Eukaryotic translation initiation factor 4E

Overview
NameEukaryotic translation initiation factor 4E
Smed IDSMED30028475
Length (bp)835
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Eukaryotic translation initiation factor 4E (SMED30028475) t-SNE clustered cells

Violin plots show distribution of expression levels for Eukaryotic translation initiation factor 4E (SMED30028475) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Eukaryotic translation initiation factor 4E (SMED30028475) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Eukaryotic translation initiation factor 4E (SMED30028475) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30028475

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
testis primordiumSMED30028475SMESG000074929.1 Contig7466_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Eukaryotic translation initiation factor 4E vs. Ensembl Human
Match: EIF4E (eukaryotic translation initiation factor 4E [Source:HGNC Symbol;Acc:HGNC:3287])

HSP 1 Score: 140.969 bits (354), Expect = 4.487e-40
Identity = 70/176 (39.77%), Postives = 96/176 (54.55%), Query Frame = 1
Query:  247 LQNEWSLWFCKRDSSRDWTESLHLIEHFNTVEDFWRLIDHITPPFALPTGCDYYLFRRDIKPMWEHNTNRCGGSWQVTFKNSTRSLLLNRFWENLTMLLVGEGCGSDSEIVCGGVVNVRKMTDRLCLWVSNYEDKQQIMRIGRHIKRILEI--DFPIEFYPHIDVVKNALYSGRGR 768
            LQN W+LWF K D S+ W  +L LI  F+TVEDFW L +HI     L  GCDY LF+  I+PMWE   N+ GG W +T     R   L+RFW    + L+GE     S+ VCG VVNVR   D++ +W +  E+++ +  IGR  K  L +     I +  H D    +  + + R
Sbjct:   67 LQNRWALWFFKNDKSKTWQANLRLISKFDTVEDFWALYNHIQLSSNLMPGCDYSLFKDGIEPMWEDEKNKRGGRWLITLNKQQRRSDLDRFWLETLLCLIGESFDDYSDDVCGAVVNVRAKGDKIAIWTTECENREAVTHIGRVYKERLGLPPKIVIGYQSHADTATKSGSTTKNR 242          
BLAST of Eukaryotic translation initiation factor 4E vs. Ensembl Human
Match: EIF4E (eukaryotic translation initiation factor 4E [Source:HGNC Symbol;Acc:HGNC:3287])

HSP 1 Score: 139.813 bits (351), Expect = 4.585e-40
Identity = 70/176 (39.77%), Postives = 96/176 (54.55%), Query Frame = 1
Query:  247 LQNEWSLWFCKRDSSRDWTESLHLIEHFNTVEDFWRLIDHITPPFALPTGCDYYLFRRDIKPMWEHNTNRCGGSWQVTFKNSTRSLLLNRFWENLTMLLVGEGCGSDSEIVCGGVVNVRKMTDRLCLWVSNYEDKQQIMRIGRHIKRILEI--DFPIEFYPHIDVVKNALYSGRGR 768
            LQN W+LWF K D S+ W  +L LI  F+TVEDFW L +HI     L  GCDY LF+  I+PMWE   N+ GG W +T     R   L+RFW    + L+GE     S+ VCG VVNVR   D++ +W +  E+++ +  IGR  K  L +     I +  H D    +  + + R
Sbjct:   39 LQNRWALWFFKNDKSKTWQANLRLISKFDTVEDFWALYNHIQLSSNLMPGCDYSLFKDGIEPMWEDEKNKRGGRWLITLNKQQRRSDLDRFWLETLLCLIGESFDDYSDDVCGAVVNVRAKGDKIAIWTTECENREAVTHIGRVYKERLGLPPKIVIGYQSHADTATKSGSTTKNR 214          
BLAST of Eukaryotic translation initiation factor 4E vs. Ensembl Human
Match: EIF4E (eukaryotic translation initiation factor 4E [Source:HGNC Symbol;Acc:HGNC:3287])

HSP 1 Score: 140.198 bits (352), Expect = 7.745e-40
Identity = 70/176 (39.77%), Postives = 96/176 (54.55%), Query Frame = 1
Query:  247 LQNEWSLWFCKRDSSRDWTESLHLIEHFNTVEDFWRLIDHITPPFALPTGCDYYLFRRDIKPMWEHNTNRCGGSWQVTFKNSTRSLLLNRFWENLTMLLVGEGCGSDSEIVCGGVVNVRKMTDRLCLWVSNYEDKQQIMRIGRHIKRILEI--DFPIEFYPHIDVVKNALYSGRGR 768
            LQN W+LWF K D S+ W  +L LI  F+TVEDFW L +HI     L  GCDY LF+  I+PMWE   N+ GG W +T     R   L+RFW    + L+GE     S+ VCG VVNVR   D++ +W +  E+++ +  IGR  K  L +     I +  H D    +  + + R
Sbjct:   59 LQNRWALWFFKNDKSKTWQANLRLISKFDTVEDFWALYNHIQLSSNLMPGCDYSLFKDGIEPMWEDEKNKRGGRWLITLNKQQRRSDLDRFWLETLLCLIGESFDDYSDDVCGAVVNVRAKGDKIAIWTTECENREAVTHIGRVYKERLGLPPKIVIGYQSHADTATKSGSTTKNR 234          
BLAST of Eukaryotic translation initiation factor 4E vs. Ensembl Human
Match: EIF4E1B (eukaryotic translation initiation factor 4E family member 1B [Source:HGNC Symbol;Acc:HGNC:33179])

HSP 1 Score: 140.198 bits (352), Expect = 8.038e-40
Identity = 66/166 (39.76%), Postives = 92/166 (55.42%), Query Frame = 1
Query:  247 LQNEWSLWFCKRDSSRDWTESLHLIEHFNTVEDFWRLIDHITPPFALPTGCDYYLFRRDIKPMWEHNTNRCGGSWQVTFKNSTRSLLLNRFWENLTMLLVGEGCGSDSEIVCGGVVNVRKMTDRLCLWVSNYEDKQQIMRIGRHIKRILEIDFP--IEFYPHIDVV 738
            LQN W+LWF K D SR W ++LHL+   +TVEDFW L  HI     L +GCDY LF+  I+PMWE + N+ GG W V+     R + L+R W    + L+GE     S  VCG VVN+R   D++ +W    E++  ++ +GR  K  L +     I +  H D  
Sbjct:   64 LQNRWALWFFKNDRSRAWQDNLHLVTKVDTVEDFWALYSHIQLASKLSSGCDYALFKDGIQPMWEDSRNKRGGRWLVSLAKQQRHIELDRLWLETLLCLIGESFEEHSREVCGAVVNIRTKGDKIAVWTREAENQAGVLHVGRVYKERLGLSPKTIIGYQAHADTA 229          
BLAST of Eukaryotic translation initiation factor 4E vs. Ensembl Human
Match: EIF4E1B (eukaryotic translation initiation factor 4E family member 1B [Source:HGNC Symbol;Acc:HGNC:33179])

HSP 1 Score: 140.198 bits (352), Expect = 8.038e-40
Identity = 66/166 (39.76%), Postives = 92/166 (55.42%), Query Frame = 1
Query:  247 LQNEWSLWFCKRDSSRDWTESLHLIEHFNTVEDFWRLIDHITPPFALPTGCDYYLFRRDIKPMWEHNTNRCGGSWQVTFKNSTRSLLLNRFWENLTMLLVGEGCGSDSEIVCGGVVNVRKMTDRLCLWVSNYEDKQQIMRIGRHIKRILEIDFP--IEFYPHIDVV 738
            LQN W+LWF K D SR W ++LHL+   +TVEDFW L  HI     L +GCDY LF+  I+PMWE + N+ GG W V+     R + L+R W    + L+GE     S  VCG VVN+R   D++ +W    E++  ++ +GR  K  L +     I +  H D  
Sbjct:   64 LQNRWALWFFKNDRSRAWQDNLHLVTKVDTVEDFWALYSHIQLASKLSSGCDYALFKDGIQPMWEDSRNKRGGRWLVSLAKQQRHIELDRLWLETLLCLIGESFEEHSREVCGAVVNIRTKGDKIAVWTREAENQAGVLHVGRVYKERLGLSPKTIIGYQAHADTA 229          
BLAST of Eukaryotic translation initiation factor 4E vs. Ensembl Celegans
Match: ife-3 (Eukaryotic translation initiation factor 4E-3 [Source:UniProtKB/Swiss-Prot;Acc:O61955])

HSP 1 Score: 134.42 bits (337), Expect = 6.406e-38
Identity = 63/151 (41.72%), Postives = 88/151 (58.28%), Query Frame = 1
Query:  247 LQNEWSLWFCKRDSSRDWTESLHLIEHFNTVEDFWRLIDHITPPFALPTGCDYYLFRRDIKPMWEHNTNRCGGSWQVTFKNSTRSLLLNRFWENLTMLLVGEGCGSDSEIVCGGVVNVRKMTDRLCLWVSNYEDKQQIMRIGRHIKRILEI 699
            LQN W+LW+ K D +++W + L ++  F+TVEDFW L +HI     L  G DYYLF+  IKPMWE   N  GG W V      R+ LL+ +W  L M +VGE      + +CG VVNVR+  D++ LW  +       +RIG+ +K+ L I
Sbjct:   34 LQNRWALWYLKADRNKEWEDCLKMVSLFDTVEDFWSLYNHIQSAGGLNWGSDYYLFKEGIKPMWEDVNNVQGGRWLVVVDKQRRTQLLDHYWLELLMAIVGEQFDEYGDYICGAVVNVRQKGDKVSLWTRDATRDDVNLRIGQVLKQKLSI 184          
BLAST of Eukaryotic translation initiation factor 4E vs. Ensembl Celegans
Match: ife-3 (Eukaryotic translation initiation factor 4E-3 [Source:UniProtKB/Swiss-Prot;Acc:O61955])

HSP 1 Score: 134.42 bits (337), Expect = 6.406e-38
Identity = 63/151 (41.72%), Postives = 88/151 (58.28%), Query Frame = 1
Query:  247 LQNEWSLWFCKRDSSRDWTESLHLIEHFNTVEDFWRLIDHITPPFALPTGCDYYLFRRDIKPMWEHNTNRCGGSWQVTFKNSTRSLLLNRFWENLTMLLVGEGCGSDSEIVCGGVVNVRKMTDRLCLWVSNYEDKQQIMRIGRHIKRILEI 699
            LQN W+LW+ K D +++W + L ++  F+TVEDFW L +HI     L  G DYYLF+  IKPMWE   N  GG W V      R+ LL+ +W  L M +VGE      + +CG VVNVR+  D++ LW  +       +RIG+ +K+ L I
Sbjct:   34 LQNRWALWYLKADRNKEWEDCLKMVSLFDTVEDFWSLYNHIQSAGGLNWGSDYYLFKEGIKPMWEDVNNVQGGRWLVVVDKQRRTQLLDHYWLELLMAIVGEQFDEYGDYICGAVVNVRQKGDKVSLWTRDATRDDVNLRIGQVLKQKLSI 184          
BLAST of Eukaryotic translation initiation factor 4E vs. Ensembl Celegans
Match: ife-3 (Eukaryotic translation initiation factor 4E-3 [Source:UniProtKB/Swiss-Prot;Acc:O61955])

HSP 1 Score: 129.798 bits (325), Expect = 3.730e-36
Identity = 64/154 (41.56%), Postives = 89/154 (57.79%), Query Frame = 1
Query:  247 LQNEWSLWFCKRDSSRDWTESLHLIEHFNTVEDFWRLIDHITPPFALPTGCDYYLFRRDIKPMWEHNTNRCGGSWQVTF---KNSTRSLLLNRFWENLTMLLVGEGCGSDSEIVCGGVVNVRKMTDRLCLWVSNYEDKQQIMRIGRHIKRILEI 699
            LQN W+LW+ K D +++W + L ++  F+TVEDFW L +HI     L  G DYYLF+  IKPMWE   N  GG W V     K   R+ LL+ +W  L M +VGE      + +CG VVNVR+  D++ LW  +       +RIG+ +K+ L I
Sbjct:   34 LQNRWALWYLKADRNKEWEDCLKMVSLFDTVEDFWSLYNHIQSAGGLNWGSDYYLFKEGIKPMWEDVNNVQGGRWLVVVDKQKLQRRTQLLDHYWLELLMAIVGEQFDEYGDYICGAVVNVRQKGDKVSLWTRDATRDDVNLRIGQVLKQKLSI 187          
BLAST of Eukaryotic translation initiation factor 4E vs. Ensembl Celegans
Match: ife-3 (Eukaryotic translation initiation factor 4E-3 [Source:UniProtKB/Swiss-Prot;Acc:O61955])

HSP 1 Score: 129.798 bits (325), Expect = 3.730e-36
Identity = 64/154 (41.56%), Postives = 89/154 (57.79%), Query Frame = 1
Query:  247 LQNEWSLWFCKRDSSRDWTESLHLIEHFNTVEDFWRLIDHITPPFALPTGCDYYLFRRDIKPMWEHNTNRCGGSWQVTF---KNSTRSLLLNRFWENLTMLLVGEGCGSDSEIVCGGVVNVRKMTDRLCLWVSNYEDKQQIMRIGRHIKRILEI 699
            LQN W+LW+ K D +++W + L ++  F+TVEDFW L +HI     L  G DYYLF+  IKPMWE   N  GG W V     K   R+ LL+ +W  L M +VGE      + +CG VVNVR+  D++ LW  +       +RIG+ +K+ L I
Sbjct:   34 LQNRWALWYLKADRNKEWEDCLKMVSLFDTVEDFWSLYNHIQSAGGLNWGSDYYLFKEGIKPMWEDVNNVQGGRWLVVVDKQKLQRRTQLLDHYWLELLMAIVGEQFDEYGDYICGAVVNVRQKGDKVSLWTRDATRDDVNLRIGQVLKQKLSI 187          
BLAST of Eukaryotic translation initiation factor 4E vs. Ensembl Celegans
Match: ife-3 (Eukaryotic translation initiation factor 4E-3 [Source:UniProtKB/Swiss-Prot;Acc:O61955])

HSP 1 Score: 129.028 bits (323), Expect = 5.868e-36
Identity = 63/153 (41.18%), Postives = 88/153 (57.52%), Query Frame = 1
Query:  247 LQNEWSLWFCKRDSSRDWTESLHLIEHFNTVEDFWRLIDHITPPFALPTGCDYYLFRRDIKPMWEHNTNRCGGSWQVTFKN--STRSLLLNRFWENLTMLLVGEGCGSDSEIVCGGVVNVRKMTDRLCLWVSNYEDKQQIMRIGRHIKRILEI 699
            LQN W+LW+ K D +++W + L ++  F+TVEDFW L +HI     L  G DYYLF+  IKPMWE   N  GG W V        R+ LL+ +W  L M +VGE      + +CG VVNVR+  D++ LW  +       +RIG+ +K+ L I
Sbjct:   34 LQNRWALWYLKADRNKEWEDCLKMVSLFDTVEDFWSLYNHIQSAGGLNWGSDYYLFKEGIKPMWEDVNNVQGGRWLVVVDKQLQRRTQLLDHYWLELLMAIVGEQFDEYGDYICGAVVNVRQKGDKVSLWTRDATRDDVNLRIGQVLKQKLSI 186          
BLAST of Eukaryotic translation initiation factor 4E vs. Ensembl Fly
Match: eIF4E7 (gene:FBgn0040368 transcript:FBtr0070252)

HSP 1 Score: 135.191 bits (339), Expect = 1.785e-36
Identity = 61/164 (37.20%), Postives = 100/164 (60.98%), Query Frame = 1
Query:  247 LQNEWSLWFCKRDSSRDWTESLHLIEHFNTVEDFWRLIDHITPPFALPTGCDYYLFRRDIKPMWEHNTNRCGGSWQVTFKNSTRSLLLNRFWENLTMLLVGEGCGSDSEIVCGGVVNVRKMTDRLCLWVSNYEDKQQIMRIGRHIKRILEID--FPIEFYPHID 732
            L N W+LW+ + D ++ W E LH +  F+TVE FW LI HI PP  L  G DY LF++ I+PMWE   N  GG W +    S + + L+ FW +  + L+GE C   S+ +CG VVN+R  ++++ +W ++  ++  ++ IGR ++++L +D  + +E+  H D
Sbjct:  253 LNNCWTLWYLENDRNKSWEEMLHKVTSFDTVEKFWSLITHIKPPSELMLGSDYSLFKKGIRPMWEDEANVNGGRWVINLTKSAK-MALDSFWMDAMLCLIGEAC-KHSDDLCGVVVNIRGKSNKISIWNADGGNQTTVLEIGRILRKVLRMDNIYVLEYQLHKD 414          
BLAST of Eukaryotic translation initiation factor 4E vs. Ensembl Fly
Match: eIF4E1 (gene:FBgn0015218 transcript:FBtr0076488)

HSP 1 Score: 124.02 bits (310), Expect = 7.376e-34
Identity = 55/166 (33.13%), Postives = 100/166 (60.24%), Query Frame = 1
Query:  247 LQNEWSLWFCKRDSSRDWTESLHLIEHFNTVEDFWRLIDHITPPFALPTGCDYYLFRRDIKPMWEHNTNRCGGSWQVTFKNSTRSLLLNRFWENLTMLLVGEGCGSDSEIVCGGVVNVRKMTDRLCLWVSNYEDKQQIMRIGRHIKRILEI--DFPIEFYPHIDVV 738
            L N W+LW+ + D S+ W +  + I  F+TVEDFW L +HI PP  +  G DY LF+++I+PMWE   N+ GG W +T   S+++ L N  W ++ + L+GE     S+ +CG V+N+R  ++++ +W ++  +++  + IG  ++  L +  +  +++  H D +
Sbjct:   72 LMNVWTLWYLENDRSKSWEDMQNEITSFDTVEDFWSLYNHIKPPSEIKLGSDYSLFKKNIRPMWEDAANKQGGRWVITLNKSSKTDLDN-LWLDVLLCLIGEAF-DHSDQICGAVINIRGKSNKISIWTADGNNEEAALEIGHKLRDALRLGRNNSLQYQLHKDTM 235          
BLAST of Eukaryotic translation initiation factor 4E vs. Ensembl Fly
Match: eIF4E1 (gene:FBgn0015218 transcript:FBtr0076493)

HSP 1 Score: 123.635 bits (309), Expect = 1.091e-33
Identity = 53/151 (35.10%), Postives = 93/151 (61.59%), Query Frame = 1
Query:  247 LQNEWSLWFCKRDSSRDWTESLHLIEHFNTVEDFWRLIDHITPPFALPTGCDYYLFRRDIKPMWEHNTNRCGGSWQVTFKNSTRSLLLNRFWENLTMLLVGEGCGSDSEIVCGGVVNVRKMTDRLCLWVSNYEDKQQIMRIGRHIKRILEI 699
            L N W+LW+ + D S+ W +  + I  F+TVEDFW L +HI PP  +  G DY LF+++I+PMWE   N+ GG W +T   S+++ L N  W ++ + L+GE     S+ +CG V+N+R  ++++ +W ++  +++  + IG  ++  L +
Sbjct:   83 LMNVWTLWYLENDRSKSWEDMQNEITSFDTVEDFWSLYNHIKPPSEIKLGSDYSLFKKNIRPMWEDAANKQGGRWVITLNKSSKTDLDN-LWLDVLLCLIGEAF-DHSDQICGAVINIRGKSNKISIWTADGNNEEAALEIGHKLRDALRL 231          
BLAST of Eukaryotic translation initiation factor 4E vs. Ensembl Fly
Match: eIF4E1 (gene:FBgn0015218 transcript:FBtr0076489)

HSP 1 Score: 123.635 bits (309), Expect = 1.091e-33
Identity = 53/151 (35.10%), Postives = 93/151 (61.59%), Query Frame = 1
Query:  247 LQNEWSLWFCKRDSSRDWTESLHLIEHFNTVEDFWRLIDHITPPFALPTGCDYYLFRRDIKPMWEHNTNRCGGSWQVTFKNSTRSLLLNRFWENLTMLLVGEGCGSDSEIVCGGVVNVRKMTDRLCLWVSNYEDKQQIMRIGRHIKRILEI 699
            L N W+LW+ + D S+ W +  + I  F+TVEDFW L +HI PP  +  G DY LF+++I+PMWE   N+ GG W +T   S+++ L N  W ++ + L+GE     S+ +CG V+N+R  ++++ +W ++  +++  + IG  ++  L +
Sbjct:   83 LMNVWTLWYLENDRSKSWEDMQNEITSFDTVEDFWSLYNHIKPPSEIKLGSDYSLFKKNIRPMWEDAANKQGGRWVITLNKSSKTDLDN-LWLDVLLCLIGEAF-DHSDQICGAVINIRGKSNKISIWTADGNNEEAALEIGHKLRDALRL 231          
BLAST of Eukaryotic translation initiation factor 4E vs. Ensembl Fly
Match: eIF4E1 (gene:FBgn0015218 transcript:FBtr0076490)

HSP 1 Score: 123.635 bits (309), Expect = 1.091e-33
Identity = 53/151 (35.10%), Postives = 93/151 (61.59%), Query Frame = 1
Query:  247 LQNEWSLWFCKRDSSRDWTESLHLIEHFNTVEDFWRLIDHITPPFALPTGCDYYLFRRDIKPMWEHNTNRCGGSWQVTFKNSTRSLLLNRFWENLTMLLVGEGCGSDSEIVCGGVVNVRKMTDRLCLWVSNYEDKQQIMRIGRHIKRILEI 699
            L N W+LW+ + D S+ W +  + I  F+TVEDFW L +HI PP  +  G DY LF+++I+PMWE   N+ GG W +T   S+++ L N  W ++ + L+GE     S+ +CG V+N+R  ++++ +W ++  +++  + IG  ++  L +
Sbjct:   83 LMNVWTLWYLENDRSKSWEDMQNEITSFDTVEDFWSLYNHIKPPSEIKLGSDYSLFKKNIRPMWEDAANKQGGRWVITLNKSSKTDLDN-LWLDVLLCLIGEAF-DHSDQICGAVINIRGKSNKISIWTADGNNEEAALEIGHKLRDALRL 231          
BLAST of Eukaryotic translation initiation factor 4E vs. Ensembl Zebrafish
Match: eif4e1c (eukaryotic translation initiation factor 4E family member 1c [Source:ZFIN;Acc:ZDB-GENE-050417-398])

HSP 1 Score: 150.599 bits (379), Expect = 1.967e-44
Identity = 70/151 (46.36%), Postives = 92/151 (60.93%), Query Frame = 1
Query:  247 LQNEWSLWFCKRDSSRDWTESLHLIEHFNTVEDFWRLIDHITPPFALPTGCDYYLFRRDIKPMWEHNTNRCGGSWQVTFKNSTRSLLLNRFWENLTMLLVGEGCGSDSEIVCGGVVNVRKMTDRLCLWVSNYEDKQQIMRIGRHIKRILEI 699
            LQN W+LW+ K D S+ WTE+L LI  F+TVEDFW L +HI  P  L  GCDY LF+  IKPMWE + N+ GG W +T     R   L+R+W    + L+GE     SE VCG VVNVR   D++ +W  N +++  IM IG+  K  L +
Sbjct:   35 LQNRWALWYFKNDKSKSWTENLRLISKFDTVEDFWALYNHIQQPSKLGFGCDYCLFKDGIKPMWEDDRNKLGGRWLMTLSKQQRHNDLDRYWMETLLCLIGESFDEASEDVCGAVVNVRPKGDKIAIWTGNCQNRDAIMTIGQQYKERLSL 185          
BLAST of Eukaryotic translation initiation factor 4E vs. Ensembl Zebrafish
Match: eif4e1c (eukaryotic translation initiation factor 4E family member 1c [Source:ZFIN;Acc:ZDB-GENE-050417-398])

HSP 1 Score: 150.599 bits (379), Expect = 3.591e-44
Identity = 70/151 (46.36%), Postives = 92/151 (60.93%), Query Frame = 1
Query:  247 LQNEWSLWFCKRDSSRDWTESLHLIEHFNTVEDFWRLIDHITPPFALPTGCDYYLFRRDIKPMWEHNTNRCGGSWQVTFKNSTRSLLLNRFWENLTMLLVGEGCGSDSEIVCGGVVNVRKMTDRLCLWVSNYEDKQQIMRIGRHIKRILEI 699
            LQN W+LW+ K D S+ WTE+L LI  F+TVEDFW L +HI  P  L  GCDY LF+  IKPMWE + N+ GG W +T     R   L+R+W    + L+GE     SE VCG VVNVR   D++ +W  N +++  IM IG+  K  L +
Sbjct:   52 LQNRWALWYFKNDKSKSWTENLRLISKFDTVEDFWALYNHIQQPSKLGFGCDYCLFKDGIKPMWEDDRNKLGGRWLMTLSKQQRHNDLDRYWMETLLCLIGESFDEASEDVCGAVVNVRPKGDKIAIWTGNCQNRDAIMTIGQQYKERLSL 202          
BLAST of Eukaryotic translation initiation factor 4E vs. Ensembl Zebrafish
Match: eif4e1c (eukaryotic translation initiation factor 4E family member 1c [Source:ZFIN;Acc:ZDB-GENE-050417-398])

HSP 1 Score: 150.599 bits (379), Expect = 3.591e-44
Identity = 70/151 (46.36%), Postives = 92/151 (60.93%), Query Frame = 1
Query:  247 LQNEWSLWFCKRDSSRDWTESLHLIEHFNTVEDFWRLIDHITPPFALPTGCDYYLFRRDIKPMWEHNTNRCGGSWQVTFKNSTRSLLLNRFWENLTMLLVGEGCGSDSEIVCGGVVNVRKMTDRLCLWVSNYEDKQQIMRIGRHIKRILEI 699
            LQN W+LW+ K D S+ WTE+L LI  F+TVEDFW L +HI  P  L  GCDY LF+  IKPMWE + N+ GG W +T     R   L+R+W    + L+GE     SE VCG VVNVR   D++ +W  N +++  IM IG+  K  L +
Sbjct:   52 LQNRWALWYFKNDKSKSWTENLRLISKFDTVEDFWALYNHIQQPSKLGFGCDYCLFKDGIKPMWEDDRNKLGGRWLMTLSKQQRHNDLDRYWMETLLCLIGESFDEASEDVCGAVVNVRPKGDKIAIWTGNCQNRDAIMTIGQQYKERLSL 202          
BLAST of Eukaryotic translation initiation factor 4E vs. Ensembl Zebrafish
Match: eif4e1b (eukaryotic translation initiation factor 4E family member 1B [Source:NCBI gene;Acc:30738])

HSP 1 Score: 148.288 bits (373), Expect = 7.116e-44
Identity = 70/169 (41.42%), Postives = 97/169 (57.40%), Query Frame = 1
Query:  247 LQNEWSLWFCKRDSSRDWTESLHLIEHFNTVEDFWRLIDHITPPFALPTGCDYYLFRRDIKPMWEHNTNRCGGSWQVTFKNSTRSLLLNRFWENLTMLLVGEGCGSDSEIVCGGVVNVRKMTDRLCLWVSNYEDKQQIMRIGRHIKRILEI--DFPIEFYPHIDVVKNA 747
            LQN W LWF K D S+ W ++L LI  F+TVEDFW L ++I  P  L +GCDY +F+  I+PMWE  +N+CGG W +T     R   L+ FW    + L+GEG  S S  +CG V+N+R   D++ LW SN E+ + +  IGR  K  L +     I +  H D    +
Sbjct:    5 LQNRWGLWFYKNDKSKMWQDNLRLITKFDTVEDFWGLYNNIQLPSKLSSGCDYSMFKDGIEPMWEDRSNKCGGRWLITLAKQHRHTELDHFWLETLLCLIGEGFSSFSRDICGSVINIRAKGDKIALWTSNAENCETVTYIGRKYKESLGLPQKLVIGYQAHADTATKS 173          
BLAST of Eukaryotic translation initiation factor 4E vs. Ensembl Zebrafish
Match: eif4e1b (eukaryotic translation initiation factor 4E family member 1B [Source:NCBI gene;Acc:30738])

HSP 1 Score: 148.288 bits (373), Expect = 1.613e-43
Identity = 70/169 (41.42%), Postives = 97/169 (57.40%), Query Frame = 1
Query:  247 LQNEWSLWFCKRDSSRDWTESLHLIEHFNTVEDFWRLIDHITPPFALPTGCDYYLFRRDIKPMWEHNTNRCGGSWQVTFKNSTRSLLLNRFWENLTMLLVGEGCGSDSEIVCGGVVNVRKMTDRLCLWVSNYEDKQQIMRIGRHIKRILEI--DFPIEFYPHIDVVKNA 747
            LQN W LWF K D S+ W ++L LI  F+TVEDFW L ++I  P  L +GCDY +F+  I+PMWE  +N+CGG W +T     R   L+ FW    + L+GEG  S S  +CG V+N+R   D++ LW SN E+ + +  IGR  K  L +     I +  H D    +
Sbjct:   36 LQNRWGLWFYKNDKSKMWQDNLRLITKFDTVEDFWGLYNNIQLPSKLSSGCDYSMFKDGIEPMWEDRSNKCGGRWLITLAKQHRHTELDHFWLETLLCLIGEGFSSFSRDICGSVINIRAKGDKIALWTSNAENCETVTYIGRKYKESLGLPQKLVIGYQAHADTATKS 204          
BLAST of Eukaryotic translation initiation factor 4E vs. Ensembl Xenopus
Match: snx1 (sorting nexin 1 [Source:Xenbase;Acc:XB-GENE-992259])

HSP 1 Score: 147.132 bits (370), Expect = 6.197e-43
Identity = 78/213 (36.62%), Postives = 112/213 (52.58%), Query Frame = 1
Query:  136 LNSNCEVPNPLAILPPDSDEVSNSNSIDSKDETAFNYLQNEWSLWFCKRDSSRDWTESLHLIEHFNTVEDFWRLIDHITPPFALPTGCDYYLFRRDIKPMWEHNTNRCGGSWQVTFKNSTRSLLLNRFWENLTMLLVGEGCGSDSEIVCGGVVNVRKMTDRLCLWVSNYEDKQQIMRIGRHIKRILEI--DFPIEFYPHIDVVKNALYSGRGR 768
            + S  E  NP +    + ++   S  I S D+   + LQN W+LWF K D S+ W  +L LI  F+TVEDFW L +HI     L +GCDY LF+  I+PMWE   N+ GG W +T     R   L+RFW    M L+GE     S+ VCG VVNVR   D++ +W + +E++  +  IG+  K  L +     I +  H D    +  + + R
Sbjct:    4 IESTWEGTNPQST---EEEKTETSQEIVSPDQYIKHPLQNRWALWFFKNDKSKTWQANLRLISKFDTVEDFWALYNHIQLSSNLMSGCDYSLFKDGIEPMWEDEKNKRGGRWLITLNKQQRRNDLDRFWLETLMCLIGESFDEYSDDVCGAVVNVRAKGDKIAIWTTEFENRDAVTHIGKVYKERLGLPAKVVIGYQSHADTATKSGSTTKNR 213          
BLAST of Eukaryotic translation initiation factor 4E vs. Ensembl Xenopus
Match: snx1 (sorting nexin 1 [Source:Xenbase;Acc:XB-GENE-992259])

HSP 1 Score: 147.132 bits (370), Expect = 7.042e-42
Identity = 77/214 (35.98%), Postives = 112/214 (52.34%), Query Frame = 1
Query:  157 PNPLAILPPDS--------DEVSNSNSIDSKDETAFNYLQNEWSLWFCKRDSSRDWTESLHLIEHFNTVEDFWRLIDHITPPFALPTGCDYYLFRRDIKPMWEHNTNRCGGSWQVTFKNSTRSLLLNRFWENLTMLLVGEGCGSDSEIVCGGVVNVRKMTDRLCLWVSNYEDKQQIMRIGRHIKRILEI--DFPIEFYPHIDVVKNALYSGRGR 768
            P+ +A + P+         ++   S  I S D+   + LQN W+LWF K D S+ W  +L LI  F+TVEDFW L +HI     L +GCDY LF+  I+PMWE   N+ GG W +T     R   L+RFW    M L+GE     S+ VCG VVNVR   D++ +W + +E++  +  IG+  K  L +     I +  H D    +  + + R
Sbjct:   89 PSKMASVEPEGTNPQSTEEEKTETSQEIVSPDQYIKHPLQNRWALWFFKNDKSKTWQANLRLISKFDTVEDFWALYNHIQLSSNLMSGCDYSLFKDGIEPMWEDEKNKRGGRWLITLNKQQRRNDLDRFWLETLMCLIGESFDEYSDDVCGAVVNVRAKGDKIAIWTTEFENRDAVTHIGKVYKERLGLPAKVVIGYQSHADTATKSGSTTKNR 302          
BLAST of Eukaryotic translation initiation factor 4E vs. Ensembl Xenopus
Match: ENSXETT00000049404.1 (eukaryotic translation initiation factor 4E family member 1B [Source:NCBI gene;Acc:100127761])

HSP 1 Score: 129.798 bits (325), Expect = 3.203e-36
Identity = 63/166 (37.95%), Postives = 89/166 (53.61%), Query Frame = 1
Query:  247 LQNEWSLWFCKRDSSRDWTESLHLIEHFNTVEDFWRLIDHITPPFALPTGCDYYLFRRDIKPMWEHNTNRCGGSWQVTFKNSTRSLLLNRFWENLTMLLVGEGCGSDSEIVCGGVVNVRKMTDRLCLWVSNYEDKQQIMRIGRHIKRILEID--FPIEFYPHIDVV 738
            LQ+ W+LWF K   S+ W  +L L+  FNTVEDFW L  HI     L +GCDY LF+  I+PMWE + N+ GG W +T     R   L+  W    + L+GE     SE VCG V+N+R   D++ +W    E+++ +  IG+  K  L +     I +  H D  
Sbjct:   39 LQSRWALWFFKNVKSQPWQCNLRLVTTFNTVEDFWSLYTHIQLASKLSSGCDYSLFKDGIEPMWEDSRNKRGGRWLITLSKQQRHSDLDALWLETLLCLIGEAFDEYSEEVCGAVINIRAKGDKIAIWTRETENREAVTHIGKVYKERLGLSSKVVIGYQAHADTA 204          
BLAST of Eukaryotic translation initiation factor 4E vs. Ensembl Xenopus
Match: ENSXETT00000049401.1 (eukaryotic translation initiation factor 4E family member 1B [Source:NCBI gene;Acc:100127761])

HSP 1 Score: 129.028 bits (323), Expect = 7.957e-36
Identity = 63/169 (37.28%), Postives = 90/169 (53.25%), Query Frame = 1
Query:  247 LQNEWSLWFCKRDSSRDWTESLHLIEHFNTVEDFWRLIDHITPPFALPTGCDYYLFRRDIKPMWEHNTNRCGGSWQVTFKNSTRSLLLNRFWENLTMLLVGEGCGSDSEIVCGGVVNVRKMTDRLCLWVSNYEDKQQIMRIGRHIKRILEID--FPIEFYPHIDVVKNA 747
            LQ+ W+LWF K   S+ W  +L L+  FNTVEDFW L  HI     L +GCDY LF+  I+PMWE + N+ GG W +T     R   L+  W    + L+GE     SE VCG V+N+R   D++ +W    E+++ +  IG+  K  L +     I +  H D    +
Sbjct:   48 LQSRWALWFFKNVKSQPWQCNLRLVTTFNTVEDFWSLYTHIQLASKLSSGCDYSLFKDGIEPMWEDSRNKRGGRWLITLSKQQRHSDLDALWLETLLCLIGEAFDEYSEEVCGAVINIRAKGDKIAIWTRETENREAVTHIGKVYKERLGLSSKVVIGYQAHADTATKS 216          
BLAST of Eukaryotic translation initiation factor 4E vs. Ensembl Xenopus
Match: txnrd1 (thioredoxin reductase 1 [Source:Xenbase;Acc:XB-GENE-956002])

HSP 1 Score: 104.375 bits (259), Expect = 1.657e-26
Identity = 58/177 (32.77%), Postives = 92/177 (51.98%), Query Frame = 1
Query:  247 LQNEWSLWFCKRD-----SSRDWTESLHLIEHFNTVEDFWRLIDHITPPFALPTGCDYYLFRRDIKPMWEHNTNRCGGSWQVTFKNSTRSLLLNRFWENLTMLLVGEGCGSDSEIVCGGVVNVRKMTDRLCLWVSNYEDKQQIMRIGRHIKRILEI--DFPIEFYPHIDVVKNALYS 756
            LQ  ++ W+ +R      SS+ + +++  I  F +VE FWR   H+  P  L    D++LF+  IKPMWE + N+ GG W +      R  L +R WENL + ++GE      EI CG VV+VR   D + +W     D+    RI   ++R+L +  +  +E+  H D +K  + S
Sbjct:   42 LQYNYTFWYSRRTPGRPTSSQSYEQNIKQIGTFASVEQFWRFYSHMVRPGDLTGHSDFHLFKEGIKPMWEDDANKNGGKWIIRL----RKGLASRCWENLILAMLGEQFMVGEEI-CGAVVSVRFQEDIISIWNKTASDQATTARIRDTLRRVLNLPPNTVMEYKTHTDSIKYVVLS 213          
BLAST of Eukaryotic translation initiation factor 4E vs. Ensembl Mouse
Match: Eif4e1b (eukaryotic translation initiation factor 4E family member 1B [Source:MGI Symbol;Acc:MGI:2685119])

HSP 1 Score: 140.198 bits (352), Expect = 5.683e-40
Identity = 71/169 (42.01%), Postives = 90/169 (53.25%), Query Frame = 1
Query:  247 LQNEWSLWFCKRDSSRDWTESLHLIEHFNTVEDFWRLIDHITPPFALPTGCDYYLFRRDIKPMWEHNTNRCGGSWQVTFKNSTRSLLLNRFWENLTMLLVGEGCGSDSEIVCGGVVNVRKMTDRLCLWVSNYEDKQQIMRIGRHIKRILEIDFP--IEFYPHIDVVKNA 747
            LQ  W LWF K D SR W ++L L+  FNTVEDFW +  HI     L +GCDY LF+  I PMWE N N+ GG W ++     R   L+R W    + LVG      S  VCG VVN+R   D++ LW S  EDK  +M+IG+  K  L I     I +  H D    +
Sbjct:   73 LQYRWVLWFFKNDRSRAWQDNLQLVTKFNTVEDFWAVYSHIKLASKLSSGCDYALFKEGILPMWEDNRNKQGGRWLLSIDKQLRHFELDRLWLETLLCLVGNCFEEYSREVCGAVVNIRTKRDKIALWTSEAEDKAGVMQIGQIYKERLGISTKTIIGYQAHADTAAKS 241          
BLAST of Eukaryotic translation initiation factor 4E vs. Ensembl Mouse
Match: Eif4e (eukaryotic translation initiation factor 4E [Source:MGI Symbol;Acc:MGI:95305])

HSP 1 Score: 139.428 bits (350), Expect = 5.797e-40
Identity = 70/176 (39.77%), Postives = 95/176 (53.98%), Query Frame = 1
Query:  247 LQNEWSLWFCKRDSSRDWTESLHLIEHFNTVEDFWRLIDHITPPFALPTGCDYYLFRRDIKPMWEHNTNRCGGSWQVTFKNSTRSLLLNRFWENLTMLLVGEGCGSDSEIVCGGVVNVRKMTDRLCLWVSNYEDKQQIMRIGRHIKRILEI--DFPIEFYPHIDVVKNALYSGRGR 768
            LQN W+LWF K D S+ W  +L LI  F+TVEDFW L +HI     L  GCDY LF+  I+PMWE   N+ GG W +T     R   L+RFW    + L+GE     S+ VCG VVNVR   D++ +W +  E++  +  IGR  K  L +     I +  H D    +  + + R
Sbjct:   39 LQNRWALWFFKNDKSKTWQANLRLISKFDTVEDFWALYNHIQLSSNLMPGCDYSLFKDGIEPMWEDEKNKRGGRWLITLNKQQRRSDLDRFWLETLLCLIGESFDDYSDDVCGAVVNVRAKGDKIAIWTTECENRDAVTHIGRVYKERLGLPPKIVIGYQSHADTATKSGSTTKNR 214          
BLAST of Eukaryotic translation initiation factor 4E vs. Ensembl Mouse
Match: Eif4e1b (eukaryotic translation initiation factor 4E family member 1B [Source:MGI Symbol;Acc:MGI:2685119])

HSP 1 Score: 140.198 bits (352), Expect = 5.852e-40
Identity = 71/169 (42.01%), Postives = 90/169 (53.25%), Query Frame = 1
Query:  247 LQNEWSLWFCKRDSSRDWTESLHLIEHFNTVEDFWRLIDHITPPFALPTGCDYYLFRRDIKPMWEHNTNRCGGSWQVTFKNSTRSLLLNRFWENLTMLLVGEGCGSDSEIVCGGVVNVRKMTDRLCLWVSNYEDKQQIMRIGRHIKRILEIDFP--IEFYPHIDVVKNA 747
            LQ  W LWF K D SR W ++L L+  FNTVEDFW +  HI     L +GCDY LF+  I PMWE N N+ GG W ++     R   L+R W    + LVG      S  VCG VVN+R   D++ LW S  EDK  +M+IG+  K  L I     I +  H D    +
Sbjct:   72 LQYRWVLWFFKNDRSRAWQDNLQLVTKFNTVEDFWAVYSHIKLASKLSSGCDYALFKEGILPMWEDNRNKQGGRWLLSIDKQLRHFELDRLWLETLLCLVGNCFEEYSREVCGAVVNIRTKRDKIALWTSEAEDKAGVMQIGQIYKERLGISTKTIIGYQAHADTAAKS 240          
BLAST of Eukaryotic translation initiation factor 4E vs. Ensembl Mouse
Match: Eif4e1b (eukaryotic translation initiation factor 4E family member 1B [Source:MGI Symbol;Acc:MGI:2685119])

HSP 1 Score: 140.198 bits (352), Expect = 5.945e-40
Identity = 71/169 (42.01%), Postives = 90/169 (53.25%), Query Frame = 1
Query:  247 LQNEWSLWFCKRDSSRDWTESLHLIEHFNTVEDFWRLIDHITPPFALPTGCDYYLFRRDIKPMWEHNTNRCGGSWQVTFKNSTRSLLLNRFWENLTMLLVGEGCGSDSEIVCGGVVNVRKMTDRLCLWVSNYEDKQQIMRIGRHIKRILEIDFP--IEFYPHIDVVKNA 747
            LQ  W LWF K D SR W ++L L+  FNTVEDFW +  HI     L +GCDY LF+  I PMWE N N+ GG W ++     R   L+R W    + LVG      S  VCG VVN+R   D++ LW S  EDK  +M+IG+  K  L I     I +  H D    +
Sbjct:   67 LQYRWVLWFFKNDRSRAWQDNLQLVTKFNTVEDFWAVYSHIKLASKLSSGCDYALFKEGILPMWEDNRNKQGGRWLLSIDKQLRHFELDRLWLETLLCLVGNCFEEYSREVCGAVVNIRTKRDKIALWTSEAEDKAGVMQIGQIYKERLGISTKTIIGYQAHADTAAKS 235          
BLAST of Eukaryotic translation initiation factor 4E vs. Ensembl Mouse
Match: Eif4e1b (eukaryotic translation initiation factor 4E family member 1B [Source:MGI Symbol;Acc:MGI:2685119])

HSP 1 Score: 140.198 bits (352), Expect = 5.945e-40
Identity = 71/169 (42.01%), Postives = 90/169 (53.25%), Query Frame = 1
Query:  247 LQNEWSLWFCKRDSSRDWTESLHLIEHFNTVEDFWRLIDHITPPFALPTGCDYYLFRRDIKPMWEHNTNRCGGSWQVTFKNSTRSLLLNRFWENLTMLLVGEGCGSDSEIVCGGVVNVRKMTDRLCLWVSNYEDKQQIMRIGRHIKRILEIDFP--IEFYPHIDVVKNA 747
            LQ  W LWF K D SR W ++L L+  FNTVEDFW +  HI     L +GCDY LF+  I PMWE N N+ GG W ++     R   L+R W    + LVG      S  VCG VVN+R   D++ LW S  EDK  +M+IG+  K  L I     I +  H D    +
Sbjct:   67 LQYRWVLWFFKNDRSRAWQDNLQLVTKFNTVEDFWAVYSHIKLASKLSSGCDYALFKEGILPMWEDNRNKQGGRWLLSIDKQLRHFELDRLWLETLLCLVGNCFEEYSREVCGAVVNIRTKRDKIALWTSEAEDKAGVMQIGQIYKERLGISTKTIIGYQAHADTAAKS 235          
BLAST of Eukaryotic translation initiation factor 4E vs. UniProt/SwissProt
Match: sp|Q9PW28|IF4EB_DANRE (Eukaryotic translation initiation factor 4E-1B OS=Danio rerio OX=7955 GN=eif4e1b PE=2 SV=1)

HSP 1 Score: 148.288 bits (373), Expect = 1.218e-42
Identity = 70/169 (41.42%), Postives = 97/169 (57.40%), Query Frame = 1
Query:  247 LQNEWSLWFCKRDSSRDWTESLHLIEHFNTVEDFWRLIDHITPPFALPTGCDYYLFRRDIKPMWEHNTNRCGGSWQVTFKNSTRSLLLNRFWENLTMLLVGEGCGSDSEIVCGGVVNVRKMTDRLCLWVSNYEDKQQIMRIGRHIKRILEI--DFPIEFYPHIDVVKNA 747
            LQN W LWF K D S+ W ++L LI  F+TVEDFW L ++I  P  L +GCDY +F+  I+PMWE  +N+CGG W +T     R   L+ FW    + L+GEG  S S  +CG V+N+R   D++ LW SN E+ + +  IGR  K  L +     I +  H D    +
Sbjct:   36 LQNRWGLWFYKNDKSKMWQDNLRLITKFDTVEDFWGLYNNIQLPSKLSSGCDYSMFKDGIEPMWEDRSNKCGGRWLITLAKQHRHTELDHFWLETLLCLIGEGFSSFSRDICGSVINIRAKGDKIALWTSNAENCETVTYIGRKYKESLGLPQKLVIGYQAHADTATKS 204          
BLAST of Eukaryotic translation initiation factor 4E vs. UniProt/SwissProt
Match: sp|P48597|IF4E_XENLA (Eukaryotic translation initiation factor 4E OS=Xenopus laevis OX=8355 GN=eif4e PE=1 SV=1)

HSP 1 Score: 148.288 bits (373), Expect = 1.262e-42
Identity = 76/195 (38.97%), Postives = 104/195 (53.33%), Query Frame = 1
Query:  190 DEVSNSNSIDSKDETAFNYLQNEWSLWFCKRDSSRDWTESLHLIEHFNTVEDFWRLIDHITPPFALPTGCDYYLFRRDIKPMWEHNTNRCGGSWQVTFKNSTRSLLLNRFWENLTMLLVGEGCGSDSEIVCGGVVNVRKMTDRLCLWVSNYEDKQQIMRIGRHIKRILEI--DFPIEFYPHIDVVKNALYSGRGR 768
            +E      I S D+   + LQN W+LWF K D S+ W  +L LI  F+TVEDFW L +HI     L +GCDY LF+  I+PMWE   N+ GG W +T     R   L+RFW    M L+GE     S+ VCG VVNVR   D++ +W + +E+K  +  IGR  K  L +     I +  H D    +  + + R
Sbjct:   16 EEKETGQEIVSPDQYIKHPLQNRWALWFFKNDKSKTWQANLRLISKFDTVEDFWALYNHIQLSSNLMSGCDYSLFKDGIEPMWEDEKNKRGGRWLITLNKQQRRNDLDRFWLETLMCLIGESFDEHSDDVCGAVVNVRAKGDKIAIWTTEFENKDAVTHIGRVYKERLGLPAKVVIGYQSHADTATKSGSTTKNR 210          
BLAST of Eukaryotic translation initiation factor 4E vs. UniProt/SwissProt
Match: sp|Q9DFS6|IF4EA_DANRE (Eukaryotic translation initiation factor 4E-1A OS=Danio rerio OX=7955 GN=eif4e1a PE=1 SV=1)

HSP 1 Score: 147.902 bits (372), Expect = 2.144e-42
Identity = 72/169 (42.60%), Postives = 96/169 (56.80%), Query Frame = 1
Query:  247 LQNEWSLWFCKRDSSRDWTESLHLIEHFNTVEDFWRLIDHITPPFALPTGCDYYLFRRDIKPMWEHNTNRCGGSWQVTFKNSTRSLLLNRFWENLTMLLVGEGCGSDSEIVCGGVVNVRKMTDRLCLWVSNYEDKQQIMRIGRHIKRILEI--DFPIEFYPHIDVVKNA 747
            LQN W+LWF K D S+ W  +L LI  F+TVEDFW L +HI     L +GCDY LF+  I+PMWE   N+ GG W +T     R   L+RFW    + LVGE     S+ VCG VVN+R   D++ +W ++YE+K  I+ IGR  K  L +     I +  H D    +
Sbjct:   37 LQNRWALWFFKNDKSKTWQANLRLISKFDTVEDFWALYNHIQLSSNLMSGCDYSLFKDGIEPMWEDERNKRGGRWLITLSKQQRRADLDRFWLETLLCLVGEAFDDHSDDVCGAVVNIRTKGDKIAIWTTDYENKDAIVHIGRVYKERLGVPPKVIIGYQSHADTATKS 205          
BLAST of Eukaryotic translation initiation factor 4E vs. UniProt/SwissProt
Match: sp|O77210|IF4E_APLCA (Eukaryotic translation initiation factor 4E OS=Aplysia californica OX=6500 PE=1 SV=1)

HSP 1 Score: 144.05 bits (362), Expect = 5.095e-41
Identity = 68/176 (38.64%), Postives = 96/176 (54.55%), Query Frame = 1
Query:  247 LQNEWSLWFCKRDSSRDWTESLHLIEHFNTVEDFWRLIDHITPPFALPTGCDYYLFRRDIKPMWEHNTNRCGGSWQVTFKNSTRSLLLNRFWENLTMLLVGEGCGSDSEIVCGGVVNVRKMTDRLCLWVSNYEDKQQIMRIGRHIKRILEI--DFPIEFYPHIDVVKNALYSGRGR 768
            LQN W++WF K D SRDW ++L +I  F+TVEDFW L +H  P   L +GCDY +F+  I+PMWE   N+ GG W +    + R   L+ FW    + L+GEG    SE +CG  VN+R   D+L LW  + +  +   +IG  +K  L +     I F  H D    A  + + R
Sbjct:   37 LQNSWAMWFFKNDKSRDWKDNLRVITTFDTVEDFWGLYNHTLPASKLQSGCDYSVFKAGIQPMWEDAQNKKGGRWLINLNKTQRQTHLDDFWLETLLCLIGEGFDEHSEEICGATVNIRNKGDKLGLWTRDAQKTEATKKIGIKLKESLSVPPKIVIGFQAHSDTAGKAGSTVKNR 212          
BLAST of Eukaryotic translation initiation factor 4E vs. UniProt/SwissProt
Match: sp|Q9N0T5|IF4E_BOVIN (Eukaryotic translation initiation factor 4E OS=Bos taurus OX=9913 GN=EIF4E PE=2 SV=2)

HSP 1 Score: 140.584 bits (353), Expect = 1.208e-39
Identity = 70/176 (39.77%), Postives = 96/176 (54.55%), Query Frame = 1
Query:  247 LQNEWSLWFCKRDSSRDWTESLHLIEHFNTVEDFWRLIDHITPPFALPTGCDYYLFRRDIKPMWEHNTNRCGGSWQVTFKNSTRSLLLNRFWENLTMLLVGEGCGSDSEIVCGGVVNVRKMTDRLCLWVSNYEDKQQIMRIGRHIKRILEI--DFPIEFYPHIDVVKNALYSGRGR 768
            LQN W+LWF K D S+ W  +L LI  F+TVEDFW L +HI     L  GCDY LF+  I+PMWE   N+ GG W +T     R   L+RFW    + L+GE     S+ VCG VVNVR   D++ +W +  E+++ +  IGR  K  L +     I +  H D    +  + + R
Sbjct:   39 LQNRWALWFFKNDKSKTWQANLRLISKFDTVEDFWALYNHIQLSSNLMPGCDYSLFKDGIEPMWEDEKNKRGGRWLITLNKQQRRSDLDRFWLETVLCLIGESFDDYSDDVCGAVVNVRAKGDKIAIWTTECENREAVTHIGRVYKERLGLPPKIVIGYQSHADTATKSGSTTKNR 214          
BLAST of Eukaryotic translation initiation factor 4E vs. TrEMBL
Match: A0A3Q2YZP1 (Eukaryotic translation initiation factor 4E family member 1c OS=Hippocampus comes OX=109280 PE=3 SV=1)

HSP 1 Score: 159.458 bits (402), Expect = 1.241e-44
Identity = 75/174 (43.10%), Postives = 107/174 (61.49%), Query Frame = 1
Query:  178 PPDSDEVSNSNSIDSKDETAFNYLQNEWSLWFCKRDSSRDWTESLHLIEHFNTVEDFWRLIDHITPPFALPTGCDYYLFRRDIKPMWEHNTNRCGGSWQVTFKNSTRSLLLNRFWENLTMLLVGEGCGSDSEIVCGGVVNVRKMTDRLCLWVSNYEDKQQIMRIGRHIKRILEI 699
             P++DE    + + ++++   + LQN W+LW+ K D S+ WTE+L LI  F+TVEDFW L +HI  P  L  GCDY LF+  IKPMWE + N+ GG W +T     R   L+R+W    + LVGE     S+ VCG VVNVR   D++ +W SN ++++ IM+IG   K +L I
Sbjct:    8 APETDEQQCDSQVTNQEQYIKHPLQNRWALWYFKNDKSKSWTENLRLISKFDTVEDFWALYNHIQQPSKLVYGCDYCLFKDGIKPMWEDDRNKLGGRWLMTLNKVQRHNDLDRYWMETLLCLVGESFDEASDDVCGAVVNVRHKADKIAIWTSNCQNREAIMKIGETYKDLLSI 181          
BLAST of Eukaryotic translation initiation factor 4E vs. TrEMBL
Match: A0A5N5ST68 (Eukaryotic translation initiation factor 4E OS=Armadillidium nasatum OX=96803 GN=IF4E_1 PE=4 SV=1)

HSP 1 Score: 159.073 bits (401), Expect = 3.282e-44
Identity = 80/216 (37.04%), Postives = 122/216 (56.48%), Query Frame = 1
Query:  136 LNSNCEVPNPLAILPPDSDEVSNSNSID---SKDETAFNYLQNEWSLWFCKRDSSRDWTESLHLIEHFNTVEDFWRLIDHITPPFALPTGCDYYLFRRDIKPMWEHNTNRCGGSWQVTFKNSTRSLLLNRFWENLTMLLVGEGCGSDSEIVCGGVVNVRKMTDRLCLWVSNYEDKQQIMRIGRHIKRILEI--DFPIEFYPHIDVVKNALYSGRGR 768
            + ++ EV N +     D+++     S +   S +    + LQNEW++WF K+DS+R W ES  ++  F+TVEDFW L +HI     L TGCDY LF++ IKPMWE   N  GG W +    + R+  L+ FW  + +LL+GE    DSE VCG VVNVR   D++ +W  + ++   I++IG  ++R L I  +  I +  H D +  A  + + R
Sbjct:    1 MAADMEVQNQVDHKEKDAEKQKEKESTEKSLSPEMLIKHPLQNEWTMWFFKQDSTRSWEESQIVVASFDTVEDFWALYNHIELASKLKTGCDYSLFKKGIKPMWEDTRNCAGGRWIINLSKNQRATELDNFWMEMLLLLIGEAFDQDSEEVCGAVVNVRAKGDKVGVWTRDAQNAAGILKIGDTLRRRLNIPHNIQIGYQAHTDSMVKAGSTAKNR 216          
BLAST of Eukaryotic translation initiation factor 4E vs. TrEMBL
Match: A0A444UN53 (Eukaryotic translation initiation factor 4E OS=Acipenser ruthenus OX=7906 GN=EOD39_11650 PE=3 SV=1)

HSP 1 Score: 158.303 bits (399), Expect = 4.238e-44
Identity = 83/195 (42.56%), Postives = 111/195 (56.92%), Query Frame = 1
Query:  115 VATDESQLNSNCEVPNPLAILPPDSDEVSNSNSIDSKDETAFNYLQNEWSLWFCKRDSSRDWTESLHLIEHFNTVEDFWRLIDHITPPFALPTGCDYYLFRRDIKPMWEHNTNRCGGSWQVTFKNSTRSLLLNRFWENLTMLLVGEGCGSDSEIVCGGVVNVRKMTDRLCLWVSNYEDKQQIMRIGRHIKRILEI 699
            +AT E Q    C   +  +   P +  V+N       +E   + LQN+W+LW+ K D S+ WTE+L LI  F+TVEDFW L +HI  P  L  GCDY LF+  IKPMWE + N+ GG W +T     R   L+R+W    + L+GE  G  S+ VCG VVNVR   D+L +W  N E+K+ IM IG+  K  L I
Sbjct:    1 MATSEPQ----CATESEESTAEPTAPVVANP------EEYMKHPLQNKWALWYFKNDKSKSWTENLRLIAKFDTVEDFWALYNHIQQPSKLGFGCDYCLFKDGIKPMWEDDRNKLGGRWLMTLNKQQRHNDLDRYWMETLLCLIGESFGEASDDVCGAVVNVRPKGDKLAIWTGNCENKEAIMTIGQQYKERLSI 185          
BLAST of Eukaryotic translation initiation factor 4E vs. TrEMBL
Match: A0A3B4BNX2 (Eukaryotic translation initiation factor 4E family member 1B OS=Pygocentrus nattereri OX=42514 PE=3 SV=1)

HSP 1 Score: 157.532 bits (397), Expect = 1.030e-43
Identity = 73/174 (41.95%), Postives = 102/174 (58.62%), Query Frame = 1
Query:  223 KDETAFNYLQNEWSLWFCKRDSSRDWTESLHLIEHFNTVEDFWRLIDHITPPFALPTGCDYYLFRRDIKPMWEHNTNRCGGSWQVTFKNSTRSLLLNRFWENLTMLLVGEGCGSDSEIVCGGVVNVRKMTDRLCLWVSNYEDKQQIMRIGRHIKRILEI--DFPIEFYPHIDVV 738
            K+  A + LQN W+LWF K D S+ W ++L LI  F+T EDFW L ++I P   L +GCDY +F+  I+PMWE  +N+CGG W +T     R   L+RFW    + L+GEG GS S  VCG V+NVR   D++ +W +N E+ + +  IGR  K  L +     I +  H D  
Sbjct:   29 KEPQARHPLQNRWALWFYKNDKSKMWQDNLRLITKFDTAEDFWALYNNIQPASKLSSGCDYSVFKDGIEPMWEDRSNKCGGRWLITLSKQQRHSELDRFWLETLLCLIGEGFGSYSRDVCGAVINVRAKGDKIAIWTTNTENAEAVTYIGRKYKETLGLPAKLVIGYQAHADTA 202          
BLAST of Eukaryotic translation initiation factor 4E vs. TrEMBL
Match: A0A4W4G8F6 (Uncharacterized protein OS=Electrophorus electricus OX=8005 GN=LOC113587405 PE=3 SV=1)

HSP 1 Score: 157.147 bits (396), Expect = 1.198e-43
Identity = 73/174 (41.95%), Postives = 102/174 (58.62%), Query Frame = 1
Query:  223 KDETAFNYLQNEWSLWFCKRDSSRDWTESLHLIEHFNTVEDFWRLIDHITPPFALPTGCDYYLFRRDIKPMWEHNTNRCGGSWQVTFKNSTRSLLLNRFWENLTMLLVGEGCGSDSEIVCGGVVNVRKMTDRLCLWVSNYEDKQQIMRIGRHIKRILEI--DFPIEFYPHIDVV 738
            K+  A + LQN W+LWF K D S+ W ++L LI  F+TVEDFW L ++I P   L +GCDY +F+  I+PMWE  +N+CGG W +T     R   L+RFW    + L+GEG G  S  VCG V+NVR   D++ +W +N E+ + +  IGR  K  L +     I +  H D  
Sbjct:   29 KEPRAKHPLQNRWALWFYKNDKSKMWQDNLRLITKFDTVEDFWGLYNNIQPASKLSSGCDYSVFKDGIEPMWEDRSNKCGGRWLITLSKQQRHTELDRFWRETLLCLIGEGFGPYSRDVCGAVINVRAKGDKIAVWTTNTENAEAVTYIGRKYKETLGLPAKLVIGYQAHADTA 202          
BLAST of Eukaryotic translation initiation factor 4E vs. Ensembl Cavefish
Match: eif4e1c (eukaryotic translation initiation factor 4E-like [Source:NCBI gene;Acc:103032634])

HSP 1 Score: 151.754 bits (382), Expect = 4.783e-45
Identity = 78/187 (41.71%), Postives = 105/187 (56.15%), Query Frame = 1
Query:  184 DSDEVSNSNSIDSKDETAFNY-LQNEWSLWFCKRDSSRDWTESLHLIEHFNTVEDFWRLIDHITPPFALPTGCDYYLFRRDIKPMWEHNTNRCGGSWQVTFKNSTRSLLLNRFWENLTMLLVGEGCGSDSEIVCGGVVNVRKMTDRLCLWVSNYEDKQQIMRIGRHIKRILEIDFP--IEFYPHIDV 735
            +S+E SN +   +  E    + LQN W+LW+ K D S+ WTE+L LI  F+TVEDFW L +HI  P  L  GCDY LF+  IKPMWE + N+ GG W +T     R   L+R+W    + L+GE     SE VCG VVNVR   D++ +W  N +++  IM IG   K  L +     I +  H D 
Sbjct:   10 ESEEASNDSPTPAVAEQYIKHPLQNRWALWYFKNDKSKSWTENLRLISKFDTVEDFWALYNHIQQPSKLGFGCDYCLFKDGIKPMWEDDRNKLGGRWLMTLSKQQRHNDLDRYWMETLLCLIGESFDEASEDVCGAVVNVRPKGDKIAIWTGNCQNRDAIMTIGLQYKERLNLPIKTLIGYQSHDDT 196          
BLAST of Eukaryotic translation initiation factor 4E vs. Ensembl Cavefish
Match: eif4eb (eukaryotic translation initiation factor 4E-1A [Source:NCBI gene;Acc:103043156])

HSP 1 Score: 149.058 bits (375), Expect = 9.019e-44
Identity = 74/169 (43.79%), Postives = 96/169 (56.80%), Query Frame = 1
Query:  247 LQNEWSLWFCKRDSSRDWTESLHLIEHFNTVEDFWRLIDHITPPFALPTGCDYYLFRRDIKPMWEHNTNRCGGSWQVTFKNSTRSLLLNRFWENLTMLLVGEGCGSDSEIVCGGVVNVRKMTDRLCLWVSNYEDKQQIMRIGRHIKRILEI--DFPIEFYPHIDVVKNA 747
            LQN WSLWF K D S+ W  +L LI  F+TVEDFW L +HI     L +GCDY LF+  I+PMWE   N+ GG W +T     R L L+RFW    + L+GE     S+ VCG VVNVR   D++ +W ++YE++  I  IGR  K  L I     I +  H D    +
Sbjct:   49 LQNRWSLWFFKNDKSKTWQANLRLISKFDTVEDFWALYNHIQLSSNLMSGCDYSLFKDGIEPMWEDERNKKGGRWLITLNKQQRKLDLDRFWLETLLCLIGEAFDDYSDDVCGAVVNVRTKGDKIAVWTTDYENRDGITHIGRVYKERLGIPMKMTIGYQSHADTATKS 217          
BLAST of Eukaryotic translation initiation factor 4E vs. Ensembl Cavefish
Match: eif4ea (eukaryotic translation initiation factor 4E-1A [Source:NCBI gene;Acc:103043705])

HSP 1 Score: 148.288 bits (373), Expect = 1.599e-43
Identity = 72/166 (43.37%), Postives = 95/166 (57.23%), Query Frame = 1
Query:  247 LQNEWSLWFCKRDSSRDWTESLHLIEHFNTVEDFWRLIDHITPPFALPTGCDYYLFRRDIKPMWEHNTNRCGGSWQVTFKNSTRSLLLNRFWENLTMLLVGEGCGSDSEIVCGGVVNVRKMTDRLCLWVSNYEDKQQIMRIGRHIKRILEI--DFPIEFYPHIDVV 738
            LQN W+LWF K D S+ W  +L LI  F+TVEDFW L +HI     L +GCDY LF+  I+PMWE   N+ GG W +T     R   L+RFW    + LVGE     S+ VCG VVN+R   D++ +W ++YE+K  I+ IGR  K  L +     I +  H D  
Sbjct:   40 LQNRWALWFFKNDKSKTWQANLQLISKFDTVEDFWALYNHIQLSSNLISGCDYSLFKDGIEPMWEDERNKKGGRWLITLSKQQRRADLDRFWLETLLCLVGEAFDDHSDDVCGAVVNIRTKGDKISIWTTDYENKDAIVHIGRVYKARLGVPPKVIIGYQSHADTA 205          
BLAST of Eukaryotic translation initiation factor 4E vs. Ensembl Cavefish
Match: eif4e1b (eukaryotic translation initiation factor 4E family member 1B [Source:NCBI gene;Acc:30738])

HSP 1 Score: 102.834 bits (255), Expect = 2.098e-26
Identity = 58/174 (33.33%), Postives = 88/174 (50.57%), Query Frame = 1
Query:  223 KDETAFNYLQNEWSLWFCKRDSSRDWTESLHLIEHFNTVEDFWRLIDHITPPFALPTGCDYYLFRRDIKPMWEHNTNRCGGSWQVTFKNSTRSLLLNRFWENLTMLLVGEGCGSDSEIVCGGVVNVRKMTDRLCLWVSNYEDKQQIMRIGRHIKRILEI--DFPIEFYPHIDVV 738
            K+  A + LQN W+LWF K D S+ W ++L LI  F+T EDFW L ++I     L +GCDY +F+ + +                 +K     L + +      + ++GEG GS S  VCG V+NVR   D++ +W +N E+ + +  IGR  K IL +     I +  H D  
Sbjct:   29 KEPQAKHPLQNRWALWFYKNDKSKMWQDNLRLITKFDTAEDFWALYNNIQAASKLSSGCDYSVFKVNPR----------------VYKACFFLLCILQL-----LCMIGEGFGSYSRDVCGSVINVRAKGDKIAVWTTNTENAEAVTHIGRKYKEILGLPSKLVIGYQAHADTA 181          
BLAST of Eukaryotic translation initiation factor 4E vs. Ensembl Cavefish
Match: eif4e2 (eukaryotic translation initiation factor 4E family member 2 [Source:NCBI gene;Acc:103021705])

HSP 1 Score: 102.449 bits (254), Expect = 7.897e-26
Identity = 56/172 (32.56%), Postives = 90/172 (52.33%), Query Frame = 1
Query:  247 LQNEWSLWFCKRD-----SSRDWTESLHLIEHFNTVEDFWRLIDHITPPFALPTGCDYYLFRRDIKPMWEHNTNRCGGSWQVTFKNSTRSLLLNRFWENLTMLLVGEGCGSDSEIVCGGVVNVRKMTDRLCLWVSNYEDKQQIMRIGRHIKRILEI--DFPIEFYPHIDVVK 741
            LQ  ++ W+ +R      S++ + +++  I  F +VE FWR   H+  P  L    D++LF+  IKPMWE + N+ GG W +      R  L +R WENL + ++GE      EI CG VV+VR   D + +W     D+    RI   ++R+L +  +  +E+  H D +K
Sbjct:   55 LQYNYTFWYSRRTPGRPASTQSYEQNIKQIGSFASVEQFWRFYSHMIRPGDLTGHSDFHLFKEGIKPMWEDDANKSGGKWIIRL----RKGLASRCWENLILAMLGEQFMVGEEI-CGAVVSVRFQEDIISIWNKTASDQATTARIRDTLRRVLNLPPNTIMEYKTHTDSIK 221          
BLAST of Eukaryotic translation initiation factor 4E vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001509.1 (pep scaffold:Pmarinus_7.0:GL501028:982:8648:-1 gene:ENSPMAG00000001359.1 transcript:ENSPMAT00000001509.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 134.806 bits (338), Expect = 3.105e-39
Identity = 73/193 (37.82%), Postives = 104/193 (53.89%), Query Frame = 1
Query:  124 DESQLNS----NCEVPNPLAI--LPPDSDEVSNSNSIDSKDETAFNY----LQNEWSLWFCKRDSSRDWTESLHLIEHFNTVEDFWRLIDHITPPFALPTGCDYYLFRRDIKPMWEHNTNRCGGSWQVTFKNSTRSLLLNRFWENLTMLLVGEGCGSDSEIVCGGVVNVRKMTDRLCLWVSNYEDKQQIMRIG 672
            +++QLN     N  V   +AI  L P+  E          D    NY    LQN W+LWF K D S+ W  +L LI   +TVEDFW L +HI     L  GCDY LF+  I+PMWE   N+ GG W +T   + R   L+R+W    + L+GE     S+ VCG VVNVR   D++ +W ++ ++++ ++ IG
Sbjct:    7 EQTQLNKHYLKNRSVTKEMAIRALTPEEPEKVEDLVTAETDVDPENYIKHPLQNRWALWFYKNDKSKSWQANLRLITKVDTVEDFWALYNHIQVASRLMPGCDYSLFKDGIEPMWEDERNKRGGRWLITLTKTQRHSDLDRYWLETLLCLIGEAFDDHSDDVCGAVVNVRPKADKIAVWTADCDNRESVVGIG 199          
BLAST of Eukaryotic translation initiation factor 4E vs. Ensembl Sea Lamprey
Match: eif4e2 (eukaryotic translation initiation factor 4E family member 2 [Source:ZFIN;Acc:ZDB-GENE-050327-59])

HSP 1 Score: 104.76 bits (260), Expect = 2.139e-27
Identity = 60/172 (34.88%), Postives = 90/172 (52.33%), Query Frame = 1
Query:  247 LQNEWSLWFCKRDSSR-----DWTESLHLIEHFNTVEDFWRLIDHITPPFALPTGCDYYLFRRDIKPMWEHNTNRCGGSWQVTFKNSTRSLLLNRFWENLTMLLVGEGCGSDSEIVCGGVVNVRKMTDRLCLWVSNYEDKQQIMRIGRHIKRILEI--DFPIEFYPHIDVVK 741
            LQ  +SLWF +R   R     ++ +++  I  F +VE FWR   HI  P  L    D++LF+  IKPMWE + N+ GG W V      R  L +R WENL + ++GE      EI CG VV++R   D + +W     D+    RI   ++R+L +  +  +E+  H D +K
Sbjct:   47 LQYNYSLWFSRRTPGRQASKQNYEQNIKHIGTFASVEMFWRFYSHIVRPSDLTGHSDFHLFKEGIKPMWEDDANKSGGKWIVRL----RKGLASRCWENLILAMLGEQFMVGEEI-CGAVVSLRFQEDIISIWNKTASDQGTTSRIRDTLRRVLNLPPNTIMEYKTHTDSIK 213          
BLAST of Eukaryotic translation initiation factor 4E vs. Ensembl Yeast
Match: CDC33 (mRNA cap binding protein and translation initiation factor eIF4E; the eIF4E-cap complex is responsible for mediating cap-dependent mRNA translation via interactions with translation initiation factor eIF4G (Tif4631p or Tif4632p); protein abundance increases in response to DNA replication stress; mutants are defective for adhesion and pseudohyphal growth; human homolog EIF4E can complement yeast cdc33 null mutant [Source:SGD;Acc:S000005499])

HSP 1 Score: 116.316 bits (290), Expect = 4.002e-32
Identity = 56/164 (34.15%), Postives = 93/164 (56.71%), Query Frame = 1
Query:  247 LQNEWSLWFCKR--DSSRDWTESLHLIEHFNTVEDFWRLIDHITPPFALPTGCDYYLFRRDIKPMWEHNTNRCGGSWQVTFKNSTRSLLLNRFWENLTMLLVGEGCGSDSEIVCGGVVNVRKMTDRLCLWVSNYEDKQQIMRIGRHIKRILEI--DFPIEFYPH 726
            L  +W+LW+ K   D S  W++ L  +  F TVE+FW +I +I  P  LP   DY++FR D++P WE   N  GG W  +F+   +   ++  W    + ++GE    D   + G V+++RK  ++  LW  + EDK+ ++RIG   K++L++  D  +EF+PH
Sbjct:   39 LNTKWTLWYTKPAVDKSESWSDLLRPVTSFQTVEEFWAIIQNIPEPHELPLKSDYHVFRNDVRPEWEDEANAKGGKW--SFQLRGKGADIDELWLRTLLAVIGETIDEDDSQINGVVLSIRKGGNKFALWTKS-EDKEPLLRIGGKFKQVLKLTDDGHLEFFPH 199          
BLAST of Eukaryotic translation initiation factor 4E vs. Ensembl Nematostella
Match: EDO49832 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7REQ6])

HSP 1 Score: 134.42 bits (337), Expect = 4.945e-39
Identity = 67/166 (40.36%), Postives = 90/166 (54.22%), Query Frame = 1
Query:  247 LQNEWSLWFCKRDSSRDWTESLHLIEHFNTVEDFWRLIDHITPPFALPTGCDYYLFRRDIKPMWEHNTNRCGGSWQVTFKNSTRSLLLNRFWENLTMLLVGEGCGSDSEIVCGGVVNVRKMTDRLCLWVSNYEDKQQIMRIGRHIKRILEI--DFPIEFYPHIDVV 738
            LQN W LWF K D S+ W  +L  I  F+TVEDFW + +HI     L  GCDY LF+  I+PMWE   N+ GG W +    + R   L+RFW    + L+GE  G  SE VCG VV +R   D++ +W  N  D++   RIG+  K  L +     I +  H D +
Sbjct:    5 LQNRWVLWFFKNDKSKSWAANLRNITSFDTVEDFWGIYNHIQQASRLQPGCDYSLFKDGIEPMWEDKRNKDGGRWLINTNKNQRQSDLDRFWLETLLCLIGEAFGEYSEGVCGAVVQIRNKGDKIAVWTGNATDEEGTRRIGQVFKERLGLPPKMFIGYQAHQDTM 170          
BLAST of Eukaryotic translation initiation factor 4E vs. Ensembl Nematostella
Match: EDO43460 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYG8])

HSP 1 Score: 103.219 bits (256), Expect = 2.537e-26
Identity = 58/173 (33.53%), Postives = 90/173 (52.02%), Query Frame = 1
Query:  247 LQNEWSLWFCKR-----DSSRDWTESLHLIEHFNTVEDFWRLIDHITPPFALPTGCDYYLFRRDIKPMWEHNTNRCGGSWQVTFKNSTRSLLLNRFWENLTMLLVGEGCGSDSEIVCGGVVNVRKMTDRLCLWVSNYEDKQQIMRIGRHIKRILEI--DFPIEFYPHIDVVKN 744
            LQ  +  WF +R      S+ ++ +++ ++  F +VE FW     +  P  L    D +LF+  IKPMWE   N+CGG W V      R  L +R WENL + ++GE     SE VCG V++VR   D + +W  N  D+    RI   +KR+L +  +  +E+  H D +K+
Sbjct:   70 LQCPYVFWFSRRPPGKIQSATNYADNIKIVGKFASVEQFWGFYSFMVRPGELTGHSDIHLFKDGIKPMWEDEANKCGGKWIVRL----RKGLASRCWENLVLAMLGEQFMVGSE-VCGAVISVRFQEDIISIWNRNAADQATTTRIRDTLKRVLNLPPNTIMEYKAHQDSIKD 237          
BLAST of Eukaryotic translation initiation factor 4E vs. Ensembl Nematostella
Match: EDO26680 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TBC7])

HSP 1 Score: 69.3218 bits (168), Expect = 4.346e-15
Identity = 36/104 (34.62%), Postives = 52/104 (50.00%), Query Frame = 1
Query:  433 MWEHNTNRCGGSWQVTFKNSTRSLLLNRFWENLTMLLVGEGCGSDSEIVCGGVVNVRKMTDRLCLWVSNYEDKQQIMRIGRHIKRILEI--DFPIEFYPHIDVV 738
            MWE   N+ GG W +    + R   L+RFW    + L+GE  G  SE VCG VV +R   D++ +W  N  D++   RIG+  K  L +     I +  H D +
Sbjct:    1 MWEDKRNKDGGRWLINTNKNQRQSDLDRFWLETLLCLIGEAFGEYSEGVCGAVVQIRNKGDKIAVWTGNATDEEGTRRIGQVFKERLGLPPKMFIGYQAHQDTM 104          
BLAST of Eukaryotic translation initiation factor 4E vs. Ensembl Nematostella
Match: EDO39481 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SA12])

HSP 1 Score: 51.2174 bits (121), Expect = 2.231e-8
Identity = 26/105 (24.76%), Postives = 53/105 (50.48%), Query Frame = 1
Query:  247 LQNEWSLW---FCKRDSSRDWTESLHLIEHFNTVEDFWRLIDHITPPFALPTGCDYYLFRRDIKPMWEHNTNRCGGSWQVTFKNSTRSLLLNRFWENLTMLLVGE 552
            L + W+LW   + +  ++ ++  +L  I +F+TV+ FW + ++I     L +   Y+  R   +P+WE   N  GG W++         + ++ W+ L +  +GE
Sbjct:   19 LNSSWTLWHDRYIRGATAAEYAANLRKIYNFHTVQSFWSVFNNIPKASELGSRASYHCMRGVRRPIWEDAENANGGYWKMRCPKD----MTDKVWKELLLAAIGE 119          
BLAST of Eukaryotic translation initiation factor 4E vs. Ensembl Medaka
Match: eif4eb (eukaryotic translation initiation factor 4E [Source:NCBI gene;Acc:101166761])

HSP 1 Score: 150.599 bits (379), Expect = 2.145e-44
Identity = 74/166 (44.58%), Postives = 96/166 (57.83%), Query Frame = 1
Query:  247 LQNEWSLWFCKRDSSRDWTESLHLIEHFNTVEDFWRLIDHITPPFALPTGCDYYLFRRDIKPMWEHNTNRCGGSWQVTFKNSTRSLLLNRFWENLTMLLVGEGCGSDSEIVCGGVVNVRKMTDRLCLWVSNYEDKQQIMRIGRHIKRILEI--DFPIEFYPHIDVV 738
            LQN WSLWF K D S+ W  +L LI  F+TVEDFW L +HI     L +GCDY LF+  I+PMWE   N+ GG W +T     R   L+RFW    + LVGE     S+ VCG VVNVR   D++ +W SNYE+++ +  IGR  K  L +  +  I +  H D  
Sbjct:   38 LQNRWSLWFYKNDKSKTWQANLRLISKFDTVEDFWALYNHIQVSSNLISGCDYSLFKDGIEPMWEDERNKRGGRWLITLNKQLRRSDLDRFWLETLLCLVGEAFDDYSDDVCGAVVNVRNKGDKIAVWTSNYENREAVTHIGRVYKERLGLPMNMTIGYQSHADTA 203          
BLAST of Eukaryotic translation initiation factor 4E vs. Ensembl Medaka
Match: eif4eb (eukaryotic translation initiation factor 4E [Source:NCBI gene;Acc:101166761])

HSP 1 Score: 150.214 bits (378), Expect = 5.322e-44
Identity = 74/169 (43.79%), Postives = 97/169 (57.40%), Query Frame = 1
Query:  247 LQNEWSLWFCKRDSSRDWTESLHLIEHFNTVEDFWRLIDHITPPFALPTGCDYYLFRRDIKPMWEHNTNRCGGSWQVTFKNSTRSLLLNRFWENLTMLLVGEGCGSDSEIVCGGVVNVRKMTDRLCLWVSNYEDKQQIMRIGRHIKRILEI--DFPIEFYPHIDVVKNA 747
            LQN WSLWF K D S+ W  +L LI  F+TVEDFW L +HI     L +GCDY LF+  I+PMWE   N+ GG W +T     R   L+RFW    + LVGE     S+ VCG VVNVR   D++ +W SNYE+++ +  IGR  K  L +  +  I +  H D    +
Sbjct:   65 LQNRWSLWFYKNDKSKTWQANLRLISKFDTVEDFWALYNHIQVSSNLISGCDYSLFKDGIEPMWEDERNKRGGRWLITLNKQLRRSDLDRFWLETLLCLVGEAFDDYSDDVCGAVVNVRNKGDKIAVWTSNYENREAVTHIGRVYKERLGLPMNMTIGYQSHADTATKS 233          
BLAST of Eukaryotic translation initiation factor 4E vs. Ensembl Medaka
Match: eif4e1c (eukaryotic translation initiation factor 4E [Source:NCBI gene;Acc:101169085])

HSP 1 Score: 148.288 bits (373), Expect = 1.053e-43
Identity = 74/165 (44.85%), Postives = 98/165 (59.39%), Query Frame = 1
Query:  247 LQNEWSLWFCKRDSSRDWTESLHLIEHFNTVEDFWRLIDHITPPFALPTGCDYYLFRRDIKPMWEHNTNRCGGSWQVTFKNSTRSLLLNRFWENLTMLLVGEGCGSDSEIVCGGVVNVRKMTDRLCLWVSNYEDKQQIMRIGRHIKRILEIDFP--IEFYPHIDV 735
            LQN W+LW+ K D ++ WTE+L LI  F+TVEDFW L +HI  P  L  GCDY LF+  IKPMWE + N+ GG W +T  N  +   L+R+W    + LVGE     SE VCG VVNVR   D++ +W  N ++K+ IM IG+  K  L +     I +  H D 
Sbjct:   33 LQNRWALWYFKNDKTKSWTENLRLISKFDTVEDFWALYNHIQQPSKLVLGCDYCLFKDGIKPMWEDDKNKLGGRWLMTL-NKQKHNDLDRYWMETLLCLVGESFDDASEEVCGAVVNVRHKGDKISIWTGNCQNKEAIMTIGQLYKERLNLPMKAIIGYQSHDDT 196          
BLAST of Eukaryotic translation initiation factor 4E vs. Ensembl Medaka
Match: eif4ea (eukaryotic translation initiation factor 4E-1A [Source:NCBI gene;Acc:100049330])

HSP 1 Score: 149.058 bits (375), Expect = 2.418e-43
Identity = 87/244 (35.66%), Postives = 125/244 (51.23%), Query Frame = 1
Query:   61 EENEIVNC----HEKENIKFSQVA--TDESQLNSNCEVPNPLAILPP-------DSDEVSNSNSIDSKDETAFNYLQNEWSLWFCKRDSSRDWTESLHLIEHFNTVEDFWRLIDHITPPFALPTGCDYYLFRRDIKPMWEHNTNRCGGSWQVTFKNSTRSLLLNRFWENLTMLLVGEGCGSDSEIVCGGVVNVRKMTDRLCLWVSNYEDKQQIMRIGRHIKRILEI--DFPIEFYPHIDVVKNA 747
            +EN +V C    H +  I+  Q+A  TD   L    +      ++         +  E+SN   I + +    + LQN W+LWF K D S+ W  +L LI  F+TVEDFW L +HI     L +GCDY LF+  I+PMWE   NR GG W +T     R + L+RFW    + LVGE     S+ VCG V+N+R   D++ +W +N E+K+ I +IGR  K  L +     I +  H D    +
Sbjct:   13 KENLLVFCFVINHLRMRIEVPQLAILTDAKSLREEFQKMATAVVVSTSIPGNLEEKSEISNGK-IGNPEACIKHPLQNRWTLWFFKNDKSKTWQANLRLISTFDTVEDFWALYNHIQLSSNLMSGCDYSLFKDGIEPMWEDERNRRGGRWLITLSKQQRKMDLDRFWLETLLCLVGEAFDDHSDDVCGAVINIRAKGDKIAIWTTNCENKEAITQIGRVYKERLGVPPKVIIGYQSHADTATKS 255          
BLAST of Eukaryotic translation initiation factor 4E vs. Ensembl Medaka
Match: eif4e1c (eukaryotic translation initiation factor 4E [Source:NCBI gene;Acc:101169085])

HSP 1 Score: 147.132 bits (370), Expect = 4.167e-43
Identity = 74/165 (44.85%), Postives = 98/165 (59.39%), Query Frame = 1
Query:  247 LQNEWSLWFCKRDSSRDWTESLHLIEHFNTVEDFWRLIDHITPPFALPTGCDYYLFRRDIKPMWEHNTNRCGGSWQVTFKNSTRSLLLNRFWENLTMLLVGEGCGSDSEIVCGGVVNVRKMTDRLCLWVSNYEDKQQIMRIGRHIKRILEIDFP--IEFYPHIDV 735
            LQN W+LW+ K D ++ WTE+L LI  F+TVEDFW L +HI  P  L  GCDY LF+  IKPMWE + N+ GG W +T  N  +   L+R+W    + LVGE     SE VCG VVNVR   D++ +W  N ++K+ IM IG+  K  L +     I +  H D 
Sbjct:   39 LQNRWALWYFKNDKTKSWTENLRLISKFDTVEDFWALYNHIQQPSKLVLGCDYCLFKDGIKPMWEDDKNKLGGRWLMTL-NKQKHNDLDRYWMETLLCLVGESFDDASEEVCGAVVNVRHKGDKISIWTGNCQNKEAIMTIGQLYKERLNLPMKAIIGYQSHDDT 202          
BLAST of Eukaryotic translation initiation factor 4E vs. Planmine SMEST
Match: SMESG000074929.1 (SMESG000074929.1)

HSP 1 Score: 505.753 bits (1301), Expect = 0.000e+0
Identity = 243/243 (100.00%), Postives = 243/243 (100.00%), Query Frame = 1
Query:   55 MSEENEIVNCHEKENIKFSQVATDESQLNSNCEVPNPLAILPPDSDEVSNSNSIDSKDETAFNYLQNEWSLWFCKRDSSRDWTESLHLIEHFNTVEDFWRLIDHITPPFALPTGCDYYLFRRDIKPMWEHNTNRCGGSWQVTFKNSTRSLLLNRFWENLTMLLVGEGCGSDSEIVCGGVVNVRKMTDRLCLWVSNYEDKQQIMRIGRHIKRILEIDFPIEFYPHIDVVKNALYSGRGRPLLEL 783
            MSEENEIVNCHEKENIKFSQVATDESQLNSNCEVPNPLAILPPDSDEVSNSNSIDSKDETAFNYLQNEWSLWFCKRDSSRDWTESLHLIEHFNTVEDFWRLIDHITPPFALPTGCDYYLFRRDIKPMWEHNTNRCGGSWQVTFKNSTRSLLLNRFWENLTMLLVGEGCGSDSEIVCGGVVNVRKMTDRLCLWVSNYEDKQQIMRIGRHIKRILEIDFPIEFYPHIDVVKNALYSGRGRPLLEL
Sbjct:    1 MSEENEIVNCHEKENIKFSQVATDESQLNSNCEVPNPLAILPPDSDEVSNSNSIDSKDETAFNYLQNEWSLWFCKRDSSRDWTESLHLIEHFNTVEDFWRLIDHITPPFALPTGCDYYLFRRDIKPMWEHNTNRCGGSWQVTFKNSTRSLLLNRFWENLTMLLVGEGCGSDSEIVCGGVVNVRKMTDRLCLWVSNYEDKQQIMRIGRHIKRILEIDFPIEFYPHIDVVKNALYSGRGRPLLEL 243          
BLAST of Eukaryotic translation initiation factor 4E vs. Planmine SMEST
Match: SMESG000031703.1 (SMESG000031703.1)

HSP 1 Score: 163.696 bits (413), Expect = 1.072e-49
Identity = 76/182 (41.76%), Postives = 113/182 (62.09%), Query Frame = 1
Query:  190 DEVSNSNSIDSKDETAFNYLQNEWSLWFCKRDSSRDWTESLHLIEHFNTVEDFWRLIDHITPPFALPTGCDYYLFRRDIKPMWEHNTNRCGGSWQVTFKNSTRSLLLNRFWENLTMLLVGEGCGSDSEIVCGGVVNVRKMTDRLCLWVSNYEDKQQIMRIGRHIKRILEIDFPIEFYPHIDV 735
            DE +  N      ++  +YLQN+W+ +F K D S+DW +++  +  F+TVEDFW L++HI PP  LP+GCDYY+F+  I+PMWE + N+ GG W +TF+ + R   L+  W  + MLLVGE    DS+ +CG VVN+R   DR+ +W ++    + I RIG+ IK  L +   IE+  H D 
Sbjct:   17 DEDNEENLKSLAGDSELHYLQNKWTFYFFKNDRSKDWIDNMKKVIDFDTVEDFWGLMNHIAPPSKLPSGCDYYVFKDVIQPMWEDDRNKNGGMWLLTFEKNQRISHLDPCWLEILMLLVGETFEDDSDEICGAVVNIRGKGDRVSVWTTDCSSAEAIKRIGQKIKDALGLTCAIEYTAHTDA 198          
BLAST of Eukaryotic translation initiation factor 4E vs. Planmine SMEST
Match: SMESG000046515.1 (SMESG000046515.1)

HSP 1 Score: 132.109 bits (331), Expect = 8.539e-38
Identity = 56/164 (34.15%), Postives = 91/164 (55.49%), Query Frame = 1
Query:  235 AFNYLQNEWSLWFCKRDSSRDWTESLHLIEHFNTVEDFWRLIDHITPPFALPTGCDYYLFRRDIKPMWEHNTNRCGGSWQVTFKNSTRSLLLNRFWENLTMLLVGEGCGSDSEIVCGGVVNVRKMTDRLCLWVSNYEDKQQIMRIGRHIKRILEIDFPIEFYPH 726
              N L +EW +++ K D  + W +++  I   ++VE FW ++ H+ P   +  GCDYY FR+ I PMWE+  N+ GG+W ++   S R   LN  W  + M L+GE    DS  +CG  +N+R   D++ +W +N  + +   RIG  +K +L +   IE+  H
Sbjct:   10 TINKLADEWKIYYFKMDKEKRWIDNMKTIFTVDSVESFWGILRHLKPVSDMSYGCDYYFFRKHIAPMWENEFNQNGGTWVISSHKSKRHSELNSMWTEVLMFLIGETTNEDSSEICGAAINIRGNYDKITVWTANSANDETNKRIGLQLKSLLNLTTTIEYISH 173          
BLAST of Eukaryotic translation initiation factor 4E vs. Planmine SMEST
Match: SMESG000062612.1 (SMESG000062612.1)

HSP 1 Score: 130.954 bits (328), Expect = 2.614e-37
Identity = 61/178 (34.27%), Postives = 101/178 (56.74%), Query Frame = 1
Query:  199 SNSNSIDSKDETAFNYLQNEWSLWFCKRDSSRDWTESLHLIEHFNTVEDFWRLIDHITPPFALPTGCDYYLFRRDIKPMWEHNTNRCGGSWQVTFKNSTRSLLLNRFWENLTMLLVGEGCGSDSEIVCGGVVNVRKMTDRLCLWVSNYEDKQQIMRIGRHIKRILEIDFPIEFYPHID 732
            SN+N   S  ET    L ++W+ ++ K D  + W E+++ I   +++E FW ++ H+ P   L  G D+Y FR  I+PMWE  +N+ GG+W ++   S R   L+  W  L M L+GE    DS+++CG  +N+R   D++ +W S+  + +   RIG  +K IL +   IE+  HI+
Sbjct:    3 SNTNENKSHCETV-TKLADQWNFYYFKLDKKKQWIENMNKILTIDSIESFWGIMHHLKPISTLNFGSDFYFFRSHIRPMWEDTSNQNGGTWIISSHKSKRHTELDILWMELLMFLIGETMDEDSDLICGAAINIRGTNDKITVWTSDSSNLEANRRIGMKLKSILNLHDTIEYISHIN 179          
BLAST of Eukaryotic translation initiation factor 4E vs. Planmine SMEST
Match: SMESG000017108.1 (SMESG000017108.1)

HSP 1 Score: 122.479 bits (306), Expect = 6.969e-34
Identity = 62/181 (34.25%), Postives = 96/181 (53.04%), Query Frame = 1
Query:  226 DETAFNYLQNEWSLWFCKRDSSRDWTES-LHLIEHFNTVEDFWRLIDHITPPFALPTGCDYYLFRRDIKPMWEHNTNRCGGSWQVTFKNSTRSLLLNRFWENLTMLLVGEGCGSDSE----IVCGGVVNVRKMTDRLCLWVSNYEDKQQIMRIGRHIKRILEIDFPIEFYPHIDVVKNALY 753
            DE   +YL ++W +WF   DS+  W E+ L  I  FNTVE+FW +  H+  P  L  G D  LF+  IKP+WE  +N+ GGSW + F  +     L   WE + + ++ +    + E     +CG  VN+R   D++ LW+ +   K  I++IGR +K  L     + +Y H D +K+  Y
Sbjct:    9 DEEKLHYLNDKWCMWFMYYDSNSVWKETNLQQIFEFNTVEEFWGMFYHLKSPMDLKNGRDLSLFKSGIKPVWEDASNKGGGSWTIHFPRNENRTKLTIIWEEILLFVISDIVDENEEDLNQFICGVAVNIRGKVDKISLWIHHQSQKDSILKIGRKLKEWLNYSSTLNYYSH-DHMKSRTY 188          
The following BLAST results are available for this feature:
BLAST of Eukaryotic translation initiation factor 4E vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
EIF4E4.487e-4039.77eukaryotic translation initiation factor 4E [Sourc... [more]
EIF4E4.585e-4039.77eukaryotic translation initiation factor 4E [Sourc... [more]
EIF4E7.745e-4039.77eukaryotic translation initiation factor 4E [Sourc... [more]
EIF4E1B8.038e-4039.76eukaryotic translation initiation factor 4E family... [more]
EIF4E1B8.038e-4039.76eukaryotic translation initiation factor 4E family... [more]
back to top
BLAST of Eukaryotic translation initiation factor 4E vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ife-36.406e-3841.72Eukaryotic translation initiation factor 4E-3 [So... [more]
ife-36.406e-3841.72Eukaryotic translation initiation factor 4E-3 [So... [more]
ife-33.730e-3641.56Eukaryotic translation initiation factor 4E-3 [So... [more]
ife-33.730e-3641.56Eukaryotic translation initiation factor 4E-3 [So... [more]
ife-35.868e-3641.18Eukaryotic translation initiation factor 4E-3 [So... [more]
back to top
BLAST of Eukaryotic translation initiation factor 4E vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
eIF4E71.785e-3637.20gene:FBgn0040368 transcript:FBtr0070252[more]
eIF4E17.376e-3433.13gene:FBgn0015218 transcript:FBtr0076488[more]
eIF4E11.091e-3335.10gene:FBgn0015218 transcript:FBtr0076493[more]
eIF4E11.091e-3335.10gene:FBgn0015218 transcript:FBtr0076489[more]
eIF4E11.091e-3335.10gene:FBgn0015218 transcript:FBtr0076490[more]
back to top
BLAST of Eukaryotic translation initiation factor 4E vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
eif4e1c1.967e-4446.36eukaryotic translation initiation factor 4E family... [more]
eif4e1c3.591e-4446.36eukaryotic translation initiation factor 4E family... [more]
eif4e1c3.591e-4446.36eukaryotic translation initiation factor 4E family... [more]
eif4e1b7.116e-4441.42eukaryotic translation initiation factor 4E family... [more]
eif4e1b1.613e-4341.42eukaryotic translation initiation factor 4E family... [more]
back to top
BLAST of Eukaryotic translation initiation factor 4E vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
snx16.197e-4336.62sorting nexin 1 [Source:Xenbase;Acc:XB-GENE-992259... [more]
snx17.042e-4235.98sorting nexin 1 [Source:Xenbase;Acc:XB-GENE-992259... [more]
ENSXETT00000049404.13.203e-3637.95eukaryotic translation initiation factor 4E family... [more]
ENSXETT00000049401.17.957e-3637.28eukaryotic translation initiation factor 4E family... [more]
txnrd11.657e-2632.77thioredoxin reductase 1 [Source:Xenbase;Acc:XB-GEN... [more]
back to top
BLAST of Eukaryotic translation initiation factor 4E vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Eif4e1b5.683e-4042.01eukaryotic translation initiation factor 4E family... [more]
Eif4e5.797e-4039.77eukaryotic translation initiation factor 4E [Sourc... [more]
Eif4e1b5.852e-4042.01eukaryotic translation initiation factor 4E family... [more]
Eif4e1b5.945e-4042.01eukaryotic translation initiation factor 4E family... [more]
Eif4e1b5.945e-4042.01eukaryotic translation initiation factor 4E family... [more]
back to top
BLAST of Eukaryotic translation initiation factor 4E vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9PW28|IF4EB_DANRE1.218e-4241.42Eukaryotic translation initiation factor 4E-1B OS=... [more]
sp|P48597|IF4E_XENLA1.262e-4238.97Eukaryotic translation initiation factor 4E OS=Xen... [more]
sp|Q9DFS6|IF4EA_DANRE2.144e-4242.60Eukaryotic translation initiation factor 4E-1A OS=... [more]
sp|O77210|IF4E_APLCA5.095e-4138.64Eukaryotic translation initiation factor 4E OS=Apl... [more]
sp|Q9N0T5|IF4E_BOVIN1.208e-3939.77Eukaryotic translation initiation factor 4E OS=Bos... [more]
back to top
BLAST of Eukaryotic translation initiation factor 4E vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3Q2YZP11.241e-4443.10Eukaryotic translation initiation factor 4E family... [more]
A0A5N5ST683.282e-4437.04Eukaryotic translation initiation factor 4E OS=Arm... [more]
A0A444UN534.238e-4442.56Eukaryotic translation initiation factor 4E OS=Aci... [more]
A0A3B4BNX21.030e-4341.95Eukaryotic translation initiation factor 4E family... [more]
A0A4W4G8F61.198e-4341.95Uncharacterized protein OS=Electrophorus electricu... [more]
back to top
BLAST of Eukaryotic translation initiation factor 4E vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
eif4e1c4.783e-4541.71eukaryotic translation initiation factor 4E-like [... [more]
eif4eb9.019e-4443.79eukaryotic translation initiation factor 4E-1A [So... [more]
eif4ea1.599e-4343.37eukaryotic translation initiation factor 4E-1A [So... [more]
eif4e1b2.098e-2633.33eukaryotic translation initiation factor 4E family... [more]
eif4e27.897e-2632.56eukaryotic translation initiation factor 4E family... [more]
back to top
BLAST of Eukaryotic translation initiation factor 4E vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000001509.13.105e-3937.82pep scaffold:Pmarinus_7.0:GL501028:982:8648:-1 gen... [more]
eif4e22.139e-2734.88eukaryotic translation initiation factor 4E family... [more]
back to top
BLAST of Eukaryotic translation initiation factor 4E vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
CDC334.002e-3234.15mRNA cap binding protein and translation initiatio... [more]
back to top
BLAST of Eukaryotic translation initiation factor 4E vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO498324.945e-3940.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO434602.537e-2633.53Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO266804.346e-1534.62Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO394812.231e-824.76Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Eukaryotic translation initiation factor 4E vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
eif4eb2.145e-4444.58eukaryotic translation initiation factor 4E [Sourc... [more]
eif4eb5.322e-4443.79eukaryotic translation initiation factor 4E [Sourc... [more]
eif4e1c1.053e-4344.85eukaryotic translation initiation factor 4E [Sourc... [more]
eif4ea2.418e-4335.66eukaryotic translation initiation factor 4E-1A [So... [more]
eif4e1c4.167e-4344.85eukaryotic translation initiation factor 4E [Sourc... [more]
back to top
BLAST of Eukaryotic translation initiation factor 4E vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000074929.10.000e+0100.00SMESG000074929.1[more]
SMESG000031703.11.072e-4941.76SMESG000031703.1[more]
SMESG000046515.18.539e-3834.15SMESG000046515.1[more]
SMESG000062612.12.614e-3734.27SMESG000062612.1[more]
SMESG000017108.16.969e-3434.25SMESG000017108.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30028475 ID=SMED30028475|Name=Eukaryotic translation initiation factor 4E|organism=Schmidtea mediterranea sexual|type=transcript|length=835bp
AGTTAATACAATTTATTAACTGAAAATTAAAAGAAACAATCGATAGATTT
CTGTATGTCTGAAGAAAATGAAATTGTAAATTGCCATGAAAAAGAAAACA
TCAAATTCAGTCAAGTGGCAACCGATGAAAGCCAGCTGAACAGTAATTGT
GAGGTTCCGAATCCATTGGCAATTTTGCCTCCGGATAGTGACGAAGTCAG
CAATTCCAACTCCATTGATTCGAAAGATGAAACCGCTTTCAACTATTTAC
AAAATGAGTGGAGTTTATGGTTTTGCAAGCGGGACTCAAGTCGAGATTGG
ACTGAAAGTTTGCATTTGATTGAGCATTTTAACACAGTTGAAGATTTCTG
GAGACTAATTGACCACATAACACCGCCGTTCGCCCTGCCGACCGGATGTG
ACTATTATCTGTTTAGACGAGACATCAAGCCAATGTGGGAGCACAATACA
AATCGATGTGGCGGAAGCTGGCAAGTGACATTCAAAAATAGCACGAGATC
TTTGCTATTGAATAGGTTTTGGGAGAACTTGACTATGCTTCTTGTCGGAG
AAGGATGCGGCTCAGATTCTGAGATCGTATGCGGAGGTGTTGTTAATGTG
AGAAAGATGACCGATAGACTGTGTTTATGGGTGTCGAATTATGAAGATAA
ACAACAAATTATGCGAATTGGGAGGCACATTAAAAGAATTCTGGAAATTG
ATTTTCCGATTGAGTTTTATCCTCATATTGATGTGGTTAAAAATGCTTTA
TATTCAGGACGTGGAAGGCCTTTATTGGAATTATAATGGACTTTTCCGTT
ATTGTTCAGAGTTTACAAAGTTTCTTTTCGTTGAG
back to top

protein sequence of SMED30028475-orf-1

>SMED30028475-orf-1 ID=SMED30028475-orf-1|Name=SMED30028475-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=244bp
MSEENEIVNCHEKENIKFSQVATDESQLNSNCEVPNPLAILPPDSDEVSN
SNSIDSKDETAFNYLQNEWSLWFCKRDSSRDWTESLHLIEHFNTVEDFWR
LIDHITPPFALPTGCDYYLFRRDIKPMWEHNTNRCGGSWQVTFKNSTRSL
LLNRFWENLTMLLVGEGCGSDSEIVCGGVVNVRKMTDRLCLWVSNYEDKQ
QIMRIGRHIKRILEIDFPIEFYPHIDVVKNALYSGRGRPLLEL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003304testis primordium
Vocabulary: INTERPRO
TermDefinition
IPR001040TIF_eIF_4E
IPR023398TIF_eIF4e-like
Vocabulary: molecular function
TermDefinition
GO:0003723RNA binding
GO:0003743translation initiation factor activity
GO:0000340RNA 7-methylguanosine cap binding
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005634nucleus
GO:0005845mRNA cap binding complex
GO:0016281eukaryotic translation initiation factor 4F complex
Vocabulary: biological process
TermDefinition
GO:0006413translational initiation
GO:0006412translation
GO:0006417regulation of translation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001040Translation Initiation factor eIF- 4ePFAMPF01652IF4Ecoord: 65..215
e-value: 3.7E-47
score: 160.1
IPR001040Translation Initiation factor eIF- 4ePANTHERPTHR11960EUKARYOTIC TRANSLATION INITIATION FACTOR 4E RELATEDcoord: 49..215
IPR023398Translation Initiation factor eIF- 4e-likeGENE3DG3DSA:3.30.760.10coord: 54..235
e-value: 5.3E-54
score: 184.6
IPR023398Translation Initiation factor eIF- 4e-likeSUPERFAMILYSSF55418eIF4e-likecoord: 59..227
NoneNo IPR availablePANTHERPTHR11960:SF29EUKARYOTIC TRANSLATION INITIATION FACTOR 4E FAMILY MEMBER 1Ccoord: 49..215