+SV H KYPP+KD VR +S  TGYLI+         TYL Q DP+G +P W +NK ++   PK  K++ KA   YPEWK+ H P +KPWL+P Q
Sbjct:   22 VQVPDDQDF-RSFRSECEAEVGWNLTYSKAGVSVWVQAVEM-DRTLHKIKCRMECCDVPAETLYDVLHDIEYRKKWDSNVIETFDIARLTVNADVGYYSWRCPKPLKNRDVITLRSWLPMGADYIIMNYSVKHPKYPPRKDLVRAVSIQTGYLIQSTGPKSCVITYLAQVDPKGSLPKWVVNKSSQFLAPKAMKKMYKACIKYPEWKQKHQPHFKPWLHPEQ 241          
BLAST of START domain-containing protein vs. Ensembl Mouse
Match: Stard10 (START domain containing 10 [Source:MGI Symbol;Acc:MGI:1860093])

HSP 1 Score: 189.889 bits (481), Expect = 1.111e-54
Identity = 93/222 (41.89%), Postives = 130/222 (58.56%), Query Frame = 1
Query:   82 LKVPTDEIFDEALKLFKDNSSDWETKYNKKNIYIGVKNTSYSDFKIIKTTSKFE---IAAETLYDVLHDEEYRKLWDRNMLEGFQIGSVSENSDITYYALKSPFVFKNRDFITQRCWRVKGNEFFIFNHSVFHKKYPPKKDFVRGLSYVTGYLIKKISENLSEFTYLTQSDPRGYIPAWAINKGAEVFIPKVTKRLAKAGEDYPEWKKTHNPDYKPWLNPSQ 738
            ++VP D+ F  + +   +    W   Y+K  + + V+     D  + K   + E   + AETLYDVLHD EYRK WD N++E F I  ++ N+D+ YY+ + P   KNRD IT R W   G ++ I N+SV H KYPP+KD VR +S  TGYLI+         TYL Q DP+G +P W +NK ++   PK  K++ KA   YPEWK+ H P +KPWL+P Q
Sbjct:   22 VQVPDDQDF-RSFRSECEAEVGWNLTYSKAGVSVWVQAVEM-DRTLHKIKCRMECCDVPAETLYDVLHDIEYRKKWDSNVIETFDIARLTVNADVGYYSWRCPKPLKNRDVITLRSWLPMGADYIIMNYSVKHPKYPPRKDLVRAVSIQTGYLIQSTGPKSCVITYLAQVDPKGSLPKWVVNKSSQFLAPKAMKKMYKACIKYPEWKQKHQPHFKPWLHPEQ 241          
BLAST of START domain-containing protein vs. Ensembl Mouse
Match: Stard10 (START domain containing 10 [Source:MGI Symbol;Acc:MGI:1860093])

HSP 1 Score: 190.274 bits (482), Expect = 6.368e-54
Identity = 98/247 (39.68%), Postives = 139/247 (56.28%), Query Frame = 1
Query:   82 LKVPTDEIFDEALKLFKDNSSDWETKYNKKNIYIGVKNTSYSDFKIIKTTSKFE---IAAETLYDVLHDEEYRKLWDRNMLEGFQIGSVSENSDITYYALKSPFVFKNRDFITQRCWRVKGNEFFIFNHSVFHKKYPPKKDFVRGLSYVTGYLIKKISENLSEFTYLTQSDPRGYIPAWAINKGAEVFIPKVTKRLAKAGEDYPEWKKTHNPDYKPWLNPSQVKISKYDPADILCQPDFDMAFKIDE 813
            ++VP D+ F  + +   +    W   Y+K  + + V+     D  + K   + E   + AETLYDVLHD EYRK WD N++E F I  ++ N+D+ YY+ + P   KNRD IT R W   G ++ I N+SV H KYPP+KD VR +S  TGYLI+         TYL Q DP+G +P W +NK ++   PK  K++ KA   YPEWK+ H P +KPWL+P Q  +     +++  Q   D    IDE
Sbjct:   95 VQVPDDQDF-RSFRSECEAEVGWNLTYSKAGVSVWVQAVEM-DRTLHKIKCRMECCDVPAETLYDVLHDIEYRKKWDSNVIETFDIARLTVNADVGYYSWRCPKPLKNRDVITLRSWLPMGADYIIMNYSVKHPKYPPRKDLVRAVSIQTGYLIQSTGPKSCVITYLAQVDPKGSLPKWVVNKSSQFLAPKAMKKMYKACIKYPEWKQKHQPHFKPWLHPEQSPLPSLALSELSVQ-HADSLENIDE 338          
BLAST of START domain-containing protein vs. Ensembl Mouse
Match: Stard10 (START domain containing 10 [Source:MGI Symbol;Acc:MGI:1860093])

HSP 1 Score: 185.267 bits (469), Expect = 4.602e-53
Identity = 82/166 (49.40%), Postives = 108/166 (65.06%), Query Frame = 1
Query:  241 EIAAETLYDVLHDEEYRKLWDRNMLEGFQIGSVSENSDITYYALKSPFVFKNRDFITQRCWRVKGNEFFIFNHSVFHKKYPPKKDFVRGLSYVTGYLIKKISENLSEFTYLTQSDPRGYIPAWAINKGAEVFIPKVTKRLAKAGEDYPEWKKTHNPDYKPWLNPSQ 738
            ++ AETLYDVLHD EYRK WD N++E F I  ++ N+D+ YY+ + P   KNRD IT R W   G ++ I N+SV H KYPP+KD VR +S  TGYLI+         TYL Q DP+G +P W +NK ++   PK  K++ KA   YPEWK+ H P +KPWL+P Q
Sbjct:   68 DVPAETLYDVLHDIEYRKKWDSNVIETFDIARLTVNADVGYYSWRCPKPLKNRDVITLRSWLPMGADYIIMNYSVKHPKYPPRKDLVRAVSIQTGYLIQSTGPKSCVITYLAQVDPKGSLPKWVVNKSSQFLAPKAMKKMYKACIKYPEWKQKHQPHFKPWLHPEQ 233          
BLAST of START domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9JMD3|STA10_MOUSE (START domain-containing protein 10 OS=Mus musculus OX=10090 GN=Stard10 PE=1 SV=1)

HSP 1 Score: 189.889 bits (481), Expect = 7.772e-54
Identity = 93/222 (41.89%), Postives = 130/222 (58.56%), Query Frame = 1
Query:   82 LKVPTDEIFDEALKLFKDNSSDWETKYNKKNIYIGVKNTSYSDFKIIKTTSKFE---IAAETLYDVLHDEEYRKLWDRNMLEGFQIGSVSENSDITYYALKSPFVFKNRDFITQRCWRVKGNEFFIFNHSVFHKKYPPKKDFVRGLSYVTGYLIKKISENLSEFTYLTQSDPRGYIPAWAINKGAEVFIPKVTKRLAKAGEDYPEWKKTHNPDYKPWLNPSQ 738
            ++VP D+ F  + +   +    W   Y+K  + + V+     D  + K   + E   + AETLYDVLHD EYRK WD N++E F I  ++ N+D+ YY+ + P   KNRD IT R W   G ++ I N+SV H KYPP+KD VR +S  TGYLI+         TYL Q DP+G +P W +NK ++   PK  K++ KA   YPEWK+ H P +KPWL+P Q
Sbjct:   22 VQVPDDQDF-RSFRSECEAEVGWNLTYSKAGVSVWVQAVEM-DRTLHKIKCRMECCDVPAETLYDVLHDIEYRKKWDSNVIETFDIARLTVNADVGYYSWRCPKPLKNRDVITLRSWLPMGADYIIMNYSVKHPKYPPRKDLVRAVSIQTGYLIQSTGPKSCVITYLAQVDPKGSLPKWVVNKSSQFLAPKAMKKMYKACIKYPEWKQKHQPHFKPWLHPEQ 241          
BLAST of START domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9Y365|STA10_HUMAN (START domain-containing protein 10 OS=Homo sapiens OX=9606 GN=STARD10 PE=1 SV=2)

HSP 1 Score: 187.963 bits (476), Expect = 4.915e-53
Identity = 92/222 (41.44%), Postives = 130/222 (58.56%), Query Frame = 1
Query:   82 LKVPTDEIFDEALKLFKDNSSDWETKYNKKNIYIGVKNTSYSDFKIIKTTSKFE---IAAETLYDVLHDEEYRKLWDRNMLEGFQIGSVSENSDITYYALKSPFVFKNRDFITQRCWRVKGNEFFIFNHSVFHKKYPPKKDFVRGLSYVTGYLIKKISENLSEFTYLTQSDPRGYIPAWAINKGAEVFIPKVTKRLAKAGEDYPEWKKTHNPDYKPWLNPSQ 738
            ++VP D+ F  + +   +    W   Y++  + + V+     D  + K   + E   + AETLYDVLHD EYRK WD N++E F I  ++ N+D+ YY+ + P   KNRD IT R W   G ++ I N+SV H KYPP+KD VR +S  TGYLI+         TYL Q DP+G +P W +NK ++   PK  K++ KA   YPEWK+ H P +KPWL+P Q
Sbjct:   22 VQVPDDQDF-RSFRSECEAEVGWNLTYSRAGVSVWVQAVEM-DRTLHKIKCRMECCDVPAETLYDVLHDIEYRKKWDSNVIETFDIARLTVNADVGYYSWRCPKPLKNRDVITLRSWLPMGADYIIMNYSVKHPKYPPRKDLVRAVSIQTGYLIQSTGPKSCVITYLAQVDPKGSLPKWVVNKSSQFLAPKAMKKMYKACLKYPEWKQKHLPHFKPWLHPEQ 241          
BLAST of START domain-containing protein vs. UniProt/SwissProt
Match: sp|P53808|PPCT_MOUSE (Phosphatidylcholine transfer protein OS=Mus musculus OX=10090 GN=Pctp PE=1 SV=2)

HSP 1 Score: 60.4622 bits (145), Expect = 6.262e-9
Identity = 52/204 (25.49%), Postives = 84/204 (41.18%), Query Frame = 1
Query:   94 TDEIFDEALKLFKD---NSSDWETKYNKKNIYIGVKNTSYSDFKIIKTTSKFEIAAETLY-DVLHDEEYRKLWDRNMLEGFQIGSVSENSDITYYALKSPFVFKNRDFITQRCWRV----KGNEFFIFNHSVFHKKYPPKKDFVRGLSYVTGYLIKKISENLSEFTYLTQSDPRGYIPAWAINKGAEVFIPKVTKRLAKAGEDY 681
            +DE F EA    +      +DW+       I I       S     K     E  +  L  DV  D +YRK WD+ + E ++    S+   + Y+ +K PF   NRD++  R  R     +   + +   S+   ++P K   +R   Y     I+   +  S        +P G IP+W IN  A+  +P   K + KA ++Y
Sbjct:    9 SDEQFREACAELQKPALTGADWQLLVEASGITIYRLLDQPSGLYEYKVFGVLEGCSPALLTDVYMDLDYRKQWDQYVKELYE--KESDEQMVAYWEVKYPFPLSNRDYVYTRQRRDLDVDRRKIYVVLAQSISAPQFPEKSGVIRVKQYKQSLAIESDGKKGSRVFMYYFDNPGGQIPSWLINWAAKNGVPNFLKDMVKACQNY 210          
BLAST of START domain-containing protein vs. UniProt/SwissProt
Match: sp|P53809|PPCT_RAT (Phosphatidylcholine transfer protein OS=Rattus norvegicus OX=10116 GN=Pctp PE=2 SV=2)

HSP 1 Score: 59.6918 bits (143), Expect = 9.207e-9
Identity = 51/206 (24.76%), Postives = 88/206 (42.72%), Query Frame = 1
Query:   94 TDEIFDEALKLFKD---NSSDWETKYNKKNIYIGV---KNTSYSDFKIIKTTSKFEIAAETLYDVLHDEEYRKLWDRNMLEGFQIGSVSENSDITYYALKSPFVFKNRDFITQRCWR---VKGNEFFI-FNHSVFHKKYPPKKDFVRGLSYVTGYLIKKISENLSEFTYLTQSDPRGYIPAWAINKGAEVFIPKVTKRLAKAGEDY 681
            +DE F EA    +      +DW+       I I     ++T   ++K+             L DV  D +YRK WD+ + E ++     +   + Y+ +K PF   NRD++  R  R   V G + ++    ++   ++P K   +R   Y     I+   +  S        +P G IP+W IN  A+  +P   K + KA ++Y
Sbjct:    9 SDEQFREACAELQKPALTGADWQLLVEASGITIYRLLDQSTGLYEYKVFGVLE--SCIPSLLADVYMDLDYRKKWDQYVKELYE--KSFDGQMVAYWEVKYPFPLSNRDYVYTRQRRDLDVDGRKIYVVLAQNISVPQFPEKSGVIRVKQYKQSLAIESDGKKGSRVFMYYFDNPGGQIPSWLINWAAKNGVPSFLKDMVKACQNY 210          
BLAST of START domain-containing protein vs. UniProt/SwissProt
Match: sp|P02720|PPCT_BOVIN (Phosphatidylcholine transfer protein OS=Bos taurus OX=9913 GN=PCTP PE=1 SV=1)

HSP 1 Score: 55.4546 bits (132), Expect = 2.605e-7
Identity = 41/147 (27.89%), Postives = 67/147 (45.58%), Query Frame = 1
Query:  253 ETLYDVLHDEEYRKLWDRNMLEGFQIGSVSENSDITYYALKSPFVFKNRDFITQRCWR---VKGNEF-FIFNHSVFHKKYPPKKDFVRGLSYVTGYLIKKISENLSEFTYLTQSDPRGYIPAWAINKGAEVFIPKVTKRLAKAGEDY 681
            + L DV  D  YRK WD+ + E ++     E   + Y+ +K PF   NRD++  R  +    +G +   I   S    ++P K   +R   Y     I+   +  S+       +P G IP+W IN  A+  +P   K + KA ++Y
Sbjct:   66 DLLADVYMDLAYRKQWDQYVKELYEKECSGET--VVYWQVKYPFPMSNRDYVYVRQRQELDFEGQKVHVILAQSTSEPQFPEKSGVIRVKHYKQRLAIQSDGKRGSKVFMYYFDNPGGQIPSWVINWAAKNGVPNFLKDMVKACQNY 210          
BLAST of START domain-containing protein vs. TrEMBL
Match: K1QJW9 (PCTP-like protein OS=Crassostrea gigas OX=29159 GN=CGI_10024298 PE=4 SV=1)

HSP 1 Score: 245.358 bits (625), Expect = 1.745e-72
Identity = 118/256 (46.09%), Postives = 166/256 (64.84%), Query Frame = 1
Query:   67 LKVGELKVPTDEIFDEALKLFKDNSSDWETKYNKKNIYIGVKNTSYSDFKIIKTTSKF-EIAAETLYDVLHDEEYRKLWDRNMLEGFQIGSVSENSDITYYALKSPFVFKNRDFITQRCWRVKGNEFFIFNHSVFHKKYPPKKDFVRGLSYVTGYLIKKISENLSEFTYLTQSDPRGYIPAWAINKGAEVFIPKVTKRLAKAGEDYPEWKKTHNPDYKPWLNPSQVKISKYDPADILCQPDFDMAFKIDERQHKEE 831
            + VGE++V  D  F+  LK   D+++ W+ +YNK N  +  K    S+F+++K  + F +I AE LYDVLHD +YRK WD  M+EG++I +++ N+DI YYA+K P   KNRDF+TQR W   G E  I NHSV HK  P +K +VRG+SYVTGYLI++      +FTY++QSDPRG +PAW +NK  +   PKV  R+ KA ++Y  WK +HNP +KPWL P Q+ + + D  DI  + +F     +DE   KEE
Sbjct:    1 MDVGEVRVAEDADFNR-LKSLCDDTNGWKQEYNKNNTTVWTKINELSEFQMVKVRTVFKDIKAEVLYDVLHDPDYRKTWDHTMVEGYEICAINPNNDIGYYAMKCPPPLKNRDFVTQRSWLDLGAEKCIVNHSVNHKSMPIRKGYVRGISYVTGYLIREQGAQKCQFTYVSQSDPRGKLPAWVVNKATQYLAPKVISRIYKACQNYSTWKSSHNPGHKPWLYPEQMSLPRLDLQDIQAECEFTSNESLDESNVKEE 255          
BLAST of START domain-containing protein vs. TrEMBL
Match: A0A2C9KZD3 (START domain-containing protein OS=Biomphalaria glabrata OX=6526 GN=106054639 PE=4 SV=1)

HSP 1 Score: 238.424 bits (607), Expect = 7.804e-70
Identity = 117/240 (48.75%), Postives = 158/240 (65.83%), Query Frame = 1
Query:   61 MTLKVGELKVPTDEIFDEALKLFKDNSSDWETKYNKKNIYIGVKNTSYSDFKIIKTTSKFEIAAETLYDVLHDEEYRKLWDRNMLEGFQIGSVSENSDITYYALKSPFVFKNRDFITQRCWRVKGNEFFIFNHSVFHKKYPPKKDFVRGLSYVTGYLIKKISENLSEFTYLTQSDPRGYIPAWAINKGAEVFIPKVTKRLAKAGEDYPEWKKTHNPDYKPWLNPSQV--KISKYDPADIL 774
            ++LKVGE+K+P D  F     L +DN   W+ + NK    +  K    SDFK++K  S F+I A TLYDVLHD  YRK WD +MLEG +I +++ N+DI YYA++ P   KNRDF+TQR W   G E  I NHSV H     KK F+RG S++TGY I K+  + ++ TY++QSDP+G +PAWAINK   +F PKV  R+ KA ++Y  WK  +NPD KPWLNP Q+   + +Y+PADI+
Sbjct:    5 LSLKVGEVKIPEDSDFRHFKSLCEDNDG-WKLEVNKNQTTVWTKANELSDFKMVKVRSVFDIDAATLYDVLHDPHYRKTWDHSMLEGAEICAINPNNDIGYYAIRCPPPLKNRDFVTQRSWLDCGYEKIIINHSVNHVARSLKKGFIRGTSFLTGYYIVKLEADKTQLTYVSQSDPKGNLPAWAINKLTRIFAPKVIHRIYKAAKNYNSWKSKNNPDLKPWLNPEQMMTTLPRYNPADIV 243          
BLAST of START domain-containing protein vs. TrEMBL
Match: A0A4S2MEF2 (START domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_001558 PE=4 SV=1)

HSP 1 Score: 238.424 bits (607), Expect = 1.117e-69
Identity = 115/260 (44.23%), Postives = 164/260 (63.08%), Query Frame = 1
Query:   67 LKVGELKVPTDEIFDEALKLFKDNSSDWETKYNKKNIYIGVKNTSYSDFKIIKTTSKF-EIAAETLYDVLHDEEYRKLWDRNMLEGFQIGSVSENSDITYYALKSPFVFKNRDFITQRCWRVKGNEFFIFNHSVFHKKYPPKKDFVRGLSYVTGYLIKKISENLSEFTYLTQSDPRGYIPAWAINKGAEVFIPKVTKRLAKAGEDYPEWKKTHNPDYKPW--LNPSQVKISKYDPADILCQPDFDMAFKIDERQHKEEVV 837
             ++GE+++PTD+ FD    +  D +S W+  ++KK + +  ++TS S FK+IK  +   +++A+ +YD LHD  YR  WD+ M EG +I  +S NS I Y+A+K+PF F NRDF+  R WR+ G+EF IFN SVFHKK PPKK+++RG+ ++TGYLI++      +F Y+TQ+DPRG IPAWAIN G +   P + K L +A  DYP WK  H+PD+ PW   N         D  DIL +PDF    +IDE    E   
Sbjct:    4 FELGEVRLPTDDDFDYFKSMVLD-TSQWKKHHSKKKVQVFTRSTSVSSFKMIKVIASLPDVSADVMYDTLHDSIYRGSWDKTMKEGHEICRISPNSVIDYHAIKAPFAFSNRDFVMNRVWRISGDEFIIFNRSVFHKKAPPKKEYIRGICFLTGYLIRRTGPRSCDFYYITQNDPRGIIPAWAINLGTKSLAPSIMKSLHRAALDYPAWKDQHDPDFMPWRYTNQQSGLSPPLDMNDILKEPDF-CRTEIDESNVSEAAA 261          
BLAST of START domain-containing protein vs. TrEMBL
Match: H2KSW8 (PCTP-like protein OS=Clonorchis sinensis OX=79923 GN=CLF_110624 PE=4 SV=1)

HSP 1 Score: 235.343 bits (599), Expect = 1.613e-68
Identity = 113/260 (43.46%), Postives = 163/260 (62.69%), Query Frame = 1
Query:   67 LKVGELKVPTDEIFDEALKLFKDNSSDWETKYNKKNIYIGVKNTSYSDFKIIKTTSKF-EIAAETLYDVLHDEEYRKLWDRNMLEGFQIGSVSENSDITYYALKSPFVFKNRDFITQRCWRVKGNEFFIFNHSVFHKKYPPKKDFVRGLSYVTGYLIKKISENLSEFTYLTQSDPRGYIPAWAINKGAEVFIPKVTKRLAKAGEDYPEWKKTHNPDYKPW--LNPSQVKISKYDPADILCQPDFDMAFKIDERQHKEEVV 837
             ++GE+++PTD+ FD    +  D +S W+  ++KK + +  ++TS S FK+IK  +   +++A+ +YD LHD  YR  WD+ M EG +I  +S NS I Y+A+K+PF F NRDF+  R WR+ G+EF IFN SVFHKK PPKK+++RG+ ++TGYLI++      +F Y+TQ+DPRG IPAWAIN G +   P + + L +A   YP WK  H+PD+ PW   N         D  DIL +PDF    +IDE    E   
Sbjct:    4 FELGEVRLPTDDDFDYFKSMVLD-TSQWKKHHSKKKVQVFTRSTSVSSFKMIKVIASLPDVSADVMYDTLHDSIYRGSWDKTMKEGHEICRISPNSVIDYHAIKAPFAFSNRDFVMNRVWRISGDEFIIFNRSVFHKKAPPKKEYIRGICFLTGYLIRRTGPRSCDFYYITQNDPRGIIPAWAINLGTKSLAPSIMRSLHRAALSYPAWKDQHDPDFMPWRYTNQQSGLSPPLDMNDILKEPDF-CRTEIDESNVSEAAA 261          
BLAST of START domain-containing protein vs. TrEMBL
Match: A0A210PPP5 (PCTP-like protein OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT12152 PE=4 SV=1)

HSP 1 Score: 236.113 bits (601), Expect = 4.636e-68
Identity = 113/258 (43.80%), Postives = 160/258 (62.02%), Query Frame = 1
Query:   67 LKVGELKVPTDEIFDEALKLFKDNSSDWETKYNKKNIYIGVKNTSYSDFKIIKTTSKF-EIAAETLYDVLHDEEYRKLWDRNMLEGFQIGSVSENSDITYYALKSPFVFKNRDFITQRCWRVKGNEFFIFNHSVFHKKYPPKKDFVRGLSYVTGYLIKKISENLSEFTYLTQSDPRGYIPAWAINKGAEVFIPKVTKRLAKAGEDYPEWKKTHNPDYKPWLNPSQVKISKYDPADILCQPDFDMAFKIDERQHKEEVV 837
            ++VGE++V  D  F + L    D    W+ +YNK N  +  KN   SD KIIK  + F ++ AE LYDVLHD  YRK WD +MLEG++I +++ N+DI YYA+K P   KNRDF+TQR W   G+EF+I NHSV H   P +K F+RG+S+VTG+LI+K      +  Y++ SDP+G +P WA+NK  ++  PKV  R+ KA ++Y  WK  +NP  KPWL P Q+ + + D   I    +F     IDE   +E+ +
Sbjct:    1 MQVGEVRVAEDADF-KRLNTLCDEKDGWKQEYNKNNTCVWTKNNDVSDCKIIKVRTLFTDVKAEVLYDVLHDPHYRKTWDMSMLEGYEICALNPNNDIGYYAMKCPSPLKNRDFVTQRSWLDLGSEFYILNHSVNHASVPARKGFIRGVSHVTGFLIRKQDTFTCQLNYVSHSDPKGKLPVWAVNKATQILAPKVINRIYKACKNYEAWKSMNNPRMKPWLYPEQMSLPRLDMTQIKPASEFTSTESIDESSIQEDEI 257          
BLAST of START domain-containing protein vs. Ensembl Cavefish
Match: stard14 (START domain-containing protein 10-like [Source:NCBI gene;Acc:103043036])

HSP 1 Score: 214.542 bits (545), Expect = 3.026e-64
Identity = 105/265 (39.62%), Postives = 161/265 (60.75%), Query Frame = 1
Query:   67 LKVGELKVPTDEIFDEALKLFKDNSSDWETKYNKKNIYIGVK----------NTSYSDFKIIKTTSKF-EIAAETLYDVLHDEEYRKLWDRNMLEGFQIGSVSENSDITYYALKSPFVFKNRDFITQRCWRVKGNEFFIFNHSVFHKKYPPKKDFVRGLSYVTGYLIKKISENLSEFTYLTQSDPRGYIPAWAINKGAEVFIPKVTKRLAKAGEDYPEWKKTHNPDYKPWLNPSQVKISKYDPADILCQPDFDMAFKIDERQHKE 828
            +  G   +P + +F + L+    ++ +WE KY+K  + + V+           +SYS    IK      +++A T+YDVLHD +YRK WD  MLE F+I  +S N+D++YY+   P   KNRD +T R W+   +E+ I N+SV H KYPP+KD VR +SY+TGYL+K    N   FTYL+Q+DP+G +P WA+NK ++V  PKV K + KAG++YP WK  ++P++KPWL P Q ++   +P ++  Q   D    +DE   ++
Sbjct:    1 MSRGSGIIPDESVFAD-LRRQCSSTENWENKYSKNGMDVWVEVPSINSVQGNKSSYSKVHKIKCRIAISDVSAATMYDVLHDNKYRKTWDPAMLESFEIARLSPNADVSYYSWLCPKPLKNRDVVTLRSWQASEDEYIIVNYSVKHAKYPPRKDLVRAVSYLTGYLLKPTGPNSCSFTYLSQADPKGSLPKWAVNKASQVLAPKVMKSVHKAGQNYPAWKAQNSPEHKPWLYPIQSELPMMNPRELSIQ-RGDSLENVDESSSRD 263          
BLAST of START domain-containing protein vs. Ensembl Cavefish
Match: stard15 (START domain-containing protein 10-like [Source:NCBI gene;Acc:103033714])

HSP 1 Score: 204.142 bits (518), Expect = 2.197e-60
Identity = 103/255 (40.39%), Postives = 147/255 (57.65%), Query Frame = 1
Query:   82 LKVPTDEIFDEALKLFKDNSSDWETKYNKKNIYIGVKNTSYSDFKIIKTTSKF-EIAAETLYDVLHDEEYRKLWDRNMLEGFQIGSVSENSDITYYALKSPFVFKNRDFITQRCWRVKGNEFFIFNHSVFHKKYPPKKDFVRGLSYVTGYLIKKISENLSEFTYLTQSDPRGYIPAWAINKGAEVFIPKVTKRLAKAGEDYPEWKKTHNPDYKPWLNPSQVKISKYDPADILCQPDFDMAFKIDERQHKEEVVKH 843
            +++P D  F  + K   +N   W  +YNK  + +  +       + +K      ++ AETLYDVLHD  YRK WD NM++ F IG ++ N+D+ YY+ K P   KNRDF+T R W   GN++ I N+SV H +YPPKKD+VR +S +TGYLI+    N     YLTQ DPRG +P W +N+ ++   PK  +++ KA   YPEWK+ H P+ KPW+ P Q  +   + AD+  Q   D    IDE    EE  +H
Sbjct:    3 VQIPDDTDF-ASFKDQCENHDGWLARYNKGGVTVWCREEETKTVQKLKMRIVCKDVRAETLYDVLHDTSYRKKWDTNMIDTFDIGRLTVNADVGYYSWKCPSPLKNRDFVTMRSWLPLGNDYLIINYSVKHPQYPPKKDYVRAVSLLTGYLIQSNGPNCCTLYYLTQVDPRGSLPKWVVNRVSQFVAPKAMRKIYKACLKYPEWKRKHEPNLKPWMYPEQNTLPCINVADLTVQ-RADSLENIDESGLSEEKNQH 255          
BLAST of START domain-containing protein vs. Ensembl Cavefish
Match: stard10 (StAR related lipid transfer domain containing 10 [Source:NCBI gene;Acc:103028029])

HSP 1 Score: 199.134 bits (505), Expect = 2.052e-58
Identity = 111/260 (42.69%), Postives = 146/260 (56.15%), Query Frame = 1
Query:   79 ELKVPTDEIFDEALKLFKDNSSDWETKYNKKNI--YIGVKNTSYSDFKIIKTTSKFEIAAETLYDVLHDEEYRKLWDRNMLEGFQIGSVSENSDITYYALKSPFVFKNRDFITQRCWRVKGNEFFIFNHSVFHKKYPPKKDFVRGLSYVTGYLIKKISENLSEFTYLTQSDPRGYIPAWAINKGAEVFIPKVTKRLAKAGEDYPEWKKTHNPDYKPWLNPSQVKISKYDPADILCQPDFDMAFKIDE---RQHKEEVVKH 843
            E+ +P D+ F  + K+   +   W   YNK  I   I +     S  KI       ++AAET+YDVLHD EYRK WD N++E F IG ++ N+DI YY+ K P   KNRD IT R W   G ++ I N+SV H KYPPKKD VR +S  TGYLI+    +    TYL Q DPRG +P W +NK ++   PK  K + KA   Y EWK+ HNP YKPWL P Q  +S    +++  Q   D    IDE    + K+E  +H
Sbjct:    5 EVLIPDDKAF-ISFKIECCSDEGWSLTYNKTGITVLIQILEEEKSLHKIKCRMVCKDVAAETMYDVLHDIEYRKKWDSNVIETFDIGKLTVNADIGYYSWKCPKPLKNRDVITLRSWLPMGKDYIIMNYSVKHPKYPPKKDMVRAVSIQTGYLIQSNGPSSCTLTYLAQVDPRGSLPKWVVNKSSQFLAPKAMKHICKACLKYAEWKQRHNPGYKPWLYPEQNPLSSIPLSELSIQ-HADSLENIDESSLSEGKDERAEH 262          
BLAST of START domain-containing protein vs. Ensembl Cavefish
Match: star (steroidogenic acute regulatory protein [Source:NCBI gene;Acc:63999])

HSP 1 Score: 55.4546 bits (132), Expect = 6.199e-8
Identity = 38/138 (27.54%), Postives = 72/138 (52.17%), Query Frame = 1
Query:  235 KFEIAAETLYDVLHDE-----EYRKLWDRNMLEGFQIGSVSENSDITY-YALKSPF-VFKNRDFITQRCWRVKGNEFFIFNHSVFHKKYPPKKDFVRGLSYVTGYLIKKISE--NLSEFTYLTQSDPRGYIPAWAINK 621
            K E+  +   D L++E     E    W+ N+ +   +  V +++ +T+  A ++P  V   RDF++ RC + +G+  F+   +  H   P +K FVR  +  T  ++K  ++  N ++FT+L   D +G+IP   IN+
Sbjct:  118 KLEVVLDQQPDDLYEELVDNIEKMGEWNPNVKQVKILQKVGQDTMVTHEMASETPGNVVGPRDFVSVRCAKRRGSTCFLAGMATQHPSMPEQKGFVRAENGPTCIVLKPSTDDPNKTQFTWLLNLDLKGWIPKTVINR 255          
BLAST of START domain-containing protein vs. Ensembl Cavefish
Match: stard13a (StAR-related lipid transfer (START) domain containing 13a [Source:ZFIN;Acc:ZDB-GENE-091116-18])

HSP 1 Score: 55.4546 bits (132), Expect = 2.104e-7
Identity = 38/167 (22.75%), Postives = 77/167 (46.11%), Query Frame = 1
Query:  118 LKLFKDNSSDWETKYNKKNIYIGVKNTS-YSDFKIIKTTSKFEIAAETLYDVLHDEEYRKLWDRNMLEGFQIGSVSENSDITYYALKSPFVFKNRDFITQRCWR--VKGNEFFIFNHSVFHKKYPPKKDFVRGLSYVTGYLIKKISENLSEFTYLTQSDPRGYIPAW 609
            LK  +D +  W  + N  N+ +  +     S  +  + + + E     + + +  E  R LWD N+L+G  + ++ + +++  YA+ S     +RDF+  R WR  +      + + S+ H+   P    VRG+   + YL+++     S  T++ + D +G    W
Sbjct:  880 LKEARDKTKCWVARPNINNVELSFRKVGDGSPLRRWRVSVEVEAPPCVVLNRVLRE--RHLWDSNLLQGKVLETLDKQTEVYQYAINSMAPHPSRDFVVLRTWRTDMPKGACVLVSVSIDHEDSMPMAG-VRGVVLESQYLLEQCGSGKSRLTHICRVDLKGKSLEW 1043          
BLAST of START domain-containing protein vs. Ensembl Sea Lamprey
Match: stard10 (StAR-related lipid transfer (START) domain containing 10 [Source:ZFIN;Acc:ZDB-GENE-040426-1797])

HSP 1 Score: 189.889 bits (481), Expect = 1.748e-55
Identity = 100/254 (39.37%), Postives = 147/254 (57.87%), Query Frame = 1
Query:   64 TLKVGE-LKVPTDEIFDEALKLFKDNSSDWETKYNKKNIYIGVKNTSYSDFKIIKTTSKFE---IAAETLYDVLHDEEYRKLWDRNMLEGFQIGSVSENSDITYYALKSPFVFKNRDFITQRCWRVKGNEFFIFNHSVFHKKYPPKKDFVRGLSYVTGYLIKKISENLSEFTYLTQSDPRGYIPAWAINKGAEVFIPKVTKRLAKAGEDYPEWKKTHNPDYKPWLNPSQVKISKYDPADILCQPDFDMAFKIDE 813
            T+  GE +++P DE F ++ +   +++  W+  YNK  + +  +      F + K  ++ E   ++AET+YDVLHD +YRK WD N++E F IG ++ N+D+ YY+ K     KNRDFIT R W    + + I NHSV H  YP KK+ VR +S +TGYL+     N    TYL Q DP+G +P W +NK ++   PK  K++ KA   YPEWK  HN D+KPWL P Q  +     +++  Q   D   +IDE
Sbjct:   17 TMSKGETVQIPDDEAF-QSFRNDCESTEGWDVTYNKGAVVVWTQPLRNGTF-VQKLKTRLECKDVSAETMYDVLHDIDYRKKWDSNVVETFDIGKLTANADVGYYSCKCK-PLKNRDFITLRSWLALPDSYMIINHSVKHPHYPAKKECVRAVSLMTGYLVHITGANSCSLTYLCQVDPKGSLPKWVVNKSSQFMAPKAMKKIYKACLKYPEWKSKHNCDHKPWLYPEQNTLVTVRLSELTVQ-HADSLERIDE 266          
BLAST of START domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003106.1 (pep scaffold:Pmarinus_7.0:GL476998:37517:41189:1 gene:ENSPMAG00000002845.1 transcript:ENSPMAT00000003106.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 64.6994 bits (156), Expect = 3.520e-11
Identity = 36/99 (36.36%), Postives = 52/99 (52.53%), Query Frame = 1
Query: 1255 EESPQKKFLVKEMSDAFHQINKGMRKLQQMDVNEERFSEVNKLIQKNLACYYEIYREMKPQTVQTTLDRFVKKTRIGYSVSEDNAMDCSLVISKHDDDT 1551
            +E+P      K +S+AF     GM  L++ D N ER S+ +++I+    CY EIYRE K   VQT+LD F KK      V+   A+  S +   H  D+
Sbjct:  410 QETPHPSLSTKVLSEAFQHFETGMALLEKNDPNFERSSKASEIIRSGYTCYREIYREQKKAAVQTSLDLFFKK-----PVAPRIALPKSPLAESHPSDS 503          
BLAST of START domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009988.1 (pep scaffold:Pmarinus_7.0:GL479350:24792:46194:-1 gene:ENSPMAG00000009033.1 transcript:ENSPMAT00000009988.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 58.151 bits (139), Expect = 3.254e-9
Identity = 41/150 (27.33%), Postives = 73/150 (48.67%), Query Frame = 1
Query:  205 SDFKIIKTTSKFEIAAETLY-DVLHDEEYRKLWDRNMLEGFQIGSVSENSDITY--YALKSPFVFKNRDFITQRCWRVKGNEFFIFNHSVFHKKYPPKKDFVRGLSYVTGYLIKKISE--NLSEFTYLTQSDPRGYIPAWAINKG-AEVF 636
            ++ KI           E +Y +V+   E    W+R +++   +  +S+++ +TY   A  +    K RDF+  R    +G  +     S  H+  PP  DFVRG +   G++++K SE  N   F ++  +D +G IP + +NK  AE+ 
Sbjct:  238 NNMKIFILKMSLPCPPEVVYKEVILQPERMPSWNRAVIDCQVLMRISDHTLVTYDVSAGAANGYVKPRDFVNVRRIEKQGQRYISAGMSTLHENKPPSSDFVRGNNDSGGFIVQKNSEQHNGCSFIWILNTDIKGNIPRYLVNKSLAEIM 387          
BLAST of START domain-containing protein vs. Ensembl Sea Lamprey
Match: dlc1 (DLC1 Rho GTPase activating protein [Source:ZFIN;Acc:ZDB-GENE-130206-12])

HSP 1 Score: 55.8398 bits (133), Expect = 1.759e-8
Identity = 37/136 (27.21%), Postives = 65/136 (47.79%), Query Frame = 1
Query:  211 FKIIKTTSKFEIAAETLYDVLHDEEYRKLWDRNMLEGFQIGSVSENSDITYYALKSPFVFKNRDFITQRCWRV---KGNEFFIFNHSVFHKKYPPKKDFVRGLSYVTGYLIKKISENLSEFTYLTQSDPRGYIPAW 609
             ++ KTT + E     +   +  E  R LWD ++L+   + ++  N+++ YY L S      RD++  R WR    KG+   +   SV H++ P   +  R +   + YLI+ +  N S  T++ + D RG    W
Sbjct:  317 LRLWKTTVEVEAPPPRVLQRIRSE--RHLWDEDLLQWKVVETLDPNTEVFYYVLNSMAPHPARDYLVLRSWRTDLPKGSCVLVAT-SVEHEEVPCVGE-ARAVVLASRYLIEPLGANRSRLTHVCRIDTRGRSLEW 448          
BLAST of START domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005656.1 (pep scaffold:Pmarinus_7.0:GL476578:539135:542172:1 gene:ENSPMAG00000005132.1 transcript:ENSPMAT00000005656.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 54.299 bits (129), Expect = 5.767e-8
Identity = 23/73 (31.51%), Postives = 48/73 (65.75%), Query Frame = 1
Query: 1246 SDEEESPQKKFLVKEMSDAFHQINKGMRKLQQMDVNEERFSEVNKLIQKNLACYYEIYREMKPQTVQTTLDRF 1464
            ++  ++P   F ++ +++A  +I +G+    + D N+ER SEVN++I+K ++CY E+Y E + Q  ++ ++RF
Sbjct:  420 AEATKTPTPTFTLRNLAEANRRIEEGLAIYARNDPNQERSSEVNRVIRKAMSCYTELYLEKQRQASESKINRF 492          
BLAST of START domain-containing protein vs. Ensembl Nematostella
Match: EDO39000 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBA9])

HSP 1 Score: 194.897 bits (494), Expect = 1.189e-57
Identity = 93/225 (41.33%), Postives = 136/225 (60.44%), Query Frame = 1
Query:   67 LKVGELKVPTDEIFDEALKLFKDNSSDWETKYNKKNIYIGVKNTSYSDFKIIKTTSKF-EIAAETLYDVLHDEEYRKLWDRNMLEGFQIGSVSENSDITYYALKSPFVFKNRDFITQRCWRVKGNEFFIFNHSVFHKKYPPKKDFVRGLSYVTGYLIKKISENLSEFTYLTQSDPRGYIPAWAINKGAEVFIPKVTKRLAKAGEDYPEWKKTHNPDYKPWLNPSQ 738
            ++VGE++V   E F E  +   +++  W  +Y++    +  K T  S  K+IK  + F ++    LYDVLHD EYR+ WD NM+E +++  +  N+DI YY++K P   KNRDF+TQR W+   ++F I NH+V HK   PKK F+RG S +TGY +K  +   +  TY+TQ DP+G +P W +N+ +    PKV  +L KA  +Y  WK  H P YKPWL P Q
Sbjct:    1 MQVGEVRVAKAEDF-EQFRRLSESAEKWALQYDRCGTKVYSKITDASTVKMIKVVAHFADVPFMVLYDVLHDPEYRRSWDENMIECYELCQLDCNNDIGYYSVKCPAPMKNRDFVTQRSWKCSDSDFVIINHTVHHKAAHPKKGFIRGTSILTGYHVKAKNSGCT-LTYVTQVDPKGTLPKWIVNRVSGKIAPKVVAKLHKAAIEYKSWKDLHQPSYKPWLKPEQ 223          
BLAST of START domain-containing protein vs. Ensembl Nematostella
Match: EDO43620 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RY23])

HSP 1 Score: 53.1434 bits (126), Expect = 2.639e-7
Identity = 44/186 (23.66%), Postives = 81/186 (43.55%), Query Frame = 1
Query:   79 ELKVPTDEIFDEALKLFKDNSSDWETKYNKKNIYIGVKNTSYSDFKIIKTTSKFEIAAETLYD--VLHDEEYRKLWDRNMLEGFQIGSVSENSDITYYALKSPFVFKNRDFITQRCWRVKGNEFFIFNHSVFHKKYPPKKDFVRGLSYVTGYLI--KKISENLSEFTYLTQSDPRGYIPAWAINKG 624
            E +    + FD AL+L     + W  +  +  I I   + S    K+ K     +   + ++   VL  E+  K W+ ++ E            +  +  + P V   RDF+  R W+ +GN +   N SV   K PP K  +RG ++  G+    K    N ++F  +  +D +G++P + I++ 
Sbjct:  236 EFQRKAKDTFDTALQLLTMEDNTWNLEKAQDGITIS-SHLSKETGKLFKAQCIVDARPKDVFTRIVLQVEDGPK-WNDSIAE----------CRMYIFPRQGPPVLVTRDFVNLRHWQKRGNAYVSCNVSVEFDKMPPVKPHIRGTNHPGGWCFAEKDGCRNKTDFMMVVNTDLKGWLPQYLIDQA 409          
BLAST of START domain-containing protein vs. Ensembl Medaka
Match: stard14 (START domain-containing protein 10 [Source:NCBI gene;Acc:101168965])

HSP 1 Score: 212.231 bits (539), Expect = 2.050e-63
Identity = 102/256 (39.84%), Postives = 158/256 (61.72%), Query Frame = 1
Query:   88 VPTDEIFDEALKLFKDNSSDWETKYNKKNIYIGVKNTS-YSDFKIIKTTSKF---EIAAETLYDVLHDEEYRKLWDRNMLEGFQIGSVSENSDITYYALKSPFVFKNRDFITQRCWRVKGNEFFIFNHSVFHKKYPPKKDFVRGLSYVTGYLIKKISENLSEFTYLTQSDPRGYIPAWAINKGAEVFIPKVTKRLAKAGEDYPEWKKTHNPDYKPWLNPSQVKISKYDPADILCQ-----PDFDMAFKIDERQHKE 828
            +P DE+F +  +      + W++KYNK ++ + ++N    S  K+ K   K    +++A T+YDV+HD EYRK WD NML+ F I  +S+N+D+ YY+   P   KNRD +T R W+VK +E+ I N SV H KYP + + VR +S +TGY IK    N   F YL+Q+DP+G +P W +NK ++V  P+V K + KAG+ YPEWK+ + P+ KPWL+P Q  +   +PA++  Q      + D  FK D +++++
Sbjct:    7 LPDDEVFADFRRQCLSAENCWQSKYNKNDMQVWIENPPPNSAPKVHKIRCKMTIKDVSAATMYDVIHDGEYRKTWDPNMLDSFDIARLSDNADVGYYSWNCPKPLKNRDVVTLRSWQVKDDEYIIINFSVKHPKYPAQGNLVRAVSMLTGYYIKNTGPNSCTFIYLSQADPKGSLPKWVVNKASQVLAPRVLKSVHKAGQKYPEWKQQNKPNQKPWLHPEQSSLPTMNPAELSIQRADSLENVDETFKKDAQENED 262          
BLAST of START domain-containing protein vs. Ensembl Medaka
Match: stard15 (START domain-containing protein 10 [Source:NCBI gene;Acc:101170411])

HSP 1 Score: 205.682 bits (522), Expect = 1.551e-60
Identity = 106/261 (40.61%), Postives = 149/261 (57.09%), Query Frame = 1
Query:   73 VGELKVPTDEIFDEALKLFKD---NSSDWETKYNKKNIYIGVKNTSYSDFKIIKTTSKF-EIAAETLYDVLHDEEYRKLWDRNMLEGFQIGSVSENSDITYYALKSPFVFKNRDFITQRCWRVKGNEFFIFNHSVFHKKYPPKKDFVRGLSYVTGYLIKKISENLSEFTYLTQSDPRGYIPAWAINKGAEVFIPKVTKRLAKAGEDYPEWKKTHNPDYKPWLNPSQVKISKYDPADILCQPDFDMAFKIDERQHKEEVVKH 843
            V +L++P     D     FKD   +   W+++YNK  + +  +    S  + +K      ++ AETLYDVLHD  YRK WD NM+E + IG ++ N+D+ YY+ + P   KNRDF+T R W   GN++ I N SV H K+PP+KD+VR +S  TGYLI+      S   YLTQ DPRG +P W +N+ ++   PK  K++ KA   YPEWK+ HNP  KPW+ P Q  +   +PA++  Q   D    IDE    EE   H
Sbjct:   27 VFDLEMPVQIPDDSDFSSFKDQVLSEDGWKSRYNKGGVTVWCREEESSAVQKLKMRIVCKDLPAETLYDVLHDINYRKKWDSNMIETYDIGRLTVNADVGYYSWRCPSPLKNRDFVTMRSWLPLGNDYLIINFSVKHPKHPPRKDYVRAVSLQTGYLIQSNGATGSTLYYLTQVDPRGSLPKWVVNRVSQFVAPKAMKKIYKAALKYPEWKRKHNPALKPWMFPEQNALPPINPAELTLQ-RADSLENIDESGLSEEKTHH 286          
BLAST of START domain-containing protein vs. Ensembl Medaka
Match: stard15 (START domain-containing protein 10 [Source:NCBI gene;Acc:101170411])

HSP 1 Score: 204.142 bits (518), Expect = 1.851e-60
Identity = 105/258 (40.70%), Postives = 148/258 (57.36%), Query Frame = 1
Query:   82 LKVPTDEIFDEALKLFKD---NSSDWETKYNKKNIYIGVKNTSYSDFKIIKTTSKF-EIAAETLYDVLHDEEYRKLWDRNMLEGFQIGSVSENSDITYYALKSPFVFKNRDFITQRCWRVKGNEFFIFNHSVFHKKYPPKKDFVRGLSYVTGYLIKKISENLSEFTYLTQSDPRGYIPAWAINKGAEVFIPKVTKRLAKAGEDYPEWKKTHNPDYKPWLNPSQVKISKYDPADILCQPDFDMAFKIDERQHKEEVVKH 843
            +++P D  F      FKD   +   W+++YNK  + +  +    S  + +K      ++ AETLYDVLHD  YRK WD NM+E + IG ++ N+D+ YY+ + P   KNRDF+T R W   GN++ I N SV H K+PP+KD+VR +S  TGYLI+      S   YLTQ DPRG +P W +N+ ++   PK  K++ KA   YPEWK+ HNP  KPW+ P Q  +   +PA++  Q   D    IDE    EE   H
Sbjct:    3 VQIPDDSDFSS----FKDQVLSEDGWKSRYNKGGVTVWCREEESSAVQKLKMRIVCKDLPAETLYDVLHDINYRKKWDSNMIETYDIGRLTVNADVGYYSWRCPSPLKNRDFVTMRSWLPLGNDYLIINFSVKHPKHPPRKDYVRAVSLQTGYLIQSNGATGSTLYYLTQVDPRGSLPKWVVNRVSQFVAPKAMKKIYKAALKYPEWKRKHNPALKPWMFPEQNALPPINPAELTLQ-RADSLENIDESGLSEEKTHH 255          
BLAST of START domain-containing protein vs. Ensembl Medaka
Match: stard10 (StAR related lipid transfer domain containing 10 [Source:NCBI gene;Acc:101172673])

HSP 1 Score: 184.882 bits (468), Expect = 3.531e-53
Identity = 85/199 (42.71%), Postives = 119/199 (59.80%), Query Frame = 1
Query:  148 WETKYNKKNIYI--GVKNTSYSDFKIIKTTSKFEIAAETLYDVLHDEEYRKLWDRNMLEGFQIGSVSENSDITYYALKSPFVFKNRDFITQRCWRVKGNEFFIFNHSVFHKKYPPKKDFVRGLSYVTGYLIKKISENLSEFTYLTQSDPRGYIPAWAINKGAEVFIPKVTKRLAKAGEDYPEWKKTHNPDYKPWLNPSQ 738
            W   YN+  I +   V     S  ++       ++ AET+YDVLHD EYR  WD N+++ F IG ++ N+D+ YY+ K P   + RD +T R W   GN++ I N+SV H KYPP+KD VR +S  TGY+I+    N     YL Q DPRG +P W +NK +++  P+V K++ KA   Y +WKK HNP +KPWL P Q
Sbjct:   28 WSLTYNRGGITVRTQVLEEGKSIHRVKCRMVCEDVPAETMYDVLHDTEYRWRWDTNVIDTFDIGKLTVNADVGYYSWKCPRPLRYRDVVTLRSWLPMGNDYIIMNYSVKHSKYPPRKDMVRAISIQTGYMIQSQGPNRCTLVYLAQVDPRGSLPKWVVNKSSQLLAPRVLKKIHKASLKYSDWKKKHNPCFKPWLFPEQ 226          
BLAST of START domain-containing protein vs. Ensembl Medaka
Match: stard10 (StAR related lipid transfer domain containing 10 [Source:NCBI gene;Acc:101172673])

HSP 1 Score: 182.956 bits (463), Expect = 3.531e-53
Identity = 79/166 (47.59%), Postives = 109/166 (65.66%), Query Frame = 1
Query:  241 EIAAETLYDVLHDEEYRKLWDRNMLEGFQIGSVSENSDITYYALKSPFVFKNRDFITQRCWRVKGNEFFIFNHSVFHKKYPPKKDFVRGLSYVTGYLIKKISENLSEFTYLTQSDPRGYIPAWAINKGAEVFIPKVTKRLAKAGEDYPEWKKTHNPDYKPWLNPSQ 738
            ++ AET+YDVLHD EYR  WD N+++ F IG ++ N+D+ YY+ K P   + RD +T R W   GN++ I N+SV H KYPP+KD VR +S  TGY+I+    N     YL Q DPRG +P W +NK +++  P+V K++ KA   Y +WKK HNP +KPWL P Q
Sbjct:   11 DVPAETMYDVLHDTEYRWRWDTNVIDTFDIGKLTVNADVGYYSWKCPRPLRYRDVVTLRSWLPMGNDYIIMNYSVKHSKYPPRKDMVRAISIQTGYMIQSQGPNRCTLVYLAQVDPRGSLPKWVVNKSSQLLAPRVLKKIHKASLKYSDWKKKHNPCFKPWLFPEQ 176          
BLAST of START domain-containing protein vs. Planmine SMEST
Match: SMESG000028630.1 (SMESG000028630.1)

HSP 1 Score: 539.65 bits (1389), Expect = 0.000e+0
Identity = 261/261 (100.00%), Postives = 261/261 (100.00%), Query Frame = 1
Query:   61 MTLKVGELKVPTDEIFDEALKLFKDNSSDWETKYNKKNIYIGVKNTSYSDFKIIKTTSKFEIAAETLYDVLHDEEYRKLWDRNMLEGFQIGSVSENSDITYYALKSPFVFKNRDFITQRCWRVKGNEFFIFNHSVFHKKYPPKKDFVRGLSYVTGYLIKKISENLSEFTYLTQSDPRGYIPAWAINKGAEVFIPKVTKRLAKAGEDYPEWKKTHNPDYKPWLNPSQVKISKYDPADILCQPDFDMAFKIDERQHKEEVVKH 843
            MTLKVGELKVPTDEIFDEALKLFKDNSSDWETKYNKKNIYIGVKNTSYSDFKIIKTTSKFEIAAETLYDVLHDEEYRKLWDRNMLEGFQIGSVSENSDITYYALKSPFVFKNRDFITQRCWRVKGNEFFIFNHSVFHKKYPPKKDFVRGLSYVTGYLIKKISENLSEFTYLTQSDPRGYIPAWAINKGAEVFIPKVTKRLAKAGEDYPEWKKTHNPDYKPWLNPSQVKISKYDPADILCQPDFDMAFKIDERQHKEEVVKH
Sbjct:    1 MTLKVGELKVPTDEIFDEALKLFKDNSSDWETKYNKKNIYIGVKNTSYSDFKIIKTTSKFEIAAETLYDVLHDEEYRKLWDRNMLEGFQIGSVSENSDITYYALKSPFVFKNRDFITQRCWRVKGNEFFIFNHSVFHKKYPPKKDFVRGLSYVTGYLIKKISENLSEFTYLTQSDPRGYIPAWAINKGAEVFIPKVTKRLAKAGEDYPEWKKTHNPDYKPWLNPSQVKISKYDPADILCQPDFDMAFKIDERQHKEEVVKH 261          
BLAST of START domain-containing protein vs. Planmine SMEST
Match: SMESG000046413.1 (SMESG000046413.1)

HSP 1 Score: 279.641 bits (714), Expect = 3.607e-89
Identity = 132/254 (51.97%), Postives = 171/254 (67.32%), Query Frame = 1
Query:   67 LKVGELKVPTDEIFDEALKLFKDNSSDWETKYNKKNIYIGVKNTSYSDFKIIKTTSKFEIAAETLYDVLHDEEYRKLWDRNMLEGFQIGSVSENSDITYYALKSPFVFKNRDFITQRCWRVKGNEFFIFNHSVFHKKYPPKKDFVRGLSYVTGYLIKKISENLSEFTYLTQSDPRGYIPAWAINKGAEVFIPKVTKRLAKAGEDYPEWKKTHNPDYKPWLNPSQVKISKYDPADILCQPDFDMAFKIDERQHKE 828
             ++GE++ P D  F    KL  DN  +++  YNK ++ + VK+TSYS FK+ K     ++ A  +Y+ LHD +YR  WD+N++EGFQI  V  NSDI YYA+KSP  FKNRDF+TQRCWRV  NEF IFNHSVFHK YPPKK FVR +SYVTGYL++ I EN +E TY+TQS+PRG IP+WAINK A+  +PK+  R  KA   YP WKK +NP++ PW N         +  DIL QPD D+A  ++E    E
Sbjct:    4 FEIGEVRSPKDSDFVTFTKLCDDNE-NFDEVYNKNDVSVFVKSTSYSSFKMFKVRGILKVNALVMYNTLHDADYRSTWDKNLMEGFQICRVESNSDIGYYAMKSPLAFKNRDFVTQRCWRVSDNEFAIFNHSVFHKAYPPKKQFVRAISYVTGYLLRPIDENTTEMTYVTQSNPRGSIPSWAINKAAKFVVPKIVHRFQKAAIHYPAWKKQNNPNFMPWSNMGVWTTPMINWNDILFQPDVDIAVNVEEDHVTE 256          
BLAST of START domain-containing protein vs. Planmine SMEST
Match: SMESG000048192.1 (SMESG000048192.1)

HSP 1 Score: 242.276 bits (617), Expect = 1.202e-74
Identity = 116/240 (48.33%), Postives = 155/240 (64.58%), Query Frame = 1
Query:   73 VGELKVPTDEIFDEALKLFKDNSSDWETKYNKKNIYIGVKNTSYSDFKIIKTTSKF-EIAAETLYDVLHDEEYRKLWDRNMLEGFQIGSVSENSDITYYALKSPFVFKNRDFITQRCWRVKGNEFFIFNHSVFHKKYPPKKDFVRGLSYVTGYLIKKISENLSEFTYLTQSDPRGYIPAWAINKGAEVFIPKVTKRLAKAGEDYPEWKKTHNPDYKPWLNPSQVKISKYDPADILCQPDF 789
            VG+++V  D      + +  DN   W  + NK ++ I  K    SDFKI+K  +   ++AA  +YDVLHD +YR++WDR M++   I  ++ N+DI YYALKSP  FKNRDF+TQR W     E+ IFNHSVFHK+ PP+K F+R +S++TGYLIK + +N    TY+ Q DPRG +PAWA+NK  +   PKV  RL KA   YP WKK HNPD KPWL P Q+KI + +   I+  PDF
Sbjct:    6 VGDVRVADDSDMKYFMSIC-DNHEGWTLEVNKPDLQIWCKPAPESDFKIVKLKANLKDVAANVMYDVLHDPDYRRIWDRGMIKSKDICMINPNNDIGYYALKSPPPFKNRDFVTQRSWLQTSTEYVIFNHSVFHKEMPPQKSFIRAISHLTGYLIKPLPDNGCVLTYVAQCDPRGKLPAWAVNKATQYVAPKVITRLLKAAVKYPAWKKKHNPDLKPWLYPEQLKIPRINFDHIIATPDF 244          
BLAST of START domain-containing protein vs. Planmine SMEST
Match: SMESG000021912.1 (SMESG000021912.1)

HSP 1 Score: 191.43 bits (485), Expect = 4.056e-58
Identity = 91/92 (98.91%), Postives = 91/92 (98.91%), Query Frame = 1
Query: 1291 MSDAFHQINKGMRKLQQMDVNEERFSEVNKLIQKNLACYYEIYREMKPQTVQTTLDRFVKKTRIGYSVSEDNAMDCSLVISKHDDDTKITLS 1566
            MSDAFHQINKGMRKLQQMDVNEERFSEVNKLIQKNLACYYEIYREMKPQTVQT LDRFVKKTRIGYSVSEDNAMDCSLVISKHDDDTKITLS
Sbjct:    1 MSDAFHQINKGMRKLQQMDVNEERFSEVNKLIQKNLACYYEIYREMKPQTVQTILDRFVKKTRIGYSVSEDNAMDCSLVISKHDDDTKITLS 92          
BLAST of START domain-containing protein vs. Planmine SMEST
Match: SMESG000045326.1 (SMESG000045326.1)

HSP 1 Score: 194.126 bits (492), Expect = 1.662e-51
Identity = 99/115 (86.09%), Postives = 101/115 (87.83%), Query Frame = 1
Query: 1222 GENVDKGKSDEEESPQKKFLVKEMSDAFHQINKGMRKLQQMDVNEERFSEVNKLIQKNLACYYEIYREMKPQTVQTTLDRFVKKTRIGYSVSEDNAMDCSLVISKHDDDTKITLS 1566
            G  VDK K     S +    +KEMSDAFHQINKGMRKLQQMDVNEERFSEVNKLIQKNLACYYEI REMKPQTVQTTLDRFVKKTRIGYSVSEDNAMDCSLVISKHDDDTKITLS
Sbjct:  286 GNWVDKWKITINGSDR----IKEMSDAFHQINKGMRKLQQMDVNEERFSEVNKLIQKNLACYYEINREMKPQTVQTTLDRFVKKTRIGYSVSEDNAMDCSLVISKHDDDTKITLS 396          
The following BLAST results are available for this feature:
BLAST of START domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
STARD102.925e-5441.44StAR related lipid transfer domain containing 10 [... [more]
STARD101.024e-5341.44StAR related lipid transfer domain containing 10 [... [more]
STARD101.024e-5341.44StAR related lipid transfer domain containing 10 [... [more]
STARD101.133e-5249.40StAR related lipid transfer domain containing 10 [... [more]
STARD102.185e-5249.40StAR related lipid transfer domain containing 10 [... [more]
back to top
BLAST of START domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
T28D6.71.533e-5038.82pep chromosome:WBcel235:III:11344255:11346789:-1 g... [more]
strl-16.118e-723.74Steroidogenic acute regulatory-like protein 1 [So... [more]
strl-16.118e-723.74Steroidogenic acute regulatory-like protein 1 [So... [more]
strl-18.703e-723.74Steroidogenic acute regulatory-like protein 1 [So... [more]
back to top
BLAST of START domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of START domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
stard102.597e-6144.44StAR-related lipid transfer (START) domain contain... [more]
stard146.555e-6140.16START domain containing 14 [Source:ZFIN;Acc:ZDB-GE... [more]
stard146.555e-6140.16START domain containing 14 [Source:ZFIN;Acc:ZDB-GE... [more]
stard147.347e-6140.16START domain containing 14 [Source:ZFIN;Acc:ZDB-GE... [more]
stard155.640e-6042.49StAR-related lipid transfer (START) domain contain... [more]
back to top
BLAST of START domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nr2f64.003e-6042.55nuclear receptor subfamily 2 group F member 6 [Sou... [more]
stard103.855e-5842.63StAR related lipid transfer domain containing 10 [... [more]
ENSXETT00000038456.15.530e-5542.99uncharacterized LOC100145115 [Source:NCBI gene;Acc... [more]
DLC12.231e-732.20DLC1 Rho GTPase activating protein [Source:NCBI ge... [more]
DLC12.290e-732.20DLC1 Rho GTPase activating protein [Source:NCBI ge... [more]
back to top
BLAST of START domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Stard101.111e-5441.89START domain containing 10 [Source:MGI Symbol;Acc:... [more]
Stard101.111e-5441.89START domain containing 10 [Source:MGI Symbol;Acc:... [more]
Stard101.111e-5441.89START domain containing 10 [Source:MGI Symbol;Acc:... [more]
Stard106.368e-5439.68START domain containing 10 [Source:MGI Symbol;Acc:... [more]
Stard104.602e-5349.40START domain containing 10 [Source:MGI Symbol;Acc:... [more]
back to top
BLAST of START domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9JMD3|STA10_MOUSE7.772e-5441.89START domain-containing protein 10 OS=Mus musculus... [more]
sp|Q9Y365|STA10_HUMAN4.915e-5341.44START domain-containing protein 10 OS=Homo sapiens... [more]
sp|P53808|PPCT_MOUSE6.262e-925.49Phosphatidylcholine transfer protein OS=Mus muscul... [more]
sp|P53809|PPCT_RAT9.207e-924.76Phosphatidylcholine transfer protein OS=Rattus nor... [more]
sp|P02720|PPCT_BOVIN2.605e-727.89Phosphatidylcholine transfer protein OS=Bos taurus... [more]
back to top
BLAST of START domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
K1QJW91.745e-7246.09PCTP-like protein OS=Crassostrea gigas OX=29159 GN... [more]
A0A2C9KZD37.804e-7048.75START domain-containing protein OS=Biomphalaria gl... [more]
A0A4S2MEF21.117e-6944.23START domain-containing protein OS=Opisthorchis fe... [more]
H2KSW81.613e-6843.46PCTP-like protein OS=Clonorchis sinensis OX=79923 ... [more]
A0A210PPP54.636e-6843.80PCTP-like protein OS=Mizuhopecten yessoensis OX=65... [more]
back to top
BLAST of START domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
stard143.026e-6439.62START domain-containing protein 10-like [Source:NC... [more]
stard152.197e-6040.39START domain-containing protein 10-like [Source:NC... [more]
stard102.052e-5842.69StAR related lipid transfer domain containing 10 [... [more]
star6.199e-827.54steroidogenic acute regulatory protein [Source:NCB... [more]
stard13a2.104e-722.75StAR-related lipid transfer (START) domain contain... [more]
back to top
BLAST of START domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
stard101.748e-5539.37StAR-related lipid transfer (START) domain contain... [more]
ENSPMAT00000003106.13.520e-1136.36pep scaffold:Pmarinus_7.0:GL476998:37517:41189:1 g... [more]
ENSPMAT00000009988.13.254e-927.33pep scaffold:Pmarinus_7.0:GL479350:24792:46194:-1 ... [more]
dlc11.759e-827.21DLC1 Rho GTPase activating protein [Source:ZFIN;Ac... [more]
ENSPMAT00000005656.15.767e-831.51pep scaffold:Pmarinus_7.0:GL476578:539135:542172:1... [more]
back to top
BLAST of START domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of START domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO390001.189e-5741.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO436202.639e-723.66Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of START domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
stard142.050e-6339.84START domain-containing protein 10 [Source:NCBI ge... [more]
stard151.551e-6040.61START domain-containing protein 10 [Source:NCBI ge... [more]
stard151.851e-6040.70START domain-containing protein 10 [Source:NCBI ge... [more]
stard103.531e-5342.71StAR related lipid transfer domain containing 10 [... [more]
stard103.531e-5347.59StAR related lipid transfer domain containing 10 [... [more]
back to top
BLAST of START domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000028630.10.000e+0100.00SMESG000028630.1[more]
SMESG000046413.13.607e-8951.97SMESG000046413.1[more]
SMESG000048192.11.202e-7448.33SMESG000048192.1[more]
SMESG000021912.14.056e-5898.91SMESG000021912.1[more]
SMESG000045326.11.662e-5186.09SMESG000045326.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30028489 ID=SMED30028489|Name=START domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2052bp
AATTGTTATTTGTTTAATTCTATTATTTATATCGTTTAAATTCAATTTTC
AATTCAAATAATGACGTTGAAAGTAGGCGAATTAAAAGTTCCTACCGATG
AAATATTTGATGAGGCTTTAAAATTATTTAAAGACAATTCTTCTGACTGG
GAAACGAAATATAATAAAAAAAATATTTATATTGGTGTGAAAAATACAAG
TTACAGTGATTTCAAAATAATTAAAACCACATCAAAATTTGAAATTGCCG
CTGAGACACTTTATGATGTTCTCCACGACGAGGAATATCGTAAACTATGG
GATAGGAATATGCTTGAAGGTTTCCAAATTGGATCAGTTTCAGAAAACAG
TGATATCACATATTATGCATTGAAATCACCATTCGTATTCAAAAATCGGG
ATTTCATAACTCAACGATGTTGGAGGGTGAAAGGAAACGAGTTTTTTATA
TTCAACCATTCTGTGTTTCATAAAAAATATCCTCCAAAAAAAGACTTTGT
CAGAGGATTGTCCTATGTGACAGGGTATTTAATTAAGAAAATCAGTGAGA
ATCTTTCAGAATTCACATATCTTACTCAAAGTGACCCAAGAGGTTACATA
CCAGCATGGGCTATAAATAAAGGAGCCGAGGTATTTATTCCAAAAGTTAC
AAAACGTCTAGCAAAGGCTGGTGAAGATTATCCAGAATGGAAGAAAACTC
ACAATCCGGATTACAAGCCGTGGCTCAATCCGTCTCAAGTTAAAATAAGT
AAATATGATCCAGCAGACATCCTCTGTCAGCCTGATTTTGACATGGCTTT
TAAGATTGACGAGCGACAACACAAGGAAGAAGTTGTTAAACATTAATAAT
AGGATTCCACTTGAGAATAGTTAATTTATTTAATGTAAAATTATATTTTT
TTGAGTTTTAATAATGATGTTTTGATGATTTTTCTTCTGAAATTACATTA
CAGGTAGTCCCCGACTTACGACCGCTCGACTTACGACCATCCGCACTTAC
GACCAATTTTTTTTCAATTTTTTCATAGAAAATGATTAAAATAGTTTCGT
AGTCTTCCCTATAATATGTATATGAGAAAAATTTGTTAAAAAAACACCCA
ATGTACAAGATTCGATTTATTTAAGCATAAATAATACGTTTGTTTTAGTG
AATAATTTTAATCATCCCAAAAATGGCTGGAACTAGTAAAACTAATAAAA
GCAAAAGAAGTAAAATGTGTTGGAGAAAACGTTGATAAAGGCAAATCGGA
TGAAGAAGAAAGTCCACAAAAAAAATTTTTAGTAAAAGAAATGAGTGATG
CTTTTCACCAAATTAATAAGGGAATGCGTAAATTACAACAAATGGATGTA
AATGAAGAACGATTCTCAGAAGTAAATAAGCTGATTCAGAAAAATTTGGC
TTGTTATTATGAAATTTACCGGGAAATGAAACCTCAAACTGTTCAGACGA
CATTAGACAGATTTGTTAAGAAAACTAGGATTGGATATTCTGTTTCTGAA
GACAACGCAATGGATTGCTCTCTAGTAATAAGTAAACATGATGACGACAC
GAAAATAACGCTAAGTTGAATAAAATGTTTTTGTTTAATTATATATTTCT
TATTATGTATTTTTGTTTTGTTACATATATAATGTGTGTTATTAGTACAC
ATTTAATATATATTTTTGGGTTATTATTTCATTTTATAAATTTTAATAAA
GTTTTCATTATATGAATTTTCGGTAGTTTCATTTCTCCTGATCCTAAAAG
TTAGTAGTACAGTATCTAATATTTTTCTTTAGTTATTCATGATGAAACTC
GACTTACGACTTAATCGACTTACGACCGATGACTAGGAACCTATCTCGGT
CGTAAGTCGGGGACTACCTGTATATTGTTGACAATCAATTCCGAACAGAA
TACATGGTTAGATGAAACTACAAAAGTAGGTTCCAAGTCACTTGACTTTA
ACCAGATTTGTTCCATTGTCAAAATTTGATTTATCAGAATTCGAAGTTCT
GAAAGTTGAAAGCAATTCTCATTATCGATTTTTGTCCTAATTAACAACAA
CG
back to top

protein sequence of SMED30028489-orf-1

>SMED30028489-orf-1 ID=SMED30028489-orf-1|Name=SMED30028489-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=262bp
MTLKVGELKVPTDEIFDEALKLFKDNSSDWETKYNKKNIYIGVKNTSYSD
FKIIKTTSKFEIAAETLYDVLHDEEYRKLWDRNMLEGFQIGSVSENSDIT
YYALKSPFVFKNRDFITQRCWRVKGNEFFIFNHSVFHKKYPPKKDFVRGL
SYVTGYLIKKISENLSEFTYLTQSDPRGYIPAWAINKGAEVFIPKVTKRL
AKAGEDYPEWKKTHNPDYKPWLNPSQVKISKYDPADILCQPDFDMAFKID
ERQHKEEVVKH*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0000074oocyte
PLANA:0000099neuron
PLANA:0000231vitelline gland
PLANA:0000418head
PLANA:0002032epidermal cell
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR002913START_lipid-bd_dom
IPR023393START-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0008289lipid binding