slc22a-3

Overview
Nameslc22a-3 (AKN21551.1)
Smed IDSMED30028480
Length (bp)1868
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of slc22a-3 (SMED30028480) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for slc22a-3 (SMED30028480) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30028480

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30028480h1SMcG0001089 dd_Smed_v4_11135_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30028480h1SMcG0001089 dd_Smed_v4_11135_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30028480h1SMcG0001089 dd_Smed_v6_11135_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
proximal tubuleSMED30028480h1SMcG0001089 Smed-slc22a-3smed_ncbi_20240424PMID:21828097
Rink et al., 2011
whole organism asexual adult fluorescence in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of slc22a-3 vs. Ensembl Human
Match: SLC22A7 (solute carrier family 22 member 7 [Source:HGNC Symbol;Acc:HGNC:10971])

HSP 1 Score: 176.022 bits (445), Expect = 2.372e-47
Identity = 139/536 (25.93%), Postives = 240/536 (44.78%), Query Frame = 3
Query:  228 MDPEKCLDELGGKNIWILKWFLLISFMKSLPCVFSMYSFQFTGVKPDSFHCALP--------PNVSRESMIPKERTGDKWEFSSCNQF-------------------QSQDNSTIIPCQNGYNYTMKYFTSSIVTEWDLVCDRAILNALATSSFFVMSFFGAIISCSIADRFGRKVVLITAFMCLNLCEFAQTYITSIYVLIVFKLLAGIFQQGCFISGFTMTIELFSLRNRSNACLADTFSWTXXXXXXXXXXXXXRDWRNYFFWTSITMLPFCLVFYHLPESIRWMMAKDQTKNAQILLKTATLYSNPPLPEKTF--ENYDKYKRKQESEKLPHYNVLHIFRETLLLRYQLINSFVWFTTAMTYYGVQVKVVEIG-NPFLNFFLSSLVEIPANILCFPIANKYGRKITIGLTNFLVGFSLFMGYILWKYLDSPWPAIIVFLVGKMLNTGIFNLIFMHVSEFFPTTLRTTAVGMSSSCARIGASFGAMIFQITLYHDSIAFVIVIGCCLLTGVLVFCLPETYRKKMPTSIEEIKQ 1745
            M  E+ L+++GG   + L+   L++  + L  +  +       V   +  CALP         +V  E+ +P+E  G     SSC +F                   + +D    +PC  G+ Y    F+S+I TEWDLVC++  LN  A++ FF     GA+    ++DRFGR+ +L+ A++   +   A     S  +  + + L G    G  I    + +E   + +R+ A +  +  WT    +L +  Y IRDWR      ++   P  L  + +PES RW++ +   K A   L      +  P+ E +F  E   K    +   + P Y  L +FR   L    L    VWF    +YYG+ + V  +G N +    L   VE+P+ +L +      GR++T   T  L+G +L  G  L    D    + ++ ++GK  +   F   ++  SE +PT LR T +G+++   R+G S   +   +     S+  +   G  LL       LPET + ++P +I+++++
Sbjct:    1 MGFEELLEQVGGFGPFQLRNVALLALPRVLLPLHFLLPIFLAAVP--AHRCALPGAPANFSHQDVWLEAHLPREPDGT---LSSCLRFAYPQALPNTTLGEERQSRGELEDEPATVPCSQGWEYDHSEFSSTIATEWDLVCEQKGLNRAASTFFFAGVLVGAVAFGYLSDRFGRRRLLLVAYVSTLVLGLASAASVSYVMFAITRTLTGSALAGFTIIVMPLELEWLDVEHRTVAGVLSSTFWTGGVMLLALVGYLIRDWRWLLLAVTLPCAPGILSLWWVPESARWLLTQGHVKEAHRYLLHCARLNGRPVCEDSFSQEAVSKVAAGERVVRRPSY--LDLFRTPRLRHISLCCVVVWFGVNFSYYGLSLDVSGLGLNVYQTQLLFGAVELPSKLLVYLSVRYAGRRLTQAGT--LLGTALAFGTRLLVSSDMKSWSTVLAVMGKAFSEAAFTTAYLFTSELYPTVLRQTGMGLTALVGRLGGSLAPLAALLDGVWLSLPKLTYGGIALLAAGTALLLPETRQAQLPETIQDVER 527          
BLAST of slc22a-3 vs. Ensembl Human
Match: SLC22A7 (solute carrier family 22 member 7 [Source:HGNC Symbol;Acc:HGNC:10971])

HSP 1 Score: 175.637 bits (444), Expect = 3.515e-47
Identity = 138/533 (25.89%), Postives = 239/533 (44.84%), Query Frame = 3
Query:  237 EKCLDELGGKNIWILKWFLLISFMKSLPCVFSMYSFQFTGVKPDSFHCALP--------PNVSRESMIPKERTGDKWEFSSCNQF-------------------QSQDNSTIIPCQNGYNYTMKYFTSSIVTEWDLVCDRAILNALATSSFFVMSFFGAIISCSIADRFGRKVVLITAFMCLNLCEFAQTYITSIYVLIVFKLLAGIFQQGCFISGFTMTIELFSLRNRSNACLADTFSWTXXXXXXXXXXXXXRDWRNYFFWTSITMLPFCLVFYHLPESIRWMMAKDQTKNAQILLKTATLYSNPPLPEKTF--ENYDKYKRKQESEKLPHYNVLHIFRETLLLRYQLINSFVWFTTAMTYYGVQVKVVEIG-NPFLNFFLSSLVEIPANILCFPIANKYGRKITIGLTNFLVGFSLFMGYILWKYLDSPWPAIIVFLVGKMLNTGIFNLIFMHVSEFFPTTLRTTAVGMSSSCARIGASFGAMIFQITLYHDSIAFVIVIGCCLLTGVLVFCLPETYRKKMPTSIEEIKQ 1745
            E+ L+++GG   + L+   L++  + L  +  +       V   +  CALP         +V  E+ +P+E  G     SSC +F                   + +D    +PC  G+ Y    F+S+I TEWDLVC++  LN  A++ FF     GA+    ++DRFGR+ +L+ A++   +   A     S  +  + + L G    G  I    + +E   + +R+ A +  +  WT    +L +  Y IRDWR      ++   P  L  + +PES RW++ +   K A   L      +  P+ E +F  E   K    +   + P Y  L +FR   L    L    VWF    +YYG+ + V  +G N +    L   VE+P+ +L +      GR++T   T  L+G +L  G  L    D    + ++ ++GK  +   F   ++  SE +PT LR T +G+++   R+G S   +   +     S+  +   G  LL       LPET + ++P +I+++++
Sbjct:    4 EELLEQVGGFGPFQLRNVALLALPRVLLPLHFLLPIFLAAVP--AHRCALPGAPANFSHQDVWLEAHLPREPDGT---LSSCLRFAYPQALPNTTLGEERQSRGELEDEPATVPCSQGWEYDHSEFSSTIATEWDLVCEQKGLNRAASTFFFAGVLVGAVAFGYLSDRFGRRRLLLVAYVSTLVLGLASAASVSYVMFAITRTLTGSALAGFTIIVMPLELEWLDVEHRTVAGVLSSTFWTGGVMLLALVGYLIRDWRWLLLAVTLPCAPGILSLWWVPESARWLLTQGHVKEAHRYLLHCARLNGRPVCEDSFSQEAVSKVAAGERVVRRPSY--LDLFRTPRLRHISLCCVVVWFGVNFSYYGLSLDVSGLGLNVYQTQLLFGAVELPSKLLVYLSVRYAGRRLTQAGT--LLGTALAFGTRLLVSSDMKSWSTVLAVMGKAFSEAAFTTAYLFTSELYPTVLRQTGMGLTALVGRLGGSLAPLAALLDGVWLSLPKLTYGGIALLAAGTALLLPETRQAQLPETIQDVER 527          
BLAST of slc22a-3 vs. Ensembl Human
Match: SLC22A7 (solute carrier family 22 member 7 [Source:HGNC Symbol;Acc:HGNC:10971])

HSP 1 Score: 171.4 bits (433), Expect = 1.544e-45
Identity = 138/535 (25.79%), Postives = 239/535 (44.67%), Query Frame = 3
Query:  237 EKCLDELGGKNIWILKWFLLISFMKSLPCVFSMYSFQFTGVKPDSFHCALP--------PNVSRESMIPKERTGDKWEFSSCNQF-------------------QSQDNSTIIPCQNGYNYTMKYFTSSIVTE--WDLVCDRAILNALATSSFFVMSFFGAIISCSIADRFGRKVVLITAFMCLNLCEFAQTYITSIYVLIVFKLLAGIFQQGCFISGFTMTIELFSLRNRSNACLADTFSWTXXXXXXXXXXXXXRDWRNYFFWTSITMLPFCLVFYHLPESIRWMMAKDQTKNAQILLKTATLYSNPPLPEKTF--ENYDKYKRKQESEKLPHYNVLHIFRETLLLRYQLINSFVWFTTAMTYYGVQVKVVEIG-NPFLNFFLSSLVEIPANILCFPIANKYGRKITIGLTNFLVGFSLFMGYILWKYLDSPWPAIIVFLVGKMLNTGIFNLIFMHVSEFFPTTLRTTAVGMSSSCARIGASFGAMIFQITLYHDSIAFVIVIGCCLLTGVLVFCLPETYRKKMPTSIEEIKQ 1745
            E+ L+++GG   + L+   L++  + L  +  +       V   +  CALP         +V  E+ +P+E  G     SSC +F                   + +D    +PC  G+ Y    F+S+I TE  WDLVC++  LN  A++ FF     GA+    ++DRFGR+ +L+ A++   +   A     S  +  + + L G    G  I    + +E   + +R+ A +  +  WT    +L +  Y IRDWR      ++   P  L  + +PES RW++ +   K A   L      +  P+ E +F  E   K    +   + P Y  L +FR   L    L    VWF    +YYG+ + V  +G N +    L   VE+P+ +L +      GR++T   T  L+G +L  G  L    D    + ++ ++GK  +   F   ++  SE +PT LR T +G+++   R+G S   +   +     S+  +   G  LL       LPET + ++P +I+++++
Sbjct:    4 EELLEQVGGFGPFQLRNVALLALPRVLLPLHFLLPIFLAAVP--AHRCALPGAPANFSHQDVWLEAHLPREPDGT---LSSCLRFAYPQALPNTTLGEERQSRGELEDEPATVPCSQGWEYDHSEFSSTIATESQWDLVCEQKGLNRAASTFFFAGVLVGAVAFGYLSDRFGRRRLLLVAYVSTLVLGLASAASVSYVMFAITRTLTGSALAGFTIIVMPLELEWLDVEHRTVAGVLSSTFWTGGVMLLALVGYLIRDWRWLLLAVTLPCAPGILSLWWVPESARWLLTQGHVKEAHRYLLHCARLNGRPVCEDSFSQEAVSKVAAGERVVRRPSY--LDLFRTPRLRHISLCCVVVWFGVNFSYYGLSLDVSGLGLNVYQTQLLFGAVELPSKLLVYLSVRYAGRRLTQAGT--LLGTALAFGTRLLVSSDMKSWSTVLAVMGKAFSEAAFTTAYLFTSELYPTVLRQTGMGLTALVGRLGGSLAPLAALLDGVWLSLPKLTYGGIALLAAGTALLLPETRQAQLPETIQDVER 529          
BLAST of slc22a-3 vs. Ensembl Human
Match: SLC22A5 (solute carrier family 22 member 5 [Source:HGNC Symbol;Acc:HGNC:10969])

HSP 1 Score: 164.081 bits (414), Expect = 5.194e-43
Identity = 109/423 (25.77%), Postives = 218/423 (51.54%), Query Frame = 3
Query:  498 CQNGYNYTMKYFTSSIVTEWDLVCDRAILNALATSSFFVMSFFGAIISCSIADRFGRKVVLITAFMCLNLCEFAQTYITSIYVLIVFKLLAGIFQQGCFISGFTMTIELFSLRNRS-----NACLADTFSWTXXXXXXXXXXXXXRDWRNYFFWTSITMLPFCLVFYHLPESIRWMMAKDQTKNAQILLKTATLYSNPPLPEKTF---ENYDKYKRKQESEKLPHYNVLHIFRETLLLRYQLINSFVWFTTAMTYYGVQVKVVEI-GNPFLNFFLSSLVEIPANILCFPIANKYGRKITIGLTNFLVGFSLFMGYILWKYLDSPWPAIIVFLVGKMLNTGIFNLIFMHVSEFFPTTLRTTAVGMSSSCARIGASFGAMIFQITLYHDSIAFVIVIGCCLLTGVLVFCLPETYRKKMPTSIEEI 1739
            C +G+ ++   + S+IVTEW+LVC+      L  S FFV    G+ IS  ++DRFGRK VL           F Q +  +  + +V  +L G+ Q   +++ F +  E+     R        C+   F +     +L ++ YFIRDWR      ++  +    +++ +PES RW++++ + + A+++++ A   +   +P   F   E  D   +KQ+S     +N+L + R   +    +++  +W T ++ Y+G+ +    + G+ F+N FLS++VE+PA +L + +     R+ ++    FL G  L    ++    D  + A ++ +VGK   T  F++++++ +E +PT +R   VG+SS+ +R+G+        +  Y   + ++++    +LT +L   LPE++   +P +I+++
Sbjct:  113 CLDGWEFSQDVYLSTIVTEWNLVCEDDWKAPLTISLFFVGVLLGSFISGQLSDRFGRKNVLFVTMGMQTGFSFLQIFSKNFEMFVVLFVLVGMGQISNYVAAFVLGTEILGKSVRIIFSTLGVCIFYAFGY----MVLPLFAYFIRDWRMLLVALTMPGVLCVALWWFIPESPRWLISQGRFEEAEVIIRKAAKANGIVVPSTIFDPSELQDLSSKKQQS-----HNILDLLRTWNIRMVTIMSIMLWMTISVGYFGLSLDTPNLHGDIFVNCFLSAMVEVPAYVLAWLLLQYLPRRYSMATALFLGGSVLLFMQLVPP--DLYYLATVLVMVGKFGVTAAFSMVYVYTAELYPTVVRNMGVGVSSTASRLGSILSPYFVYLGAYDRFLPYILMGSLTILTAILTLFLPESFGTPLPDTIDQM 524          
BLAST of slc22a-3 vs. Ensembl Human
Match: SLC22A16 (solute carrier family 22 member 16 [Source:HGNC Symbol;Acc:HGNC:20302])

HSP 1 Score: 154.836 bits (390), Expect = 7.927e-40
Identity = 122/493 (24.75%), Postives = 217/493 (44.02%), Query Frame = 3
Query:  309 KSLPCVFSMYSFQFTGVKPDSFHCALPPNVSRESMIPKERTGDKWEFSSCNQFQSQDNSTI----------IPCQNGYNYTMKYFTSSIVTEWDLVCDRAILNALATSSFFVMSFFGAIISCSIADRFGRKVVLITAFMCLNLCEFAQTYITSIYVLIVFKLLAGIFQQGCFISGFTMTIELFSLRNRSNACLADTFSWTXXXXXXXXXXXXXRDWRNYFFWTSITMLPFCLVFYHLPESIRWMMAKDQTKNAQILLKTATLY---SNPPLPEKTFENYDKYKRKQESEKLPHYNVLHIFRETLLLRYQLINSFVWFTTAMTYYGVQVKVVEI-GNPFLNFFLSSLVEIPANILCFPIANKYGRKITIGLTNFLVGFSLFMGYILWKYLDSPWPAIIVFLVGKMLNTGIFNLIFMHVSEFFPTTLRTTAVGMSSSCARIGASFGAMIFQITLYHDSIAFVIVIGCCLLTGVLVFCLPETYRKKMPTSIEEIKQ 1745
            +++ C     +  F GV P   H   PP           + G+ WE S C++ + ++ S++           PC +GY Y    + S+ VT+W+LVCDR  L  L    F      G++     +DR GR+VVL      + L   A  +    Y  +  +    +   G  + GF   +E   +++R+ A +     +   + ++ +  Y +R W  Y    S   +PF L  + LPE+  W++++ + + AQ ++     +   S+  L E    +         +E   H N+ ++F    + +  L    +WFT ++ +Y   +  V + GN +LN FL  +VEIPA        +K GR+  +  + F    +L  G ++          ++  +VGK      F LI+++ +E +PT +R+ AVG  S   R+ +        ++     I  + V    LL+GVL   LPET  K++ T+ EE  +
Sbjct:   28 QNISCGIHYLASVFMGVTPH--HVCRPPG--------NLQNGEIWELSRCSRNKRENTSSLGYEYTGSKKEFPCVDGYIYDQNTWKSTAVTQWNLVCDRKWLAMLIQPLFMFGVLLGSVTFGYFSDRLGRRVVLWATSSSMFLFGIAAAFAVDYYTFMAARFFLAMVASGYLVVGFVYVMEFIGMKSRTWASVHLHSFFAVGTLLVALTGYLVRTWWLYQMILSTVTVPFILCCWVLPETPFWLLSEGRYEEAQKIVDIMAKWNRASSCKLSELLSLDLQGPVSNSPTEVQKH-NLSYLFYNWSITKRTLTVWLIWFTGSLGFYSFSLNSVNLGGNEYLNLFLLGVVEIPAYTFVCIAMDKVGRRTVLAYSLFCS--ALACGVVMVIPQKHYILGVVTAMVGKFAIGAAFGLIYLYTAELYPTIVRSLAVGSGSMVCRLASILAPFSVDLSSIWIFIPQLFVGTMALLSGVLTLKLPETLGKRLATTWEEAAK 507          
BLAST of slc22a-3 vs. Ensembl Celegans
Match: oct-1 (Organic cation transporter 1 [Source:UniProtKB/Swiss-Prot;Acc:Q9U539])

HSP 1 Score: 167.933 bits (424), Expect = 1.127e-44
Identity = 136/535 (25.42%), Postives = 243/535 (45.42%), Query Frame = 3
Query:  246 LDELGGKNIWILKWFLLISFMKSLPCVFSMYSFQFTGVKPDSFHCALPPNVSRESMIPKERTGDKWEFSSCNQFQS-----------------QDNSTIIPCQNGYNYTMKYFTSSIVTEWDLVCDRAILNALATSSFFVMSFFGAIISCSIADRFGRKVVLITAFMCLNLCEFAQTYITSIYVLIVFKLLAGIFQQGCFISGFTMTIELFSLRNRSNACLADTFSWTXXXXXXXXXXXXXRDWRNYFFWTSITMLPFCLVFYHLPESIRWMMAKDQTKNAQILLKTATLY---SNPPLPE--KTFENYDKYKRKQESEKLPHYNVLHIFRETLLLRYQLINSFVWFTTAMTYYGVQVKVVEIG-NPFLNFFLSSLVEIPANILCFPIANKYGRKITIGLTNFLVGF----SLFM--GYILWKYLDSPWPAIIVFLVGKMLNTGIFNLIFMHVSEFFPTTLRTTAVGMSSSCARIGASFGAMIFQITLYHDSIAFVIVIGCCLLTGVLVFCLPETYRKKMPTSIEEIKQWVAHKP 1763
            L+++G    + + +F +I    SLP  FS ++  F    P    C +P    +E + P   T D  +  SC Q+                    D  +++PCQNG++Y    +  S+VTE++LVCD+     ++T+SF+V SF G  +   +AD+FGR+         L +C  A ++   I   I+ +   G+     F   F + +E      R  + L  +  +  +  +L +   FIR WR   F+ +     + + ++ LPES RW ++  +  +A+  LK        SN  + E   + +N+     ++E+++   +NV  +F+   L R  LI +++W   A+ Y G+ + V  +  + + +F ++  VE+P   + +P+    GR+ T+  T  + G     ++FM  GY        PW       +GK      F +I++   E +PT +R   +GMSS  A  G      I  +      +  +I+    L  G+L F LPET    +P +IE+ + +   KP
Sbjct:   13 LEQVGNYGTYQIVFFFIICLPTSLPSAFSAFNIPFVVGNPPH-TCHIPEG--KEYLRP--LTNDT-QILSCKQYNETQINVFRAFTSAPVDTYSDRISLVPCQNGWDYDNSTYLDSLVTEFNLVCDQQAWIEISTTSFYVGSFIGNCLFGYVADKFGRRRSFFVILTVLIVCGTASSFAKDIESFIILRFFTGLAFPALFQIPFIICMEFMGNSGRIFSGLMTSLFFGAAMALLGVVAMFIRRWRQLTFFCNAPFAFYIIYYFFLPESPRWSVSVGKWADAKKQLKKIAKMNGKSNVDVDELVDSMKNHQNAAEEKETKR--SHNVTDLFKTPNLRRKTLIVTYIWVMNAIIYNGLTLNVSNLPVDDYWSFIINGAVELPGYFVVWPLLQCAGRRWTLAATMIVCGIGCVSAMFMPDGY--------PWLVASASFIGKFGVGSGFAVIYIFAGELYPTVVRAIGMGMSSMVAGSGLLLAPHIVNLGKIVKILPLLIMGLMALSAGILTFFLPETLGAPLPMTIEDAENF-GKKP 530          
BLAST of slc22a-3 vs. Ensembl Celegans
Match: oct-1 (Organic cation transporter 1 [Source:UniProtKB/Swiss-Prot;Acc:Q9U539])

HSP 1 Score: 167.933 bits (424), Expect = 1.127e-44
Identity = 136/535 (25.42%), Postives = 243/535 (45.42%), Query Frame = 3
Query:  246 LDELGGKNIWILKWFLLISFMKSLPCVFSMYSFQFTGVKPDSFHCALPPNVSRESMIPKERTGDKWEFSSCNQFQS-----------------QDNSTIIPCQNGYNYTMKYFTSSIVTEWDLVCDRAILNALATSSFFVMSFFGAIISCSIADRFGRKVVLITAFMCLNLCEFAQTYITSIYVLIVFKLLAGIFQQGCFISGFTMTIELFSLRNRSNACLADTFSWTXXXXXXXXXXXXXRDWRNYFFWTSITMLPFCLVFYHLPESIRWMMAKDQTKNAQILLKTATLY---SNPPLPE--KTFENYDKYKRKQESEKLPHYNVLHIFRETLLLRYQLINSFVWFTTAMTYYGVQVKVVEIG-NPFLNFFLSSLVEIPANILCFPIANKYGRKITIGLTNFLVGF----SLFM--GYILWKYLDSPWPAIIVFLVGKMLNTGIFNLIFMHVSEFFPTTLRTTAVGMSSSCARIGASFGAMIFQITLYHDSIAFVIVIGCCLLTGVLVFCLPETYRKKMPTSIEEIKQWVAHKP 1763
            L+++G    + + +F +I    SLP  FS ++  F    P    C +P    +E + P   T D  +  SC Q+                    D  +++PCQNG++Y    +  S+VTE++LVCD+     ++T+SF+V SF G  +   +AD+FGR+         L +C  A ++   I   I+ +   G+     F   F + +E      R  + L  +  +  +  +L +   FIR WR   F+ +     + + ++ LPES RW ++  +  +A+  LK        SN  + E   + +N+     ++E+++   +NV  +F+   L R  LI +++W   A+ Y G+ + V  +  + + +F ++  VE+P   + +P+    GR+ T+  T  + G     ++FM  GY        PW       +GK      F +I++   E +PT +R   +GMSS  A  G      I  +      +  +I+    L  G+L F LPET    +P +IE+ + +   KP
Sbjct:   13 LEQVGNYGTYQIVFFFIICLPTSLPSAFSAFNIPFVVGNPPH-TCHIPEG--KEYLRP--LTNDT-QILSCKQYNETQINVFRAFTSAPVDTYSDRISLVPCQNGWDYDNSTYLDSLVTEFNLVCDQQAWIEISTTSFYVGSFIGNCLFGYVADKFGRRRSFFVILTVLIVCGTASSFAKDIESFIILRFFTGLAFPALFQIPFIICMEFMGNSGRIFSGLMTSLFFGAAMALLGVVAMFIRRWRQLTFFCNAPFAFYIIYYFFLPESPRWSVSVGKWADAKKQLKKIAKMNGKSNVDVDELVDSMKNHQNAAEEKETKR--SHNVTDLFKTPNLRRKTLIVTYIWVMNAIIYNGLTLNVSNLPVDDYWSFIINGAVELPGYFVVWPLLQCAGRRWTLAATMIVCGIGCVSAMFMPDGY--------PWLVASASFIGKFGVGSGFAVIYIFAGELYPTVVRAIGMGMSSMVAGSGLLLAPHIVNLGKIVKILPLLIMGLMALSAGILTFFLPETLGAPLPMTIEDAENF-GKKP 530          
BLAST of slc22a-3 vs. Ensembl Celegans
Match: oct-1 (Organic cation transporter 1 [Source:UniProtKB/Swiss-Prot;Acc:Q9U539])

HSP 1 Score: 167.933 bits (424), Expect = 1.586e-44
Identity = 136/535 (25.42%), Postives = 243/535 (45.42%), Query Frame = 3
Query:  246 LDELGGKNIWILKWFLLISFMKSLPCVFSMYSFQFTGVKPDSFHCALPPNVSRESMIPKERTGDKWEFSSCNQFQS-----------------QDNSTIIPCQNGYNYTMKYFTSSIVTEWDLVCDRAILNALATSSFFVMSFFGAIISCSIADRFGRKVVLITAFMCLNLCEFAQTYITSIYVLIVFKLLAGIFQQGCFISGFTMTIELFSLRNRSNACLADTFSWTXXXXXXXXXXXXXRDWRNYFFWTSITMLPFCLVFYHLPESIRWMMAKDQTKNAQILLKTATLY---SNPPLPE--KTFENYDKYKRKQESEKLPHYNVLHIFRETLLLRYQLINSFVWFTTAMTYYGVQVKVVEIG-NPFLNFFLSSLVEIPANILCFPIANKYGRKITIGLTNFLVGF----SLFM--GYILWKYLDSPWPAIIVFLVGKMLNTGIFNLIFMHVSEFFPTTLRTTAVGMSSSCARIGASFGAMIFQITLYHDSIAFVIVIGCCLLTGVLVFCLPETYRKKMPTSIEEIKQWVAHKP 1763
            L+++G    + + +F +I    SLP  FS ++  F    P    C +P    +E + P   T D  +  SC Q+                    D  +++PCQNG++Y    +  S+VTE++LVCD+     ++T+SF+V SF G  +   +AD+FGR+         L +C  A ++   I   I+ +   G+     F   F + +E      R  + L  +  +  +  +L +   FIR WR   F+ +     + + ++ LPES RW ++  +  +A+  LK        SN  + E   + +N+     ++E+++   +NV  +F+   L R  LI +++W   A+ Y G+ + V  +  + + +F ++  VE+P   + +P+    GR+ T+  T  + G     ++FM  GY        PW       +GK      F +I++   E +PT +R   +GMSS  A  G      I  +      +  +I+    L  G+L F LPET    +P +IE+ + +   KP
Sbjct:   30 LEQVGNYGTYQIVFFFIICLPTSLPSAFSAFNIPFVVGNPPH-TCHIPEG--KEYLRP--LTNDT-QILSCKQYNETQINVFRAFTSAPVDTYSDRISLVPCQNGWDYDNSTYLDSLVTEFNLVCDQQAWIEISTTSFYVGSFIGNCLFGYVADKFGRRRSFFVILTVLIVCGTASSFAKDIESFIILRFFTGLAFPALFQIPFIICMEFMGNSGRIFSGLMTSLFFGAAMALLGVVAMFIRRWRQLTFFCNAPFAFYIIYYFFLPESPRWSVSVGKWADAKKQLKKIAKMNGKSNVDVDELVDSMKNHQNAAEEKETKR--SHNVTDLFKTPNLRRKTLIVTYIWVMNAIIYNGLTLNVSNLPVDDYWSFIINGAVELPGYFVVWPLLQCAGRRWTLAATMIVCGIGCVSAMFMPDGY--------PWLVASASFIGKFGVGSGFAVIYIFAGELYPTVVRAIGMGMSSMVAGSGLLLAPHIVNLGKIVKILPLLIMGLMALSAGILTFFLPETLGAPLPMTIEDAENF-GKKP 547          
BLAST of slc22a-3 vs. Ensembl Celegans
Match: B0252.3 (Putative transporter B0252.3 [Source:UniProtKB/Swiss-Prot;Acc:Q10917])

HSP 1 Score: 130.183 bits (326), Expect = 4.624e-32
Identity = 102/401 (25.44%), Postives = 179/401 (44.64%), Query Frame = 3
Query:  540 SIVTEWDLVCDRAILNALATSSFFVMSFFGAIISCSIADRFGRKVVLITAFMCLNLCEFAQTYITSIYVLIVFKLLAGIFQQGCFISGFTMTIELFSLRNRSNACLADTFSWTXXXXXXXXXXXXXRDWRNYFFWTSITMLPFCLVFYH-LPESIRWMMAKDQTKNAQILLKTATLYSNPPLPEKTFENYDKYKRKQESEKLPHYNVLHIFRETLLLRYQLINSFVWFTTAMTYYGVQVKVVEI-GNPFLNFFLSSLVEIPANILCFPIANKYGRKITIGLTNFLVGFSLFMGYILWKYLDSPWPAIIVFLVGKMLNTGIFNLIFMHVSEFFPTTLRTTAVGMSSSCARIGASFGAMIFQITLYHDSIAFVIVIGCCLLTGVLVFCLPETYRKKMPTSIEE 1736
             +  E+DL  D + L    T+ + V +  G +    +AD +GR  V +   + + +      + TSI +  + +++ GIF     ++G+ +  E   LR R    +     W   +  L +  Y + DWR   F  S+  +   L+ Y  +PES+ ++++  Q +  +  L+          P+      D  + + E+          +++  + + Y L+ +++W      Y+G+      + GN +LNF L SLVE PA I      NKYGRK+ I  T+ + G S F+G +L     S    I  +L+GK   +  F  I+M  SE FPT  R   +G   + +R G      +  +T  H     + +    +  G+L   LPET   K+P++I E
Sbjct:   78 GVADEFDLTGDASWLAESTTTFYMVGNMIGGMFIPPLADHYGRLPVFVATVLLMAVGGMISAFSTSIMMFCIMRMIHGIFYTAAGLAGWVLGYENTPLRLRFFTSVYFGVMWVVGACFLGLLAYILPDWRYLMFCISVPNIFVALLIYMTVPESLHFLVSSQQNEKIEAWLEKIRG------PKGDISASDIVEDRDENGSSFKTLCREMWKHKMFIVYVLVMTYIWIVDTFIYFGLAFYSTNLAGNLYLNFVLMSLVEAPAYIFSPIFMNKYGRKVLISGTHIIAGLS-FLGIVL----SSEAWHIHFWLLGKFAISCSFMSIYMFASEIFPTDGRNKCIGFCETLSRFGGMLSPYLSHLTAVHALAPAITLSLIAVSGGLLTLILPETLNTKLPSTIAE 467          
BLAST of slc22a-3 vs. Ensembl Celegans
Match: B0252.3 (Putative transporter B0252.3 [Source:UniProtKB/Swiss-Prot;Acc:Q10917])

HSP 1 Score: 129.798 bits (325), Expect = 4.957e-32
Identity = 102/401 (25.44%), Postives = 179/401 (44.64%), Query Frame = 3
Query:  540 SIVTEWDLVCDRAILNALATSSFFVMSFFGAIISCSIADRFGRKVVLITAFMCLNLCEFAQTYITSIYVLIVFKLLAGIFQQGCFISGFTMTIELFSLRNRSNACLADTFSWTXXXXXXXXXXXXXRDWRNYFFWTSITMLPFCLVFYH-LPESIRWMMAKDQTKNAQILLKTATLYSNPPLPEKTFENYDKYKRKQESEKLPHYNVLHIFRETLLLRYQLINSFVWFTTAMTYYGVQVKVVEI-GNPFLNFFLSSLVEIPANILCFPIANKYGRKITIGLTNFLVGFSLFMGYILWKYLDSPWPAIIVFLVGKMLNTGIFNLIFMHVSEFFPTTLRTTAVGMSSSCARIGASFGAMIFQITLYHDSIAFVIVIGCCLLTGVLVFCLPETYRKKMPTSIEE 1736
             +  E+DL  D + L    T+ + V +  G +    +AD +GR  V +   + + +      + TSI +  + +++ GIF     ++G+ +  E   LR R    +     W   +  L +  Y + DWR   F  S+  +   L+ Y  +PES+ ++++  Q +  +  L+          P+      D  + + E+          +++  + + Y L+ +++W      Y+G+      + GN +LNF L SLVE PA I      NKYGRK+ I  T+ + G S F+G +L     S    I  +L+GK   +  F  I+M  SE FPT  R   +G   + +R G      +  +T  H     + +    +  G+L   LPET   K+P++I E
Sbjct:   58 GVADEFDLTGDASWLAESTTTFYMVGNMIGGMFIPPLADHYGRLPVFVATVLLMAVGGMISAFSTSIMMFCIMRMIHGIFYTAAGLAGWVLGYENTPLRLRFFTSVYFGVMWVVGACFLGLLAYILPDWRYLMFCISVPNIFVALLIYMTVPESLHFLVSSQQNEKIEAWLEKIRG------PKGDISASDIVEDRDENGSSFKTLCREMWKHKMFIVYVLVMTYIWIVDTFIYFGLAFYSTNLAGNLYLNFVLMSLVEAPAYIFSPIFMNKYGRKVLISGTHIIAGLS-FLGIVL----SSEAWHIHFWLLGKFAISCSFMSIYMFASEIFPTDGRNKCIGFCETLSRFGGMLSPYLSHLTAVHALAPAITLSLIAVSGGLLTLILPETLNTKLPSTIAE 447          
BLAST of slc22a-3 vs. Ensembl Fly
Match: Balat (gene:FBgn0033778 transcript:FBtr0087815)

HSP 1 Score: 167.548 bits (423), Expect = 3.253e-44
Identity = 127/547 (23.22%), Postives = 231/547 (42.23%), Query Frame = 3
Query:  228 MDPEKCLDELGGKNIWILKWFLLISFMKSLPCVFSMYSFQFTGVKPDSFHCALPP---------NVSRESMIPKERTGDKWEFSSCNQFQSQ-----------------------------DNSTIIPCQNGYNYTMKYFTSSIVTEWDLVCDRAILNALATSSFFVMSFFGAIISCSIADRFGRKVVLITAFMCLNLCEFAQTYITSIYVLIVFKLLAGIFQQGCFISGFTMTIELFSLRNRSNACLADTFSWTXXXXXXXXXXXXXRDWRNYFFWTSITMLPFCLVFYHLPESIRWMMAKDQTKNAQILLKTATLYSNPPLPEKTFENYDK-----YKRKQESEKLPHYNVLHIFRETLLLRYQLINSFVWFTTAMTYYGVQVKVVEI-GNPFLNFFLSSLVEIPANILCFPIANKYGRKITIGLTNFLVGFSLFMGYILWKYLDSPWPAIIVFLVGKMLNTGIFNLIFMHVSEFFPTTLRTTAVGMSSSCARIGASFGAMIFQITLYHDSIAFVIVIGCCLLTGVLVFCLPETYRKKMPTSIEE 1736
            MD ++ L E+G   ++       +    +LPC F  YS  F    P  F C +P           + +   IP+ R G    ++ C+ +                                D + ++PCQ+G++Y    ++S++V EW+LVCDR+ L  LA   F V    G  +   + D +GR+       +   +   A  +  + Y  +  + + G+       S + + IEL     R    +    +++    +L   IY +RDWR      S+ +L     F+ LPES RW+MA  +T+ A  +LK     +   +     E   +        + +S    HY +L +FR   + R  LI + +WF     Y G+      + G+   NFFL+  VE+P  +L +P  + +GR+  + ++  + G +    ++       P   ++++ VGKM  +  F ++ +  SE +PT +R   +  SS  + +G     MI  +      +  +++    +L G     LPET  + +P ++EE
Sbjct:    1 MDFDEVLREVGSFGLYQKVIICSVLLPAALPCAFHAYSQLFIAATPQHF-CRVPELEPWTQDYVQLVKNLSIPRNRNG---AYAECSMYSRNYTDIVRYLEYRPPPDLLRQQAEDLLKLQPDTTQVVPCQHGWHYDKSIYSSTVVQEWNLVCDRSFLVTLALVVFGVGGLLGNYVFGYLVDLWGRRPSFYAYLLLEIIACAASAFAWNYYTWLGLRFVVGLTVPAILASPYVLAIELVGPERRVFCTIVSNIAYSLGLVVLAGVIYIVRDWRELSLAVSMPLLMLFSCFFVLPESPRWLMAVGKTRRAIKILKVMARVNGVRVNRDFVERLQRKLVITRAAETKSSMTTHYGILDLFRGPNMRRKTLIITLIWFANTSVYVGLSYYAPALGGDEIWNFFLAGAVELPTYLLLWPGLSYFGRRWILFISMLVGGVACVATFLY------PDITLLLYCVGKMGISSSFVVLPLMASELYPTVVRGLGMSFSSVISMVGPIVIPMINHMGQQMLVLPLIVMGALLILGGFASLLLPETRNRNLPQTLEE 537          
BLAST of slc22a-3 vs. Ensembl Fly
Match: CG6126 (gene:FBgn0038407 transcript:FBtr0083278)

HSP 1 Score: 152.525 bits (384), Expect = 2.613e-39
Identity = 124/455 (27.25%), Postives = 203/455 (44.62%), Query Frame = 3
Query:  408 SMIPKERTGDKWEFSSCNQFQ--SQDNSTIIPCQNGYNYTMKYFTSSIVTEWDLVCDRAILNALATSSFFVMSFFGAIISCSIADRFGRKVVLITAFMCLNLCEFAQTYITSIYVLIVFKLLAGIF-QQGCFISGFTMTIELFSLRNRS--NACLADTFSWTXXXXXXXXXXXXXRDWRNYFFWTSITMLPFCLVFYH---LPESIRWMMAKDQTKNAQILLKTATLYSNPPLPEKTFENYDKYKRKQESEKLPHYNVLHIFRETLLLRYQLIN-SFVWFTTAMTYYGVQVKVVEI-GNPFLNFFLSSLVEIPANILCFPIANKYGRKITIGLTNFLVGF--SLFMGYILWKYLDSPWPAIIVFLVGKMLNTGIFNLIFMHVSEFFPTTLRTTAVGMSSSCARIGASFGAMIFQITLYHDSIAFVIVIGCCLLTGVLVFCLPETYRKKMPTSIEE 1736
            + IP +  G   E  SC  F   S   +T I C+  Y Y   Y+ +S   +W+ VCDR  + A+  + F +  F GA+    +AD+ GRK V   + +   +      +I   +  +V + L GI    G +I GF +T+EL     R+         F+           +   R W    +      L  CL   H   L ES RW+  + +   A  ++      +   +P        K K++  +E+     +  +FR T  LR + +N    WF  ++ YYG+ +   ++ GNP+L  F+  LVE P+ I    + ++ GR+ +I  T  L G    +   YI      S      V + GK+L  G F +I+ + +E FPT +R +A+G+ S CAR+  +   +I  +  +   I  V+     L++G  V  LPET  + MP SIE+
Sbjct:   75 AAIPLKPNG---ELESCLMFDPSSPGTNTTINCER-YVYDTTYYKTSRTIDWNFVCDRRWMGAIVQTVFMLGVFTGAVTLGGLADKVGRKTVFCWSALFQLIIGVGVAFIPEYFSFMVARYLLGIVGSAGAYICGFVLTMELVGPTKRTVCGITFQAVFAGGIMLVAGWGALIPDRQWLQVIY-----GLHGCLFLGHWWWLDESPRWLWMQGRAAEAVDIVAKGLRINGSGIPVDKEYYVQKAKQQAAAEEKSSAGLSDLFR-TPNLRMKTLNVCLCWFANSLVYYGLSLSAGKLYGNPYLILFIMGLVEFPSYITIVFVLDRLGRR-SITSTLMLGGGLCCIVAAYIAQGSTTS----TAVVMAGKLLIAGSFAVIYNYSAELFPTVVRNSAMGLGSMCARLSGALTPLITLLDSFDPKIPAVLFGVVALISGFWVMFLPETMNQPMPESIED 514          
BLAST of slc22a-3 vs. Ensembl Fly
Match: Orct (gene:FBgn0019952 transcript:FBtr0334870)

HSP 1 Score: 152.14 bits (383), Expect = 3.449e-39
Identity = 128/504 (25.40%), Postives = 222/504 (44.05%), Query Frame = 3
Query:  306 MKSLPCVFSMYSFQFTGVKPDSFHCALP-PNVSRESMIPKERTGDKWEFSSCNQF-----QSQDNSTIIPCQN------GYNYTMKYFTSSIVTEWDLVCDRAILNALATSSFFVMSFFGAIISCSIADRFGRKVVLITAFMCLNLCEFAQTYITSIYVLIVFKLLAGIFQQGCFISGFTMTIELFSLRNRSNACLADTFSWTXXXXXXXXXXXXXRDWRNYFFWTSITMLPFCLVFYHLPESIRWMMAKDQTKNAQILLKTATLYSNPPLPEKTFENY-----DKYKRKQESEKLPHYNVLHIFRETLLLRYQLINSFVWFTTAMTYYGVQVKVVEI-GNPFLNFFLSSLVEIPANILCFPIANKYGRKITIGLTNFLVGFSLFMGYILWKYLDSPWPAIIVFLVGKMLNTGIFNLIFMHVSEFFPTTLRTTAVGMSSSCARIGASFGAMIFQITLYHDSIAFVIVIGCCLLTGVLVFCLPETYRKKMPTSIEEIKQWVAHKP 1763
            + ++ C F   +  F   KPD F CALP  N S   + P        E   C+ +     +   N +I    N       Y Y    + +S VTEW+LVC R++L+A + S F +    G++I   ++D+ GRK     + +   +           +   + +++ G    G F+  + + +E+     R  A +A    ++    +   + YFI DWR      ++  L F   ++ +PES RW++ K +   A ++++ A   +   +P + +E       +K K+ + +   P   V  + R   L R  L+  F WF  +  YYG+      + GN  +NF +S  VEIP   L     N++GR+  +  T  + G SL     ++   D  W  +   ++GK+  T  +  I++  +E FPT +R   +G SS  AR+G      +  +      +  +I     L  G+L   LPET  K MP +IE+ + +   KP
Sbjct:   26 LPAIVCAFHKLAGVFLLAKPD-FRCALPYENGSIYELSPHLWNLSYPENERCSYYDVDYTEEYLNGSIPRSSNETKTCSSYVYDRSKYLNSAVTEWNLVCSRSLLSATSDSLFMLGVLLGSLIFGQMSDKLGRKPTFFASLVLQLIFGVLAAVAPEYFSYTISRMIVGATTSGVFLVAYVIALEMVGSSYRLFAGVAMQMFFSVGFMLTAGFAYFIHDWRWLQIAITLPGLLFLCYYWIIPESARWLLMKGRKDEAFVIIEKAAKENKVEVPNEIYEQLVDEVAEKKKQDEMAASQPAATVFDLLRYPNLRRKTLLIFFDWFVNSGVYYGLSWNTNNLGGNQLVNFMISGAVEIPGYTLLLFTLNRWGRRSILCGTMMVAGISLLA--TIFVPSDMNWLIVACAMIGKLAITSSYGTIYIFSAEQFPTVVRNVGLGASSMVARVGGILAPYLKLLGEIWRPLPLIICGALSLTAGLLSLLLPETLNKPMPETIEDGENF-GKKP 525          
BLAST of slc22a-3 vs. Ensembl Fly
Match: Orct (gene:FBgn0019952 transcript:FBtr0084599)

HSP 1 Score: 152.14 bits (383), Expect = 3.449e-39
Identity = 128/504 (25.40%), Postives = 222/504 (44.05%), Query Frame = 3
Query:  306 MKSLPCVFSMYSFQFTGVKPDSFHCALP-PNVSRESMIPKERTGDKWEFSSCNQF-----QSQDNSTIIPCQN------GYNYTMKYFTSSIVTEWDLVCDRAILNALATSSFFVMSFFGAIISCSIADRFGRKVVLITAFMCLNLCEFAQTYITSIYVLIVFKLLAGIFQQGCFISGFTMTIELFSLRNRSNACLADTFSWTXXXXXXXXXXXXXRDWRNYFFWTSITMLPFCLVFYHLPESIRWMMAKDQTKNAQILLKTATLYSNPPLPEKTFENY-----DKYKRKQESEKLPHYNVLHIFRETLLLRYQLINSFVWFTTAMTYYGVQVKVVEI-GNPFLNFFLSSLVEIPANILCFPIANKYGRKITIGLTNFLVGFSLFMGYILWKYLDSPWPAIIVFLVGKMLNTGIFNLIFMHVSEFFPTTLRTTAVGMSSSCARIGASFGAMIFQITLYHDSIAFVIVIGCCLLTGVLVFCLPETYRKKMPTSIEEIKQWVAHKP 1763
            + ++ C F   +  F   KPD F CALP  N S   + P        E   C+ +     +   N +I    N       Y Y    + +S VTEW+LVC R++L+A + S F +    G++I   ++D+ GRK     + +   +           +   + +++ G    G F+  + + +E+     R  A +A    ++    +   + YFI DWR      ++  L F   ++ +PES RW++ K +   A ++++ A   +   +P + +E       +K K+ + +   P   V  + R   L R  L+  F WF  +  YYG+      + GN  +NF +S  VEIP   L     N++GR+  +  T  + G SL     ++   D  W  +   ++GK+  T  +  I++  +E FPT +R   +G SS  AR+G      +  +      +  +I     L  G+L   LPET  K MP +IE+ + +   KP
Sbjct:   26 LPAIVCAFHKLAGVFLLAKPD-FRCALPYENGSIYELSPHLWNLSYPENERCSYYDVDYTEEYLNGSIPRSSNETKTCSSYVYDRSKYLNSAVTEWNLVCSRSLLSATSDSLFMLGVLLGSLIFGQMSDKLGRKPTFFASLVLQLIFGVLAAVAPEYFSYTISRMIVGATTSGVFLVAYVIALEMVGSSYRLFAGVAMQMFFSVGFMLTAGFAYFIHDWRWLQIAITLPGLLFLCYYWIIPESARWLLMKGRKDEAFVIIEKAAKENKVEVPNEIYEQLVDEVAEKKKQDEMAASQPAATVFDLLRYPNLRRKTLLIFFDWFVNSGVYYGLSWNTNNLGGNQLVNFMISGAVEIPGYTLLLFTLNRWGRRSILCGTMMVAGISLLA--TIFVPSDMNWLIVACAMIGKLAITSSYGTIYIFSAEQFPTVVRNVGLGASSMVARVGGILAPYLKLLGEIWRPLPLIICGALSLTAGLLSLLLPETLNKPMPETIEDGENF-GKKP 525          
BLAST of slc22a-3 vs. Ensembl Fly
Match: CG4630 (gene:FBgn0033809 transcript:FBtr0087765)

HSP 1 Score: 138.272 bits (347), Expect = 2.749e-34
Identity = 109/455 (23.96%), Postives = 207/455 (45.49%), Query Frame = 3
Query:  423 ERTGDKWEFSSCNQFQSQDNSTIIPCQNGYNYTMKYFTSSIVTEWDLVCDRAILN-ALATSSFFVMSFFGAIISCSIADRFGRKVVLITAFMCLNLCEFAQTYITSIYVLIVFKLLAGIFQQGCFISGFTMTIELFSLRNRSNACLADTFSWTXXXXXXXXXXXXXRDWRNYFFWTSITMLPFCLVFYHLPESIRWMMAKDQTKNAQILLKTATLYSNPPLPEKTFENYDKYKRKQESEKLPHYN--------------VLHIFRETLLLRYQLINSFVWFTTAMTYYGVQVKVVEI-GNPFLNFFLSSLVEIPANILCFPIANKYGRKITIGLTNFLVGFS-LFMGYILWKYLDSPWPAIIVFLVGKMLNTGIFNLIFMHVSEFFPTTLRTTAVGMSSSCARIGASFGAMIFQITLYHDSIAFVIVIGCCLLTGVLVFCLPETYRKKMPTSIEE 1736
            E + D W     +Q  +++ +T     N + Y     T  IV +W L C   +   A   +  F     G  +S  +ADR+GRK + +   + + L   AQ         + F LL  +   G +   F + +E+   R R  + +   + +     +L + ++   DWR      S+  L     F+ +PES+RW++A+++ + A ++++ A   +   +  +   ++ + +   E+ +                   V  + R  +L+    I   +W   A+ YYG+ +    + GN +LNF L  LVEIP   L +    ++GR++ +  +  L   + +  G++    L + W  + +FLVGK+  T  F +I+   +E  PT +R+  VG+ S+ AR GA     +  +  Y+D +  ++     L+ G+L   LPET+ +K+P ++EE
Sbjct:  109 ESSSDPWSAWPLDQCFAENFTTETERCNQFVYGSSERT--IVQQWGLQCPENLWKLAFVGTIHFAGLVVGTALSGYLADRYGRKHIFLFCIVFMALTGVAQALSWDYISFLFFALLNAVGTSGVYPLAFIIGVEMVGPRKREMSSIVLNYFYAVGEALLGLSVFLP-DWRQLQLALSVPPLICVAYFWLVPESVRWLLARNRREQAGVIIRRAAKVNRRDISVELMASFKQQELDAETGQEDDVEGGLHVKKDDKIWLAVKEVARSHILMGRYAILLLIWAVNAIVYYGLSLNATSLSGNKYLNFALVCLVEIPGYSLAWLFLRRFGRRVALSGSLLLCSITCVASGFVT---LGANWLVVTLFLVGKLGITSSFAVIYTFTAEMMPTVIRSGGVGVMSTFARFGAMLAPFVPLLASYYDPLPLLLFGTLSLVAGLLSLLLPETFNRKLPDTVEE 557          
BLAST of slc22a-3 vs. Ensembl Zebrafish
Match: slc22a7a (solute carrier family 22 member 7a [Source:ZFIN;Acc:ZDB-GENE-050506-52])

HSP 1 Score: 184.496 bits (467), Expect = 1.927e-50
Identity = 142/544 (26.10%), Postives = 253/544 (46.51%), Query Frame = 3
Query:  237 EKCLDELGGKNIWILKWFLLISFMKSLPCV-----FSMYSFQFTGVKPDSFHCALP--------PNVSRESM-------IPKERTGDKWEFSSCNQFQ---------------SQDNSTIIPCQNGYNYTMKYFTSSIVTEWDLVCDRAILNALATSSFFVMSFFGAIISCSIADRFGRKVVLITAFMCLNLCEFAQTYITSIYVLIVFKLLAGIFQQGCFISGFTMTIELFSLRNRSNACLADTFSWTXXXXXXXXXXXXXRDWRNYFFWTSITMLPFCLVFYHLPESIRWMMAKDQTKNAQ-ILLKTATLYSNPPLPEK-TFENYDKYKRKQESEKLPHYNVLHIFRETLLLRYQLINSFVWFTTAMTYYGVQVKVVEIG-NPFLNFFLSSLVEIPANILCFPIANKYGRKITIGLTNFLVGFSLFMGYILWKYLDSPWPAIIVFLVGKMLNTGIFNLIFMHVSEFFPTTLRTTAVGMSSSCARIGASFGAMIFQITLYHDSIAF---VIVIGCCLLTGVLVFCLPETYRKKMPTSIEEIKQ 1745
            E  L E+GG N    K+  L+ ++  LP V     F +++F  +GV P   HCALP            +E +       IP+   G    +SSC  +                   ++  +PCQNG+ Y    FTS+  TEWDLVCD   LN    + FF+    GA++   ++D+FGRK ++  +F+   +    + + +S  +  + + L G    G  I+   + +E   +++R+      +  W+  + +L +  Y IRDWR+     +   L   + ++ +PES RW++A  + + AQ  L+  A +       +K   EN  K    ++S K  +++ L + R   L +  L +   WF  A TYYG+   +   G N +L  F+  ++E+PA +  +   ++ GR+     +  + G  + +  ++     +    I V  +GK  +   F + F++ SE +PT LR   +G +S  ARIG S   M+    L+ D   +   V+     + +G +VF LPET   ++P +I ++++
Sbjct:    4 EDVLREIGGFN----KFQFLVLYILWLPRVILPLHFLLHNF-ISGVPPH--HCALPRLDGRFSASGAEKEELAQIVALGIPRNSDGS---YSSCKMYTMPMDFDLNGDLSVLYGNRSNVSVPCQNGWVYDRSQFTSTTATEWDLVCDNKKLNQALATFFFIGVTMGAVVFGQLSDKFGRKPMIQVSFVSSAVFGIIEAFSSSYVMFAIARTLCGFALTGMSITTVALCVEWTDVKHRTFTGTIISLGWSVGNMLLALLAYLIRDWRHLILVVTSPCLVGIIAWWWIPESARWLLANGRVEEAQKYLINCAKMNGKYSYTKKLDIENLKKITIAEDSNK--NHSYLDLVRTPKLRKIVLCSGIFWFAVAFTYYGISFNITGFGLNIYLTQFIYGVIEVPAKVGTYLTLDRIGRRNGQAWSLIIAGALIGLNSVIPTEFAAVRTGIAV--IGKGFSEAAFTIAFLYTSELYPTVLRQCGLGYTSFIARIGGSLAPMVI---LFEDIWHYGPPVVFSATAVFSGCVVFLLPETTNVQLPENILDVEE 530          
BLAST of slc22a-3 vs. Ensembl Zebrafish
Match: slc22a7b.1 (solute carrier family 22 member 7b, tandem duplicate 1 [Source:ZFIN;Acc:ZDB-GENE-040426-1311])

HSP 1 Score: 179.874 bits (455), Expect = 7.836e-49
Identity = 141/541 (26.06%), Postives = 246/541 (45.47%), Query Frame = 3
Query:  228 MDPEKCLDELGG--KNIWILKWFLLISFMKSLPCVFSMYSFQFTGVKPDSFHCALPP--------NVSRESM----IPKERTGDKWEFSSCN-----QFQSQDNST------IIPCQNGYNYTMKYFTSSIVTEWDLVCDRAILNALATSSFFVMSFFGAIISCSIADRFGRKVVLITAFMCLNLCEFAQTYITSIYVLIVFKLLAGIFQQGCFISGFTMTIELFSLRNRSNACLADTFSWTXXXXXXXXXXXXXRDWRNYFFWTSITMLPFCLVFYHLPESIRWMMAKDQTKNAQILLKTATLYSN-----PPLPEKTFENYDKYKRKQESEKLPHYNVLHIFRETLLLRYQLINSFVWFTTAMTYYGVQVKVVEIG-NPFLNFFLSSLVEIPANILCFPIANKYGRKI----TIGLTNFLVGFSLFMGYILWKYLDSPWPAIIVFLVGKMLNTGIFNLIFMHVSEFFPTTLRTTAVGMSSSCARIGASFGAMIFQITLYHDSIAFVIVIGCCLLTGVLVFCLPETYRKKMPTSIEEIKQ 1745
            M  E  L E+GG  K  + L   L+I  + +LPC F + +F      P S HC +          N+++E      +P +  G     +SC+     QFQ   NS+      ++ CQNG+ +    F S++ TE+DLVCDR  LN    + FF     GA I   + DRFGRK +L+ A++       A  +  S  V  + +   G+   G  I    + IE   + +R+ A +  +  W+ S  IL    Y + DWR      +  +    + +  LPES RW++A  + + A   L      +N       +  +T  N     R   +     Y+ L + R + + +  ++    WF  A TYYG+   +   G N +L  F+   +E+P+ ++ +   +K GR+     T+  T   +G ++ +  +LW       P  ++ ++GK  +   F  +F++ +E +PT LR   +G SS   R+G S   ++  +      +  V+     ++ G+L   LPET+  ++P +IE+I++
Sbjct:    1 MKFENLLAEVGGFGKYQFCLMALLVIPRV-TLPCHFLLNNF--IAAIP-SHHCDISSLSADGIFGNLTQEERLTVGVPAQEDGTP---ASCHMFSHPQFQLLINSSSSSDLPVVECQNGWRFDNSTFKSTLATEFDLVCDRRGLNKATATIFFAGVMIGAAIFGWLTDRFGRKRMLMLAYLISITFGVASAFAQSFIVFAIMRFFTGMGLTGISIISIVLCIEWADIAHRTIAGVMISLDWSLSCMILSGVAYLVNDWRALILTVTAPIALAMITWRWLPESARWLIANGKLEEAHFYLSKCASVNNRQHNLRDIKPETLANVIIADRGDRT-----YSYLDLVRSSKMRKLAMLTGITWFGVAFTYYGISFNISGFGLNLYLTQFIYGAIELPSKLVAYVCLDKLGRRYSQVGTMITTGVCIGITVLIPRVLWV------PCTVIAVLGKGFSEASFTCVFLYTTELYPTVLRQNGLGYSSFIGRVGVSLAPLVSLLDEVWLPLPQVLFCSVAIVAGLLALLLPETHNVRLPETIEDIEK 523          
BLAST of slc22a-3 vs. Ensembl Zebrafish
Match: slc22a7b.3 (solute carrier family 22 member 7b, tandem duplicate 3 [Source:ZFIN;Acc:ZDB-GENE-131120-103])

HSP 1 Score: 176.407 bits (446), Expect = 1.335e-47
Identity = 138/518 (26.64%), Postives = 236/518 (45.56%), Query Frame = 3
Query:  282 KWFLLISFMKS--LPCVFSMYSFQFTGVKPDSFHC--------ALPPNVSRESM----IPKERTGDKWEFSSCN-----QFQSQDNST------IIPCQNGYNYTMKYFTSSIVTEWDLVCDRAILNALATSSFFVMSFFGAIISCSIADRFGRKVVLITAFMCLNLCEFAQTYITSIYVLIVFKLLAGIFQQGCFISGFTMTIELFSLRNRSNACLADTFSWTXXXXXXXXXXXXXRDWRNYFFWTSITM---LPFC-LVFYHLPESIRWMMAKDQTKNAQILL-KTATLYSNPPLPEKTFENYDKYKRKQESEKLPHYNVLHIFRETLLLRYQLINSFVWFTTAMTYYGVQVKVVEIG-NPFLNFFLSSLVEIPANILCFPIANKYGRKITIGLTNFLVGFSLFMGYILWKYLDSPWPAIIVFLVGKMLNTGIFNLIFMHVSEFFPTTLRTTAVGMSSSCARIGASFGAMIFQITLYHDSIAFVIVIGCCLLTGVLVFCLPETYRKKMPTSIEEIK 1742
            K  L ISF+    +PC F + +F      P S HC         L  N++ E      +P +  G      SC+     QFQ   NS+      ++ CQNG+++    F S++ T+WDLVCD   LN    + FFV   FGA     ++DRFGRK +L+ +++       A  + TS  +  V +  +G    G  I    + +E   + +R    + D+ +W   S  L +  YFIRDWR    W ++ +   L  C ++++ +PES RW++A    + A   L K A +     +  +            + +K   Y  L + R   + +  ++   VWF  A   YG+ + +   G N +L  F+   +E+P+ ++ + +  K GR+ T        G SL +   + K  D      +V ++GK      F  I ++ SE +PT LR   +G +S  AR+G S   ++  +  +    +  I+    L+  V+ + LPET  + +P +IE+++
Sbjct:   18 KMILCISFVGRFIIPCHFLLSNF--IAAIP-SHHCDISFLDADGLFGNLTEEERLIVSVPTQEDGSP---VSCHMFSHPQFQLLINSSSSSDLPVVECQNGWHFDNSTFISTLATQWDLVCDNRGLNKAVATIFFVGVMFGAAFFGGMSDRFGRKPMLLVSYISGMAFALASVFSTSFTMFAVLRFFSGFTITGIVIVSSVLNLEWVDIEHRRLVSIIDSMAWAVGSTSLALIAYFIRDWR----WLTVAVTSPLVLCTILWWWVPESARWLIANGDVEKAHYYLHKCAVMNRKAEVTSRIKPEALAISVSDQGKK--KYTYLDLVRTPKMRKLAMLTGTVWFCVATMTYGISLNITGFGLNMYLTQFVYGAIEVPSKLIVYYLLEKIGRRKTEAGAQLFAGISLMINIFIPK--DQWIGRTVVAVLGKGFAVAAFCTIVLYSSELYPTVLRQNGMGYNSFLARLGVSVAPLVLLLDTFWGQFSQTILCSVALIASVVAWNLPETRDRCLPETIEDVE 521          
BLAST of slc22a-3 vs. Ensembl Zebrafish
Match: slc22a7b.3 (solute carrier family 22 member 7b, tandem duplicate 3 [Source:ZFIN;Acc:ZDB-GENE-131120-103])

HSP 1 Score: 176.407 bits (446), Expect = 1.810e-47
Identity = 139/517 (26.89%), Postives = 235/517 (45.45%), Query Frame = 3
Query:  282 KWFLLISFMKS--LPCVFSMYSFQFTGVKPDSFHC--------ALPPNVSRESM----IPKERTGDKWEFSSCN-----QFQSQDNST------IIPCQNGYNYTMKYFTSSIVTEWDLVCDRAILNALATSSFFVMSFFGAIISCSIADRFGRKVVLITAFMCLNLCEFAQTYITSIYVLIVFKLLAGIFQQGCFISGFTMTIELFSLRNRSNACLADTFSWTXXXXXXXXXXXXXRDWRNYFFWTSITM---LPFC-LVFYHLPESIRWMMAKDQTKNAQILL-KTATLYSNPPLPEKTFENYDKYKRKQESEKLPHYNVLHIFRETLLLRYQLINSFVWFTTAMTYYGVQVKVVEIG-NPFLNFFLSSLVEIPANILCFPIANKYGRKITIGLTNFLVGFSLFMGYILWKYLDSPWPAIIVFLVGKMLNTGIFNLIFMHVSEFFPTTLRTTAVGMSSSCARIGASFGAMIFQITLYHDSIAFVIVIGCCLLTGVLVFCLPETYRKKMPTSIEEI 1739
            K  L ISF+    +PC F + +F      P S HC         L  N++ E      +P +  G      SC+     QFQ   NS+      ++ CQNG+++    F S++ T+WDLVCD   LN    + FFV   FGA     ++DRFGRK +L+ +++       A  + TS  +  V +  +G    G  I    + +E   + +R    + D+ +W   S  L +  YFIRDWR    W ++ +   L  C ++++ +PES RW++A    + A   L K A +     +  +            + +K   Y  L + R   + +  ++   VWF  A   YG+ + +   G N +L  F+   +E+P+ ++ + +  K GR+ T        G SL +   + K  D      +V ++GK      F  I ++ SE +PT LR   +G +S  AR+G S   ++  +  +    +  I+    L+  V+ + LPET  + +P +IE+I
Sbjct:   18 KMILCISFVGRFIIPCHFLLSNF--IAAIP-SHHCDISFLDADGLFGNLTEEERLIVSVPTQEDGSP---VSCHMFSHPQFQLLINSSSSSDLPVVECQNGWHFDNSTFISTLATQWDLVCDNRGLNKAVATIFFVGVMFGAAFFGGMSDRFGRKPMLLVSYISGMAFALASVFSTSFTMFAVLRFFSGFTITGIVIVSSVLNLEWVDIEHRRLVSIIDSMAWAVGSTSLALIAYFIRDWR----WLTVAVTSPLVLCTILWWWVPESARWLIANGDVEKAHYYLHKCAVMNRKAEVTSRIKPEALAISVSDQGKK--KYTYLDLVRTPKMRKLAMLTGTVWFCVATMTYGISLNITGFGLNMYLTQFVYGAIEVPSKLIVYYLLEKIGRRKTEAGAQLFAGISLMINIFIPK--DQWIGRTVVAVLGKGFAVAAFCTIVLYSSELYPTVLRQNGMGYNSFLARLGVSVAPLVLLLDTFWGQFSQTILCSVALIASVVAWNLPETRDRCLPETIEDI 520          
BLAST of slc22a-3 vs. Ensembl Zebrafish
Match: BX005258.2 (solute carrier family 22 member 7b, tandem duplicate 3 [Source:NCBI gene;Acc:100001772])

HSP 1 Score: 175.252 bits (443), Expect = 2.926e-47
Identity = 138/516 (26.74%), Postives = 234/516 (45.35%), Query Frame = 3
Query:  282 KWFLLISFMKS--LPCVFSMYSFQFTGVKPDSFHC--------ALPPNVSRESM----IPKERTGDKWEFSSCN-----QFQSQDNST------IIPCQNGYNYTMKYFTSSIVTEWDLVCDRAILNALATSSFFVMSFFGAIISCSIADRFGRKVVLITAFMCLNLCEFAQTYITSIYVLIVFKLLAGIFQQGCFISGFTMTIELFSLRNRSNACLADTFSWTXXXXXXXXXXXXXRDWRNYFFWTSITM---LPFC-LVFYHLPESIRWMMAKDQTKNAQILL-KTATLYSNPPLPEKTFENYDKYKRKQESEKLPHYNVLHIFRETLLLRYQLINSFVWFTTAMTYYGVQVKVVEIG-NPFLNFFLSSLVEIPANILCFPIANKYGRKITIGLTNFLVGFSLFMGYILWKYLDSPWPAIIVFLVGKMLNTGIFNLIFMHVSEFFPTTLRTTAVGMSSSCARIGASFGAMIFQITLYHDSIAFVIVIGCCLLTGVLVFCLPETYRKKMPTSIEE 1736
            K  L ISF+    +PC F + +F      P S HC         L  N++ E      +P +  G      SC+     QFQ   NS+      ++ CQNG+++    F S++ T+WDLVCD   LN    + FFV   FGA     ++DRFGRK +L+ +++       A  + TS  +  V +  +G    G  I    + +E   + +R    + D+ +W   S  L +  YFIRDWR    W ++ +   L  C ++++ +PES RW++A    + A   L K A +     +  +            + +K   Y  L + R   + +  ++   VWF  A   YG+ + +   G N +L  F+   +E+P+ ++ + +  K GR+ T        G SL +   + K  D      +V ++GK      F  I ++ SE +PT LR   +G +S  AR+G S   ++  +  +    +  I+    L+  V+ + LPET  + +P +IE+
Sbjct:   18 KMILCISFVGRFIIPCHFLLSNF--IAAIP-SHHCDISFLDADGLFGNLTEEERLIVSVPTQEDGSP---VSCHMFSHPQFQLLINSSSSSDLPVVECQNGWHFDNSTFISTLATQWDLVCDNRGLNKAVATIFFVGVMFGAAFFGGMSDRFGRKPMLLVSYISGMAFALASVFSTSFTMFAVLRFFSGFTITGIVIVSSVLNLEWVDIEHRRLVSIIDSMAWAVGSTSLALIAYFIRDWR----WLTVAVTSPLVLCTILWWWVPESARWLIANGDVEKAHYYLHKCAVMNRKAEVTSRIKPEALAISVSDQGKK--KYTYLDLVRTPKMRKLAMLTGTVWFCVATMTYGISLNITSFGLNMYLTQFVYGAIEVPSKLIVYYLLEKIGRRKTEAGAQLFAGISLMINIFIPK--DQWIGRTVVAVLGKGFAVAAFCTIVLYSSELYPTVLRQNGMGYNSFLARLGVSVAPLVLLLDTFWGQFSQTILCSVALIASVVAWNLPETRDRCLPETIED 519          
BLAST of slc22a-3 vs. Ensembl Xenopus
Match: slc22a4 (solute carrier family 22 (organic cation/zwitterion transporter), member 4 [Source:NCBI gene;Acc:394948])

HSP 1 Score: 181.415 bits (459), Expect = 2.134e-49
Identity = 125/465 (26.88%), Postives = 236/465 (50.75%), Query Frame = 3
Query:  375 HCALPPNVSRESMIPKERTGDKWEFSSCNQFQSQD-NSTII---PCQNGYNYTMKYFTSSIVTEWDLVCDRAILNALATSSFFVMSFFGAIISCSIADRFGRKVVLITAFMCLNLCEFAQTYITSIYVLIVFKLLAGIFQQGCFISGFTMTIELFSLRNRSN-ACLADTFSWTXXXXXXXXXXXXXRDWRNYFFWTSITMLPFCL-VFYHLPESIRWMMAKDQTKNAQILLKTATLYSNPPLPE---KTFENYDKYKRKQESEKLPHYNVLHIFRETLLLRYQLINSFVWFTTAMTYYGVQVKVVEI-GNPFLNFFLSSLVEIPANILCFPIANKYGRKITIGLTNFLVGFSLFMGYILWKYLDSPWPAIIVFLVGKMLNTGIFNLIFMHVSEFFPTTLRTTAVGMSSSCARIGASFGAMIFQITLYHDSIAFVIVIGCCLLTGVLVFCLPETYRKKMPTSIEEI 1739
            + ++P    ++S   + R G    +S+      +D + T I   PC +G+NY+   + S+IVTEWD+VC+      L TS FFV    G+ +S  ++D FGRK +L             Q + TS  +  +F L+ G+ Q   +++ F +  E+     R   + L     +     +L ++ YFIRDWR      +I  L FC+ +++ +PES +W++ K + + A+++++ A   +  P P    KT E  D  +R++ S     Y +L + +   +    ++  F+W  T++ Y+G+ +    + G+PFLN FL + +E+P+NI  + +     R+ +  +   L+   + +  I    LD    + ++ +VGK   T  F++++++ +E +PT +R T VG+ S  +RIG+        +  Y   + F+++    +L G+   CLPE++   +P +IEE+
Sbjct:   64 NASIPRQDGQDSQCRRYRLGTLTNYSALGLLPGRDVDVTGIEQEPCLDGWNYSKSLYLSTIVTEWDIVCENDWKGPLTTSLFFVGVLLGSFVSGQLSDSFGRKKILFVTMAIQTGFSIVQVFSTSWEMFAIFFLIVGMGQISNYVAAFILGTEILGKSARIIFSTLGTCIFFAIGYMMLPLFAYFIRDWRTLLLALTIPGL-FCIPLWWIIPESPQWLICKGRIEEAEVIIRKAAKINRVPAPAVIFKTTELEDLAERQKRS-----YTLLDLVKTFNVRIITIMTVFLWLITSIGYFGISLNTPNLHGDPFLNCFLLAAIEVPSNIFAWLLLRYISRRYS--MCGSLLLGGVVLLLIQLVPLDLQILSTVLVMVGKFGVTAAFSMVYVYTAELYPTVIRNTGVGIGSVSSRIGSVISPYFVYLGAYDRFLPFILMGSLTVLIGMFTLCLPESHGMPLPDTIEEM 520          
BLAST of slc22a-3 vs. Ensembl Xenopus
Match: slc22a4 (solute carrier family 22 (organic cation/zwitterion transporter), member 4 [Source:NCBI gene;Acc:394948])

HSP 1 Score: 181.8 bits (460), Expect = 2.328e-49
Identity = 122/465 (26.24%), Postives = 238/465 (51.18%), Query Frame = 3
Query:  375 HCALPPNVSRESMIPKERTGDKWEFSSCNQFQSQD-NSTII---PCQNGYNYTMKYFTSSIVTEWDLVCDRAILNALATSSFFVMSFFGAIISCSIADRFGRKVVLITAFMCLNLCEFAQTYITSIYVLIVFKLLAGIFQQGCFISGFTMTIELFSLRNRSN-ACLADTFSWTXXXXXXXXXXXXXRDWRNYFFWTSITMLPFCL-VFYHLPESIRWMMAKDQTKNAQILLKTATLYSNPPLPE---KTFENYDKYKRKQESEKLPHYNVLHIFRETLLLRYQLINSFVWFTTAMTYYGVQVKVVEI-GNPFLNFFLSSLVEIPANILCFPIANKYGRKITIGLTNFLVGFSLFMGYILWKYLDSPWPAIIVFLVGKMLNTGIFNLIFMHVSEFFPTTLRTTAVGMSSSCARIGASFGAMIFQITLYHDSIAFVIVIGCCLLTGVLVFCLPETYRKKMPTSIEEI 1739
            + ++P    ++S   + R G    +S+      +D + T I   PC +G+NY+   + S+IVTEWD+VC+      L TS FFV    G+ +S  ++D FGRK +L             Q + TS  +  +F L+ G+ Q   +++ F +  E+     R   + L     +     +L ++ YFIRDWR      +I  L FC+ +++ +PES +W++ K + + A+++++ A   +  P P    KT E  D  +R++ S     Y +L + +   +    ++  F+W   ++ Y+G+ +    + G+P++N FLS+++E+PA ++ + +   + R+ +   T  L G  L    ++ + L     +I++ ++GK   T  F++++++ +E +PT +R   VG SS  +R+G+        +  Y   + F+++    +L G+   CLPE++   +P +IEE+
Sbjct:   64 NASIPRQDGQDSQCRRYRLGTLTNYSALGLLPGRDVDVTGIEQEPCLDGWNYSKSLYLSTIVTEWDIVCENDWKGPLTTSLFFVGVLLGSFVSGQLSDSFGRKKILFVTMAIQTGFSIVQVFSTSWEMFAIFFLIVGMGQISNYVAAFILGTEILGKSARIIFSTLGTCIFFAIGYMMLPLFAYFIRDWRTLLLALTIPGL-FCIPLWWIIPESPQWLICKGRIEEAEVIIRKAAKINRVPAPAVIFKTTELEDLAERQKRS-----YTLLDLVKTFNVRIITIMTVFLWMIISVGYFGLSLNTPNLHGDPYVNCFLSAIIEVPAYVIAWLLLRSFPRRYSTASTLVLGGVVLLFIQLVPQELGI--LSIVLVMLGKFGITSAFSMVYVYTAELYPTVVRNMGVGASSMASRMGSILSPYFVYLGAYDRFLPFILMGSLTVLIGMFTLCLPESHGMPLPDTIEEM 520          
BLAST of slc22a-3 vs. Ensembl Xenopus
Match: ccdc30 (coiled-coil domain containing 30 [Source:Xenbase;Acc:XB-GENE-1004904])

HSP 1 Score: 180.259 bits (456), Expect = 1.163e-48
Identity = 144/503 (28.63%), Postives = 234/503 (46.52%), Query Frame = 3
Query:  315 LPCVFSMYSFQFTGVKPDSFHCALPPNVS-------------RESMIPKERTGDKWEFSSCNQFQSQD----------NSTIIPCQNGYNYTMKYFTSSIVTEWDLVCDRAILNALATSSFFVMSFFGAIISCSIADRFGRKVVLITAFMCLNLCEFAQTYITSIYVLIVFKLLAGIFQQGCFISGFTMTIELFSLRNRSNACLADTFSWTXXXXXXXXXXXXXRDWRNYFFWTSITMLPFCLVFYHLPESIRWMMAKDQTKNAQILLKTATLYSNPPLPEKTFENYD-KYKRKQESEKLPHYNVLHIFRETLLLRYQLINSFVWFTTAMTYYGVQVKVVEI-GNPFLNFFLSSLVEIPANIL-CFPIANKYGRKITIGLTNFLVGFSLFMGYILWKYLDSPWPAIIVFLVGKMLNTGIFNLIFMHVSEFFPTTLRTTAVGMSSSCARIGASFGAMIFQITLYHDSIAFVIVIGCCLLTGVLVFCLPETYRKKMPTSIEEIKQ 1745
            L  VF   + +F    P++    L PN S             ++ ++ K+  GD WE + C++F+ ++          N T+  C NGY Y      SSIVT+W LVC+R  L  L   +F      GA+I   IADR GR+++L        L   A  +    Y  ++ + L  +   G ++  F    E   ++ RS A +     +     I+ +  + +R W  Y    S+T LPF L  + LPE+  W+ ++ + K  + L+ T   ++    P K  E    +  +K E + L  ++VL +F      R  +    +WFT ++ YY   +  V + GN +LN FL+S VEIP+ I+ CF + +K GR+ T  L  FL+  ++  G I+    D     I + + GK      F LI+++ +E +PT +R+ AVG  S   RIG+        +T     +  ++V     LTGVL   LPET    + ++IEE  +
Sbjct:   33 LASVFIAITPKFICRAPENISSVLLPNASTLRLEDVWELWTPKDYLVVKQENGDIWELNQCSRFKRENTSYLTYSYDGNKTLFSCSNGYYYDNTNLESSIVTDWHLVCEREWLAKLIQPTFMFGVLIGAVIFGDIADRVGRRLILWLTSTGQFLFGIAVAFTFDYYSFVIVRFLLAMVSSGYYVVVFVYVTEYVGIKARSWASMHVHAFFAVGVMIVSLVGFLVRTWWMYQIILSLTTLPFVLCCWMLPETPFWLYSQGKHKEVEKLIGTIEKWNKISTPCKLSELCSVQETQKTEMDTLKKHSVLDLFYNWSFARRTVTVWLIWFTGSLGYYVFALNSVNLGGNEYLNLFLTSAVEIPSYIVACFGM-DKIGRRNT--LAPFLILSAVICGIIMLIPQDHSTVTIAMSMGGKFSIAVAFGLIYLYTAELYPTIVRSLAVGSGSMMCRIGSVVAPFCVYLTDVWIFMPQMLVGIMAFLTGVLTLKLPETLGVPLTSTIEEAAE 532          
BLAST of slc22a-3 vs. Ensembl Xenopus
Match: slc22a4 (solute carrier family 22 (organic cation/zwitterion transporter), member 4 [Source:NCBI gene;Acc:394948])

HSP 1 Score: 179.104 bits (453), Expect = 2.228e-48
Identity = 124/467 (26.55%), Postives = 237/467 (50.75%), Query Frame = 3
Query:  375 HCALPPNVSRESMIPKERTGDKWEFSSCNQFQSQD-NSTII---PCQNGYNYTMKYFTSSIVTEWDLVCDRAILNALATSSFFVMSFFGAIISCSIADRFGRKVVLITAFMCLNLCEFAQTYITSIYVLIVFKLLAGIFQQGCFISGFTMTIELFSLRNRSN-ACLADTFSWTXXXXXXXXXXXXXRDWRNYFFWTSITMLPFCL-VFYHLPESIRWMMAKDQTKNAQILLKTATLYSNPPLPE---KTFENYDKYKRKQESEKLPHYNVLHIFRETLLLRYQLINSFVWFTTAMTYYGVQVKVVEI-GNPFLNFFLSSLVEIPANILCFPIANKYGRKITIGLTNFLVGFSLFMGYILWKYLDSPWPAIIVFLVGKMLNTGIFNLIFMHVSEFFPTTLRTTAVGMSSSCARIGASFGAMIFQITLYHDSIAFVIVIGCCLLTGVLVFCLPETYRKKMPTSIEEIKQ 1745
            + ++P    ++S   + R G    +S+      +D + T I   PC +G+NY+   + S+IVTEWD+VC+      L TS FFV    G+ +S  ++D FGRK +L             Q + TS  +  +F L+ G+ Q   +++ F +  E+     R   + L     +     +L ++ YFIRDWR      +I  L FC+ +++ +PES +W++ K + + A+++++ A   +  P P    KT E  D  +R++ S     Y +L + +   +    ++  F+W  T++ Y+G+ +    + G+PFLN FL + +E+P+NI  + +     R+ +  +   L+   + +  I    LD    + ++ +VGK   T  F++++++ +E +PT +R T VG+ S  +RIG+        +  Y+  + ++++    +  G+LV   PET+ K +P +IE+ + 
Sbjct:   65 NASIPRQDGQDSQCRRYRLGTLTNYSALGLLPGRDVDVTGIEQEPCLDGWNYSKSLYLSTIVTEWDIVCENDWKGPLTTSLFFVGVLLGSFVSGQLSDSFGRKKILFVTMAIQTGFSIVQVFSTSWEMFAIFFLIVGMGQISNYVAAFILGTEILGKSARIIFSTLGTCIFFAIGYMMLPLFAYFIRDWRTLLLALTIPGL-FCIPLWWIIPESPQWLICKGRIEEAEVIIRKAAKINRVPAPAVIFKTTELEDLAERQKRS-----YTLLDLVKTFNVRIITIMTVFLWLITSIGYFGISLNTPNLHGDPFLNCFLLAAIEVPSNIFAWLLLRYISRRYS--MCGSLLLGGVVLLLIQLVPLDLQILSTVLVMVGKFGVTAAFSMVYVYTAELYPTVIRNTGVGIGSVSSRIGSVISPYFVYLGAYNRLLPYILMGSLTVANGILVLFFPETFGKPLPETIEQTQN 523          
BLAST of slc22a-3 vs. Ensembl Xenopus
Match: emc2 (ER membrane protein complex subunit 2 [Source:Xenbase;Acc:XB-GENE-484487])

HSP 1 Score: 171.785 bits (434), Expect = 9.922e-46
Identity = 121/466 (25.97%), Postives = 235/466 (50.43%), Query Frame = 3
Query:  375 HCALPPNVSRESMIPKERTGDKWEFSSCNQFQSQD-NSTII---PCQNGYNYTMKYFTSSIVTEWDLVCDRAILNALATSSFFVMSFFGAIISCSIADRFGRKVVLITAFMCLNLCEFAQTYITSIYVLIVFKLLAGIFQQGCFISGFTMTIELFSLRNRSN-ACLADTFSWTXXXXXXXXXXXXXRDWRNYFFWTSITMLPFCL-VFYHLPESIRWMMAKDQTKNAQILLKTATLYSNPPLPEKTFENYDKYKRKQESEKLPHYNVLHIFRETLLLRYQLINSF----VWFTTAMTYYGVQVKVVEI-GNPFLNFFLSSLVEIPANILCFPIANKYGRKITIGLTNFLVGFSLFMGYILWKYLDSPWPAIIVFLVGKMLNTGIFNLIFMHVSEFFPTTLRTTAVGMSSSCARIGASFGAMIFQITLYHDSIAFVIVIGCCLLTGVLVFCLPETYRKKMPTSIEEI 1739
            + ++P    ++S   + R G    +S+      +D + T I   PC +G+NY+   + S+IVTEW+LVC+      L TS FFV    G+ +S  ++DRFGRK VL             Q +  +  +     ++ G+ Q   +++ F +  E+     R   + L     +     +L ++ YFIRDWR      +I  L FC+ +++ +PES RW++++ + + A+ +++ A   +    P+  F     +   QE ++L H +  H F + L  R   I +F    +W   ++ Y+G+ +    + G+P++N FLS+++E+PA ++ + +   + R+ +   T  L G  L    ++ + L     +I++ ++GK   T  F++++++ +E +PT +R   VG SS  +R+G+        +  Y   + F+++    +L G+   CLPE++   +P +IEE+
Sbjct:   64 NASIPRQDGQDSQCRRYRLGTLTNYSALGLLPGRDVDVTGIEQEPCLDGWNYSKSLYLSTIVTEWNLVCENDWKGPLTTSLFFVGVLIGSFVSGQMSDRFGRKKVLFATMAVQTGFSIIQVFSVNWEMFTALFIIVGMGQISNYVAAFILGAEILDKSVRIIFSTLGVCIFYAIGYMLLPLFAYFIRDWRTLLLALTIPGL-FCIPLWWIIPESPRWLISQGRFQEAEDIIRKAAKKNGITPPDSIF----NFTELQEQKELTHKS--HTFLDLLKTRNIRIITFLSILLWMIISVGYFGLSLNTPNLHGDPYVNCFLSAIIEVPAYVIAWLLLRSFPRRYSTASTLVLGGVVLLFIQLVPQELGI--LSIVLVMLGKFGITSAFSMVYVYTAELYPTVVRNMGVGASSMASRMGSILSPYFVYLGAYDRFLPFILMGSLTVLIGMFTLCLPESHGMPLPDTIEEM 520          
BLAST of slc22a-3 vs. Ensembl Mouse
Match: Slc22a7 (solute carrier family 22 (organic anion transporter), member 7 [Source:MGI Symbol;Acc:MGI:1859559])

HSP 1 Score: 177.178 bits (448), Expect = 7.111e-48
Identity = 135/537 (25.14%), Postives = 244/537 (45.44%), Query Frame = 3
Query:  228 MDPEKCLDELGGKNIWILKWFLLISFMK-SLPCVFSMYSFQFTGVKPDSFHCALP---PNVSRESM-----IPKERTGDKWEFSSCNQF---QSQDNSTI----------------IPCQNGYNYTMKYFTSSIVTEWDLVCDRAILNALATSSFFVMSFFGAIISCSIADRFGRKVVLITAFMCLNLCEFAQTYITSIYVLIVFKLLAGIFQQGCFISGFTMTIELFSLRNRSNACLADTFSWTXXXXXXXXXXXXXRDWRNYFFWTSITMLPFCLVFYHLPESIRWMMAKDQTKNAQILLKTATLYSNPPLPEKTF--ENYDKYKRKQESEKLPHYNVLHIFRETLLLRYQLINSFVWFTTAMTYYGVQVKVVEIG-NPFLNFFLSSLVEIPANILCFPIANKYGRKITIGLTNFLVGFSLFMGYILWKYLDSPWPAIIVFLVGKMLNTGIFNLIFMHVSEFFPTTLRTTAVGMSSSCARIGASFGAMIFQITLYHDSIAFVIVIGCCLLTGVLVFCLPETYRKKMPTSIEEIKQ 1745
            M  E+ L ++GG   + L+  +L++  +  LP  F +  F        + HCALP    N+S + +     +P+E  G    FSSC +F   Q+  N T+                +PC  G+ Y    F+S+I TEWDLVC +  LN + ++ FF+    GA++   ++DRFGR+ +L+ A++             +  + +  ++L G    G  I    + +E   + +R+ A +  T  WT    +L +  Y IR WR      ++  +P  +  + +PES RW++ + + + A+  L      +  P+ E +   E  +K    +   + P Y  L +FR + L    L    +WF    +YYG+ +    +G   +    L   VE+P+ I  F +    GR++T      L+  +L  G  L    D+      + ++GK  +   F   ++  SE +PT LR T +G ++   R+GAS   ++  +      +  +   G   L    V  LPET + ++P +I+++++
Sbjct:    1 MGFEELLHKVGGFGPFQLRNLVLLALPRFLLPMHFLLPIFM---AAVPAHHCALPDAPANLSHQDLWLKTHLPRETDGS---FSSCLRFAYPQALPNVTLGTEVYNSGEPEGEPLTVPCSQGWEYDRSEFSSTIATEWDLVCQQRGLNKVTSTCFFIGVLLGAVVYGYLSDRFGRRRLLLVAYVSTLALGLMSAASVNYIMFVTTRMLTGSALAGFTIIVLPLELEWLDVEHRTVAGVISTTFWTGGVLLLTLVGYLIRSWRWLLLAATLPCVPGIISIWWVPESARWLLTQGRVEEAKKYLSICAKLNGRPISEDSLSQEALNKVITMERVSQRPSY--LDLFRTSQLRHVSLCCMMMWFGVNFSYYGLTLDASGLGLTVYQTQLLFGAVEVPSKITVFFLVRLVGRRLTEA--GMLLATALTFGISLLVSSDTKSWITALVVIGKAFSEAAFTTAYLFTSELYPTVLRQTGMGFTALIGRLGASLAPLVVLLDGVWLLLPKLAYGGISFLAACTVLLLPETKKAQLPETIQDVER 527          
BLAST of slc22a-3 vs. Ensembl Mouse
Match: Slc22a8 (solute carrier family 22 (organic anion transporter), member 8 [Source:MGI Symbol;Acc:MGI:1336187])

HSP 1 Score: 162.54 bits (410), Expect = 1.227e-42
Identity = 138/479 (28.81%), Postives = 215/479 (44.89%), Query Frame = 3
Query:  348 FTGVKPDSFHCALPPNVSRES-MIPKERTGDKWEFSSCNQFQSQDNSTII--------PCQNGYNYTMKYFTSSIVTEWDLVCDRAILNALATSSFFVMSFFGAIISCSIADRFGRKVVLITAFMCLNLCEFAQTYITSIYVLIVFKLLAGIFQQGCFISGFTMTIELFSLRNRSNACLADTFSWTXXXXXXXXXXXXXRDWRNYFFWTSITMLPFCLVFYHLPESIRWMMAKDQ-TKNAQILLKTATLYSNPPLPEK-TFENYDKYKRKQESEKLPHYNVLHIFRETLLLRYQLINSFVWFTTAMTYYGVQVKVVEIG-NPFLNFFLSSLVEIPANILCFPIANKYGRKITIGLTNFLVGFSLFMGYILWKYLDSPWPAIIVFLVGKMLNTGIFNLIFMHVSEFFPTTLRTTAVGMSSSCARIGASFGAMIFQITLYHDSIAFVIVIGCCLLTGVLVFCLPETYRKKMPTSIEEIKQW 1748
            FT   PD  HC  PPN S E  ++P    G       C +F    N+++         PC +G+ Y     T  IVTEWDLVC    L  +A S F      G  +   ++DRFGRK +L  +++ L     +  +  S+ V ++F+ L G    G  +S   + +E      R+ +     + +T   FIL    Y +  WR      S     F L+ + +PESIRW++   + +K  + L + AT        EK T E      +K  +     Y +  +FR ++L R     S  WF T   YY + + V E G N ++   +   V+IPA  +     +  GR+IT G    L G ++     +   +     A+ VF  GK   +G F+ +F++ SE +PT LR T +G+S+  AR+G+    ++         I  VI     LL G   F L ET  + +P +IE+I+ W
Sbjct:   40 FTATTPDH-HCRPPPNASLEPWVLPLGPNGKP---EKCLRFVHLPNASLPNDTQGATEPCLDGWIYNSTRDT--IVTEWDLVCGSNKLKEMAQSVFMAGILVGGPVFGELSDRFGRKPILTWSYLLLAASGSSAAFSPSLTVYMIFRFLCGCSISGISLSTIILNVEWVPTSTRAISSTTIGYCYTIGQFILPGLAYAVPQWRWLQLSVSAAFFIFSLLSWWVPESIRWLVLSGKFSKALKTLQRVATFNGKKEEGEKLTVEELKFNLQKDITSAKVKYGLSDLFRVSILRRVTFCLSLAWFATGFAYYSLAMGVEEFGVNIYILQIIFGGVDIPAKFITILSISYLGRRITQGFLLILAGVAILALIFVSSEMQLLRTALAVF--GKGCLSGSFSCLFLYTSELYPTVLRQTGMGISNIWARVGSMIAPLVKITGELQPFIPNVIFGTMTLLGGSAAFFLLETLNRPLPETIEDIQDW 510          
BLAST of slc22a-3 vs. Ensembl Mouse
Match: Slc22a8 (solute carrier family 22 (organic anion transporter), member 8 [Source:MGI Symbol;Acc:MGI:1336187])

HSP 1 Score: 162.54 bits (410), Expect = 1.227e-42
Identity = 138/479 (28.81%), Postives = 215/479 (44.89%), Query Frame = 3
Query:  348 FTGVKPDSFHCALPPNVSRES-MIPKERTGDKWEFSSCNQFQSQDNSTII--------PCQNGYNYTMKYFTSSIVTEWDLVCDRAILNALATSSFFVMSFFGAIISCSIADRFGRKVVLITAFMCLNLCEFAQTYITSIYVLIVFKLLAGIFQQGCFISGFTMTIELFSLRNRSNACLADTFSWTXXXXXXXXXXXXXRDWRNYFFWTSITMLPFCLVFYHLPESIRWMMAKDQ-TKNAQILLKTATLYSNPPLPEK-TFENYDKYKRKQESEKLPHYNVLHIFRETLLLRYQLINSFVWFTTAMTYYGVQVKVVEIG-NPFLNFFLSSLVEIPANILCFPIANKYGRKITIGLTNFLVGFSLFMGYILWKYLDSPWPAIIVFLVGKMLNTGIFNLIFMHVSEFFPTTLRTTAVGMSSSCARIGASFGAMIFQITLYHDSIAFVIVIGCCLLTGVLVFCLPETYRKKMPTSIEEIKQW 1748
            FT   PD  HC  PPN S E  ++P    G       C +F    N+++         PC +G+ Y     T  IVTEWDLVC    L  +A S F      G  +   ++DRFGRK +L  +++ L     +  +  S+ V ++F+ L G    G  +S   + +E      R+ +     + +T   FIL    Y +  WR      S     F L+ + +PESIRW++   + +K  + L + AT        EK T E      +K  +     Y +  +FR ++L R     S  WF T   YY + + V E G N ++   +   V+IPA  +     +  GR+IT G    L G ++     +   +     A+ VF  GK   +G F+ +F++ SE +PT LR T +G+S+  AR+G+    ++         I  VI     LL G   F L ET  + +P +IE+I+ W
Sbjct:   40 FTATTPDH-HCRPPPNASLEPWVLPLGPNGKP---EKCLRFVHLPNASLPNDTQGATEPCLDGWIYNSTRDT--IVTEWDLVCGSNKLKEMAQSVFMAGILVGGPVFGELSDRFGRKPILTWSYLLLAASGSSAAFSPSLTVYMIFRFLCGCSISGISLSTIILNVEWVPTSTRAISSTTIGYCYTIGQFILPGLAYAVPQWRWLQLSVSAAFFIFSLLSWWVPESIRWLVLSGKFSKALKTLQRVATFNGKKEEGEKLTVEELKFNLQKDITSAKVKYGLSDLFRVSILRRVTFCLSLAWFATGFAYYSLAMGVEEFGVNIYILQIIFGGVDIPAKFITILSISYLGRRITQGFLLILAGVAILALIFVSSEMQLLRTALAVF--GKGCLSGSFSCLFLYTSELYPTVLRQTGMGISNIWARVGSMIAPLVKITGELQPFIPNVIFGTMTLLGGSAAFFLLETLNRPLPETIEDIQDW 510          
BLAST of slc22a-3 vs. Ensembl Mouse
Match: Slc22a21 (solute carrier family 22 (organic cation transporter), member 21 [Source:MGI Symbol;Acc:MGI:1929481])

HSP 1 Score: 162.155 bits (409), Expect = 1.906e-42
Identity = 107/419 (25.54%), Postives = 212/419 (50.60%), Query Frame = 3
Query:  498 CQNGYNYTMKYFTSSIVTEWDLVCDRAILNALATSSFFVMSFFGAIISCSIADRFGRKVVLITAFMCLNLCEFAQTYITSIYVLIVFKLLAGIFQQGCFISGFTMTIELFSLRNRSN-ACLADTFSWTXXXXXXXXXXXXXRDWRNYFFWTSITMLPFCLVFYHLPESIRWMMAKDQTKNAQILLKTATLYSNPPLPEKTFENYDKYKRKQESEKLPHYNVLHIFRETLLLRYQLINSFV-WFTTAMTYYGVQVKVVEI-GNPFLNFFLSSLVEIPANILCFPIANKYGRKITIGLTNFLVGFSLFMGYILWKYLDSPWPAIIVFLVGKMLNTGIFNLIFMHVSEFFPTTLRTTAVGMSSSCARIGASFGAMIFQITLYHDSIAFVIVIGCCLLTGVLVFCLPETYRKKMPTSIEEIKQ 1745
            C +G+ Y    F S+IVTEWDLVC       L TS F+V    G+ IS  ++DRFGRK +L           F Q +  +  +  +   L G+     +++ F +  E+ S   R   A L     + F   +L ++ YFIR+WR      ++  +    +++ +PES RW++++ + K A+++++ A   +    P   F+  +  K + +S K P  + ++    T  +R   I S + W T ++ Y+G+ +    + GN ++N FL + VE+PA +L + +     R+ ++  + FL G  L +  ++    D  + +  + +VGK   T  +++++++ +E +PT +R   VG+SS+ +R+G+        +  Y   + ++++    +LT ++    PE+    +P +I+E+++
Sbjct:  113 CLDGWEYDKDIFLSTIVTEWDLVCKDDWKAPLTTSFFYVGVLLGSFISGQLSDRFGRKNILFLTMAMHTGFSFIQVFSVNFEMFTLLYTLVGMGHISNYVAAFVLGTEMLSKSVRIIFATLGVCIFFAFGFMVLPLFAYFIREWRRLLLAITLPGVLCGALWWFIPESPRWLISQGRIKEAEVIIRKAAKINGIVAPSTIFDPSETNKLQDDSSKKPQSHHIYDLVRTPNIRILTIMSIILWLTISVGYFGLSLDTPNLNGNIYVNCFLLAAVEVPAYVLAWLLLQHVSRRYSMAGSLFLGGSVLLLVQLVPS--DLHYLSTTLVMVGKFGITSAYSMVYVYTAELYPTVVRNMGVGVSSTASRLGSILSPYFVYLGAYDRRLPYILMGSLTILTAIITLFFPESSGVSLPETIDEMQK 529          
BLAST of slc22a-3 vs. Ensembl Mouse
Match: Slc22a5 (solute carrier family 22 (organic cation transporter), member 5 [Source:MGI Symbol;Acc:MGI:1329012])

HSP 1 Score: 157.918 bits (398), Expect = 5.394e-41
Identity = 112/425 (26.35%), Postives = 210/425 (49.41%), Query Frame = 3
Query:  498 CQNGYNYTMKYFTSSIVTEWDLVCDRAILNALATSSFFVMSFFGAIISCSIADRFGRKVVLITAFMCLNLCEFAQTYITSIYVLIVFKLLAGIFQQGCFISGFTMTIELFSLRNRSN-ACLADTFSWTXXXXXXXXXXXXXRDWRNYFFWTSITMLPFCLVFYHLPESIRWMMAKDQTKNAQILLKTATLYSNPPLPEKTFENYDKYKRKQESEKLPHYNVLHIFRETLLLRYQLINSFVWFTTAMTYYGVQVKVVEI-GNPFLNFFLSSLVEIPANILCFPIANKYGRKITIGLTNFLVGFSLFMGYILWKYLDSPWPAIIVFLVGKMLNTGIFNLIFMHVSEFFPTTLRTTAVGMSSSCARIGASFGAMIFQITLYHDSIAFVIVIGCCLLTGVLVFCLPETYRKKMPTSIEE------IKQW 1748
            C +G+ Y    F S+IVTEWDLVC       L TS FFV    G+ IS  ++DRFGRK VL           F Q +  +  +  V  +L G+ Q   +++ F +  E+ S   R   A L     + F   +L ++ YFIRDWR      ++  +    +++ +PES RW++++ + K A+++++ A   +    P   F+  +         +L H  +  + R   +    +++  +W T ++ Y+G+ +    + G+ ++N FL + VE+PA +L + +     R+ +I    FL G  L    ++   L     A++  +VGK   T  +++++++ +E +PT +R   VG+SS+ +R+G+        +  Y   + ++++    +LT +L    PE++   +P +I++      IKQW
Sbjct:  113 CLDGWEYDKDVFLSTIVTEWDLVCKDDWKAPLTTSLFFVGVLMGSFISGQLSDRFGRKNVLFLTMGMQTGFSFLQVFSVNFEMFTVLFVLVGMGQISNYVAAFVLGTEILSKSIRIIFATLGVCIFYAFGFMVLPLFAYFIRDWRMLLLALTVPGVLCGALWWFIPESPRWLISQGRIKEAEVIIRKAAKINGIVAPSTIFDPSELQDLNSTKPQLHH--IYDLIRTRNIRVITIMSIILWLTISVGYFGLSLDTPNLHGDIYVNCFLLAAVEVPAYVLAWLLLQYLPRRYSISAALFLGGSVLLFMQLVPSELFYLSTALV--MVGKFGITSAYSMVYVYTAELYPTVVRNMGVGVSSTASRLGSILSPYFVYLGAYDRFLPYILMGSLTILTAILTLFFPESFGVPLPDTIDQMLRVKGIKQW 533          
BLAST of slc22a-3 vs. UniProt/SwissProt
Match: sp|Q66KG0|S22AG_XENLA (Solute carrier family 22 member 16 OS=Xenopus laevis OX=8355 GN=slc22a16 PE=2 SV=2)

HSP 1 Score: 184.496 bits (467), Expect = 1.742e-49
Identity = 138/502 (27.49%), Postives = 228/502 (45.42%), Query Frame = 3
Query:  315 LPCVFSMYSFQFTGVKPDSFHCALPPNVS-------------RESMIPKERTGDKWEFSSCNQFQSQD----------NSTIIPCQNGYNYTMKYFTSSIVTEWDLVCDRAILNALATSSFFVMSFFGAIISCSIADRFGRKVVLITAFMCLNLCEFAQTYITSIYVLIVFKLLAGIFQQGCFISGFTMTIELFSLRNRSNACLADTFSWTXXXXXXXXXXXXXRDWRNYFFWTSITMLPFCLVFYHLPESIRWMMAKDQTKNAQILLKTATLYSNPPLPEKTFENYDKYKRK-QESEKLPHYNVLHIFRETLLLRYQLINSFVWFTTAMTYYGVQVKVVEI-GNPFLNFFLSSLVEIPANILCFPIANKYGRKITIGLTNFLVGFSLFMGYILWKYLDSPWPAIIVFLVGKMLNTGIFNLIFMHVSEFFPTTLRTTAVGMSSSCARIGASFGAMIFQITLYHDSIAFVIVIGCCLLTGVLVFCLPETYRKKMPTSIEEIKQ 1745
            L  VF   + +F    P +    L PN S             ++ ++ ++  GD WE + C++ + +D          N T+  C NGY+Y      SSIVTEWDLVCDR  L  L    F +    GA+I   IADR GR+ ++        L   A  +    Y  ++ + L  +   G ++  F    E   ++ R+ A +     +     I+ +  + +R W  Y    S+T LPF L  + LPE+  W+ ++ + K  + L++T   ++    P K  E     +    +   L ++NVL +F      R  +    +WFT ++ YY   +  V + GN +LN FL+  VEIP+ I+     +K GR+ T  L  FL+  ++  G I+    D     I + + GK      F LI+++ +E +PT +R+ AVG  S   RIG+        +T     +  ++V     LTG+L   LPET    + +++EE  +
Sbjct:   34 LASVFIAVTPKFICRAPGNISTVLLPNASTLRLEDAWESWTSKDYLVVQQENGDIWELNQCSRLKREDASYLTYFYDGNKTLFSCSNGYHYDKSNLESSIVTEWDLVCDREWLAKLIQPIFMLGVLIGAVIFGDIADRVGRRPIIWITSTGQFLFGIAVAFTFDYYSFVIVRFLLAMVSSGYYVVVFVYLTEYVGIKARTWASMHVHAFFAVGVMIVSLVGFLVRTWWIYQIILSLTTLPFVLCCWMLPETPFWLYSQGKYKEVEKLIRTIEKWNKISTPCKLSELCPAQETHVDQPNTLKNHNVLDLFYNWSFARRTITVWLIWFTGSLGYYVFALNSVNLGGNEYLNLFLTGAVEIPSYIVACLGMDKIGRRNT--LAPFLIISAVICGVIMLIPQDHSTVTIAMSMAGKFSIAVAFGLIYLYTAELYPTIVRSLAVGSGSMMCRIGSVVAPFCVYLTDVWIFMPQMLVGIMAFLTGILTLTLPETLGIPLTSTMEEAAE 533          
BLAST of slc22a-3 vs. UniProt/SwissProt
Match: sp|A6QLW8|S22A7_BOVIN (Solute carrier family 22 member 7 OS=Bos taurus OX=9913 GN=SLC22A7 PE=2 SV=1)

HSP 1 Score: 181.03 bits (458), Expect = 2.091e-48
Identity = 147/547 (26.87%), Postives = 253/547 (46.25%), Query Frame = 3
Query:  237 EKCLDELGG------KNIWILKW--------FLLISFMKSLPCVFSMYSFQFTGVKPDSFHCALPPNVSRESMIPKERTGDKWEFSSCNQF---QSQDNSTI-----------------IPCQNGYNYTMKYFTSSIVTEWDLVCDRAILNALATSSFFVMSFFGAIISCSIADRFGRKVVLITAFMCLNLCEFAQTYITSIYVLIVFKLLAGIFQQGCFISGFTMTIELFSLRNRSNACLADTFSWTXXXXXXXXXXXXXRDWRNYFFWTSITMLPFCLVFYHLPESIRWMMAKDQTKNAQILLKTATLYSNPPLPEKTF--ENYDKYKRKQESEKLPHYNVLHIFRETLLLRYQLINSFVWFTTAMTYYGVQVKVVEIGNPFLNFFLSSL----VEIPANILCFPIANKYGRKITIGLTNFLVGFSLFMGYILWKYLDSP----WPAIIVFLVGKMLNTGIFNLIFMHVSEFFPTTLRTTAVGMSSSCARIGASFGAMIFQITLYHDSIAFVIVIGCCLLTGVLVFCLPETYRKKMPTSIEEIKQ 1745
            E+ LD++GG      +N+ +L          FLL  F+ ++P     +     GV PD+F      +   E+ +P+E  G     S+C +F   Q+  NST+                 +PC  G+ Y    F+S+I TEWDLVC++  LN   ++ FF     GA +   ++DRFGR+ +L+ A++       A     S  +  + + L G+   G  I    + +E   +R+R+ A +  +  WT    +L +  Y IRDWR      ++  +P  L  + +PES RW++ + + + A   L      + PP+ E +   E  +K    +   + P Y  L +FR   L    L    VWF    +YYGV + +  +G   LN +L+ L    VE+P+ +L +      GR++T+  T  L+G +L +G    + L SP    W   +  + GK  +   F   ++  SE +PT LR T +G+++   R+G S   +   +     S+  +   G  LL       LPET + ++P +I+++++
Sbjct:    4 EELLDKVGGFGPFQLRNVALLALPRVLLPMHFLLPIFLAAVPA----HRCALPGV-PDNFSNE---DAWLEAHLPREPDG---RLSACLRFTHPQALPNSTLWGEGQNSGEQPEGEPSTVPCPQGWEYNHSEFSSTIATEWDLVCEQKGLNKAISTFFFAGVLVGAEVYGYLSDRFGRRRLLLVAYVSSLALGLASAASVSYIMFAITRTLTGMALAGFTIIVMPLELEWLDVRHRTVAGVLSSTFWTGGVMLLALIGYLIRDWRWLLLTVTLPCVPGILTLWWVPESARWLLTQGRVEEAHRYLLRCARLNGPPVGEDSLSREALNKVAAAERMVRRPSY--LDLFRTPRLRYISLCCMVVWFGVNFSYYGVSLDLSGLG---LNVYLTQLVFGAVELPSKLLVYLSVRHAGRRLTMAGT--LLGAALAVGL---RILVSPEMKSWSTALAVM-GKAFSEAAFTTAYLFTSELYPTVLRQTGMGLTALVGRLGGSLAPLAALLDGVWLSLPKLAYGGIALLAACTALLLPETKQAQLPETIQDVER 528          
BLAST of slc22a-3 vs. UniProt/SwissProt
Match: sp|Q5RLM2|S22A7_RAT (Solute carrier family 22 member 7 OS=Rattus norvegicus OX=10116 GN=Slc22a7 PE=1 SV=1)

HSP 1 Score: 178.718 bits (452), Expect = 1.264e-47
Identity = 140/537 (26.07%), Postives = 252/537 (46.93%), Query Frame = 3
Query:  228 MDPEKCLDELGGKNIWILKWFLLISFMKSL-PCVFSMYSFQFTGVKPDSFHCALP---PNVSR-----ESMIPKERTGDKWEFSSCNQF---QSQDNSTI----------------IPCQNGYNYTMKYFTSSIVTEWDLVCDRAILNALATSSFFVMSFFGAIISCSIADRFGRKVVLITAFMCLNLCEFAQTYITSIYVLIVFKLLAGIFQQGCFISGFTMTIELFSLRNRSNACLADTFSWTXXXXXXXXXXXXXRDWRNYFFWTSITMLPFCLVFYHLPESIRWMMAKDQTKNAQILLKTATLYSNPPLPEKTF--ENYDKYKRKQESEKLPHYNVLHIFRETLLLRYQLINSFVWFTTAMTYYGVQVKVVEIG-NPFLNFFLSSLVEIPANILCFPIANKYGRKITIGLTNFLVGFSLFMGYILWKYLDSPWPAIIVFLVGKMLNTGIFNLIFMHVSEFFPTTLRTTAVGMSSSCARIGASFGAMIFQITLYHDSIAFVIVIGCCLLTGVLVFCLPETYRKKMPTSIEEIKQ 1745
            M  E  LD++GG   + L+  +L++  + L P  F +  F        + HCALP    N+S      E+ +P+E  G    FSSC +F   Q+  N T+                +PC  G+ Y    F+S+I TEWDLVC +  LN + ++ FF+    GA++   ++DRFGR+ +L+ A++   +         +  + +V + L G    G  I    + +E   + +R+ A +  T  W+    +L +  Y IR WR      ++  +P  +  + +PES RW++ + + + A+  L +    +  P+ E +   E  +     + + + P Y  L +FR + L    L    VWF    +YYG+ + V  +G N +    L   VE+P+ I+ + +  + GR++T      L+G +L  G  L   L++      + +VGK  +   F   ++  SE +PT LR T +G+++   R+GAS   +   +      +  V   G  L+       LPET + ++P +I+++++
Sbjct:    1 MGFEDLLDKVGGFGPFQLRNLVLMALPRMLLPMHFLLPVFM---AAVPAHHCALPGAPANLSHQDLWLEAHLPRETDGS---FSSCLRFAYPQTVPNVTLGTEVSNSGEPEGEPLTVPCSQGWEYDRSEFSSTIATEWDLVCQQRGLNKITSTCFFIGVLVGAVVYGYLSDRFGRRRLLLVAYVSSLVLGLMSAASINYIMFVVTRTLTGSALAGFTIIVLPLELEWLDVEHRTVAGVISTVFWSGGVLLLALVGYLIRSWRWLLLAATLPCVPGIISIWWVPESARWLLTQGRVEEAKKYLLSCAKLNGRPVGEGSLSQEALNNVVTMERALQRPSY--LDLFRTSQLRHISLCCMMVWFGVNFSYYGLTLDVSGLGLNVYQTQLLFGAVELPSKIMVYFLVRRLGRRLTE--AGMLLGAALTFGTSLLVSLETKSWITALVVVGKAFSEAAFTTAYLFTSELYPTVLRQTGLGLTALMGRLGASLAPLAALLDGVWLLLPKVAYGGIALVAACTALLLPETKKAQLPETIQDVER 527          
BLAST of slc22a-3 vs. UniProt/SwissProt
Match: sp|Q91WU2|S22A7_MOUSE (Solute carrier family 22 member 7 OS=Mus musculus OX=10090 GN=Slc22a7 PE=1 SV=1)

HSP 1 Score: 177.948 bits (450), Expect = 2.793e-47
Identity = 135/537 (25.14%), Postives = 245/537 (45.62%), Query Frame = 3
Query:  228 MDPEKCLDELGGKNIWILKWFLLISFMK-SLPCVFSMYSFQFTGVKPDSFHCALP---PNVSRESM-----IPKERTGDKWEFSSCNQF---QSQDNSTI----------------IPCQNGYNYTMKYFTSSIVTEWDLVCDRAILNALATSSFFVMSFFGAIISCSIADRFGRKVVLITAFMCLNLCEFAQTYITSIYVLIVFKLLAGIFQQGCFISGFTMTIELFSLRNRSNACLADTFSWTXXXXXXXXXXXXXRDWRNYFFWTSITMLPFCLVFYHLPESIRWMMAKDQTKNAQILLKTATLYSNPPLPEKTF--ENYDKYKRKQESEKLPHYNVLHIFRETLLLRYQLINSFVWFTTAMTYYGVQVKVVEIG-NPFLNFFLSSLVEIPANILCFPIANKYGRKITIGLTNFLVGFSLFMGYILWKYLDSPWPAIIVFLVGKMLNTGIFNLIFMHVSEFFPTTLRTTAVGMSSSCARIGASFGAMIFQITLYHDSIAFVIVIGCCLLTGVLVFCLPETYRKKMPTSIEEIKQ 1745
            M  E+ L ++GG   + L+  +L++  +  LP  F +  F        + HCALP    N+S + +     +P+E  G    FSSC +F   Q+  N T+                +PC  G+ Y    F+S+I TEWDLVC++  LN + ++ FF+    GA++   ++DRFGR+ +L+ A++             +  + +  ++L G    G  I    + +E   + +R+ A +  T  WT    +L +  Y IR WR      ++  +P  +  + +PES RW++ + + + A+  L      +  P+ E +   E  +K    +   + P Y  L +FR + L    L    +WF    +YYG+ +    +G   +    L   VE+P+ I  F +    GR++T      L+  +L  G  L    D+      + ++GK  +   F   ++  SE +PT LR T +G ++   R+GAS   ++  +      +  +   G   L    V  LPET + ++P +I+++++
Sbjct:    1 MGFEELLHKVGGFGPFQLRNLVLLALPRFLLPMHFLLPIFM---AAVPAHHCALPDAPANLSHQDLWLKTHLPRETDGS---FSSCLRFAYPQALPNVTLGTEVYNSGEPEGEPLTVPCSQGWEYDRSEFSSTIATEWDLVCEQRGLNKVTSTCFFIGVLLGAVVYGYLSDRFGRRRLLLVAYVSTLALGLMSAASVNYIMFVTTRMLTGSALAGFTIIVLPLELEWLDVEHRTVAGVISTTFWTGGVLLLTLVGYLIRSWRWLLLAATLPCVPGIISIWWVPESARWLLTQGRVEEAKKYLSICAKLNGRPISEDSLSQEALNKVITMERVSQRPSY--LDLFRTSQLRHVSLCCMMMWFGVNFSYYGLTLDASGLGLTVYQTQLLFGAVEVPSKITVFFLVRLVGRRLTEA--GMLLATALTFGISLLVSSDTKSWITALVVIGKAFSEAAFTTAYLFTSELYPTVLRQTGMGFTALIGRLGASLAPLVVLLDGVWLLLPKLAYGGISFLAACTVLLLPETKKAQLPETIQDVER 527          
BLAST of slc22a-3 vs. UniProt/SwissProt
Match: sp|Q3YAW7|S22A7_RABIT (Solute carrier family 22 member 7 OS=Oryctolagus cuniculus OX=9986 GN=SLC22A7 PE=2 SV=1)

HSP 1 Score: 177.563 bits (449), Expect = 3.704e-47
Identity = 144/535 (26.92%), Postives = 243/535 (45.42%), Query Frame = 3
Query:  237 EKCLDELGGKNIWILKWFLLISFMK-SLPCVFSMYSFQFTGVKPDSFHCALPPNVSR--------ESMIPKERTGDKWEFSSCNQFQS-------------------QDNSTIIPCQNGYNYTMKYFTSSIVTEWDLVCDRAILNALATSSFFVMSFFGAIISCSIADRFGRKVVLITAFMCLNLCEFAQTYITSIYVLIVFKLLAGIFQQGCFISGFTMTIELFSLRNRSNACLADTFSWTXXXXXXXXXXXXXRDWRNYFFWTSITMLPFCLVFYHLPESIRWMMAKDQTKNAQ-ILLKTATLYSNP-PLPEKTFENYDKYKRKQESEKLPHYNVLHIFRETLLLRYQLINSFVWFTTAMTYYGVQVKVVEIG-NPFLNFFLSSLVEIPANILCFPIANKYGRKITIGLTNFLVGFSLFMG-YILWKYLDSPWPAIIVFLVGKMLNTGIFNLIFMHVSEFFPTTLRTTAVGMSSSCARIGASFGAMIFQITLYHDSIAFVIVIGCCLLTGVLVFCLPETYRKKMPTSIEEIKQ 1745
            E+ L+++GG   + L+   L++  +  LP  F +  F        +  CALP   +         E+ +P+E  G    FSSC +F                     Q N + +PC  G+ Y    F+S+I TEWDLVC++  L+  A++ FFV    GA+    ++DRFGR+ +L+ A++   +   A     S  +  + + L G    G  I    + +E   + +R  A +  +  WT    +L +  Y IRDWR      ++ + P  L  + +PES RW++ + + + AQ  LL+ A L   P P    + E   +    +   + P Y  L +FR   L    L    VWF    +YYG  + V  +G N +    L   VE+P+ +L +      GR++T   T  L+G +L +G  +L     S W   +  + GK  +   F   ++  SE +PT LR T +G+++   R+G S   +   +     S+  +   G  LL       LPET R ++P +I+++++
Sbjct:    4 EELLEQVGGFGPFQLRNLALLALPRILLPLHFLLPVFL---AAVPAHRCALPGTPANLSFQDAWLEAYLPREADGT---FSSCLRFTHPQAVPNITLGREGRSPGDLQGNRSSMPCTQGWEYDRSEFSSTIATEWDLVCEQKDLSRAASTFFFVGVLVGAVAFGYLSDRFGRRRLLLVAYVSALVLGLASAASVSYVMFAITRTLTGSALAGFTIIVMPLELEWLDVEHRIVAGVLSSTFWTGGVMLLALVGYLIRDWRWLLLAVTLPLAPGILSLWWVPESARWLLTQGRVEEAQRYLLRCARLNGRPVPQDGLSREALSEVAAGERVVRRPSY--LDLFRTPRLRHISLCCMVVWFGVNFSYYGQSLAVSGLGLNVYQTQLLFGAVELPSKLLVYLSVRHAGRRLTQAGT--LMGAALALGIRLLVASERSSWSTALAVM-GKGFSEAAFTTAYLFTSELYPTVLRQTGMGLTALVGRLGGSLAPLAALLDGVWLSLPKLAYGGIALLAACTALLLPETRRAQLPETIQDVER 527          
BLAST of slc22a-3 vs. TrEMBL
Match: A0A0H3YJ39 (Slc22a-3 OS=Schmidtea mediterranea OX=79327 GN=slc22a-3 PE=2 SV=1)

HSP 1 Score: 1037.71 bits (2682), Expect = 0.000e+0
Identity = 517/517 (100.00%), Postives = 517/517 (100.00%), Query Frame = 3
Query:  228 MDPEKCLDELGGKNIWILKWFLLISFMKSLPCVFSMYSFQFTGVKPDSFHCALPPNVSRESMIPKERTGDKWEFSSCNQFQSQDNSTIIPCQNGYNYTMKYFTSSIVTEWDLVCDRAILNALATSSFFVMSFFGAIISCSIADRFGRKVVLITAFMCLNLCEFAQTYITSIYVLIVFKLLAGIFQQGCFISGFTMTIELFSLRNRSNACLADTFSWTXXXXXXXXXXXXXRDWRNYFFWTSITMLPFCLVFYHLPESIRWMMAKDQTKNAQILLKTATLYSNPPLPEKTFENYDKYKRKQESEKLPHYNVLHIFRETLLLRYQLINSFVWFTTAMTYYGVQVKVVEIGNPFLNFFLSSLVEIPANILCFPIANKYGRKITIGLTNFLVGFSLFMGYILWKYLDSPWPAIIVFLVGKMLNTGIFNLIFMHVSEFFPTTLRTTAVGMSSSCARIGASFGAMIFQITLYHDSIAFVIVIGCCLLTGVLVFCLPETYRKKMPTSIEEIKQWVAHKPIISFH 1778
            MDPEKCLDELGGKNIWILKWFLLISFMKSLPCVFSMYSFQFTGVKPDSFHCALPPNVSRESMIPKERTGDKWEFSSCNQFQSQDNSTIIPCQNGYNYTMKYFTSSIVTEWDLVCDRAILNALATSSFFVMSFFGAIISCSIADRFGRKVVLITAFMCLNLCEFAQTYITSIYVLIVFKLLAGIFQQGCFISGFTMTIELFSLRNRSNACLADTFSWTFSSFILIIYIYFIRDWRNYFFWTSITMLPFCLVFYHLPESIRWMMAKDQTKNAQILLKTATLYSNPPLPEKTFENYDKYKRKQESEKLPHYNVLHIFRETLLLRYQLINSFVWFTTAMTYYGVQVKVVEIGNPFLNFFLSSLVEIPANILCFPIANKYGRKITIGLTNFLVGFSLFMGYILWKYLDSPWPAIIVFLVGKMLNTGIFNLIFMHVSEFFPTTLRTTAVGMSSSCARIGASFGAMIFQITLYHDSIAFVIVIGCCLLTGVLVFCLPETYRKKMPTSIEEIKQWVAHKPIISFH
Sbjct:    1 MDPEKCLDELGGKNIWILKWFLLISFMKSLPCVFSMYSFQFTGVKPDSFHCALPPNVSRESMIPKERTGDKWEFSSCNQFQSQDNSTIIPCQNGYNYTMKYFTSSIVTEWDLVCDRAILNALATSSFFVMSFFGAIISCSIADRFGRKVVLITAFMCLNLCEFAQTYITSIYVLIVFKLLAGIFQQGCFISGFTMTIELFSLRNRSNACLADTFSWTFSSFILIIYIYFIRDWRNYFFWTSITMLPFCLVFYHLPESIRWMMAKDQTKNAQILLKTATLYSNPPLPEKTFENYDKYKRKQESEKLPHYNVLHIFRETLLLRYQLINSFVWFTTAMTYYGVQVKVVEIGNPFLNFFLSSLVEIPANILCFPIANKYGRKITIGLTNFLVGFSLFMGYILWKYLDSPWPAIIVFLVGKMLNTGIFNLIFMHVSEFFPTTLRTTAVGMSSSCARIGASFGAMIFQITLYHDSIAFVIVIGCCLLTGVLVFCLPETYRKKMPTSIEEIKQWVAHKPIISFH 517          
BLAST of slc22a-3 vs. TrEMBL
Match: C3ZR16 (MFS domain-containing protein OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_87519 PE=4 SV=1)

HSP 1 Score: 212.616 bits (540), Expect = 6.387e-58
Identity = 137/493 (27.79%), Postives = 235/493 (47.67%), Query Frame = 3
Query:  333 MYSFQFTGVKPDSFHCALPPNVSR----------ESMIPKERTGDKWEFSSC------NQFQSQDNSTIIPCQNGYNYTMKYFTSSIVTEWDLVCDRAILNALATSSFFVMSFFGAIISCSIADRFGRKVVLITAFMCLNLCEFAQTYITSIYVLIVFKLLAGIFQQGCFISGFTMTIELFSLRNRSNACLADTFSWTXXXXXXXXXXXXXRDWRNYFFWTSITMLPFCLVFYHLPESIRWMMAKDQTKNAQILLKTATLYSNPPLPEKTFENY-DKYKRKQESEKLPHYNVLHIFRETLLLRYQLINSFVWFTTAMTYYGVQVKVVEI-GNPFLNFFLSSLVEIPANILCFPIANKYGRKITIGLTNFLVGFSLFMGYILWKYLDSPWPAIIVF----LVGKMLNTGIFNLIFMHVSEFFPTTLRTTAVGMSSSCARIGASFGAMIFQITLYHDSIAFVIVIGCCLLTGVLVFCLPETYRKKMPTSIEEIKQ 1745
            M++  F    P + HC L PN S            S +P E  G +W +SSC      ++  ++ N T   C +G+ Y    + S++VT++DLVC+R  L  L  S F V    G +IS + +DRFGR+  ++   +   +   A  + T     +V +LLAG    G F  G T+ IE+     R+   +  + SW   +  L    YF+RDW +     S+  +P    ++ LPES RW+++ ++ K A+I ++ A  ++   +P++ ++    K K K+  EK   Y+++ +FR   L R+ +  S VWF T + YY + +   ++ G+P+LNF L +L+E   + +      K+GR+  +G      GF    G        +P     V     L+G+      FN + M+  E  PT +RT  VG+++  +R G      +  +      +  +     C L G  VF LPET+   +P ++E+ ++
Sbjct:    1 MFAQAFLAATP-AHHCRLYPNDSSAMYGHPSERLNSSVPMENVGGRWRYSSCLMHNGTSETSTESNQTAT-CNHGWEYDQSVYHSTVVTDYDLVCERHWLKELGQSIFMVGVAAGGLISGTTSDRFGRRPTVVACIILQLISGLAAAFTTDYVTFLVLRLLAGGAANGAFYVGLTLGIEVIGSSKRNVVGMTISSSWNPGAVFLAGLAYFLRDWWSLQLAVSLMSVPLLSYWWLLPESPRWLLSNNRIKKAKISIQKAAKFNRVTIPDEVYDKVITKAKDKEPGEKFKKYSLVDLFRGPRLRRFTVTVSLVWFATVVVYYALIIGSADLAGDPYLNFVLGALLEWGLSFVGLVAMEKWGRRPVVG------GFLFLTGAACLAVASTPTERQDVIRYISLLGRCAIGVAFNCLAMYSPEVLPTVVRTMGVGVANMWSRAGGILSPFVSLLADVWPPLPMLTFGILCTLGGAGVFSLPETFGIPLPDTLEDGEK 485          
BLAST of slc22a-3 vs. TrEMBL
Match: R7UIT7 (MFS domain-containing protein (Fragment) OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_63021 PE=4 SV=1)

HSP 1 Score: 209.92 bits (533), Expect = 1.485e-57
Identity = 130/418 (31.10%), Postives = 219/418 (52.39%), Query Frame = 3
Query:  540 SIVTEWDLVCDRAILNALATSSFFVMSFFGAIISCSIADRFGRKVVLITAFMCLNLCEFAQTYITSIYVLIVFKLLAGIFQQGCFISGFTMTIELFSLRNRSNACLADTFSWTXXXXXXXXXXXXXRDWRNYFFWTSITMLPFCLVFYHLPESIRWMMAKDQTKNAQILLKTATLYSNPPLPEKT-FEN--YDKYK--RKQESEKLPHYNVLHIFRETLLLRYQLINSFVWFTTAMTYYGVQVKVVEI-GNPFLNFFLSSLVEIPANILCFPIANKYGRKITIGLTNFLVGF----SLFMGYILWKYLDSPWPAIIVFLVGKMLNTGIFNLIFMHVSEFFPTTLRTTAVGMSSSCARIGASFGAMIFQITLYHDSIAFVIVIGCCLLTGVLVFCLPETYRKKMPTSIEEIKQWVAHKP 1763
            SI ++W+LVCDR  +  ++ +        GA+    ++D FGRK + + + M + +      ++ + Y   VF+  AG  QQG  ++GF M  ELF  + R+ A +A    W     +L ++ Y IR+WR+     S+  L    +F+ LPESI W+ A  + + A+ +++ A  ++N P+P+++ F +   DK++  RK+   +   Y +L + R   LL Y  +  F+W    + YYG+      + G+ +LNFFLS LVEIPA   C  I  ++GR+  + + +F+ G     ++F+  +     D  W  I   ++GK   TG F +IF++  E FPTTLR  A+G++S   RIG         +      +  ++     L  G+LVF LPET  + +P +IE+I+ W + KP
Sbjct:    3 SIFSQWNLVCDRRFMKDMSQTIMVFGVMVGAMGFTMLSDNFGRKPIFLFSHMAMVVVGCITAFLNNYYAFCVFRFFAGALQQGIILTGFVMACELFPAKYRTFAGMAIENFWATGMCLLALWAYLIRNWRHLQLLISLLGLFAVPLFWFLPESIPWLCANQRVEEAEEIIQKAAKFNNVPMPKRSKFPSSIIDKFRQTRKKSGPEAARYTLLDVLRNRRLLSYATMMCFIWLVNNLVYYGLSFSTSALAGDRYLNFFLSGLVEIPAYTSCIFILERFGRRWPLCIFHFIAGLFLAVTMFIPEVTEGGTDLRWLLITCNMIGKFGITGTFGIIFLYTPEIFPTTLRAQAMGIASLGGRIGNMMAPFADSLAAAVPWLPGILFGALSLAAGLLVFFLPETLNRPLPQTIEDIENW-SKKP 419          
BLAST of slc22a-3 vs. TrEMBL
Match: A0A3P8XC61 (MFS domain-containing protein OS=Esox lucius OX=8010 PE=4 SV=1)

HSP 1 Score: 209.92 bits (533), Expect = 1.609e-56
Identity = 151/541 (27.91%), Postives = 264/541 (48.80%), Query Frame = 3
Query:  204 RINSSRLEMDPEKCLDELGGKNIWILKWF-LLISFMKSLPCVFSMYSF---QFTGVKPDSFHCALPP-----NVSRESM----IPKERTGDKWEFSSCNQF---------QSQDNSTI-IPCQNGYNYTMKYFTSSIVTEWDLVCDRAILNALATSSFFVMSFFGAIISCSIADRFGRKVVLITAFMCLNLCEFAQTYITSIYVLIVFKLLAGIFQQGCFISGFTMTIELFSLRNRSNACLADTFSWTXXXXXXXXXXXXXRDWRNYFFWTSITMLPFCLVFYHLPESIRWMMAKDQTKNAQILLKTATLYSNPP--LPEKTFENYDKYKRKQESEKLPHYNVLHIFRETLLLRYQLINSFVWFTTAMTYYGVQVKVVEIG-NPFLNFFLSSLVEIPANILCFPIANKYGRKITIGLTNFLVGFSLFMGYILWKYLDSPWP-AIIVFLVGKMLNTGIFNLIFMHVSEFFPTTLRTTAVGMSSSCARIGASFGAMIFQITLYHDSIAFVIVIGCCLLTGVLVFCLPETYRKKMPTSIEEIKQ 1745
            R +S  L M  E  L+E  G       WF +LI  +  +P V   ++F    F    P + HCAL       N+++E      +P E  G     SSC  F            D+  + +PCQNG+ Y    F S+I TEWDLVC+R  +N +  + FFV    GAI   +++D+FGRK +L+ +++   +  F+  +  S  + IV + L G    G  I    +++E   +++R+   ++ + +W+  + +L    Y + DWR      S+ +    + ++ LPES RW++A  + + A + L+    ++N    L +   E+        +S K   Y+ L + R   + R  L+   VW+  A TYYG+ + +   G + +L  F+ S +EIPA I+ +   + +GRK+    T  L G  + +   + K     W    IV ++GK L+   F  + +H +E +PT +R   +G ++  AR+G S   +I  +      +  VI+    +L+G++ F LPET+  ++P +IE+I++
Sbjct:    3 RGDSRMLRMKFENILEETDG-----CGWFQILIITLLCVPRVILPFNFLLHNFIAAVP-AHHCALDDAGVIRNLTQEQRLTVSVPVEEDGTP---SSCKMFLEPQFHLLINPNDSDLVKVPCQNGWVYDNSTFKSTIATEWDLVCNRTAMNKVTATIFFVGVMMGAIAFGTLSDKFGRKPMLLVSYILSIVFGFSCAFSNSYTMFIVMRFLTGFGLTGISIISTVLSVEWVDIKHRALIGISGSLAWSVGNIMLAGIAYQVNDWRLLMIAVSVPLSLAIVTWWWLPESARWLIANGEVEKAHLYLQKCAYFNNKKDFLSKIKPEDLSNVVVVDKSNK--TYSYLDLVRTPKMRRLALLTGIVWYGVASTYYGISLNITGFGLSVYLTHFIFSAIEIPAKIIVYFCLDTFGRKLCQASTLLLAGTCIAINMFVPK---GQWHLRTIVAVLGKGLSEASFTTVILHTTEIYPTVVRQNGLGYTNFMARLGVSIAPLIILLEEVWKPLPEVIICCVSILSGLVAFLLPETHNVRLPETIEDIEK 529          
BLAST of slc22a-3 vs. TrEMBL
Match: A0A093JNL3 (Solute carrier family 22 member 7 (Fragment) OS=Struthio camelus australis OX=441894 GN=N308_05817 PE=4 SV=1)

HSP 1 Score: 205.682 bits (522), Expect = 3.658e-55
Identity = 149/533 (27.95%), Postives = 258/533 (48.41%), Query Frame = 3
Query:  228 MDPEKCLDELGG-KNIWILKWFLLISFMKSLPCVFSMYSFQFTGVKPDSFHCALPP-----NVSRESM----IPKERTGDKWEFSSCNQF--------------QSQDNSTIIPCQNGYNYTMKYFTSSIVTEWDLVCDRAILNALATSSFFVMSFFGAIISCSIADRFGRKVVLITAFMCLNLCEFAQTYITSIYVLIVFKLLAGIFQQGCFISGFTMTIELFSLRNRSNACLADTFSWTXXXXXXXXXXXXXRDWRNYFFWTSITMLPFCLVFYHLPESIRWMMAKDQTKNA-QILLKTATLYSNPPLPEKTFENYDKYKRKQESEKL--PHYNVLHIFRETLLLRYQLINSFVWFTTAMTYYGVQVKVVEIG-NPFLNFFLSSLVEIPANILCFPIANKYGRKITIGLTNFLVGFSLFMGYILWKYLDSPWPAIIVFLVGKMLNTGIFNLIFMHVSEFFPTTLRTTAVGMSSSCARIGASFGAMIFQITLYHDSIAFVIVIGCCLLTGVLVFCLPETYRKKMPTSIEEIK 1742
            M  E  L E GG     IL  FLL     +LP  F +++F        S HCA+P      N++ E +    +P+E  G    F SC  F              Q +++S I  C++G+ Y    FTS+  T+WDLVC++  LN    + FF+    GA+I   ++DR+GRK +L+ + +C  +        TS  +L + + L G+   G  +    + +E   +++R+ + +  +  W+  + +L +  Y +RDWR      +    P  +  + +PES RW++A  + K A + LL+ A +        K F    +  R+  +EK    +Y+ + +FR  +L +  L +  VWF  A +YYG+ + +   G N +L+ F+  ++EIPA ++ + + N+ GR+ +   T  L G  +    I+ K   S     +V ++GK  +   F  +F++ SE +PT LR   +G +S  ARIG +   ++F +     S+  V   G  +  G + F LPET    +P  IE+++
Sbjct:    1 MKFEDLLLETGGFGRFQILILFLLCFPRINLPMHFLLHNFL---AATPSHHCAIPHQEAFVNLTTEELLLISVPREPDGT---FRSCEMFSQPQFYLLLLNSSLQPENDSLIEDCKHGWVYDHSQFTSTTATQWDLVCEQRGLNQATATFFFIGVTVGAVIFGYLSDRYGRKAMLLVSLVCSGMFGMLSAASTSYSMLAITRTLTGVALSGISLIILPLGMEWVDVQHRTLSGILTSIFWSIGNMLLAMVAYLVRDWRWLLVAVTGPCFPSIICLWWVPESARWLIANGKVKQAHRHLLRCARMNG-----RKDFAVSPEALRRMTTEKKSGENYSYISLFRTPVLRKISLCSGAVWFGVAFSYYGMSLNLTGFGLNMYLSQFVFGIIEIPAKLIMYVLVNRVGRRQSQAWTLILAGLCIGANVIIPKSFTS--MRSVVAIMGKGFSESAFTTVFLYTSELYPTILRQNGMGYTSFVARIGGALAPLVFLLDDVWRSLPEVTYCGVAVCCGSVAFLLPETLNVHLPEGIEDVE 520          
BLAST of slc22a-3 vs. Ensembl Cavefish
Match: ENSAMXT00000010878.2 (pep primary_assembly:Astyanax_mexicanus-2.0:14:29265439:29284025:-1 gene:ENSAMXG00000010589.2 transcript:ENSAMXT00000010878.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 191.815 bits (486), Expect = 5.293e-53
Identity = 137/517 (26.50%), Postives = 253/517 (48.94%), Query Frame = 3
Query:  279 LKWFLLISFMKSLPCVFSMYSFQFTGVKPDSFHCALP-PNVSRE---SMIPKERTGDKWEFSSCNQFQSQ-----------------DNSTIIPCQNGYNYTMKYFTSSIVTEWDLVCDRAILNALATSSFFVMSFFGAIISCSIADRFGRKVVLITAFMCLNLCEFAQTYITSIYVLIVFKLLAGIFQQGCFISGFTMTIELFSLRNRS-----NACLADTFSWTXXXXXXXXXXXXXRDWRNYFFWTSITMLPFCLVFYHLPESIRWMMAKDQTKNAQILLKTATLYSNPPLPEKTFENYDKYKRKQESEKL-PHYNVLHIFRETLLLRYQLINSFVWFTTAMTYYGVQVKVVEI-GNPFLNFFLSSLVEIPANILCFPIANKYGRKITIGLTNFLVGFSLFMGYILWKYLDSPWPAIIVFLVGKMLNTGIFNLIFMHVSEFFPTTLRTTAVGMSSSCARIGASFGAMIFQITLYHDSIAFVIVIGCCLLTGVLVFCLPETYRKKMPTSIEEIKQ 1745
            L +FLL S   ++P  FS +S  F    P + HC +P  N+S E   + IP      K E S C ++  +                  +  +  C +G+ Y+   + S+IVTE+DLVCD        +S +F+    G+  S  I+DRFGRK VL    M   +  F Q +  S  V  +   + G+ Q   +++ F +  EL S   R        CL   F +     +L +  Y IR+WR      S+  L +  +++ +PES RW++++ + + A+ ++K A   +    P+  F+  ++ ++  + +K  P  N+L + R + + R  LI   VW T +M Y+G+ +    + G+ ++N F+S+ +E+PA I  +       RK++  ++  L G  L+  +I     D P  ++ + + GK        L+F +  E +PT LR TAVG  +  +R+G++       +++YH  + ++++   C+ + +    LPET+R+ +P +I+++++
Sbjct:   38 LIFFLLCS--STIPNGFSAFSVIFLADIP-AHHCLIPGANLSEEWIRASIPLNVVNGKHELSKCRRYNQEIIRNLSAQGFNPEDVNLTSVELEKCTDGWTYSKDVYQSTIVTEFDLVCDDEWKQPFTSSIYFIGVLCGSFFSGQISDRFGRKPVLFATMMVQTIFTFIQVFAPSWEVFSILFFIVGLGQISNYVAAFVLGTELLSGGVRVFYSSLGVCLFFAFGY----MMLPLIAYLIRNWRMLLVALSVPGLIYIPLWWFIPESPRWLISQGRVEEAEAIVKNAARKNGVLPPDIIFKKSEEEEKNTKPQKTKPENNILDLMRTSNIRRTTLILFLVWLTLSMGYFGLSLNTSRLHGDSYVNCFISAALEVPAYITSWLSLRYLPRKLSCPVSMLLGGGVLY--FIQLVPPDLPALSVALEMAGKFGMAIGTALMFAYTGELYPTVLRNTAVGSCAMVSRVGSAVAPYFIHLSVYHKYLPYILLGTLCIFSSLTTLFLPETFRRPLPETIDQMQK 545          
BLAST of slc22a-3 vs. Ensembl Cavefish
Match: ENSAMXT00000043421.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001371.1:10938:20593:-1 gene:ENSAMXG00000011796.2 transcript:ENSAMXT00000043421.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 183.341 bits (464), Expect = 2.662e-50
Identity = 131/521 (25.14%), Postives = 247/521 (47.41%), Query Frame = 3
Query:  237 EKCLDELGGKNIWILKWFLLISFMKS-LPCVFSMYSFQFTGVKPDSFHCALP-------PNVSRESMIPKERTGDKWEFSSCNQFQSQDN--------STIIPCQNGYNYTMKYFTSSIVTEWDLVCDRAILNALATSSFFVMSFFGAIISCSIADRFGRKVVLITAFMCLNLCEFAQTYITSIYVLIVFKLLAGIFQQGCFISGFTMTIELFSLRNRSNACLADTFSWTXXXXXXXXXXXXXRDWRNYFFWTSITMLPFCLVFYHLPESIRWMMAKDQTKNAQ-ILLKTATLYSNPPLPEKTFENYDKYKRKQESEKLPHYNVLHIFRETLLLRYQLINSFVWFTTAMTYYGVQVKVVEIG-NPFLNFFLSSLVEIPANILCFPIANKYGRKITIGLTNFLVGFSLFMGYILWKYLDSPWPAIIVFLVGKMLNTGIFNLIFMHVSEFFPTTLRTTAVGMSSSCARIGASFGAMIFQITLYHDSIAFVIVIGCCLLTGVLVFCLPETYRKKMPTSIEEIKQ 1745
            E+ LDE+GG + +      ++S  +  LP  F +++F  + V P   HCALP        +  +  ++P +  G     SSC QF   +N        +  +PCQ G+ Y  + F S+  TEWDLVCD   LN    + FF+    GA++   +ADRFGRK +L+ +F+   +   A  + +S  +  + + L+G+   G  I+   ++     +++R+ +    +  W+  + +L +  Y +RDWR+     +   +     ++ +PES RW++   + + AQ +L + A +       +K  E   K    +E  K   ++ L + +   L +  L +  VWF  A TYYG+   +   G N +L  F+   +E+PA +  + + ++ GR+     +  L G  +     +          + V   GK  +   F + F++ +E FPT +R   +G +S   R+G S   ++  +     S   ++     +++G + F LPET R ++P +I+++++
Sbjct:    4 EEVLDEVGGFHRFQFVILHILSIPRVILPLNFLLHNF-ISAVPPH--HCALPHLDDRYADHTPQPQLLPHDPDG---ALSSCRQFPELENFNSSGTGSNGSVPCQYGWTYDRRIFNSTTATEWDLVCDSKHLNQALATFFFMGVMMGAVLFGYLADRFGRKPMLLVSFVSSCVLGVAIAFSSSFLMFAICRTLSGVALTGMSITTLVLS---EGIKHRTFSGTILSLGWSVGNMLLALLAYLLRDWRHLMLAVTAPCILAIATWWWVPESARWLLVNGRVEEAQRVLQQCAKMNGKTSKLDK--ETLLKVTINEEPSK--DHSYLDLVKTPKLRKISLCSGIVWFAVAFTYYGISFNISGFGLNAYLTQFIYGAIEVPAKVGTYFLLDRIGRRNGQAWSLILCGMLIGANTAIPSGYSGVRTGVAV--CGKGFSEAAFTIAFLYTAELFPTVIRQCGLGYTSFMGRLGGSLAPLLIMLDDVWSSAPSLVFSIAAVISGCVAFLLPETLRVRLPETIQDVEE 509          
BLAST of slc22a-3 vs. Ensembl Cavefish
Match: slc22a7b.2 (solute carrier family 22 member 7b, tandem duplicate 2 [Source:ZFIN;Acc:ZDB-GENE-030131-9391])

HSP 1 Score: 177.948 bits (450), Expect = 5.378e-48
Identity = 135/511 (26.42%), Postives = 228/511 (44.62%), Query Frame = 3
Query:  282 KWFLLISFMKSLPCVFSMYSFQFTGVKPDSFHCALPP--------NVSRESM----IPKERTGDKWEFSSC-----NQFQSQDNST------IIPCQNGYNYTMKYFTSSIVTEWDLVCDRAILNALATSSFFVMSFFGAIISCSIADRFGRKVVLITAFMCLNLCEFAQTYITSIYVLIVFKLLAGIFQQGCFISGFTMTIELFSLRNRSNACLADTFSWTXXXXXXXXXXXXXRDWRNYFFWTSITMLPFCLVFYHLPESIRWMMAKDQTKNAQILLKTATLYSNPPLPEKTFENYDKYKRKQESEKLPHYNVLHIFRETLLLRYQLINSFVWFTTAMTYYGVQVKVVEIG-NPFLNFFLSSLVEIPANILCFPIANKYGRKITIGLTNFLVGFSLFMGYILWKYLDSPWPAIIVFLVGKMLNTGIFNLIFMHVSEFFPTTLRTTAVGMSSSCARIGASFGAMIFQITLYHDSIAFVIVIGCCLLTGVLVFCLPETYRKKMPTSIEEIK 1742
            K  LL +F+     V       F  V P S HC            N+++E      IP+   G    F SC      QF    NS+      ++ CQNG+ Y    FTSS+ T+WDLVC+   +N    + FF+   FGA    S++  +GRK +L+ +++         T+ +S  +  V +   G    G  I    + +E   +++R    + D+ SWT  +    +  Y+IRDW+      S+ +    + ++ +PES RW++A      A   L+     +N      + +           E    Y+ L + R + + R  L+    WF  A   YG+   V   G N FL  F+   +E+P  +  F + +K GR+  +     LVG SL +   + K  D      ++ ++G+  ++  F  I ++ SE +PT LR   +G +S  AR+GA+   +I  +      ++ VI+    LL  ++ F LPET  + +P +IE+I+
Sbjct:   68 KMLLLNNFVGRFSLVSHFLLNVFIAVIP-SHHCDFSALDVYNVYENLTQEQRLTVSIPQHGDG---TFDSCYMFSEPQFHLLSNSSDTTELPVVRCQNGWVYDNSTFTSSLATQWDLVCENVGMNKAVATIFFIGVMFGAAAFGSLSATYGRKRMLLVSYILGMGFALGSTFSSSFIMFAVLRFFTGFSITGIVIVSTILNVEWVDIKHRKMVGMIDSISWTSGTMCFSLIAYWIRDWKWLTVAVSLPIAASIISWWWIPESARWLIANGNVDKAHYYLQKCADMNNRKEIMSSIKPETLSSIVVTEEGNRKYSYLDLVRTSKIRRLALLTGITWFCVATVAYGIVFNVGSFGLNLFLTQFVYGAIEVPTKVGTFFLLDKIGRRAIVVGGQLLVGLSLLINIFIPK--DQTVVRTVIAVLGRGCSSASFMTIVLYSSELYPTVLRQNGMGYNSFLARLGAAMAPLILLLDEVWGYLSQVILCSVALLAALVAFQLPETRHRCLPETIEDIE 572          
BLAST of slc22a-3 vs. Ensembl Cavefish
Match: slc22a5 (solute carrier family 22 member 4-like [Source:NCBI gene;Acc:103026458])

HSP 1 Score: 176.407 bits (446), Expect = 1.253e-47
Identity = 142/533 (26.64%), Postives = 252/533 (47.28%), Query Frame = 3
Query:  231 DPEKCLDELGGKNIWILKWFLLISFMKSLPCVFSMYSFQFTGVKPDSFHC-ALPPNVSRE---SMIPKERTGDKWEFSSCNQFQ--------------SQDNSTIIP---CQNGYNYTMKYFTSSIVTEWDLVCDRAILNALATSSFFVMSFFGAIISCSIADRFGRKVVLITAFMCLNLCEFAQTYITSIYVLIVFKLLAGIFQQGCFISGFTMTIELFSLRNRSN-ACLADTFSWTXXXXXXXXXXXXXRDWRNYFFWTSITMLPFCLVFYHLPESIRWMMAKDQTKNAQILLKTATLYSNPPLPEKTFENYDKYKRKQESEKLP----HYNVLHIFRETLLLRYQLINSFVWFTTAMTYYGVQVKVVE-IGNPFLNFFLSSLVEIPANILCFPIANKYGRK-ITIGLTNFLVGFSLFMGYILWKYLDSPWPAIIVFLVGKMLNTGIFNLIFMHVSEFFPTTLRTTAVGMSSSCARIGASFGAMIFQITLYHDSIAFVIVIGCCLLTGVLVFCLPETYRKKMPTSIEEIKQ 1745
            D E+    LG K  + L  FLL++ +  +   F  +   F G  P S HC  L  N+S E   + IP E    K E S C ++               S  N T I    C  G+ Y+ + + S+IV+EWDLVC+R      A+S+ ++    G+++S  ++DRFGRK VL  +    ++  FAQ++  S  V  +     G FQ   +I+ F +  E+ S   R     L     +     +L    + IRDWR      S+  + +  +++ +PES RW++++ + K A+ ++K A   +    P+  F       R  E  K+P     Y+++ + + + +     +   +W    + Y+G+ +     IG+PFLN FLS++ E+PA I+   +     R+ +  G  +   GF L +  I  +       A+ + + GK   T  F +++++ +E +PT LR   +GM SS ARIG+     I  +  Y   + ++++    + + +    LPET+ K +P + E++++
Sbjct:    3 DYEEDTAFLGQKGPFFLIIFLLLNAIY-ISTGFHSFYIVFAGASP-SHHCQVLDGNLSEEWIKASIPTEEINGKLEQSKCWRYSLGAIQHFAAEGYNSSSVNFTDIARERCVEGWKYSTEVYHSTIVSEWDLVCEREWRVPFASSTIYMGYLLGSLVSGQLSDRFGRKKVLFASLALESVIIFAQSFSQSWLVFCILYFFVGAFQISLYITAFVLGTEVLSTSLRVLFTTLGAFLHYCVGYMVLPWIAFVIRDWRTLLRVLSVLTVVYIPLWWFIPESPRWLISQGRVKEAEAIIKDAAKKNKVSAPDIIF-------RPLEGNKIPAPARKYSLIDVVKTSNIRFTTFMCLLLWMAINIGYFGLSLNTSNLIGDPFLNCFLSAVAEVPAYIIATLLLKSCPRRPLLSGFLSIGGGFLLLIQLIPERLHTL---AVALEMAGKFGFTMSFTVVYIYTAEIYPTVLRNLGMGMCSSAARIGSITAPYIIFLGTYSKYLPYILMGSLTIGSSIANMFLPETFGKVLPETCEQMQR 523          
BLAST of slc22a-3 vs. Ensembl Cavefish
Match: slc22a7a (solute carrier family 22 member 7a [Source:ZFIN;Acc:ZDB-GENE-050506-52])

HSP 1 Score: 175.252 bits (443), Expect = 2.156e-47
Identity = 136/531 (25.61%), Postives = 245/531 (46.14%), Query Frame = 3
Query:  237 EKCLDELGGKNIWILKWFLLISFMKS-LPCVFSMYSFQFTGVKPDSFHCALP-------PNVSRESMIPKERTGDKWEFSSCNQFQSQDN--------STIIPCQNGYNYTMKYFTSSIVTEWDLVCDRAILNALATSSFFVMSFFGAIISCSIADRFGRKVVLITAFMCLNLCEFAQTYITSIYVLIVFKLLAGIFQQGCFISGFTMTIELFSLRNRSNACLADTFSWTXXXXXXXXXXXXXRDWRNYFFWTSITMLPFCLVFYHLPESIRWMMAKDQTKNAQILLKTATLYSNPPLPEKTFENYDKYKRKQESEKLPH----YNVLHIFRETLLLRYQLINSFVWFTTAMTYYGVQVKVVEIG-NPFLNFFLSSLVEIPANILCFPIANKYGRKITIGLTNFLVGFS-------LFMGYILWKYLDSPWPAIIVFLVGKMLNTGIFNLIFMHVSEFFPTTLRTTAVGMSSSCARIGASFGAMIFQITLYHDSIAFVIVIGCCLLTGVLVFCLPETYRKKMPTSIEEIKQ 1745
            E+ LDE+GG + +      ++S  +  LP  F +++F  + V P   HCALP        +  +  ++P +  G     SSC QF   +N        +  +PCQ G+ Y  + F S+  TEWDLVCD   LN    + FF+    GA++   +ADRFGRK +L+ +F+   +   A  + +S  +  + + L+G+   G  I+   ++IE   +++R+ +    +  W+  + +L +  Y +RDWR+     +   +     ++ +PES RW++   + + AQ +L+                N    K  +E   L H    ++ L + +   L +  L +  VWF  A TYYG+   +   G N +L  F+   +E+PA +  + + ++ GR+     +  L  F        +F+GY   +          V + GK  +   F + F++ +E FPTT+     G+ S   R+G S   ++  +    D I            G + F LPET R ++P +I+++++
Sbjct:    4 EEVLDEVGGFHRFQFVILHILSIPRVILPLNFLLHNF-ISAVPPH--HCALPHLDDRYADHTPQPQLLPHDPDG---ALSSCRQFPELENFNSSGTGSNGSVPCQYGWTYDRRIFNSTTATEWDLVCDSKHLNQALATFFFMGVMMGAVLFGYLADRFGRKPMLLVSFVSSCVLGVAIAFSSSFLMFAICRTLSGVALTGMSITTLALSIEWTGIKHRTFSGTILSLGWSVGNMLLALLAYLLRDWRHLMLAVTAPCILAIATWWWVPESARWLLVNGRVEEAQRVLQQCAKM-----------NGKTSKLDKEVAGLTHPSKDHSYLDLVKTPKLRKISLCSGIVWFAVAFTYYGISFNISGFGLNAYLTQFIYGAIEVPAKVGTYFLLDRIGRRNGQAWSLILSFFHAVCMCVCVFVGYSGVR--------TGVAVCGKGFSEAAFTIAFLYTAELFPTTVWFW--GLHSFMGRLGGSLAPLLIML----DGI------------GCVAFLLPETLRVRLPETIQDVEE 491          
BLAST of slc22a-3 vs. Ensembl Sea Lamprey
Match: oct2 (organic cation transporter 2 [Source:ZFIN;Acc:ZDB-GENE-080204-92])

HSP 1 Score: 128.642 bits (322), Expect = 1.123e-31
Identity = 94/426 (22.07%), Postives = 198/426 (46.48%), Query Frame = 3
Query:  480 NSTIIPCQNGYNYTMKYFTSSIVTEWDLVCDRAILNALATSSFFVMSFFGAIISCSIADRFGRKVVLITAFMCLNLCEFAQTYITSIYVLIVFKLLAGIFQQGCFISGFTMTIELFSLRNRSNACLADTFSWTXXXXXXXXXXXXXRDWRNYFFWTSITMLPFCLVFYH--LPESIRWMMAKDQTKNAQILLKTATLYSNPPLPEKTFENYDKYKRKQESEKLPHYNVLHIFRETLLLRYQLINSFVWFTTAMTYYGVQVKVVEIGNP-FLNFFLSSLVEIPANILCFPIANKYGRKITIGLTNFLVGFSLFMGYILWKYLDSPWPAIIVFLVGKMLNTGIFNLIFMHVSEFFPTTLRTTAVGMSSSCARIGASFGA-MIFQITLYHDSIAFVIVIGCCLLTGVLVFCLPETYRKKMPTSIEEIKQ 1745
            +  +I C +G+ +  +    ++V+E+DLVC+ A L  L+ +   V    GAI+   ++DR+GR+  L+ + +   +      +  +    +  + L GIF  G + + F    E      R    +     ++F   +L    Y++R WR  +   ++T+    L  Y+  LPES RW++++++ + A  +LK     +   L +   +N+++  R  E    P  ++  + R   + +Y ++    WF   + Y G+ +    IG+  +L F +  L EIP  ++   + ++ GR++ + +   L G +     ++    D  W  I +  +G++  T  + ++ +  +E +PT LR  A+   SS + IG      +++++      +  VI     ++ G ++  LPET    +P + E+ + 
Sbjct:  121 SGRLIACDHGWEFDTEKTGLTLVSEFDLVCENAWLLDLSQALLNVGLLVGAILMGYVSDRYGRRWSLMVSIVMQTIFGVLVAFAPNYAAFVCMRTLQGIFNMGSWTTVFVTATEFVGSGQRRVVHMVLQMFFSFGVIMLSGIAYYLRTWR--YLQLALTLPNVVLFSYYWLLPESPRWLISQNRKEQAFGVLKKIASVNGRELSDNIRKNFEEVTRADEKAGNP--SIADLMRSAKIRKYTVVLMIYWFVVGVVYQGLAMSTGNIGDDVYLAFLMGGLAEIPGALMVIALIDRVGRRLPMCVAPGLSGLACLATALVPH--DIGWLNITLVTLGRLGLTMAYEMVTLVNNELYPTHLRNMAMSTCSSLSGIGGIVAPFVLYRLYTIWRHLPMVIFGTLAIIGGFVILLLPETNGLPLPETTEDAEN 540          
BLAST of slc22a-3 vs. Ensembl Sea Lamprey
Match: SLC22A7 (solute carrier family 22 member 7 [Source:HGNC Symbol;Acc:HGNC:10971])

HSP 1 Score: 95.9005 bits (237), Expect = 6.517e-22
Identity = 52/219 (23.74%), Postives = 110/219 (50.23%), Query Frame = 3
Query:  417 PKERTGDKWEFSSCNQFQS----------QDNSTIIPCQNGYNYTMKYFTSSIVTEWDLVCDRAILNALATSSFFVMSFFGAIISCSIADRFGRKVVLITAFMCLNLCEFAQTYITSIYVLIVFKLLAGIFQQGCFISGFTMTIELFSLRNRSNACLADTFSWTXXXXXXXXXXXXXRDWRNYFFWTSITMLPFC-LVFYHLPESIRWMMAKDQTKNAQ 1040
            P  R  D+   S+C+  ++          +++S  +PC +G+ Y  + FT ++VT+WDLVC+   LN L+ + F      G+++   ++DR+GR+  L+ +++   +   A  +  S       + L G+   G  ++  ++++E     +R+ A  +  F+W+  +  L +  Y +R W+        + + FC L ++ +PES RW++ + + + A 
Sbjct:   74 PPWRDDDEEGLSACSLREAAGTNASESPLRNSSEAVPCPSGWEYDRRQFTETVVTQWDLVCEHKALNHLSLTLFMAGVMLGSLVFGYLSDRYGRRNALLGSYVLNAVTGTAAAWAPSFSSFTAMRFLLGVSLSGIIVNTLSLSVEWLDQGHRTFAGTSGGFAWSTGNMALGLLAYLLRGWQQLQL-VVTSPIYFCILTWWFIPESPRWLLVRGRAREAH 291          
BLAST of slc22a-3 vs. Ensembl Sea Lamprey
Match: si:dkey-190l8.2 (si:dkey-190l8.2 [Source:ZFIN;Acc:ZDB-GENE-030131-9103])

HSP 1 Score: 94.3597 bits (233), Expect = 6.431e-21
Identity = 93/391 (23.79%), Postives = 170/391 (43.48%), Query Frame = 3
Query:  600 SSFFVMSFFGAIISCSIADRFGRKVVLITAFMCLNLCEFAQTYITSIYVLIVFKLLAGIFQQGCFISGFTMTIELFSLRNRSNACLADTFSWTXXXXXXXXXXXXXRDWRNYFFWTSITMLPFCLVFYHLPESIRWMMAKDQTKNAQILLKTATLYSNPPLPEKTFENYDKYKRKQESEKLPHYNVLHIFRETLLLRYQLINSFVWFTTAMTYYGVQVKVVEIG-NPFLNFFLSSLVEIPANILCFPIANKYGRKITIGLTNFLVGFSLFMGYILWKYLDSPWPAIIVFLVGKMLNTGIFNLIFMHVSEFFPTTL-------RTTAVGMSSSCARIGASFGAMIFQITLYHDSIAFVIVIGC-CLLTGVLVFCLPETYRKKMPTSIEEIKQ 1745
            ++F V    G+I     +DR+GR+ VL+         EF   ++ +    ++ +LL G    G  +  F++ +E      R+   +    +++     L       ++W      T +  L   L+F+ LPES RW+  K +T  A+ LL+ A++ +      +      +   K  +       +L  FR   L +  LI S++    +MTYYG+ + V + G +  +  FLS L EIP  +L  P+  + GR+    +   + G +  +   L   L +    + + L+GK+       +  ++  E FPT +       R  A+G  + C  +G+    ++ +  L    ++ + V GC  L    L   LPET R   P S+EE ++
Sbjct:   23 TTFMVGLLVGSIAMGIASDRYGRRPVLLGCVASQGAAEFVIAFLPNFPTYLLGRLLTGTTASGIMLCSFSLGVEWCGPALRAWPPIILALAFSVGMMALAGVAKISQNWPQLHLATGVPQLMVLLLFWSLPESPRWLFLKKRTTEARNLLRQASIINR---RSEVSWTPLRLTSKLSTRGANESTLLITFRNRTLRKRLLIMSYICAAVSMTYYGLCLSVGDFGLDIHMAQFLSGLAEIP-QLLLPPLMRRVGRRSLCIVFLSVAGATCLLCLPLQPNLAN--VVVALALLGKLCAQVTACVATLYRIELFPTNVRPRCHGHRQNALGAVAMCGSVGSLLAPLVNRAALVLG-VSALSVHGCLPLAGAALALLLPETRRAPFPDSVEECER 406          
BLAST of slc22a-3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007122.1 (pep scaffold:Pmarinus_7.0:GL476962:153150:164773:-1 gene:ENSPMAG00000006444.1 transcript:ENSPMAT00000007122.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 81.2629 bits (199), Expect = 1.901e-17
Identity = 52/203 (25.62%), Postives = 89/203 (43.84%), Query Frame = 3
Query:  360 KPDSFHCALPPNVSRESMIPKERTGDKWEFSSCNQFQSQDNSTIIPCQNGYNYTMKYFTSSIVTEWDLVCDRAILNALATSSFFVMSFFGAIISCSIADRFGRKVVLITAFMCLNLCEFAQTYITSIYVLIVFKLLAGIFQQGCFISGFTMTIELFSLRNRSNACLADTFSWTXXXXXXXXXXXXXRDWRNYFFWTSITMLPF 968
             P   H  +P   +      +    +  E   C      + S   PC  G++Y    FTS++VTEWDLVC R+ LN + +S F +    GA +  ++AD++GRK V++ +            +  +  +  + + + G+   G  ++ F +  E   +  R  A +A   ++     +L    YFIRDWR      SI  + F
Sbjct:   51 DPPGGHAPVPSATTAPPTAGESAAANGTERPRCGS--RLNESGWQPCATGWDYDRSVFTSTVVTEWDLVCTRSYLNNVGSSIFMLGLMVGAPVLGTMADKYGRKSVILVSMAIQTAFGLGAAFAPNFVMYALARFMVGVAISGVIMNAFVLATEWTGIGERMLAGIATQQAFGVGYMLLAPVAYFIRDWRQLQLAISIPEILF 251          
BLAST of slc22a-3 vs. Ensembl Sea Lamprey
Match: slc22a6l (solute carrier family 22 member 6, like [Source:NCBI gene;Acc:404609])

HSP 1 Score: 80.1073 bits (196), Expect = 1.067e-16
Identity = 72/314 (22.93%), Postives = 140/314 (44.59%), Query Frame = 3
Query:  816 IELFSLRNRSNACLADTFSWTXXXXXXXXXXXXXRDWRNYFFWTSITMLPFCLVFYHLPESIRWMMAKDQTKNAQILLKTATLYSNPPLPEKTFENYDKYKRKQ-ESEKLPH--YNVLHIFRETLLLRYQLINSFVWFTTAMTYYGVQVKVVE--IGNPFLNFFLSSLVEIPANILCFPIANKYGRKITIGLTNFLVGFSLFMGYILWKYLDSPWPAIIVFLVGKMLNTGIFNLIFMHVSEFFPTTLRTTAVGMSSSCARIGASFGAMIFQITLYHDSIAFVIVIGCCLLTGVLVFCLPETYRKKMPTSIEEIK 1742
            +E  ++++R+   +    ++T    +L+   Y+IRDWR+     S     F L  +  PES RW++ +   + A   LK   + +          +  +Y RK+ E +  P   Y + ++     L R  L+ S VW      +Y   V +V     + FL   +   ++ PA ++   + +  GR+ T   +  +   + F   +L    +S      + ++GK   +  FN  +++  E FPT +R + +G+ S+ AR+G     ++        ++   +     L+ G LV+ LPET  + +P +IEE+ 
Sbjct:    1 VEWIAMKDRTLYGMLSGVAYTTGQLVLVALAYYIRDWRHLQHSISAAFYVFFLCSWCTPESARWLVMRGHYERALHGLKRVAVINGRKREAAQLTSPLQYLRKELEEDTGPRRFYTMFNLLTIPALRRRTLVMSLVWCDDVFCWYAGFVVIVTRTCAHTFLLQVIYGAIDYPAKVVGLVVLSLLGRRATQAGSLAVASIASFC--LLAIPAESGTARTCLAVLGKGALSCSFNCAYLYTGEIFPTVIRQSGLGLCSTMARVGGMLAPLVIMAGESLPALPLSMYGSASLVAGSLVYFLPETLNRPLPETIEELS 312          
BLAST of slc22a-3 vs. Ensembl Yeast
Match: CIN10 (Putative transporter; member of the sugar porter family; non-essential gene; overexpression results in elevated colony sectoring, an indicator of chromosomal instability [Source:SGD;Acc:S000002795])

HSP 1 Score: 48.9062 bits (115), Expect = 1.835e-6
Identity = 52/214 (24.30%), Postives = 89/214 (41.59%), Query Frame = 3
Query:  552 EWDLVCDRAILNALATSSFFVMSFFGAIISCSIADRFGRKVVLITAFMCLNLCEFAQTYITSIYVLIVFKLLAGI---FQQGCF-----------ISGFTMTIELFSLRNRSNACLADTFSWTXXXXXXXXXXXXXRDWRNYFFWTSITMLPFCLVFYHLPESIRWMMAKDQ---TKNA-QILLKTATLYSNPPLPEKTFENYDKYKRKQESEK 1139
            +  LV    +   L TSS  V SFFG+I++  +ADR+GR++ L        L         ++  LI  +LL GI       C            I GF +T+ +          +A T     S  I  +       WR  F  ++I  + F  +   +PES RW ++K     T+++ ++L  TA+ Y      ++     DK +  +++ +
Sbjct:   71 DLSLVVLTDVQKELITSSTSVGSFFGSILAFPLADRYGRRITLAICCSIFILAAIGMAIARTLTFLICGRLLVGIAVGVSAQCVPLFLSEISPSRIRGFMLTLNI----------IAITGGQLVSYVIASLMKEIDNSWRYLFALSAIPAILFLSILDFIPESPRWSISKGDILYTRDSLRMLYPTASTYHVNSKIKQLIIELDKLRLYEDASE 274          
BLAST of slc22a-3 vs. Ensembl Nematostella
Match: EDO47316 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMR6])

HSP 1 Score: 178.333 bits (451), Expect = 3.258e-49
Identity = 128/437 (29.29%), Postives = 218/437 (49.89%), Query Frame = 3
Query:  450 SSCN---QFQSQDNSTIIPC---QNGYNYTMKYFTSSIVTEWDLVCDRAILNALATSSFFVMSFFGAIISCSIADRFGRKVVLITAFMCLNLCEFAQTYITSIYVLIVFKLLAGIFQQGCFISGFTMTIELFSLRNRSNACLADTFSWTXXXXXXXXXXXXXRDWRNYFFWTSITMLPFCLVFYHLPESIRWMMAKDQTKNAQILLKTATLYSNPPLPEKTFENYDKYKRKQESEKLPHYNVLHIFRETLLLRYQLINSFVWFTTAMTYYGVQVKVVEIGNP-FLNFFLSSLVEIPANILCFPIANKYGRKITIGLTNFLVGFSLFMGYILWKYLDSPW---PAIIVFLVGKMLNTGIFNLIFMHVSEFFPTTLRTTAVGMSSSCARIGASFGAMIFQITLYHDSIAFVIVIGCCLLTGVLVFCLPETYRKKMPTSI 1730
            SSCN    F+  D +    C   ++ + + +     SIVTEWDLVC +++   +A S  F++  FGA+    I+D+FGRK+V+    +  +LC  A  +    +V  +F+ L G    G  I GF + +E   +R+RS       + W  + F+L +  Y I  WR     TS   L F + ++  P+S+RW + K +  +A+ +L            ++ FE  +++    E E+L   ++  +F    +    L++ + W  + + YYG+ +    IG   +LNFFLS+L E     +  P+ +++GRK TI  + ++   +  +  +L +Y D        I   ++ K   T  F+ ++++ SE FPT +R TA+G S+S ARIG SF A   Q    H  + F I+    L+ G+L   LPET  K +P ++
Sbjct:   55 SSCNFTGTFKPGDANYEKRCMMARDQWEFAIDAGFDSIVTEWDLVCSKSMYATIANSITFILWIFGAMAGSIISDKFGRKIVVFPCVIFASLCGLASAFANKYWVFALFRALLGAGIGGYSICGFVLVMEYIGIRHRSIVGFCVWYPWILALFMLALLGYLIPSWRTLSIITSAPGLLFFVFWWFTPDSLRWYLVKGKFDDAKKVLVDVAKGCGNNYTKQDFEFEEEHTFNIEHERLG--DIRDLFHSRSMAHRTLVSWYCWLVSGLVYYGISLSSTTIGGDMYLNFFLSALFEGIGMAIGIPLLDRFGRKKTIVASMYVAALAAIVAALLSQYDDGTMLVGKIISAMVIAKFFVTIAFDGVYVYSSELFPTVVRNTAMGTSTSAARIG-SFAAPFTQKV--HPMMPFGIMALNALICGILCMTLPETKDKPLPDTV 486          
BLAST of slc22a-3 vs. Ensembl Nematostella
Match: EDO27829 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T865])

HSP 1 Score: 179.874 bits (455), Expect = 5.883e-49
Identity = 123/444 (27.70%), Postives = 219/444 (49.32%), Query Frame = 3
Query:  450 SSCN---QFQSQDNSTIIPC---QNGYNYTMKYFTSSIVTEWDLVCDRAILNALATSSFFVMSFFGAIISCSIADRFGRKVVLITAFMCLNLCEFAQTYITSIYVLIVFKLLAGIFQQGCFISGFTMTIELFSLRNRSNACLADTFSWTXXXXXXXXXXXXXRDWRNYFFWTSITMLPFCLVFYHLPESIRWMMAKDQTKNAQILLKTATLYSNPPLPEKTFENYDKYKRKQESEKLPHYNVLHIFRETLLLRYQLINSFVWFTTAMTYYGVQVKVVEIGNP-FLNFFLSSLVEIPANILCFPIANKYGRKITIGLTNFLVGFSLFMGYILWKYLDSPWPAII-----VFLVGKMLNTGIFNLIFMHVSEFFPTTLRTTAVGMSSSCARIGASFGAMIFQITLYHDSIAFVIVIGCCLLTGVLVFCLPETYRKKMPTSIEEIKQ 1745
            SSCN    F+  D +    C   ++ + + +     SIVTEWDLVC +++   +A S  F++  FGA+    I D+FGRK+V+    +  +LC  A  +    +V  +F+ L G    G  I GF + +E   +R+RS       + W  + F+L +  Y I  WR     TS   L F + ++  P+S+RW + K +  +A+ +L            ++ FE  +++    E E+L   ++  +F    +    L++ + W  + + YYG+ +    IG   +LNFFLS+L E     +  P+ +++GRK TI  + ++   +  +  +L +Y D     ++       ++ K   T  F+ ++++ SE FPT +R TA+G S+S ARIG+            H  + F I+    L+ G+L   LPET  K +P ++++ ++
Sbjct:   55 SSCNFTGTFKPGDANYEKRCLMARDQWEFAIDAGFDSIVTEWDLVCSKSMYATIANSITFILWIFGAMAGSIIGDKFGRKIVVFPCVIFASLCGLASAFANKYWVFALFRALLGAGIGGYSICGFVLVMEYIGIRHRSIVGFCVWYPWILALFMLALLGYLIPSWRTLSIITSAPGLLFFVFWWFTPDSLRWYLVKGKFDDAKKVLVDVAKGCGNNYTKQDFEFEEEHTFNIEHERLG--DIRDLFHSRSMAHRTLVSWYCWLVSGLVYYGISLSSTTIGGDMYLNFFLSALFEGIGMAIGIPLLDRFGRKKTIVASMYVAALAAIVAALLSQYDDGSQAMLVGKIISAMVIAKFFVTIAFDGVYVYSSELFPTVVRNTAMGTSTSAARIGSFAAPFTVYSQKVHPMMPFGIMALNALICGILCMTLPETKDKPLPDTVKQTEE 496          
BLAST of slc22a-3 vs. Ensembl Nematostella
Match: EDO36597 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SI67])

HSP 1 Score: 174.866 bits (442), Expect = 5.567e-48
Identity = 129/437 (29.52%), Postives = 215/437 (49.20%), Query Frame = 3
Query:  450 SSCN---QFQSQDNSTIIPC---QNGYNYTMKYFTSSIVTEWDLVCDRAILNALATSSFFVMSFFGAIISCSIADRFGRKVVLITAFMCLNLCEFAQTYITSIYVLIVFKLLAGIFQQGCFISGFTMTIELFSLRNRSNACLADTFSWTXXXXXXXXXXXXXRDWRNYFFWTSITMLPFCLVFYHLPESIRWMMAKDQTKNAQILLKTATLYSNPPLPEKTFENYDKYKRKQESEKLPHYNVLHIFRETLLLRYQLINSFVWFTTAMTYYGVQVKVVEIGNP-FLNFFLSSLVEIPANILCFPIANKYGRKITIGLTNFLVGFSLFMGYILWKYLDSPW---PAIIVFLVGKMLNTGIFNLIFMHVSEFFPTTLRTTAVGMSSSCARIGASFGAMIFQITLYHDSIAFVIVIGCCLLTGVLVFCLPETYRKKMPTSI 1730
            SSCN    F+  D +    C   ++ + + +     SIVTEWDLVC +++   +A S  F++  FGA+    I D+FGRK+V+    +  +LC  A  +    +V  +F+ L G    G  I  F + +E   +R+RS       + W  + F+L +  Y I  WR     TS   L F  VF+  P+S+RW + K +  +A+ +L            ++ FE  +++    E E+L   ++  +F    +    L++ + W  + + YYG+ +    IG   +LNFFLS+L E     +  P+ +++GRK TI  +  +   +  +  +L +Y D        I   ++ K   T  F+ ++++ SE FPT +R TA+G S+S ARIG SF A   Q    H  + F I+    L+ G+L   LPET  K +P ++
Sbjct:   55 SSCNFTGTFKPGDANYEKRCLMARDQWEFAIDAGFDSIVTEWDLVCSKSMYATIANSITFILWIFGAMAGSIIGDKFGRKIVVFPCVIFASLCGLASAFANKYWVFALFRALLGAGIGGYSICSFVLVMEYIGIRHRSIVGFCVFYPWILALFMLALLGYLIPSWRTLSIITSAPGLLF-FVFWFTPDSLRWYLVKGKFDDAKKVLVDVAKGCGNNYTKQDFEFEEEHTFNIEHERLG--DIRDLFHSRSMAHRTLVSWYCWLVSGLVYYGISLSSTTIGGDMYLNFFLSALFEGIGMAIGIPLLDRFGRKKTIAASMCVAALAAIVAALLSQYDDGTMLVGKIISAMVIAKFFVTIAFDGVYVYSSELFPTVVRNTAMGTSTSAARIG-SFAAPFTQKV--HPMMPFGIMALNALICGILCMTLPETKDKPLPDTV 485          
BLAST of slc22a-3 vs. Ensembl Nematostella
Match: EDO46087 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RR13])

HSP 1 Score: 160.229 bits (404), Expect = 1.025e-42
Identity = 115/413 (27.85%), Postives = 197/413 (47.70%), Query Frame = 3
Query:  513 NYTMKYFTSSIVTEWDLVCDRAILNALATSSFFVMSFFGAIISCSIADRFGRKVVLITAFMCLNLCEFAQTYITSIYVLIVFKLLAGIFQQGCFISGFTMTIELFSLRNRSNACLADTFSWTXXXXXXXXXXXXXRDWRNYFFWTSITMLPFCLVFYHLPESIRWMMAKDQTKNAQILLKTATLYSNPPLPEKTFE-NYDKYKRKQESEKLPHYNVLHIFRETLLLRYQLINSFVWFTTAMTYYGVQVKVVEI-GNPFLNFFLSSLVEIPANILCFPIANKYGRKITIGLTNFLVGFSLFMGYILWKYLDSPWP---AIIVFLVGKMLNTGIFNLIFMHVSEFFPTTLRTTAVGMSSSCARIGASFGAMIFQITLYHDSIAFVIVIGCCLLTGVLVFCLPETYRKKMPTSIEE 1736
             YT KY  +SI+TEWDLVC+ A    L  S     +  GA++  ++AD++GR+ V  T    L +  FA ++  +  +    + L G    G  +S F +  EL     R  A +     +T    IL +  Y I+DWR      S+    F L F ++PES RW+M + +   A+ +L    L +   +P+   + N+  +   +       Y    +F    +++   +  F+WF   + YYG+ +    + G+ ++NFFL SL+E PA + C    N  GR+ T+     L G +  M  +  +   SP     A +  ++GK   T  F LI+++ +E FPT +R   +G+ S  +RIG      +  +  Y   +  VI   C  + G+L   LPET+++ +P ++++
Sbjct:   69 QYTSKY--TSIITEWDLVCENAYKADLVQSLLMSGTLLGALMFGALADKYGRRRVWHTTLTGLVVFGFASSFAPTFKIYATLRFLTGFCIGGEILSAFVLATELVGPSYRGFAGIMAQCFFTLGLLILPMVAYLIQDWRTLSVVLSLPASVFILFFRYVPESARWLMIRGRVSEAENILLDIALKNGIAVPKSLLQVNHPFFVGSR-------YGFFDLFCTRKIVKQTFVLIFIWFVNTLVYYGLSLNTKHLAGDIYMNFFLCSLMEFPAYLTCLFFVNWAGRRKTLFNYMVLAGLAC-MACMFVQPESSPADRTLATVFAMIGKFGITASFALIYIYSAEIFPTVVRNVGLGVCSMSSRIGGICAPFVVFLGTYMRPLPMVIFGMCAFMAGLLSLMLPETHKRPLPETMDD 471          
BLAST of slc22a-3 vs. Ensembl Nematostella
Match: EDO46581 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPJ7])

HSP 1 Score: 157.532 bits (397), Expect = 1.260e-42
Identity = 113/400 (28.25%), Postives = 196/400 (49.00%), Query Frame = 3
Query:  552 EWDLVCDRAILN-ALATSSFFVMSFFGAIISCSIADRFGRKVVLITAFMCLNLCEFAQTYITSIYVLIVFKLLAGIFQQGCFISGFTMTIELFSLRNRSNA-CLADTFSWTXXXXXXXXXXXXXRDWRNYFFWTSITMLPFCLVFYHLPESIRWMMAKDQTKNAQILLKTATLYSNPPLPEKTFENYDKYKRKQESEKLPH-YNVLHIFRETLLLRYQLINSFVWFTTAMTYYGVQVKVVEI-GNPFLNFFLSSLVEIPANILCFPIANKYGRKITIGLTNFLVGFSLFMGYILWKYLDSPWPAIIV--FLVGKMLNTGIFNLIFMHVSEFFPTTLRTTAVGMSSSCARIGASFGAMIFQITLYHDSIAFVIVIGCCLLT-GVLVFCLPETYRKKMPTSI 1730
            +WD++CD +     L  + F+     GA +   I+DRFGR+V L++  +   +    Q +  + Y+ +  ++  GI   G  I+ F +  E+     R+ A CLA   S+     +  +  Y + +W+N+    +I  + F L ++ +PES RW+ A+ + K+A+++L+     +     E   +      R+  SEK    Y++ H+F    L +  +I  + WF T+  YYG+      + G+ ++NF  S LVEIPA IL   + ++ GRK        L+ + +  G  L   L     A+++   L+GK   +  +  I++H +E +PT +RT  VG +S CAR+GA     +   T     IA  I+ G   +T G++ F LPET    +P  I
Sbjct:    1 QWDIICDDSKKYIPLTKTIFYAGKLLGAYLFGWISDRFGRRVTLLSTMLIQFISSLIQCFSVNFYMYVALRVPLGICSGGTLIAAFALMAEMVGPNRRNWANCLAQG-SYGVGIALEALIAYLLPEWKNFSLAVTIPNVLFVLYWWFVPESPRWLAARGRIKDAEVILRKIAKTNGHEYQEGALQEIKS--REMVSEKPEKTYHLWHLFSTIYLAKVTIIEGWSWFVTSGVYYGLSFNSGNLSGDFYVNFAASGLVEIPAYILASVLVDRIGRK------KPLIAYYIIGGLALLSLLPIQALALVMTFALIGKFTISAAYYQIYIHSAELYPTVIRTIGVGFASLCARVGAMGAPYVADST---PLIAPAIIFGGLSMTAGMVTFFLPETRGMPLPDHI 388          
BLAST of slc22a-3 vs. Ensembl Medaka
Match: slc22a7a (solute carrier family 22 member 7 [Source:NCBI gene;Acc:101169334])

HSP 1 Score: 186.037 bits (471), Expect = 3.970e-51
Identity = 148/527 (28.08%), Postives = 253/527 (48.01%), Query Frame = 3
Query:  237 EKCLDELGGKNIWILKWFLLISFM----KSLPCVFSMYSFQFTGVKPDSFHCALPPNVSRES----------MIPKERTGDKWEFSSCNQFQ-------SQDNSTIIPCQNGYNYTMKYFTSSIVTEWDLVCDRAILNALATSSFFVMSFFGAIISCSIADRFGRKVVLITAFMCLNLCEFAQTYITSIYVLIVFKLLAGIFQQGCFISGFTMTIELFSLRNRSNACLADTFSWTXXXXXXXXXXXXXRDWRNYFFWTSITMLPFCLVFYHLPESIRWMMAKDQTKNA-QILLKTATLYSNPPLPEK-TFENYDKYKRKQESEKLPHYNVLHIFRETLLLRYQLINSFVWFTTAMTYYGVQVKVVEIG-NPFLNFFLSSLVEIPANILCFPIANKYGRKITIGLTNFLVGFSLFMGYILWKYLDSPWPAIIVFLVGKMLNTGIFNLIFMHVSEFFPTTLRTTAVGMSSSCARIGASFGAMIFQITLYHDSIAFVIVIGCCLLTGVLVFCLPETYRKKMPTSIEEIKQ 1745
            E+ LD++GG + +    FLL+S +      LP  F +++F  +   P       P + +  S           IP+E  G    FSSC  F+       S+ N T+ PCQ+G+ +     +S+  +EWDLVC+   LN    + FF+   FGAI+   ++D+FGRK +++ AF+   L      + TS  +  V + L G+   G  I    + IE   +++R+   +    SW+  + +L +  +FIRDWR+     +  ++   + ++ LPES RW++   +T+ A + L++ A +        K   E   K    + ++K   Y  L + +   L +  L + F WF  A  YYG+  ++   G N +L  F+   VE+PA IL F + +  GR+   G   FL+   + +G      LD      +V +V K  + G F   F++ +E +PT LR   +G +S   RIG+S   M+  +      +  +I  G  + +G LVF LPET    +P +I ++++
Sbjct:    4 EEILDDIGGFSKF---QFLLLSILCLPRAILPLHFLLHNF-ISATPPHRCSLGSPEDRNGSSWETDPGVLALRIPQEEDGS---FSSCRAFELPLSSNLSRANGTV-PCQHGWIFDQTELSSTTSSEWDLVCNEKNLNQALATYFFLGVTFGAIVFGQLSDKFGRKSMILVAFISSTLLGATSAFSTSYVMFAVSRALCGMALSGMSIISVVLGIEWTDIKHRTFTTIITGLSWSVGNMLLALLAFFIRDWRHLTLVVTAPIVLTIISWWWLPESARWLLTHGRTEEAKKYLVQCAKMNGRKEDTAKLDTETLAKITVSEVAKKKHTY--LDLVKTPQLRKITLCSGFFWFAVAFLYYGISFRISGFGVNIYLTQFIYGAVEVPAKILAFFLVDWIGRR--NGQALFLISTGVLIGINTAVPLDYTVVRTVVAVVAKGFSEGAFTTAFLYSAELYPTVLRQCGIGYTSCLCRIGSSLAPMVMLLEDVWLLLPPLIFAGTGIFSGSLVFLLPETLNAHLPENILDVEE 518          
BLAST of slc22a-3 vs. Ensembl Medaka
Match: slc22a7b.3 (solute carrier family 22 member 7-like [Source:NCBI gene;Acc:101169903])

HSP 1 Score: 182.185 bits (461), Expect = 6.598e-50
Identity = 147/546 (26.92%), Postives = 256/546 (46.89%), Query Frame = 3
Query:  228 MDPEKCLDELGGKNIWILKWFLLISFMK--SLPCVFSMYSFQFTGVKPDSFHCALPP--------NVSRESM----IPKERTGDKWEFSSCNQFQ---------SQDNST---IIPCQNGYNYTMKYFTSSIVTEWDLVCDRAILNALATSSFFVMSFFGAIISCSIADRFGRKVVLITAFMCLNLCEFAQTYITSIYVLIVFKLLAGIFQQGCFISGFTMTIELFSLRNRSNACLADTFSWTXXXXXXXXXXXXXRDWRNYFFWTSITMLPFCLVFYHLPESIRWMMAKDQTKNAQILLK-----TATLYSNPPLPEKTFENYDKYKRKQESEKLPHYNVLHIFRETLLLRYQLINSFVWFTTAMTYYGVQVKVVEIG-NPFLNFFLSSLVEIPANILCFPIANKYGRKITIGLTNFLVGFSLFMGYILWKYLDSPWPAIIVFLVGKMLNTGIFNLIFMHVSEFFPTTLRTTAVGMSSSCARIGASFGAMIFQITLYHDSIAFVIVIGCCLLTGVLVFCLPETYRKKMPTSIEEI-KQWVAHKPI 1766
            M  E  LDE+ G   + +   + I+F+   +LPC F + +F      P + HC +          N+S E      IP ++ G     SSC  F          S  N T    + CQNG+ Y    F S+I +EWDLVCD+   N  + + FF+   FGAI   S++DR+GR+V+L+ +++   +   A  + T+  +  V +   G    G  I    +++E   + +R    + D+FSW+  + +     Y I DWR      S  ++   + +  +PES RW++A  + + AQI LK          S+P L  +T     + K+  ++     Y+ L + R   + +  L    +WF  A  YYG+   +  +G + +L  F+ SL+E+PA    + + +K GR+ T      L+  ++ +G  L    D   P  +V ++GK  ++  F+ + ++ SE +PT LR    G +S   R+G +    I  +    + +  +++    L  G++   L ET  + +P +IE+I +QW   KP+
Sbjct:    1 MKFENVLDEINGFGKFQIM-IIGINFLGRFTLPCHFMLSNF--IAAVP-AHHCDIKSFDNEGIFKNLSWEEKLLVSIPVQQDGTP---SSCQMFVEPQYHLLLLSSPNVTEMLTVSCQNGWVYDNTTFKSTITSEWDLVCDKRDKNKASATIFFIGVMFGAISFGSLSDRYGRRVMLLVSYISALIFAVASAFSTTYEMFAVLRFFTGFCITGIVIVSAVLSVEWVDVNHRKLVGVVDSFSWSVWNCVFPGIAYHITDWRWLILCVSSPLILSIITWRWMPESARWLIANGKFEQAQIHLKKCAKMNGAEESSPILSIETLATIIETKKTDQT-----YSYLDLIRTPKMRKIALSTGILWFCLATAYYGISFNIQGLGLSIYLTQFVYSLIELPAKGTVYYLLDKIGRRPT--QMGALLCAAICLGINLVIPKDLSVPRTVVAVIGKGFSSASFSTVVLYCSELYPTVLRQNGFGYNSFMGRLGVALAPFILLLDEVWEKLPQLVLCLLALTGGLVARTLSETRNRFLPETIEDIEQQWKNKKPL 532          
BLAST of slc22a-3 vs. Ensembl Medaka
Match: slc22a4 (solute carrier family 22 member 4 [Source:NCBI gene;Acc:101163192])

HSP 1 Score: 179.489 bits (454), Expect = 9.107e-49
Identity = 140/505 (27.72%), Postives = 235/505 (46.53%), Query Frame = 3
Query:  315 LPCVFSMYSFQFTGVKPDSFHCALPPNVS-----RESMIPKERTGDKWEFSSCNQFQ-------SQDNSTIIP-------------CQNGYNYTMKYFTSSIVTEWDLVCDRAILNALATSSFFVMSFFGAIISCSIADRFGRKVVLITAFMCLNLCEFAQTYITSIYVLIVFKLLAGIFQQGCFISGFTMTIELFSLRNRSNACLADTFSWTXXXXXXXXXXXX-XRDWRNYFFWTSITMLPFCLVFYHLPESIRWMMAKDQTKNAQILLKTATLYSNPPLPEKTFENYDKYKRKQESEKLPHYNVLHIFRETLLLRYQLINSFVWFTTAMTYYGVQVKVVEI-GNPFLNFFLSSLVEIPANILCFPIANKYGRKITIGLTNFLVGFSLFMGYILWKYLDSPWPAIIVFLVGKMLNTGIFNLIFMHVSEFFPTTLRTTAVGMSSSCARIGASFGAMIFQITLYHDSIAFVIVIGCCLLTG-VLVFCLPETYRKKMPTSIEEIKQ 1745
            LP  F+     F G  P    C +P + S     R   IP E        SSC +         SQ N  IIP             CQ+G+ Y+ + + S+IVTEWDLVCD A    L TS  +V    G ++S  ++DRFGRK +L        +   AQ +  +  +      L G      +   F +  E+ S R R   C    F  +   ++ +  + + +RDWR+     + + L +  +++ L ES RW++++ + + A+ +LK A   +   +PE  F   +        E+    N++ I +   +L   +  + +W    ++YY + +    + GNP+LN FLS++ E+PA I+   +     R I    T FL G  +    ++   +D P  A+++ ++GK   T  F +++   SE FPT +R TA+G  S  ARI       I  +  Y+ ++ + IV+G   L+G V+ F LPET  K +P +I ++++
Sbjct:   35 LPNGFTGIYIIFVGDTP-PHECYIPDSDSISEAWRNETIPMETVDGAARRSSCRRLHLETVRNYSQRN--IIPNVDVNVSEIPWEACQDGWIYSREIYQSTIVTEWDLVCDNAYKGPLTTSIHYVGVLVGTVLSGQLSDRFGRKPMLFVMMALQTVAITAQIFSPNWEIFTFIFCLVGAGGYSNYTIAFVLGSEILSPRIRVVFCSLGVFMGSAVGYMAMPAVAYFLRDWRSLLISMAASGLIYIPLWWLLSESPRWLLSQGKVEEAEAILKDAAKMNKVQVPEPIFTQAEVEDSLAMKER--KINIMVIVKSCNILSITMACASLWMIITISYYALLLNTSNLNGNPYLNCFLSAVTEVPAYIIALLLLRYCSRHICQSSTLFLGGVMILCVRLI--PIDLPAVAVLLEMLGKFGVTAAFCVVYSVTSELFPTVIRNTAMGCCSMAARIATILSPFIIYLGKYYKALPY-IVMGVLALSGAVITFILPETRGKVLPETIPQMQR 531          
BLAST of slc22a-3 vs. Ensembl Medaka
Match: si:dkey-166k12.1 (solute carrier family 22 member 13 [Source:NCBI gene;Acc:101165571])

HSP 1 Score: 178.718 bits (452), Expect = 1.472e-48
Identity = 126/442 (28.51%), Postives = 222/442 (50.23%), Query Frame = 3
Query:  453 SCNQFQSQDNSTIIPCQNGYNYTMKYFTSSIVTEWDLVCDRAILNALATSSFFVMSFFGAIISCSIADRFGRKVVLITAFMCLNLCEFAQTYITSIYVLIVFKLLAGIFQQGCFISGFTMTIELFSLRNRSNACLADTFSWTXXXXXXXXXXXXXRDWRNYFFWTSITMLPFCLVFY--HLPESIRWMMAKDQTKNAQILLKTATLYSNPPLPEKTFENYDKYKRKQESEKLPHYNVLHIFRETLLLRYQLINSFVWFTTAMTYYGVQVKVVEIG-NPFLNFFLSSLVEIPANILCFPIANKYGRKITIGLTNFLVGFSLFMGYILWKYLDSPWPAIIVFLVGKMLNTGIFNLIFMHVSEFFPTTLRTTAVGMSSSCARIGASFGAMIFQITLYHDSIAFVIVIGCCLLTGVLVFCLPETYRKKMPTSIEEIKQW-VAHKPI 1766
            S +     + +  +PC  G+ Y+ + F SS VTEWDLVC+RA LN+L +S +      G+++  ++ADR+GR+ VL+ +     +   A  +  +  V ++ +   G    G  I+ F +  E    + R  A +   +++     +L    Y IRDWR      +I+   F L+FY   LP+S RW++A D+T+ A  LL+ A L +   LP       +K++    S++   ++ + + R   + +  +I  ++WF   + YYG+ + V  +G N ++  F+  L+EIPA  L   I   + R+++  L+ FL    L    +L    D P     + +VGK   T  F +I+++ +E FPT +R T +G+SS  AR+G     +I  +  +  +   +I     LL  +L   LPET  + +P ++E+ + W V   P+
Sbjct:   73 SADALPPGNRTERVPCGRGWVYSSEVFESSTVTEWDLVCNRAGLNSLGSSVYMSGLLVGSVVFGAMADRYGRRFVLLLSIALQTVFGVAVAFAPNFPVYVLLRFAVGTTISGVIINAFVLGTEWTCTKRRMLAGIITDYTFGLGYMLLAGVAYLIRDWRK--LQLAISAPGFLLIFYIRVLPQSARWLLANDRTEEAIALLRKAALVNGRVLPPAV--QVEKWEILGGSKR--SHSAVDLVRTPQMRKRTVILFYIWFVNVLVYYGLSLGVSRLGTNLYMTQFVFGLIEIPARSLVL-IFLPFSRRLS--LSGFLAVGGLACLLMLTVPEDHPNVLTGLAMVGKFGITASFAIIYVYTAEIFPTVVRQTGIGVSSMFARMGGVLAPIINMLDSHSPATPLIIFGTSPLLGALLALALPETADRPLPDTLEDAENWDVRSAPV 505          
BLAST of slc22a-3 vs. Ensembl Medaka
Match: slc22a4 (solute carrier family 22 member 4 [Source:NCBI gene;Acc:101163192])

HSP 1 Score: 179.104 bits (453), Expect = 1.514e-48
Identity = 140/505 (27.72%), Postives = 235/505 (46.53%), Query Frame = 3
Query:  315 LPCVFSMYSFQFTGVKPDSFHCALPPNVS-----RESMIPKERTGDKWEFSSCNQFQ-------SQDNSTIIP-------------CQNGYNYTMKYFTSSIVTEWDLVCDRAILNALATSSFFVMSFFGAIISCSIADRFGRKVVLITAFMCLNLCEFAQTYITSIYVLIVFKLLAGIFQQGCFISGFTMTIELFSLRNRSNACLADTFSWTXXXXXXXXXXXX-XRDWRNYFFWTSITMLPFCLVFYHLPESIRWMMAKDQTKNAQILLKTATLYSNPPLPEKTFENYDKYKRKQESEKLPHYNVLHIFRETLLLRYQLINSFVWFTTAMTYYGVQVKVVEI-GNPFLNFFLSSLVEIPANILCFPIANKYGRKITIGLTNFLVGFSLFMGYILWKYLDSPWPAIIVFLVGKMLNTGIFNLIFMHVSEFFPTTLRTTAVGMSSSCARIGASFGAMIFQITLYHDSIAFVIVIGCCLLTG-VLVFCLPETYRKKMPTSIEEIKQ 1745
            LP  F+     F G  P    C +P + S     R   IP E        SSC +         SQ N  IIP             CQ+G+ Y+ + + S+IVTEWDLVCD A    L TS  +V    G ++S  ++DRFGRK +L        +   AQ +  +  +      L G      +   F +  E+ S R R   C    F  +   ++ +  + + +RDWR+     + + L +  +++ L ES RW++++ + + A+ +LK A   +   +PE  F   +        E+    N++ I +   +L   +  + +W    ++YY + +    + GNP+LN FLS++ E+PA I+   +     R I    T FL G  +    ++   +D P  A+++ ++GK   T  F +++   SE FPT +R TA+G  S  ARI       I  +  Y+ ++ + IV+G   L+G V+ F LPET  K +P +I ++++
Sbjct:   35 LPNGFTGIYIIFVGDTPP-HECYIPDSDSISEAWRNETIPMETVDGAARRSSCRRLHLETVRNYSQRN--IIPNVDVNVSEIPWEACQDGWIYSREIYQSTIVTEWDLVCDNAYKGPLTTSIHYVGVLVGTVLSGQLSDRFGRKPMLFVMMALQTVAITAQIFSPNWEIFTFIFCLVGAGGYSNYTIAFVLGSEILSPRIRVVFCSLGVFMGSAVGYMAMPAVAYFLRDWRSLLISMAASGLIYIPLWWLLSESPRWLLSQGKVEEAEAILKDAAKMNKVQVPEPIFTQAEVEDSLAMKER--KINIMVIVKSCNILSITMACASLWMIITISYYALLLNTSNLNGNPYLNCFLSAVTEVPAYIIALLLLRYCSRHICQSSTLFLGGVMILCVRLI--PIDLPAVAVLLEMLGKFGVTAAFCVVYSVTSELFPTVIRNTAMGCCSMAARIATILSPFIIYLGKYYKALPY-IVMGVLALSGAVITFILPETRGKVLPETIPQMQR 531          
BLAST of slc22a-3 vs. Planmine SMEST
Match: SMESG000031472.1 (SMESG000031472.1)

HSP 1 Score: 1027.31 bits (2655), Expect = 0.000e+0
Identity = 513/517 (99.23%), Postives = 514/517 (99.42%), Query Frame = 3
Query:  228 MDPEKCLDELGGKNIWILKWFLLISFMKSLPCVFSMYSFQFTGVKPDSFHCALPPNVSRESMIPKERTGDKWEFSSCNQFQSQDNSTIIPCQNGYNYTMKYFTSSIVTEWDLVCDRAILNALATSSFFVMSFFGAIISCSIADRFGRKVVLITAFMCLNLCEFAQTYITSIYVLIVFKLLAGIFQQGCFISGFTMTIELFSLRNRSNACLADTFSWTXXXXXXXXXXXXXRDWRNYFFWTSITMLPFCLVFYHLPESIRWMMAKDQTKNAQILLKTATLYSNPPLPEKTFENYDKYKRKQESEKLPHYNVLHIFRETLLLRYQLINSFVWFTTAMTYYGVQVKVVEIGNPFLNFFLSSLVEIPANILCFPIANKYGRKITIGLTNFLVGFSLFMGYILWKYLDSPWPAIIVFLVGKMLNTGIFNLIFMHVSEFFPTTLRTTAVGMSSSCARIGASFGAMIFQITLYHDSIAFVIVIGCCLLTGVLVFCLPETYRKKMPTSIEEIKQWVAHKPIISFH 1778
            MDPEKCLDELGGKN WILKWFLLISFMKSLPCVFSMYSFQFTGVKPDSFHCALPPNVSRESMIPKE TGDKW+FSSCNQFQSQDNSTIIPCQ GYNYTMKYFTSSIVTEWDLVCDRAILNALATSSFFVMSFFGAIISCSIADRFGRKVVLITAFMCLNLCEFAQTYITSIYVLIVFKLLAGIFQQGCFISGFTMTIELFSLRNRSNACLADTFSWTFSSFILIIYIYFIRDWRNYFFWTSITMLPFCLVFYHLPESIRWMMAKDQTKNAQILLKTATLYSNPPLPEKTFENYDKYKRKQESEKLPHYNVLHIFRETLLLRYQLINSFVWFTTAMTYYGVQVKVVEIGNPFLNFFLSSLVEIPANILCFPIANKYGRKITIGLTNFLVGFSLFMGYILWKYLDSPWPAIIVFLVGKMLNTGIFNLIFMHVSEFFPTTLRTTAVGMSSSCARIGASFGAMIFQITLYHDSIAFVIVIGCCLLTGVLVFCLPETYRKKMPTSIEEIKQWVAHKPIISFH
Sbjct:    1 MDPEKCLDELGGKNKWILKWFLLISFMKSLPCVFSMYSFQFTGVKPDSFHCALPPNVSRESMIPKEWTGDKWKFSSCNQFQSQDNSTIIPCQKGYNYTMKYFTSSIVTEWDLVCDRAILNALATSSFFVMSFFGAIISCSIADRFGRKVVLITAFMCLNLCEFAQTYITSIYVLIVFKLLAGIFQQGCFISGFTMTIELFSLRNRSNACLADTFSWTFSSFILIIYIYFIRDWRNYFFWTSITMLPFCLVFYHLPESIRWMMAKDQTKNAQILLKTATLYSNPPLPEKTFENYDKYKRKQESEKLPHYNVLHIFRETLLLRYQLINSFVWFTTAMTYYGVQVKVVEIGNPFLNFFLSSLVEIPANILCFPIANKYGRKITIGLTNFLVGFSLFMGYILWKYLDSPWPAIIVFLVGKMLNTGIFNLIFMHVSEFFPTTLRTTAVGMSSSCARIGASFGAMIFQITLYHDSIAFVIVIGCCLLTGVLVFCLPETYRKKMPTSIEEIKQWVAHKPIISFH 517          
BLAST of slc22a-3 vs. Planmine SMEST
Match: SMESG000040243.1 (SMESG000040243.1)

HSP 1 Score: 142.51 bits (358), Expect = 8.241e-36
Identity = 131/523 (25.05%), Postives = 244/523 (46.65%), Query Frame = 3
Query:  273 WILKWFLLISFMKSLPCVFSMYSFQFTGVKPDS---FHCALPPNVSRESMIPK-----ERTGDKWEFSSC--------------------NQFQSQDNSTIIPCQNGYNYTMKYFTSSIVTEWDLVCDRAILNALATSSFFVMSFFGAIISCSIADRFGR-KVVLITAFMCLNLCEFAQTYITSIYVLIV-FKLLAGIFQQGCFISGFTMTIELFSLRNRSNACLADTFSWTXXXXXXXXXXXXXRDWRNYFFWTSITMLPFCLVFYHLPESIRWMMAKDQTKNAQILL----KTATLYSNPPLPEKTFENYDKYKRKQESEKLPHYNVLHIFRETLLLRYQLINSFVWFTTAMTYYGVQVKVVEI-GNPFLNFFLSSLVEIPANILCFPIANKYGRKITIGLTNFLVGFSLFMGYILWKYLDSPWPAIIVFLVGKMLNTGIFNLIFMHVSEFFPTTLRTTAVGMSSSCARIGASFGAMIFQITLYHDSIAFVIVIGCCLLTGVLVFCLPETYRKKMPTSIEE 1736
            ++L W  L++   S+  VF M   +F   KPD+   +   L  N +  S I       +++ D ++ S C                    ++   Q+ +    C NG+ Y+ + + S+   E+DLVCD   + +   + FF    FGA+I   ++D  GR +  LI   +  NL      Y +   ++I  F LL G  Q G  ++ F +  EL     R          +T +  ++ +  + +++WR    ++ +  + F   F+ + ES RW+++K ++K A I++    KT  +  +  L  +  ++++  + K ++EK   ++V  + +   +L   L   F W   A+ YYG+   V  + G+ +LNF L  LVEIPA +L     ++ GR+  + ++ +  G +  +   + KY ++   A I  ++GK+  T  + +++ + SE FPTT+R  A+G+SS  ARIG +    I  +  Y   +  +I      + G L F +PET  K +  +  +
Sbjct:   22 FLLCWPFLMAGFLSVDVVFLMAVPEFV-CKPDNVTMYKLQLLSNTTSVSKIADILILLQKSMDNYKTSRCYSWNTSMIMNLTSINLIANRSRLDFQNVTLDSKCSNGFIYSTQSYGSTAPNEYDLVCDSDYIRSNLKTIFFAGRIFGAVIFGQLSDIIGRLRTFLIV--VVFNLIAGLGLYFSINPIMIGGFLLLQGFSQVGYTLTTFVLGCELVGTSKRKWTGTVLQLFYTAAFILIPLCYWGMQNWRYLALFSGLPSIFFLSYFFIVYESPRWLLSKGRSKEALIIIEKVGKTNHIKLSENLKTEILKHHESEEYKNDTEK--KHSVFDLIKSKSMLLLSLNVWFNWIVNALIYYGIIYNVENLAGSLYLNFILLGLVEIPAYVLNLLFLDRIGRRNLLIISLWGTGVACLLSGCVPKY-NTVIIATIA-MIGKLTVTMSYGVVYFYTSELFPTTVRNAAMGVSSMSARIGGTMATPILLLDHYFSPLPMIIFAVLSAVAGGLTFKMPETKGKPLDQNFHK 537          
BLAST of slc22a-3 vs. Planmine SMEST
Match: SMESG000040243.1 (SMESG000040243.1)

HSP 1 Score: 140.969 bits (354), Expect = 1.764e-35
Identity = 112/420 (26.67%), Postives = 207/420 (49.29%), Query Frame = 3
Query:  498 CQNGYNYTMKYFTSSIVTEWDLVCDRAILNALATSSFFVMSFFGAIISCSIADRFGR-KVVLITAFMCLNLCEFAQTYITSIYVLIV-FKLLAGIFQQGCFISGFTMTIELFSLRNRSNACLADTFSWTXXXXXXXXXXXXXRDWRNYFFWTSITMLPFCLVFYHLPESIRWMMAKDQTKNAQILL----KTATLYSNPPLPEKTFENYDKYKRKQESEKLPHYNVLHIFRETLLLRYQLINSFVWFTTAMTYYGVQVKVVEI-GNPFLNFFLSSLVEIPANILCFPIANKYGRKITIGLTNFLVGFSLFMGYILWKYLDSPWPAIIVFLVGKMLNTGIFNLIFMHVSEFFPTTLRTTAVGMSSSCARIGASFGAMIFQITLYHDSIAFVIVIGCCLLTGVLVFCLPETYRKKMPTSIEE 1736
            C NG+ Y+ + + S+   E+DLVCD   + +   + FF    FGA+I   ++D  GR +  LI   +  NL      Y +   ++I  F LL G  Q G  ++ F +  EL     R          +T +  ++ +  + +++WR    ++ +  + F   F+ + ES RW+++K ++K A I++    KT  +  +  L  +  ++++  + K ++EK   ++V  + +   +L   L   F W   A+ YYG+   V  + G+ +LNF L  LVEIPA +L     ++ GR+  + ++ +  G +  +   + KY ++   A I  ++GK+  T  + +++ + SE FPTT+R  A+G+SS  ARIG +    I  +  Y   +  +I      + G L F +PET  K +  +  +
Sbjct:   83 CSNGFIYSTQSYGSTAPNEYDLVCDSDYIRSNLKTIFFAGRIFGAVIFGQLSDIIGRLRTFLIV--VVFNLIAGLGLYFSINPIMIGGFLLLQGFSQVGYTLTTFVLGCELVGTSKRKWTGTVLQLFYTAAFILIPLCYWGMQNWRYLALFSGLPSIFFLSYFFIVYESPRWLLSKGRSKEALIIIEKVGKTNHIKLSENLKTEILKHHESEEYKNDTEK--KHSVFDLIKSKSMLLLSLNVWFNWIVNALIYYGIIYNVENLAGSLYLNFILLGLVEIPAYVLNLLFLDRIGRRNLLIISLWGTGVACLLSGCVPKY-NTVIIATIA-MIGKLTVTMSYGVVYFYTSELFPTTVRNAAMGVSSMSARIGGTMATPILLLDHYFSPLPMIIFAVLSAVAGGLTFKMPETKGKPLDQNFHK 496          
BLAST of slc22a-3 vs. Planmine SMEST
Match: SMESG000040243.1 (SMESG000040243.1)

HSP 1 Score: 140.584 bits (353), Expect = 2.132e-35
Identity = 112/420 (26.67%), Postives = 207/420 (49.29%), Query Frame = 3
Query:  498 CQNGYNYTMKYFTSSIVTEWDLVCDRAILNALATSSFFVMSFFGAIISCSIADRFGR-KVVLITAFMCLNLCEFAQTYITSIYVLIV-FKLLAGIFQQGCFISGFTMTIELFSLRNRSNACLADTFSWTXXXXXXXXXXXXXRDWRNYFFWTSITMLPFCLVFYHLPESIRWMMAKDQTKNAQILL----KTATLYSNPPLPEKTFENYDKYKRKQESEKLPHYNVLHIFRETLLLRYQLINSFVWFTTAMTYYGVQVKVVEI-GNPFLNFFLSSLVEIPANILCFPIANKYGRKITIGLTNFLVGFSLFMGYILWKYLDSPWPAIIVFLVGKMLNTGIFNLIFMHVSEFFPTTLRTTAVGMSSSCARIGASFGAMIFQITLYHDSIAFVIVIGCCLLTGVLVFCLPETYRKKMPTSIEE 1736
            C NG+ Y+ + + S+   E+DLVCD   + +   + FF    FGA+I   ++D  GR +  LI   +  NL      Y +   ++I  F LL G  Q G  ++ F +  EL     R          +T +  ++ +  + +++WR    ++ +  + F   F+ + ES RW+++K ++K A I++    KT  +  +  L  +  ++++  + K ++EK   ++V  + +   +L   L   F W   A+ YYG+   V  + G+ +LNF L  LVEIPA +L     ++ GR+  + ++ +  G +  +   + KY ++   A I  ++GK+  T  + +++ + SE FPTT+R  A+G+SS  ARIG +    I  +  Y   +  +I      + G L F +PET  K +  +  +
Sbjct:   95 CSNGFIYSTQSYGSTAPNEYDLVCDSDYIRSNLKTIFFAGRIFGAVIFGQLSDIIGRLRTFLIV--VVFNLIAGLGLYFSINPIMIGGFLLLQGFSQVGYTLTTFVLGCELVGTSKRKWTGTVLQLFYTAAFILIPLCYWGMQNWRYLALFSGLPSIFFLSYFFIVYESPRWLLSKGRSKEALIIIEKVGKTNHIKLSENLKTEILKHHESEEYKNDTEK--KHSVFDLIKSKSMLLLSLNVWFNWIVNALIYYGIIYNVENLAGSLYLNFILLGLVEIPAYVLNLLFLDRIGRRNLLIISLWGTGVACLLSGCVPKY-NTVIIATIA-MIGKLTVTMSYGVVYFYTSELFPTTVRNAAMGVSSMSARIGGTMATPILLLDHYFSPLPMIIFAVLSAVAGGLTFKMPETKGKPLDQNFHK 508          
BLAST of slc22a-3 vs. Planmine SMEST
Match: SMESG000004219.1 (SMESG000004219.1)

HSP 1 Score: 99.7525 bits (247), Expect = 9.626e-22
Identity = 132/530 (24.91%), Postives = 242/530 (45.66%), Query Frame = 3
Query:  228 MDPEKCLDELGGKNIWILKWFLLISFMKSLPCVFSMYSFQFTGVK----PDSFHCALPPNVS---RES--MIPKERTGDKWEFSSCNQFQSQDNSTIIPCQNGYNYTMKYFTSSIVTEWDLVCDRAILNALATSSFFVMSFFGAIISCSIADRFGRKVVLITAFMCLNLCEFAQTYITSIYVLIVFKLLAGIFQQGCFISGFTMTIELFSLRNRSNACLADTFSWTXXX---XXXXXXXXXXRDWRNYFFWTSITMLPFCLVFYHLPESIRWMMAKDQTKNAQILLKTATLYSNPPLPEKTFENYDKYKRKQESEKLPHYNVLHIFRETLLLRYQLINSFVWFTTAMTYYGVQVKVV-EIGNPFLNFFLSSLVEIPANILCFPIANKYGRKITI-GLTNFLVGFSLFMGYILWKYLDS---PWPAIIVFLVGKMLNTGIFNLIFMHVSEFFPTTLRTTAVGMSSSCARIGASFGAMIFQITL-YHDSIAFVIVIGCCLLTGVLVFC-LPETYRKKMPTSIEEIKQWVAHK 1760
            MD E    ++GG  +     F  ISFM +L      Y  +F G+        F C L  N+S   R S  +I K++           Q++   N +   C + + +  ++  ++++ E +LVCDRA    L  ++FFV   F    S  ++D  G++++LI +     +    Q     I+  +V   ++G+ +       +T  IE+  +   S+  LA T  W   S    ++ ++ Y  R WR  +  + IT + + L F+ +PE+ RW+M   +   A    KT +  +         E ++K+K  Q+      +N+L    +T++ R+ ++N F  +  +  Y G    +     N F+  F+  L+E+P   L   +ANK GRK ++  L+   +   + M +I    L S   PW  + + +  K+  +  + +  +  +E  PTT R TA+ +      +G+ F  MI  + L ++ +  F++     L+T VLVF  +PET+   +P +IE+    + HK
Sbjct:    1 MDYEHLNAKIGGCGL-----FHYISFM-TLSITTFKYVVEFQGLTFALYEPKFSC-LVKNISSTIRNSTNLISKDQC----------QYRLSVNDSWNKC-DQWTFEKRFMRNTLINELNLVCDRAFYRELIFTTFFVGCLFSFPFSI-LSDSIGKRLLLIVSIFLSTIITIGQMVSYQIWQQLVLSFVSGVCKSVYVSLAYTTLIEIIPV---SHIDLAATNFWNLYSFGYMLVALFAYIFRSWRQIYILSLITSIFYVLYFWFVPETPRWLMLNKRRNEA---FKTMSFIAKINKCTLNKEEFNKWKPIQQVTG-KFWNLLK--HKTMIYRFLILN-FAGWAFSFAYIGSATDLTFASENIFITTFVMGLIELPTGPLSGIMANKLGRKKSVSALSGLGIICLIIMPFIEADSLKSVWQPWLKVCLAMGAKLGFSSAWLIFDIITNELIPTTDRNTAMSLVYITVGLGSIFAPMIHSVLLQFYFAGPFLLYSLLLLITVVLVFAFIPETHHLPVPQTIEQAVSLLIHK 501          
The following BLAST results are available for this feature:
BLAST of slc22a-3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC22A72.372e-4725.93solute carrier family 22 member 7 [Source:HGNC Sym... [more]
SLC22A73.515e-4725.89solute carrier family 22 member 7 [Source:HGNC Sym... [more]
SLC22A71.544e-4525.79solute carrier family 22 member 7 [Source:HGNC Sym... [more]
SLC22A55.194e-4325.77solute carrier family 22 member 5 [Source:HGNC Sym... [more]
SLC22A167.927e-4024.75solute carrier family 22 member 16 [Source:HGNC Sy... [more]
back to top
BLAST of slc22a-3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
oct-11.127e-4425.42Organic cation transporter 1 [Source:UniProtKB/Sw... [more]
oct-11.127e-4425.42Organic cation transporter 1 [Source:UniProtKB/Sw... [more]
oct-11.586e-4425.42Organic cation transporter 1 [Source:UniProtKB/Sw... [more]
B0252.34.624e-3225.44Putative transporter B0252.3 [Source:UniProtKB/Sw... [more]
B0252.34.957e-3225.44Putative transporter B0252.3 [Source:UniProtKB/Sw... [more]
back to top
BLAST of slc22a-3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Balat3.253e-4423.22gene:FBgn0033778 transcript:FBtr0087815[more]
CG61262.613e-3927.25gene:FBgn0038407 transcript:FBtr0083278[more]
Orct3.449e-3925.40gene:FBgn0019952 transcript:FBtr0334870[more]
Orct3.449e-3925.40gene:FBgn0019952 transcript:FBtr0084599[more]
CG46302.749e-3423.96gene:FBgn0033809 transcript:FBtr0087765[more]
back to top
BLAST of slc22a-3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc22a7a1.927e-5026.10solute carrier family 22 member 7a [Source:ZFIN;Ac... [more]
slc22a7b.17.836e-4926.06solute carrier family 22 member 7b, tandem duplica... [more]
slc22a7b.31.335e-4726.64solute carrier family 22 member 7b, tandem duplica... [more]
slc22a7b.31.810e-4726.89solute carrier family 22 member 7b, tandem duplica... [more]
BX005258.22.926e-4726.74solute carrier family 22 member 7b, tandem duplica... [more]
back to top
BLAST of slc22a-3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc22a42.134e-4926.88solute carrier family 22 (organic cation/zwitterio... [more]
slc22a42.328e-4926.24solute carrier family 22 (organic cation/zwitterio... [more]
ccdc301.163e-4828.63coiled-coil domain containing 30 [Source:Xenbase;A... [more]
slc22a42.228e-4826.55solute carrier family 22 (organic cation/zwitterio... [more]
emc29.922e-4625.97ER membrane protein complex subunit 2 [Source:Xenb... [more]
back to top
BLAST of slc22a-3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Slc22a77.111e-4825.14solute carrier family 22 (organic anion transporte... [more]
Slc22a81.227e-4228.81solute carrier family 22 (organic anion transporte... [more]
Slc22a81.227e-4228.81solute carrier family 22 (organic anion transporte... [more]
Slc22a211.906e-4225.54solute carrier family 22 (organic cation transport... [more]
Slc22a55.394e-4126.35solute carrier family 22 (organic cation transport... [more]
back to top
BLAST of slc22a-3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q66KG0|S22AG_XENLA1.742e-4927.49Solute carrier family 22 member 16 OS=Xenopus laev... [more]
sp|A6QLW8|S22A7_BOVIN2.091e-4826.87Solute carrier family 22 member 7 OS=Bos taurus OX... [more]
sp|Q5RLM2|S22A7_RAT1.264e-4726.07Solute carrier family 22 member 7 OS=Rattus norveg... [more]
sp|Q91WU2|S22A7_MOUSE2.793e-4725.14Solute carrier family 22 member 7 OS=Mus musculus ... [more]
sp|Q3YAW7|S22A7_RABIT3.704e-4726.92Solute carrier family 22 member 7 OS=Oryctolagus c... [more]
back to top
BLAST of slc22a-3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YJ390.000e+0100.00Slc22a-3 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
C3ZR166.387e-5827.79MFS domain-containing protein OS=Branchiostoma flo... [more]
R7UIT71.485e-5731.10MFS domain-containing protein (Fragment) OS=Capite... [more]
A0A3P8XC611.609e-5627.91MFS domain-containing protein OS=Esox lucius OX=80... [more]
A0A093JNL33.658e-5527.95Solute carrier family 22 member 7 (Fragment) OS=St... [more]
back to top
BLAST of slc22a-3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000010878.25.293e-5326.50pep primary_assembly:Astyanax_mexicanus-2.0:14:292... [more]
ENSAMXT00000043421.12.662e-5025.14pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
slc22a7b.25.378e-4826.42solute carrier family 22 member 7b, tandem duplica... [more]
slc22a51.253e-4726.64solute carrier family 22 member 4-like [Source:NCB... [more]
slc22a7a2.156e-4725.61solute carrier family 22 member 7a [Source:ZFIN;Ac... [more]
back to top
BLAST of slc22a-3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
oct21.123e-3122.07organic cation transporter 2 [Source:ZFIN;Acc:ZDB-... [more]
SLC22A76.517e-2223.74solute carrier family 22 member 7 [Source:HGNC Sym... [more]
si:dkey-190l8.26.431e-2123.79si:dkey-190l8.2 [Source:ZFIN;Acc:ZDB-GENE-030131-9... [more]
ENSPMAT00000007122.11.901e-1725.62pep scaffold:Pmarinus_7.0:GL476962:153150:164773:-... [more]
slc22a6l1.067e-1622.93solute carrier family 22 member 6, like [Source:NC... [more]
back to top
BLAST of slc22a-3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
CIN101.835e-624.30Putative transporter; member of the sugar porter f... [more]
back to top
BLAST of slc22a-3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO473163.258e-4929.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO278295.883e-4927.70Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO365975.567e-4829.52Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO460871.025e-4227.85Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO465811.260e-4228.25Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of slc22a-3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc22a7a3.970e-5128.08solute carrier family 22 member 7 [Source:NCBI gen... [more]
slc22a7b.36.598e-5026.92solute carrier family 22 member 7-like [Source:NCB... [more]
slc22a49.107e-4927.72solute carrier family 22 member 4 [Source:NCBI gen... [more]
si:dkey-166k12.11.472e-4828.51solute carrier family 22 member 13 [Source:NCBI ge... [more]
slc22a41.514e-4827.72solute carrier family 22 member 4 [Source:NCBI gen... [more]
back to top
BLAST of slc22a-3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000031472.10.000e+099.23SMESG000031472.1[more]
SMESG000040243.18.241e-3625.05SMESG000040243.1[more]
SMESG000040243.11.764e-3526.67SMESG000040243.1[more]
SMESG000040243.12.132e-3526.67SMESG000040243.1[more]
SMESG000004219.19.626e-2224.91SMESG000004219.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30028480
GenBankAKN21551.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30028480 ID=SMED30028480|Name=slc22a-3|organism=Schmidtea mediterranea sexual|type=transcript|length=1868bp
ATTCTGAGATGATAAAACCAATTTTAAAGAGAGAACGAAAATAGAAAAGA
GAGATAATTGAAAATCAAATTAAATTGACATCATTAATTGAAAAATATTC
CAAATCTGAATTTTCTACGTGAAATTCTGTATTAATTATTTAAATTAGTC
AATCATGAACTTTAATCGCATTGACAGTGTTATGTATCGAATAATACTAT
GTAAGAATAAACAGTTCTAGACTTGAAATGGACCCAGAAAAATGCCTTGA
CGAGCTCGGAGGGAAGAACATATGGATTCTGAAGTGGTTTCTGTTGATTT
CCTTTATGAAATCACTGCCATGTGTGTTCTCAATGTATTCGTTTCAATTT
ACCGGCGTCAAACCAGACAGCTTTCATTGTGCACTCCCTCCGAATGTGTC
AAGGGAAAGCATGATACCCAAAGAACGGACTGGCGACAAGTGGGAATTTA
GTTCATGCAATCAGTTCCAGAGTCAAGATAACAGTACTATAATTCCTTGT
CAAAATGGATACAATTATACAATGAAGTATTTCACTTCCTCTATTGTCAC
TGAATGGGATCTAGTCTGTGATCGGGCGATTTTGAACGCATTGGCAACTA
GCTCGTTTTTTGTTATGTCATTTTTCGGTGCAATTATTAGCTGTAGTATT
GCTGATAGATTTGGACGGAAAGTTGTTTTGATTACTGCGTTTATGTGCCT
AAACCTCTGTGAGTTTGCCCAAACTTATATCACTAGTATATATGTTTTAA
TCGTTTTTAAATTATTGGCCGGGATCTTTCAACAGGGTTGTTTTATATCT
GGATTTACTATGACCATCGAATTGTTTTCTTTGAGAAACCGCAGCAATGC
CTGCCTGGCTGATACGTTTTCTTGGACGTTTTCTAGCTTCATTTTAATCA
TATATATCTATTTTATAAGAGATTGGAGAAATTATTTTTTTTGGACTTCA
ATAACGATGTTGCCGTTTTGTTTAGTATTTTATCATTTACCAGAAAGCAT
TCGTTGGATGATGGCAAAAGACCAAACAAAAAATGCTCAAATATTACTTA
AAACTGCTACTTTATACTCAAATCCTCCTCTGCCTGAGAAAACATTTGAA
AACTATGACAAATACAAAAGAAAGCAGGAATCGGAAAAGTTGCCGCATTA
TAATGTTCTACACATTTTCCGTGAAACTCTCTTGCTGAGATATCAGTTGA
TTAATTCGTTTGTTTGGTTTACCACGGCAATGACATATTACGGGGTGCAG
GTAAAAGTCGTTGAAATTGGAAACCCTTTTCTCAATTTCTTCCTATCGTC
TTTGGTAGAAATTCCAGCAAACATATTATGTTTTCCAATCGCTAACAAAT
ACGGTCGCAAAATTACAATCGGATTGACAAATTTCTTAGTTGGATTTTCC
CTCTTTATGGGATATATATTGTGGAAGTACTTGGATAGTCCATGGCCGGC
TATAATTGTATTTTTAGTCGGGAAGATGCTAAACACGGGAATATTTAATT
TGATTTTTATGCATGTCAGTGAGTTTTTCCCGACAACTCTACGAACAACA
GCAGTTGGAATGTCAAGCTCCTGCGCTAGAATAGGAGCTTCATTTGGGGC
AATGATATTTCAAATTACACTTTATCACGATTCGATTGCATTTGTTATTG
TAATTGGATGCTGTTTGTTGACAGGGGTTCTGGTGTTTTGTCTCCCTGAA
ACTTACCGAAAAAAGATGCCGACTTCTATTGAAGAAATTAAACAATGGGT
AGCTCACAAGCCTATTATAAGTTTTCATTAATTTTACAAAAACAATTTTT
AACTCTTGATTTAATACATTTTATATGATGCACTTCAAAACTTGTACTAG
AACACATTTCAATTGTAG
back to top

protein sequence of SMED30028480-orf-1

>SMED30028480-orf-1 ID=SMED30028480-orf-1|Name=SMED30028480-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=518bp
MDPEKCLDELGGKNIWILKWFLLISFMKSLPCVFSMYSFQFTGVKPDSFH
CALPPNVSRESMIPKERTGDKWEFSSCNQFQSQDNSTIIPCQNGYNYTMK
YFTSSIVTEWDLVCDRAILNALATSSFFVMSFFGAIISCSIADRFGRKVV
LITAFMCLNLCEFAQTYITSIYVLIVFKLLAGIFQQGCFISGFTMTIELF
SLRNRSNACLADTFSWTFSSFILIIYIYFIRDWRNYFFWTSITMLPFCLV
FYHLPESIRWMMAKDQTKNAQILLKTATLYSNPPLPEKTFENYDKYKRKQ
ESEKLPHYNVLHIFRETLLLRYQLINSFVWFTTAMTYYGVQVKVVEIGNP
FLNFFLSSLVEIPANILCFPIANKYGRKITIGLTNFLVGFSLFMGYILWK
YLDSPWPAIIVFLVGKMLNTGIFNLIFMHVSEFFPTTLRTTAVGMSSSCA
RIGASFGAMIFQITLYHDSIAFVIVIGCCLLTGVLVFCLPETYRKKMPTS
IEEIKQWVAHKPIISFH*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000087proximal tubule
PLANA:0000418head
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036259MFS_trans_sf
IPR005828MFS_sugar_transport-like
IPR020846MFS_dom
IPR001633EAL_dom
Vocabulary: molecular function
TermDefinition
GO:0022857transmembrane transporter activity
Vocabulary: biological process
TermDefinition
GO:0055085transmembrane transport
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:1.20.1250.20coord: 92..506
e-value: 8.6E-57
score: 194.9
NoneNo IPR availablePANTHERPTHR24064FAMILY NOT NAMEDcoord: 52..505
NoneNo IPR availablePANTHERPTHR24064:SF411coord: 52..505
NoneNo IPR availableCDDcd17317MFS_SLC22coord: 94..490
e-value: 5.24419E-59
score: 196.262
NoneNo IPR availableTMHMMTMhelixcoord: 443..465
NoneNo IPR availableTMHMMTMhelixcoord: 182..201
NoneNo IPR availableTMHMMTMhelixcoord: 20..42
NoneNo IPR availableTMHMMTMhelixcoord: 350..372
NoneNo IPR availableTMHMMTMhelixcoord: 155..177
NoneNo IPR availableTMHMMTMhelixcoord: 318..340
NoneNo IPR availableTMHMMTMhelixcoord: 235..254
NoneNo IPR availableTMHMMTMhelixcoord: 208..230
NoneNo IPR availableTMHMMTMhelixcoord: 120..142
NoneNo IPR availableTMHMMTMhelixcoord: 408..430
NoneNo IPR availableTMHMMTMhelixcoord: 379..398
NoneNo IPR availableTMHMMTMhelixcoord: 470..489
IPR005828Major facilitator, sugar transporter-likePFAMPF00083Sugar_trcoord: 116..495
e-value: 1.2E-24
score: 87.1
IPR020846Major facilitator superfamily domainPROSITEPS50850MFScoord: 71..494
score: 18.715
IPR036259MFS transporter superfamilySUPERFAMILYSSF103473MFS general substrate transportercoord: 121..497