Protein XRP2

Overview
NameProtein XRP2
Smed IDSMED30028470
Length (bp)4355
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein XRP2 (SMED30028470) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein XRP2 (SMED30028470) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein XRP2 (SMED30028470) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein XRP2 (SMED30028470) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30028470

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 12

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30028470h1SMcG0005113 SmedASXL_029937SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30028470h1SMcG0005113 SmedASXL_069443SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30028470h1SMcG0005113 SmedASXL_061915SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30028470h1SMcG0005113 SmedASXL_010670SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30028470h1SMcG0005113 dd_Smed_v4_7134_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30028470h1SMcG0005113 dd_Smed_v6_28686_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30028470h1SMcG0005113 dd_Smed_v6_7134_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30028470h1SMcG0005113 dd_Smed_v6_33679_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30028470h1SMcG0005113 OX_Smed_1.0.04548ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
reproductive organSMED30028470h1SMcG0005113 Contig19715newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30028470h1SMcG0005113 Contig19715uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
epidermisSMED30028470h1SMcG0005113 dd_Smed_v4_7134_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein XRP2 vs. Ensembl Human
Match: RP2 (RP2 activator of ARL3 GTPase [Source:HGNC Symbol;Acc:HGNC:10274])

HSP 1 Score: 206.453 bits (524), Expect = 4.094e-58
Identity = 97/205 (47.32%), Postives = 136/205 (66.34%), Query Frame = 3
Query:   33 MGSILCCDKNSDEES--QHIVSKPPEYSWDQKKKLNPKDYTIENCNDSCTGRLPQTINGEQFIIQNCKNARIYLLDHIGSITVDDCTDCDIVIGPVKTSIFIRDCNKCNFMVACQQFRTRDCRNLNVFLSCTSQPIIEATSKFKVGSYQLYYPDLAEQFEKANLSPFNCIWSDIHDFSHDSEQGSNFSFIHEETKPFDIITSPAS 641
            MG      + +D+ES  ++   +P +YSWDQ++K++PKDY      D   GRLP T+ G+QF+IQ+C+N  IY+ DH  ++T+DDCT+C I +GPVK S+F R+C  C   +ACQQFR RDCR L VFL C +QPIIE++S  K G +Q YYP+LA QF+ A LS FN  WS+IHDF+  S +  N+S + E+    D +  P +
Sbjct:    1 MGCFFSKRRKADKESRPENEEERPKQYSWDQREKVDPKDYMFSGLKDETVGRLPGTVAGQQFLIQDCENCNIYIFDHSATVTIDDCTNCIIFLGPVKGSVFFRNCRDCKCTLACQQFRVRDCRKLEVFLCCATQPIIESSSNIKFGCFQWYYPELAFQFKDAGLSIFNNTWSNIHDFTPVSGE-LNWSLLPEDAVVQDYVPIPTT 204          
BLAST of Protein XRP2 vs. Ensembl Human
Match: TBCC (tubulin folding cofactor C [Source:HGNC Symbol;Acc:HGNC:11580])

HSP 1 Score: 78.9518 bits (193), Expect = 1.211e-14
Identity = 39/135 (28.89%), Postives = 69/135 (51.11%), Query Frame = 3
Query:  213 IIQNCKNARIYLLDHIGSITVDDCTDCDIVIGPVKTSIFIRDCNKCNFMVACQQFRTRDCRNLNVFLSCTSQPIIEATSKFKVGSYQLYYPDLAEQFEKANLSPFNCIWSDIHDFSHDSEQGS--NFSFIHEETK 611
            ++    N  + L  +  ++ +     C ++ GPV TS+F+ DC+ C   VACQQ R    ++  +FL  TS+ I+E  S  +   Y   YP++ + FE + L      W+D+ DF+  +   +  N+S + EE +
Sbjct:  207 LLTELSNCTVRLYGNPNTLRLTKAHSCKLLCGPVSTSVFLEDCSDCVLAVACQQLRIHSTKDTRIFLQVTSRAIVEDCSGIQFAPYTWSYPEIDKDFESSGLDRSKNNWNDVDDFNWLARDMASPNWSILPEEER 341          
BLAST of Protein XRP2 vs. Ensembl Human
Match: SETMAR (SET domain and mariner transposase fusion gene [Source:HGNC Symbol;Acc:HGNC:10762])

HSP 1 Score: 73.9442 bits (180), Expect = 1.277e-12
Identity = 35/98 (35.71%), Postives = 57/98 (58.16%), Query Frame = 1
Query: 2812 WFEIFERGDFDIFYKPRFGRPSLIDDDVVKTMLEQNPFLTTSAIAERLNSAQQTISDHVRMIGLVWKYSRWMSHLLSQKNLDYRVTIFTSLRARNKIE 3105
            WF+ F +GD  +  + R GRPS +D+D ++ ++E +P  TT  +AE LN    T+  H++ IG V K  +W+ H L++   + R  + +SL  RN  E
Sbjct:  250 WFKKFCKGDESLEDEERSGRPSEVDNDQLRAIIEADPLTTTREVAEELNVNHSTVVRHLKQIGKVKKLDKWVPHELTENQKNRRFEVSSSLILRNHNE 347          
BLAST of Protein XRP2 vs. Ensembl Human
Match: SETMAR (SET domain and mariner transposase fusion gene [Source:HGNC Symbol;Acc:HGNC:10762])

HSP 1 Score: 73.9442 bits (180), Expect = 1.746e-12
Identity = 35/98 (35.71%), Postives = 57/98 (58.16%), Query Frame = 1
Query: 2812 WFEIFERGDFDIFYKPRFGRPSLIDDDVVKTMLEQNPFLTTSAIAERLNSAQQTISDHVRMIGLVWKYSRWMSHLLSQKNLDYRVTIFTSLRARNKIE 3105
            WF+ F +GD  +  + R GRPS +D+D ++ ++E +P  TT  +AE LN    T+  H++ IG V K  +W+ H L++   + R  + +SL  RN  E
Sbjct:  389 WFKKFCKGDESLEDEERSGRPSEVDNDQLRAIIEADPLTTTREVAEELNVNHSTVVRHLKQIGKVKKLDKWVPHELTENQKNRRFEVSSSLILRNHNE 486          
BLAST of Protein XRP2 vs. Ensembl Human
Match: SETMAR (SET domain and mariner transposase fusion gene [Source:HGNC Symbol;Acc:HGNC:10762])

HSP 1 Score: 51.9878 bits (123), Expect = 2.015e-6
Identity = 22/60 (36.67%), Postives = 37/60 (61.67%), Query Frame = 1
Query: 2812 WFEIFERGDFDIFYKPRFGRPSLIDDDVVKTMLEQNPFLTTSAIAERLNSAQQTISDHVR 2991
            WF+ F +GD  +  + R GRPS +D+D ++ ++E +P  TT  +AE LN    T+  H++
Sbjct:  153 WFKKFCKGDESLEDEERSGRPSEVDNDQLRAIIEADPLTTTREVAEELNVNHSTVVRHLK 212          
BLAST of Protein XRP2 vs. Ensembl Celegans
Match: rpi-2 (pep chromosome:WBcel235:IV:1711279:1714179:1 gene:WBGene00019536.1 transcript:K08D12.2.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:rpi-2)

HSP 1 Score: 130.568 bits (327), Expect = 1.860e-32
Identity = 58/172 (33.72%), Postives = 97/172 (56.40%), Query Frame = 3
Query:   90 SKPPEYSWDQKKKLNPKDYTIENCNDSCTGRLPQTINGEQFIIQNCKNARIYLLDHIGSITVDDCTDCDIVIGPVKTSIFIRDCNKCNFMVACQQFRTRDCRNLNVFLSCTSQPIIEATSKFKVGSYQLYYPDLAEQFEKANLSPFNCIWSDIHDFSHDSEQG-SNFSFIHE 602
             +PP+YSWD+++K+N +D+TI N +++   +  ++ +G    ++NC ++ I  L     + +DDC  C IV+GP   S+F+RDC  C    +CQQ RTRDC ++ + + C ++PI+E +S        + YP+L +Q     L PF    + +HDF+     G  NF    E
Sbjct:   34 GEPPKYSWDRREKVNAEDFTIANIHNTTLKK--ESKDGGPLQMENCTDSTILYLYQTSQVIIDDCRHCTIVLGPAAGSVFVRDCANCTIFTSCQQLRTRDCTSIRISILCPTEPIVENSSDIHFFHLAMRYPELKDQMHAVGLRPFTNRIASVHDFTPAGVNGKGNFRVTPE 203          
BLAST of Protein XRP2 vs. Ensembl Fly
Match: TBCC (gene:FBgn0051961 transcript:FBtr0077484)

HSP 1 Score: 70.0922 bits (170), Expect = 4.753e-12
Identity = 32/122 (26.23%), Postives = 58/122 (47.54%), Query Frame = 3
Query:  195 INGEQFIIQNCKNARIYLLDHIGSITVDDCTDCDIVIGPVKTSIFIRDCNKCNFMVACQQFRTRDCRNLNVFLSCTSQPIIEATSKFKVGSYQLYYPDLAEQFEKANLSPFNCIWSDIHDFS 560
            +NG+   I    +  + L  H GS+ V   + C ++ GP+  S F  +   C   +ACQQ R    R++ +++  T + IIE     ++G Y   Y  L   +  + L+     ++D+ DF+
Sbjct:  186 VNGQDITISKLNHCLVELQGHPGSVQVSRASKCTLLCGPIARSFFAENLEDCTLSIACQQLRLHSSRSIRIYMHVTCRAIIEDCKSIEIGEYNYDYSKLEADYLASGLNKAQNNYTDVADFN 307          
BLAST of Protein XRP2 vs. Ensembl Fly
Match: TBCC (gene:FBgn0051961 transcript:FBtr0077485)

HSP 1 Score: 70.0922 bits (170), Expect = 4.753e-12
Identity = 32/122 (26.23%), Postives = 58/122 (47.54%), Query Frame = 3
Query:  195 INGEQFIIQNCKNARIYLLDHIGSITVDDCTDCDIVIGPVKTSIFIRDCNKCNFMVACQQFRTRDCRNLNVFLSCTSQPIIEATSKFKVGSYQLYYPDLAEQFEKANLSPFNCIWSDIHDFS 560
            +NG+   I    +  + L  H GS+ V   + C ++ GP+  S F  +   C   +ACQQ R    R++ +++  T + IIE     ++G Y   Y  L   +  + L+     ++D+ DF+
Sbjct:  186 VNGQDITISKLNHCLVELQGHPGSVQVSRASKCTLLCGPIARSFFAENLEDCTLSIACQQLRLHSSRSIRIYMHVTCRAIIEDCKSIEIGEYNYDYSKLEADYLASGLNKAQNNYTDVADFN 307          
BLAST of Protein XRP2 vs. Ensembl Zebrafish
Match: rp2 (RP2 activator of ARL3 GTPase [Source:NCBI gene;Acc:406755])

HSP 1 Score: 199.904 bits (507), Expect = 1.141e-55
Identity = 91/192 (47.40%), Postives = 134/192 (69.79%), Query Frame = 3
Query:   60 NSDEESQHIVSKPPEYSWDQKKKLNPKDYTIENCNDSCTGRLPQTINGEQFIIQNCKNARIYLLDHIGSITVDDCTDCDIVIGPVKTSIFIRDCNKCNFMVACQQFRTRDCRNLNVFLSCTSQPIIEATSKFKVGSYQLYYPDLAEQFEKANLSPFNCIWSDIHDFSHDSEQGSNFSFIHEETKPFDIITSP 635
            NS++E+      P +YSWD+++K++PKD+ +    +   GRLP  +NG+QF+IQ+C+N  I++LDH  +IT+DDC +C IV+GPVK S+F RDC     +VACQQFRTRDC+ ++VFL C +QPIIE+++  K G +Q YYP+LA  F+ A LS FN  WS+IHDF+  S + +N+S + E+    D +  P
Sbjct:   43 NSNQEA------PKQYSWDKREKVDPKDFMLTGLKNETVGRLPGKLNGQQFVIQDCENCNIFVLDHSATITIDDCVNCRIVLGPVKGSVFFRDCKDIKCVVACQQFRTRDCKKMDVFLCCATQPIIESSTGMKFGCFQYYYPELAFHFKDAGLSIFNNNWSNIHDFTPVSGE-TNWSLLPEDAVVLDHVPLP 227          
BLAST of Protein XRP2 vs. Ensembl Zebrafish
Match: rp2 (RP2 activator of ARL3 GTPase [Source:NCBI gene;Acc:406755])

HSP 1 Score: 199.904 bits (507), Expect = 1.141e-55
Identity = 91/192 (47.40%), Postives = 134/192 (69.79%), Query Frame = 3
Query:   60 NSDEESQHIVSKPPEYSWDQKKKLNPKDYTIENCNDSCTGRLPQTINGEQFIIQNCKNARIYLLDHIGSITVDDCTDCDIVIGPVKTSIFIRDCNKCNFMVACQQFRTRDCRNLNVFLSCTSQPIIEATSKFKVGSYQLYYPDLAEQFEKANLSPFNCIWSDIHDFSHDSEQGSNFSFIHEETKPFDIITSP 635
            NS++E+      P +YSWD+++K++PKD+ +    +   GRLP  +NG+QF+IQ+C+N  I++LDH  +IT+DDC +C IV+GPVK S+F RDC     +VACQQFRTRDC+ ++VFL C +QPIIE+++  K G +Q YYP+LA  F+ A LS FN  WS+IHDF+  S + +N+S + E+    D +  P
Sbjct:   43 NSNQEA------PKQYSWDKREKVDPKDFMLTGLKNETVGRLPGKLNGQQFVIQDCENCNIFVLDHSATITIDDCVNCRIVLGPVKGSVFFRDCKDIKCVVACQQFRTRDCKKMDVFLCCATQPIIESSTGMKFGCFQYYYPELAFHFKDAGLSIFNNNWSNIHDFTPVSGE-TNWSLLPEDAVVLDHVPLP 227          
BLAST of Protein XRP2 vs. Ensembl Zebrafish
Match: tbcc (tubulin folding cofactor C [Source:ZFIN;Acc:ZDB-GENE-041008-103])

HSP 1 Score: 69.3218 bits (168), Expect = 1.022e-11
Identity = 34/134 (25.37%), Postives = 63/134 (47.01%), Query Frame = 3
Query:  156 NCNDSCTGRLPQTINGEQFIIQNCKNARIYLLDHIGSITVDDCTDCDIVIGPVKTSIFIRDCNKCNFMVACQQFRTRDCRNLNVFLSCTSQPIIEATSKFKVGSYQLYYPDLAEQFEKANLSPFNCIWSDIHDF 557
            N ++    R  + I     ++ +  + ++ L     ++ + +   C+I+ GPV +S+F+  C     +  CQQ RT +     V+L  TS+ IIE         +   YP + + F+ A LSP    W+++ DF
Sbjct:  183 NVDNQVLVRQAEEIQQRDVLLSHLTHCKVRLYGCPSTLHIKNIRSCEIMCGPVSSSVFVDQCTDSTLVFPCQQLRTHNTTATRVYLHVTSRAIIEDCQGVSFAPFTWTYPGILDHFKVAGLSPDRNNWTEVDDF 316          
BLAST of Protein XRP2 vs. Ensembl Zebrafish
Match: tbccd1 (TBCC domain containing 1 [Source:NCBI gene;Acc:100037389])

HSP 1 Score: 58.5362 bits (140), Expect = 5.146e-8
Identity = 33/120 (27.50%), Postives = 55/120 (45.83%), Query Frame = 3
Query:  189 QTINGEQFIIQNCKNARIYLLDHIGSITVDDCTDCDIVIGPVKTSIFIRDCNKCNFMVACQQFRTRDCRNLNVF---LSCTSQPIIEATSKFKVGSYQLYYPDLAEQFEKANLSPFNCIW 539
            + +N     +  C  A IYLL  + S+T+D C +  +V+GPV+TS+ I+ C   N  V C   R     + N     L+ T   ++   +   +G +   YP L +    A L+    +W
Sbjct:  326 EKLNDVNIKLHRCSEAFIYLLSPLWSVTLDKCRNSTLVLGPVRTSVHIQSCE--NVRVVCVAGRLTIGGSFNCTIHSLTPTRPLLLPGNASLTLGPFHTQYPTLEDHMASAGLAVVPNLW 443          
BLAST of Protein XRP2 vs. Ensembl Zebrafish
Match: tbccd1 (TBCC domain containing 1 [Source:NCBI gene;Acc:100037389])

HSP 1 Score: 58.5362 bits (140), Expect = 5.146e-8
Identity = 33/120 (27.50%), Postives = 55/120 (45.83%), Query Frame = 3
Query:  189 QTINGEQFIIQNCKNARIYLLDHIGSITVDDCTDCDIVIGPVKTSIFIRDCNKCNFMVACQQFRTRDCRNLNVF---LSCTSQPIIEATSKFKVGSYQLYYPDLAEQFEKANLSPFNCIW 539
            + +N     +  C  A IYLL  + S+T+D C +  +V+GPV+TS+ I+ C   N  V C   R     + N     L+ T   ++   +   +G +   YP L +    A L+    +W
Sbjct:  326 EKLNDVNIKLHRCSEAFIYLLSPLWSVTLDKCRNSTLVLGPVRTSVHIQSCE--NVRVVCVAGRLTIGGSFNCTIHSLTPTRPLLLPGNASLTLGPFHTQYPTLEDHMASAGLAVVPNLW 443          
BLAST of Protein XRP2 vs. Ensembl Xenopus
Match: pdia6 (protein disulfide isomerase family A member 6 [Source:Xenbase;Acc:XB-GENE-974680])

HSP 1 Score: 207.223 bits (526), Expect = 2.639e-58
Identity = 93/196 (47.45%), Postives = 135/196 (68.88%), Query Frame = 3
Query:   54 DKNSDEESQHIVSKPPEYSWDQKKKLNPKDYTIENCNDSCTGRLPQTINGEQFIIQNCKNARIYLLDHIGSITVDDCTDCDIVIGPVKTSIFIRDCNKCNFMVACQQFRTRDCRNLNVFLSCTSQPIIEATSKFKVGSYQLYYPDLAEQFEKANLSPFNCIWSDIHDFSHDSEQGSNFSFIHEETKPFDIITSPAS 641
            +  + E+ Q    +P +YSWD+++K++PKDY      D   G+LP  + G+QF+IQ C+N  IY+ DH  +IT+DDCT+C I +GPVK S+F RDC  C  +VACQQFRTRDCR ++VFL C++QPIIE+++  K G +Q YYP+LA QF++A LS FN  WS+IHDF+  + + +N+S +  ++   D I  P S
Sbjct:   17 EAKAGEQPQQDGEEPKQYSWDKREKVDPKDYMFSGLKDQTVGKLPDKVAGQQFVIQECENCNIYIFDHSATITIDDCTNCRIFLGPVKGSVFFRDCKDCKCVVACQQFRTRDCRRMDVFLCCSTQPIIESSTGMKFGCFQYYYPELALQFKEAGLSIFNNTWSNIHDFTPVAGE-TNWSLLPPDSVIQDFIPLPDS 211          
BLAST of Protein XRP2 vs. Ensembl Xenopus
Match: rbm11 (RNA binding motif protein 11 [Source:Xenbase;Acc:XB-GENE-975967])

HSP 1 Score: 61.2326 bits (147), Expect = 6.710e-9
Identity = 35/137 (25.55%), Postives = 61/137 (44.53%), Query Frame = 3
Query:  216 IQNCKNARIYLLDHIGSITVDDCTDCDIVIGPVKTSIFIRDCNKCNFMVACQQFRTRDCRNLNVFLSCTSQPIIEATSKFKVGSYQLYYPDLAEQFEKANLSPFNCIWSDIHDFSHDSEQ--GSNFSFIHEETKPFD 620
            +Q+C    + L     ++ +     C ++ GPV TS+F+ DC  C F   CQQ RT        ++  TS+ IIE  ++     +   Y  +   +E + L   N  W+ + DF+  +      N+  + EE +  D
Sbjct:  244 LQDCT---VTLRGSPATLHIRGLRGCKVLCGPVCTSVFVDDCRDCLFAFPCQQLRTHSTERCRFYIHVTSRAIIEDCAQLHFAPFTWSYEGILGDYEASGLDRANNNWNQVDDFNWLARDVPSPNWGVLPEEERVTD 377          
BLAST of Protein XRP2 vs. Ensembl Xenopus
Match: tbccd1 (TBCC domain containing 1 [Source:NCBI gene;Acc:549715])

HSP 1 Score: 53.9138 bits (128), Expect = 2.020e-6
Identity = 33/140 (23.57%), Postives = 60/140 (42.86%), Query Frame = 3
Query:  189 QTINGEQFIIQNCKNARIYLLDHIGSITVDDCTDCDIVIGPVKTSIFIRDCNKCNFMVACQQFRTRDCRNLNVFLSCTSQPIIEATSKFKV-GSYQLYYPDLAEQFEKANLSPFNCIWSDIHDFSHDSEQGSNFSFIHEE 605
            +T+   +  I  C +  IYLL  + S+TV+ C +C IV+GPV+T + I+ C     +  CQ+       N    +   ++P+    ++  V   + + Y  L +      L+     W     FS +S     +  +  E
Sbjct:  325 KTLVDARVKIHRCSDCYIYLLSPLRSVTVEKCQNCTIVLGPVQTVLHIQMCYNVKIIAVCQRLSLLSTTNCTFHVLTPTRPLFYCGNQGVVLAPFHISYSMLEDHMAHTGLATVPNSWDRPFFFSTESSNSHIWRLLLPE 464          
BLAST of Protein XRP2 vs. Ensembl Mouse
Match: Rp2 (retinitis pigmentosa 2 homolog [Source:MGI Symbol;Acc:MGI:1277953])

HSP 1 Score: 202.216 bits (513), Expect = 4.088e-57
Identity = 94/200 (47.00%), Postives = 130/200 (65.00%), Query Frame = 3
Query:   48 CC--DKNSDEESQHIVSKPPEYSWDQKKKLNPKDYTIENCNDSCTGRLPQTINGEQFIIQNCKNARIYLLDHIGSITVDDCTDCDIVIGPVKTSIFIRDCNKCNFMVACQQFRTRDCRNLNVFLSCTSQPIIEATSKFKVGSYQLYYPDLAEQFEKANLSPFNCIWSDIHDFSHDSEQGSNFSFIHEETKPFDIITSPAS 641
            CC   +   E+++    +P  YSWDQ++K++PKDY      D   GRLP  + G+QF+IQ+C+N  IY+ DH  +IT+DDCT+C I +GPVK S+F R+C  C   +ACQQFR RDCR L VFL C +QPIIE+++  K G +Q YYP+LA QF+ A LS FN IWS +HDF+  S +  N+S + E     D +  P +
Sbjct:    3 CCFTKRRKSEKAEGEEEQPKLYSWDQREKVDPKDYMFSGLKDETVGRLPGKVAGQQFVIQDCENCNIYIFDHSATITIDDCTNCVIFLGPVKGSVFFRNCRDCKCTLACQQFRVRDCRKLEVFLCCATQPIIESSTNIKFGCFQWYYPELAAQFKDAGLSIFNNIWSHVHDFTPVSGE-LNWSLLPENAVVQDYVPIPMT 201          
BLAST of Protein XRP2 vs. Ensembl Mouse
Match: Rp2 (retinitis pigmentosa 2 homolog [Source:MGI Symbol;Acc:MGI:1277953])

HSP 1 Score: 202.601 bits (514), Expect = 6.411e-57
Identity = 94/200 (47.00%), Postives = 130/200 (65.00%), Query Frame = 3
Query:   48 CC--DKNSDEESQHIVSKPPEYSWDQKKKLNPKDYTIENCNDSCTGRLPQTINGEQFIIQNCKNARIYLLDHIGSITVDDCTDCDIVIGPVKTSIFIRDCNKCNFMVACQQFRTRDCRNLNVFLSCTSQPIIEATSKFKVGSYQLYYPDLAEQFEKANLSPFNCIWSDIHDFSHDSEQGSNFSFIHEETKPFDIITSPAS 641
            CC   +   E+++    +P  YSWDQ++K++PKDY      D   GRLP  + G+QF+IQ+C+N  IY+ DH  +IT+DDCT+C I +GPVK S+F R+C  C   +ACQQFR RDCR L VFL C +QPIIE+++  K G +Q YYP+LA QF+ A LS FN IWS +HDF+  S +  N+S + E     D +  P +
Sbjct:    3 CCFTKRRKSEKAEGEEEQPKLYSWDQREKVDPKDYMFSGLKDETVGRLPGKVAGQQFVIQDCENCNIYIFDHSATITIDDCTNCVIFLGPVKGSVFFRNCRDCKCTLACQQFRVRDCRKLEVFLCCATQPIIESSTNIKFGCFQWYYPELAAQFKDAGLSIFNNIWSHVHDFTPVSGE-LNWSLLPENAVVQDYVPIPMT 201          
BLAST of Protein XRP2 vs. Ensembl Mouse
Match: Rp2 (retinitis pigmentosa 2 homolog [Source:MGI Symbol;Acc:MGI:1277953])

HSP 1 Score: 202.601 bits (514), Expect = 6.411e-57
Identity = 94/200 (47.00%), Postives = 130/200 (65.00%), Query Frame = 3
Query:   48 CC--DKNSDEESQHIVSKPPEYSWDQKKKLNPKDYTIENCNDSCTGRLPQTINGEQFIIQNCKNARIYLLDHIGSITVDDCTDCDIVIGPVKTSIFIRDCNKCNFMVACQQFRTRDCRNLNVFLSCTSQPIIEATSKFKVGSYQLYYPDLAEQFEKANLSPFNCIWSDIHDFSHDSEQGSNFSFIHEETKPFDIITSPAS 641
            CC   +   E+++    +P  YSWDQ++K++PKDY      D   GRLP  + G+QF+IQ+C+N  IY+ DH  +IT+DDCT+C I +GPVK S+F R+C  C   +ACQQFR RDCR L VFL C +QPIIE+++  K G +Q YYP+LA QF+ A LS FN IWS +HDF+  S +  N+S + E     D +  P +
Sbjct:    3 CCFTKRRKSEKAEGEEEQPKLYSWDQREKVDPKDYMFSGLKDETVGRLPGKVAGQQFVIQDCENCNIYIFDHSATITIDDCTNCVIFLGPVKGSVFFRNCRDCKCTLACQQFRVRDCRKLEVFLCCATQPIIESSTNIKFGCFQWYYPELAAQFKDAGLSIFNNIWSHVHDFTPVSGE-LNWSLLPENAVVQDYVPIPMT 201          
BLAST of Protein XRP2 vs. Ensembl Mouse
Match: Rp2 (retinitis pigmentosa 2 homolog [Source:MGI Symbol;Acc:MGI:1277953])

HSP 1 Score: 202.216 bits (513), Expect = 1.330e-56
Identity = 94/200 (47.00%), Postives = 130/200 (65.00%), Query Frame = 3
Query:   48 CC--DKNSDEESQHIVSKPPEYSWDQKKKLNPKDYTIENCNDSCTGRLPQTINGEQFIIQNCKNARIYLLDHIGSITVDDCTDCDIVIGPVKTSIFIRDCNKCNFMVACQQFRTRDCRNLNVFLSCTSQPIIEATSKFKVGSYQLYYPDLAEQFEKANLSPFNCIWSDIHDFSHDSEQGSNFSFIHEETKPFDIITSPAS 641
            CC   +   E+++    +P  YSWDQ++K++PKDY      D   GRLP  + G+QF+IQ+C+N  IY+ DH  +IT+DDCT+C I +GPVK S+F R+C  C   +ACQQFR RDCR L VFL C +QPIIE+++  K G +Q YYP+LA QF+ A LS FN IWS +HDF+  S +  N+S + E     D +  P +
Sbjct:    3 CCFTKRRKSEKAEGEEEQPKLYSWDQREKVDPKDYMFSGLKDETVGRLPGKVAGQQFVIQDCENCNIYIFDHSATITIDDCTNCVIFLGPVKGSVFFRNCRDCKCTLACQQFRVRDCRKLEVFLCCATQPIIESSTNIKFGCFQWYYPELAAQFKDAGLSIFNNIWSHVHDFTPVSGE-LNWSLLPENAVVQDYVPIPMT 201          
BLAST of Protein XRP2 vs. Ensembl Mouse
Match: Rp2 (retinitis pigmentosa 2 homolog [Source:MGI Symbol;Acc:MGI:1277953])

HSP 1 Score: 173.326 bits (438), Expect = 2.387e-47
Identity = 80/159 (50.31%), Postives = 107/159 (67.30%), Query Frame = 3
Query:  165 DSCTGRLPQTINGEQFIIQNCKNARIYLLDHIGSITVDDCTDCDIVIGPVKTSIFIRDCNKCNFMVACQQFRTRDCRNLNVFLSCTSQPIIEATSKFKVGSYQLYYPDLAEQFEKANLSPFNCIWSDIHDFSHDSEQGSNFSFIHEETKPFDIITSPAS 641
            D   GRLP  + G+QF+IQ+C+N  IY+ DH  +IT+DDCT+C I +GPVK S+F R+C  C   +ACQQFR RDCR L VFL C +QPIIE+++  K G +Q YYP+LA QF+ A LS FN IWS +HDF+  S +  N+S + E     D +  P +
Sbjct:    7 DETVGRLPGKVAGQQFVIQDCENCNIYIFDHSATITIDDCTNCVIFLGPVKGSVFFRNCRDCKCTLACQQFRVRDCRKLEVFLCCATQPIIESSTNIKFGCFQWYYPELAAQFKDAGLSIFNNIWSHVHDFTPVSGE-LNWSLLPENAVVQDYVPIPMT 164          
BLAST of Protein XRP2 vs. UniProt/SwissProt
Match: sp|Q5ZHN4|XRP2_CHICK (Protein XRP2 OS=Gallus gallus OX=9031 GN=RP2 PE=2 SV=3)

HSP 1 Score: 208.764 bits (530), Expect = 3.418e-58
Identity = 93/183 (50.82%), Postives = 126/183 (68.85%), Query Frame = 3
Query:   93 KPPEYSWDQKKKLNPKDYTIENCNDSCTGRLPQTINGEQFIIQNCKNARIYLLDHIGSITVDDCTDCDIVIGPVKTSIFIRDCNKCNFMVACQQFRTRDCRNLNVFLSCTSQPIIEATSKFKVGSYQLYYPDLAEQFEKANLSPFNCIWSDIHDFSHDSEQGSNFSFIHEETKPFDIITSPAS 641
            K P+YSWDQ+ K++PKDYT     D   GRLP  + G+QF+IQ+C+N  IY+ DH  ++T+DDC +C I +GP+K S+F R+C  C  +VACQQFRTRDCR L VFL C +QPIIE+++  K G +Q YYP+LA QF+ A LS FN  WS+IHDF+  S + +N+  + E     D +  PAS
Sbjct:   30 KAPQYSWDQRAKVDPKDYTFSGLKDETVGRLPGRVAGQQFVIQDCENCSIYIFDHSATVTIDDCVNCQIFLGPIKGSVFFRNCKDCKCIVACQQFRTRDCRRLEVFLCCATQPIIESSTGMKFGCFQYYYPELALQFKDAGLSIFNNTWSNIHDFTPVSGE-NNWGLLPENAVVQDYVPLPAS 211          
BLAST of Protein XRP2 vs. UniProt/SwissProt
Match: sp|O75695|XRP2_HUMAN (Protein XRP2 OS=Homo sapiens OX=9606 GN=RP2 PE=1 SV=4)

HSP 1 Score: 206.453 bits (524), Expect = 1.966e-57
Identity = 97/205 (47.32%), Postives = 136/205 (66.34%), Query Frame = 3
Query:   33 MGSILCCDKNSDEES--QHIVSKPPEYSWDQKKKLNPKDYTIENCNDSCTGRLPQTINGEQFIIQNCKNARIYLLDHIGSITVDDCTDCDIVIGPVKTSIFIRDCNKCNFMVACQQFRTRDCRNLNVFLSCTSQPIIEATSKFKVGSYQLYYPDLAEQFEKANLSPFNCIWSDIHDFSHDSEQGSNFSFIHEETKPFDIITSPAS 641
            MG      + +D+ES  ++   +P +YSWDQ++K++PKDY      D   GRLP T+ G+QF+IQ+C+N  IY+ DH  ++T+DDCT+C I +GPVK S+F R+C  C   +ACQQFR RDCR L VFL C +QPIIE++S  K G +Q YYP+LA QF+ A LS FN  WS+IHDF+  S +  N+S + E+    D +  P +
Sbjct:    1 MGCFFSKRRKADKESRPENEEERPKQYSWDQREKVDPKDYMFSGLKDETVGRLPGTVAGQQFLIQDCENCNIYIFDHSATVTIDDCTNCIIFLGPVKGSVFFRNCRDCKCTLACQQFRVRDCRKLEVFLCCATQPIIESSSNIKFGCFQWYYPELAFQFKDAGLSIFNNTWSNIHDFTPVSGE-LNWSLLPEDAVVQDYVPIPTT 204          
BLAST of Protein XRP2 vs. UniProt/SwissProt
Match: sp|Q8AVX5|XRP2_XENLA (Protein XRP2 OS=Xenopus laevis OX=8355 GN=rp2 PE=2 SV=3)

HSP 1 Score: 206.068 bits (523), Expect = 3.355e-57
Identity = 95/196 (48.47%), Postives = 135/196 (68.88%), Query Frame = 3
Query:   57 KNSDEES-QHIVSKPPEYSWDQKKKLNPKDYTIENCNDSCTGRLPQTINGEQFIIQNCKNARIYLLDHIGSITVDDCTDCDIVIGPVKTSIFIRDCNKCNFMVACQQFRTRDCRNLNVFLSCTSQPIIEATSKFKVGSYQLYYPDLAEQFEKANLSPFNCIWSDIHDFSHDSEQGSNFSFIHEETKPFDIITSPAS 641
            +NS+EE  Q    +P +YSWD+++K++PKDY      D   G+LP  + G+QF+IQ C+N  IY+ DH  +IT+DDCT+C I +GPVK S+F RDC  C  +VACQQFRTRDCR ++VFL C++QPIIE+++  K G +Q YYP+LA QF++A LS  N  WS+IHDF+  + + +N+S +  +    D I  P S
Sbjct:   13 RNSEEEQPQQDGEEPKQYSWDKREKVDPKDYMFTGLKDQTVGKLPDKVAGQQFVIQECENCNIYIFDHSATITIDDCTNCRIFLGPVKGSVFFRDCKDCKCVVACQQFRTRDCRRMDVFLCCSTQPIIESSTSMKFGCFQYYYPELALQFKEAGLSILNNTWSNIHDFTPVAGE-TNWSLLPPDAVIQDFIPLPDS 207          
BLAST of Protein XRP2 vs. UniProt/SwissProt
Match: sp|Q9EPK2|XRP2_MOUSE (Protein XRP2 OS=Mus musculus OX=10090 GN=Rp2 PE=1 SV=3)

HSP 1 Score: 202.601 bits (514), Expect = 4.485e-56
Identity = 94/200 (47.00%), Postives = 130/200 (65.00%), Query Frame = 3
Query:   48 CC--DKNSDEESQHIVSKPPEYSWDQKKKLNPKDYTIENCNDSCTGRLPQTINGEQFIIQNCKNARIYLLDHIGSITVDDCTDCDIVIGPVKTSIFIRDCNKCNFMVACQQFRTRDCRNLNVFLSCTSQPIIEATSKFKVGSYQLYYPDLAEQFEKANLSPFNCIWSDIHDFSHDSEQGSNFSFIHEETKPFDIITSPAS 641
            CC   +   E+++    +P  YSWDQ++K++PKDY      D   GRLP  + G+QF+IQ+C+N  IY+ DH  +IT+DDCT+C I +GPVK S+F R+C  C   +ACQQFR RDCR L VFL C +QPIIE+++  K G +Q YYP+LA QF+ A LS FN IWS +HDF+  S +  N+S + E     D +  P +
Sbjct:    3 CCFTKRRKSEKAEGEEEQPKLYSWDQREKVDPKDYMFSGLKDETVGRLPGKVAGQQFVIQDCENCNIYIFDHSATITIDDCTNCVIFLGPVKGSVFFRNCRDCKCTLACQQFRVRDCRKLEVFLCCATQPIIESSTNIKFGCFQWYYPELAAQFKDAGLSIFNNIWSHVHDFTPVSGE-LNWSLLPENAVVQDYVPIPMT 201          
BLAST of Protein XRP2 vs. UniProt/SwissProt
Match: sp|F1QC45|XRP2_DANRE (Protein XRP2 OS=Danio rerio OX=7955 GN=rp2 PE=1 SV=1)

HSP 1 Score: 199.904 bits (507), Expect = 8.612e-55
Identity = 91/192 (47.40%), Postives = 134/192 (69.79%), Query Frame = 3
Query:   60 NSDEESQHIVSKPPEYSWDQKKKLNPKDYTIENCNDSCTGRLPQTINGEQFIIQNCKNARIYLLDHIGSITVDDCTDCDIVIGPVKTSIFIRDCNKCNFMVACQQFRTRDCRNLNVFLSCTSQPIIEATSKFKVGSYQLYYPDLAEQFEKANLSPFNCIWSDIHDFSHDSEQGSNFSFIHEETKPFDIITSP 635
            NS++E+      P +YSWD+++K++PKD+ +    +   GRLP  +NG+QF+IQ+C+N  I++LDH  +IT+DDC +C IV+GPVK S+F RDC     +VACQQFRTRDC+ ++VFL C +QPIIE+++  K G +Q YYP+LA  F+ A LS FN  WS+IHDF+  S + +N+S + E+    D +  P
Sbjct:   43 NSNQEA------PKQYSWDKREKVDPKDFMLTGLKNETVGRLPGKLNGQQFVIQDCENCNIFVLDHSATITIDDCVNCRIVLGPVKGSVFFRDCKDIKCVVACQQFRTRDCKKMDVFLCCATQPIIESSTGMKFGCFQYYYPELAFHFKDAGLSIFNNNWSNIHDFTPVSGE-TNWSLLPEDAVVLDHVPLP 227          
BLAST of Protein XRP2 vs. TrEMBL
Match: A0A1I8HUD9 (Protein XRP2 OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig003899g1 PE=3 SV=1)

HSP 1 Score: 222.631 bits (566), Expect = 1.492e-60
Identity = 107/196 (54.59%), Postives = 139/196 (70.92%), Query Frame = 3
Query:   33 MGSILCCDKNS----DEESQHIVSKPPEYSWDQKKKLNPKDYTIENCNDSCTGRLPQTINGEQFIIQNCKNARIYLLDHIGSITVDDCTDCDIVIGPVKTSIFIRDCNKCNFMVACQQFRTRDCRNLNVFLSCTSQPIIEATSKFKVGSYQLYYPDLAEQFEKANLSPFNCIWSDIHDFSHDSEQGSNFSFIHEET 608
            MG + C   +S      ES       P++SW+Q  +++PKD+TIEN +    GRLP TING+QFII NCKN+ +YL DHI +ITVDDC +C   IGPV+TSIFIRDC  C F+VACQQFRTRDC+ L+ FLSC S PIIEA+SK + G +  YYP+L  QFE ++LSPFNC WS+IHDF+  + + SNF+ + + T
Sbjct:    1 MGCMWCKLNDSTTGQGTESTRKNESAPKFSWEQGPQVDPKDFTIENIDGEVAGRLPGTINGQQFIIANCKNSSVYLFDHINTITVDDCENCVFFIGPVQTSIFIRDCKDCKFLVACQQFRTRDCQRLDCFLSCVSLPIIEASSKMRFGPFCFYYPELLGQFENSSLSPFNCHWSEIHDFTPVTGE-SNFTLVPDGT 195          
BLAST of Protein XRP2 vs. TrEMBL
Match: H2YQW1 (C-CAP/cofactor C-like domain-containing protein OS=Ciona savignyi OX=51511 PE=4 SV=1)

HSP 1 Score: 214.927 bits (546), Expect = 3.571e-59
Identity = 102/187 (54.55%), Postives = 136/187 (72.73%), Query Frame = 3
Query:   45 LCCDKNSDEESQHIVSKPPEYSWDQKKKLNPKDYTIENCNDSCTGRLPQTINGEQFIIQNCKNARIYLLDHIGSITVDDCTDCDIVIGPVKTSIFIRDCNKCNFMVACQQFRTRDCRNLNVFLSCTSQPIIEATSKFKVGSYQLYYPDLAEQFEKANLSPFNCIWSDIHDFSHDSEQGSNFSFIHEE 605
            + C  + ++E  +  +    YSWD +K ++PKD+TI+  ND    R P +I+G+QFIIQNC N+RIYL DHI +ITVDDC++C I+IGPVK+SIFIRDC  C F+VACQQFRTRDC  L+V L CT+QPIIEA++K K G YQ YY  + EQFEK+ L  F   WS+IHDF+  S++ +N+S I E+
Sbjct:    1 MGCFGSKEKEDPNKKTTEKAYSWDNRKNIDPKDFTIDGLNDGLVIRKPGSIDGQQFIIQNCSNSRIYLFDHIAAITVDDCSNCQIIIGPVKSSIFIRDCENCKFIVACQQFRTRDCSKLDVLLLCTTQPIIEASAKLKFGCYQFYYDGIEEQFEKSQLGLFCNNWSNIHDFTPVSDK-ANWSLIDED 186          
BLAST of Protein XRP2 vs. TrEMBL
Match: F7AG49 (Protein XRP2 OS=Ciona intestinalis OX=7719 PE=3 SV=2)

HSP 1 Score: 217.238 bits (552), Expect = 9.710e-59
Identity = 107/187 (57.22%), Postives = 135/187 (72.19%), Query Frame = 3
Query:   45 LCCDKNSDEESQHIVSKPPEYSWDQKKKLNPKDYTIENCNDSCTGRLPQTINGEQFIIQNCKNARIYLLDHIGSITVDDCTDCDIVIGPVKTSIFIRDCNKCNFMVACQQFRTRDCRNLNVFLSCTSQPIIEATSKFKVGSYQLYYPDLAEQFEKANLSPFNCIWSDIHDFSHDSEQGSNFSFIHEE 605
            + C  + ++E     ++  +YSWD+++K++P  YT+EN ND    R P +I+G+QFIIQNCKN RIYL DHI SITVDDC DC I++GPV  SIFIRDC  C F+VACQQFRTRDC  L+VFLSC +QPIIEA++K K G YQL Y  L EQFEK+ LS F   W +IHDF+  +E+ SN S I EE
Sbjct:    1 MGCFGSKEKEDPEKKTEEKKYSWDKREKIDPALYTVENLNDEFVIREPGSIDGQQFIIQNCKNTRIYLFDHIASITVDDCVDCCIIVGPVMGSIFIRDCENCKFIVACQQFRTRDCSKLDVFLSCATQPIIEASAKLKFGCYQLNYDGLKEQFEKSQLSLFCNNWCNIHDFTPVTEK-SNSSLISEE 186          
BLAST of Protein XRP2 vs. TrEMBL
Match: A0A1W2W4R6 (Protein XRP2 OS=Ciona intestinalis OX=7719 GN=LOC100177396 PE=3 SV=1)

HSP 1 Score: 217.238 bits (552), Expect = 1.132e-58
Identity = 107/187 (57.22%), Postives = 135/187 (72.19%), Query Frame = 3
Query:   45 LCCDKNSDEESQHIVSKPPEYSWDQKKKLNPKDYTIENCNDSCTGRLPQTINGEQFIIQNCKNARIYLLDHIGSITVDDCTDCDIVIGPVKTSIFIRDCNKCNFMVACQQFRTRDCRNLNVFLSCTSQPIIEATSKFKVGSYQLYYPDLAEQFEKANLSPFNCIWSDIHDFSHDSEQGSNFSFIHEE 605
            + C  + ++E     ++  +YSWD+++K++P  YT+EN ND    R P +I+G+QFIIQNCKN RIYL DHI SITVDDC DC I++GPV  SIFIRDC  C F+VACQQFRTRDC  L+VFLSC +QPIIEA++K K G YQL Y  L EQFEK+ LS F   W +IHDF+  +E+ SN S I EE
Sbjct:    1 MGCFGSKEKEDPEKKTEEKKYSWDKREKIDPALYTVENLNDEFVIREPGSIDGQQFIIQNCKNTRIYLFDHIASITVDDCVDCCIIVGPVMGSIFIRDCENCKFIVACQQFRTRDCSKLDVFLSCATQPIIEASAKLKFGCYQLNYDGLKEQFEKSQLSLFCNNWCNIHDFTPVTEK-SNSSLISEE 186          
BLAST of Protein XRP2 vs. TrEMBL
Match: A0A1W5BJR8 (Protein XRP2 OS=Ciona intestinalis OX=7719 GN=LOC100177396 PE=3 SV=1)

HSP 1 Score: 217.238 bits (552), Expect = 1.143e-58
Identity = 107/187 (57.22%), Postives = 135/187 (72.19%), Query Frame = 3
Query:   45 LCCDKNSDEESQHIVSKPPEYSWDQKKKLNPKDYTIENCNDSCTGRLPQTINGEQFIIQNCKNARIYLLDHIGSITVDDCTDCDIVIGPVKTSIFIRDCNKCNFMVACQQFRTRDCRNLNVFLSCTSQPIIEATSKFKVGSYQLYYPDLAEQFEKANLSPFNCIWSDIHDFSHDSEQGSNFSFIHEE 605
            + C  + ++E     ++  +YSWD+++K++P  YT+EN ND    R P +I+G+QFIIQNCKN RIYL DHI SITVDDC DC I++GPV  SIFIRDC  C F+VACQQFRTRDC  L+VFLSC +QPIIEA++K K G YQL Y  L EQFEK+ LS F   W +IHDF+  +E+ SN S I EE
Sbjct:    1 MGCFGSKEKEDPEKKTEEKKYSWDKREKIDPALYTVENLNDEFVIREPGSIDGQQFIIQNCKNTRIYLFDHIASITVDDCVDCCIIVGPVMGSIFIRDCENCKFIVACQQFRTRDCSKLDVFLSCATQPIIEASAKLKFGCYQLNYDGLKEQFEKSQLSLFCNNWCNIHDFTPVTEK-SNSSLISEE 186          
BLAST of Protein XRP2 vs. Ensembl Cavefish
Match: rp2 (RP2 activator of ARL3 GTPase [Source:NCBI gene;Acc:406755])

HSP 1 Score: 201.83 bits (512), Expect = 9.477e-57
Identity = 92/222 (41.44%), Postives = 139/222 (62.61%), Query Frame = 3
Query:   90 SKPPEYSWDQKKKLNPKDYTIENCNDSCTGRLPQTINGEQFIIQNCKNARIYLLDHIGSITVDDCTDCDIVIGPVKTSIFIRDCNKCNFMVACQQFRTRDCRNLNVFLSCTSQPIIEATSKFKVGSYQLYYPDLAEQFEKANLSPFNCIWSDIHDFSHDSEQGSNFSFIHEETKPFDIITSP----------------ASVLNSNEAKEHGDSSEICFFIIL 707
            + P +YSWD+++K++PKD+ +    D+  GRLP  +NG+QF+IQ+C+N  I++ DH  ++T+DDC +C IV+GPVK S+F RDC     +VACQQFRTRDC+ ++VFL C +QPIIE+++  K G +Q YYPDLA  F+ A LS FN  WS+IHDF+  S + +N+S + E+    + +  P                 S++   +     +S E C F+  
Sbjct:   21 TAPKQYSWDKREKVDPKDFMLTGVKDATVGRLPGKLNGQQFVIQDCENCNIFVFDHSATVTIDDCVNCRIVLGPVKGSVFFRDCKDIKCVVACQQFRTRDCKKMDVFLCCATQPIIESSTSMKFGCFQYYYPDLAFHFKDAGLSIFNNNWSNIHDFTPVSGE-TNWSLLPEDAAVLEYVPLPDSESEFKSVRISTEVNRSIVPMTKGGRRKESEESCLFVFF 241          
BLAST of Protein XRP2 vs. Ensembl Cavefish
Match: tbcc (tubulin folding cofactor C [Source:NCBI gene;Acc:103028928])

HSP 1 Score: 65.0846 bits (157), Expect = 2.340e-10
Identity = 34/134 (25.37%), Postives = 60/134 (44.78%), Query Frame = 3
Query:  156 NCNDSCTGRLPQTINGEQFIIQNCKNARIYLLDHIGSITVDDCTDCDIVIGPVKTSIFIRDCNKCNFMVACQQFRTRDCRNLNVFLSCTSQPIIEATSKFKVGSYQLYYPDLAEQFEKANLSPFNCIWSDIHDF 557
            N  +    R    I     ++ +  N ++ L     ++ + +  +C I+ GPV +S+FI +C+      ACQQ RT +  +  ++L  TS+ IIE     +   +   Y  +   F  + L P    WS + DF
Sbjct:  210 NAQNEVLIRRSDEIQQRDVLLSHLTNCKVRLFGSPSTLHIKNIQNCQILSGPVSSSVFIDECSGSILGFACQQLRTHNTTDSQIYLHVTSRAIIEDCQGVQFAPFSWTYEGMDNDFTISGLDPNRNNWSQVDDF 343          
BLAST of Protein XRP2 vs. Ensembl Cavefish
Match: tbccd1 (TBCC domain containing 1 [Source:NCBI gene;Acc:103033584])

HSP 1 Score: 56.9954 bits (136), Expect = 1.178e-7
Identity = 25/118 (21.19%), Postives = 54/118 (45.76%), Query Frame = 3
Query:  189 QTINGEQFIIQNCKNARIYLLDHIGSITVDDCTDCDIVIGPVKTSIFIRDCNKCNFMVACQQFRTRDCRNLNVFLSCTSQP-IIEATSKFKVGSYQLYYPDLAEQFEKANLSPFNCIW 539
            + ++G    +  C  A IYLL  + S+T+D C +  +V+GPV+T++ ++ C     +    +       +  V     ++P ++   +   +G +  +YP L +      L+    +W
Sbjct:  325 EKLSGANVKLHRCSEAFIYLLSPLRSVTLDKCRNSTVVLGPVETNVHVQSCENVRLVCVTARLVIGASSHCTVHALTPTRPLLLPGNTALTLGPFHTHYPTLEDHMASVGLAVVPNLW 442          
BLAST of Protein XRP2 vs. Ensembl Sea Lamprey
Match: tbcc (tubulin folding cofactor C [Source:ZFIN;Acc:ZDB-GENE-041008-103])

HSP 1 Score: 83.9593 bits (206), Expect = 2.246e-17
Identity = 41/140 (29.29%), Postives = 73/140 (52.14%), Query Frame = 3
Query:  195 INGEQFIIQNCKNARIYLLDHIGSITVDDCTDCDIVIGPVKTSIFIRDCNKCNFMVACQQFRTRDCRNLNVFLSCTSQPIIEATSKFKVGSYQLYYPDLAEQFEKANLSPFNCIWSDIHDFSHDSEQGS-NFSFIHEETK 611
            ++G  + + N     + LL    ++ +    DC ++ GPV TS+F+ DC  C  +VAC+QFR     + + ++   S+ IIE   + +   Y L YP L   F++A +      W+ I+DF+  ++  S N+S I E+ +
Sbjct:  191 LSGTDWALGNLSGCTVALLGSPSTLHITGVRDCVVLCGPVATSVFLDDCKGCKVVVACRQFRAHRSEDTDFYVDVASKAIIEDCVRVRFAPYNLSYPGLDGHFKEARMEGHGQTWNGINDFNWLADVPSPNWSMIPEDER 330          
BLAST of Protein XRP2 vs. Ensembl Sea Lamprey
Match: TBCCD1 (TBCC domain containing 1 [Source:HGNC Symbol;Acc:HGNC:25546])

HSP 1 Score: 63.1586 bits (152), Expect = 9.509e-11
Identity = 38/155 (24.52%), Postives = 63/155 (40.65%), Query Frame = 3
Query:  195 INGEQFIIQNCKNARIYLLDHIGSITVDDCTDCDIVIGPVKTSIFIRDCNKCNFMVACQQFRTRDCRNLNVFLSCTSQPIIEATSKFKVG----SYQLYYPDLAEQFEKANLSPFNCIWSDIHDFSHDSEQGSNF--------SFIHEETKPFDI 623
            + G    I  C ++ IYLL  + S++++ C    +V+GPV+T + +  C     +VAC++     C      L    +P++ +      G     Y  +YP L E   +A L+     W            G+N         S +H  T PF I
Sbjct:   91 LAGAHVCIHRCSDSFIYLLSPLRSVSIERCRRTVLVLGPVETHVTVHGCEDVTVVVACRRLVASACSACTFHLLTPCRPLLVSAPSGDTGITLAPYHTHYPLLEEHMARAGLAAVPNRWDQPLCLGGPEADGTNGKCYRLLPPSELHLLTVPFAI 245          
BLAST of Protein XRP2 vs. Ensembl Nematostella
Match: EDO36223 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJ71])

HSP 1 Score: 195.667 bits (496), Expect = 3.830e-55
Identity = 94/201 (46.77%), Postives = 132/201 (65.67%), Query Frame = 3
Query:   48 CCDKNSDEESQHIVSKPPE---YSWDQKKKLNPKDYTIENCNDSCTGRLPQTINGEQFIIQNCKNARIYLLDHIGSITVDDCTDCDIVIGPVKTSIFIRDCNKCNFMVACQQFRTRDCRNLNVFLSCTSQPIIEATSKFKVGSYQLYYPDLAEQFEKANLSPFNCIWSDIHDFSHDSEQGSNFSFIHEETKPFDIITSPAS 641
            C +  S +ES      PPE   +SW++K + +PKDYT+ N  D   GRLP  +NGE F+IQ+C +  IY+ D+  +IT+DDC  C   +GP+K S+F RDCN C   VACQQFRTRDC+ ++ FL C SQPIIE++S  K G +Q YYP+L  QFEKA+LS +N  WS+I+DF+  + + + +S + E +K  D I  P +
Sbjct:    3 CLESKSKQES-----PPPEPKVFSWERKDRPDPKDYTLANLKDVTVGRLPGKVNGEGFVIQDCHDCNIYIFDNSATITIDDCVGCTFFLGPIKGSVFFRDCNNCKVAVACQQFRTRDCKKMDFFLLCDSQPIIESSSGMKFGCFQYYYPELEGQFEKASLSVYNNNWSNIYDFTPAAGE-TTWSLLPENSKVEDFIPLPTT 197          
BLAST of Protein XRP2 vs. Ensembl Nematostella
Match: EDO49057 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHY3])

HSP 1 Score: 76.2554 bits (186), Expect = 1.007e-14
Identity = 44/134 (32.84%), Postives = 65/134 (48.51%), Query Frame = 3
Query:  216 IQNCKNARIYLLDHIGSITVDDCTDCDIVIGPVKTSIFIRDCNKCNFMVACQQFRTRDCRNLNVFLSCTSQPIIEATSKFKVGSYQLYYPDLAEQFEKANLSPFNCIWSDIHDFS--HDSEQGSNFSFIHEETK 611
            + + +N  I L+    ++ +D   +C I+ GPV T+IFI DC  C F+VACQQ R         +L  TS+ IIE +S      Y L Y      F+ A L  +   WS ++DF+     E   N+  I E  +
Sbjct:  175 LSDLENCTIKLMGPPLAVRMDKLRNCIIISGPVSTAIFIDDCQDCTFIVACQQLRVHHTHRSLFYLHVTSRAIIEDSSGVGFAPYDLQYELKEAHFKAAGLDLYENNWSIVNDFNWLRKDEHSPNWYIIAENER 308          
BLAST of Protein XRP2 vs. Ensembl Nematostella
Match: EDO30525 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T0J5])

HSP 1 Score: 53.1434 bits (126), Expect = 7.382e-7
Identity = 30/106 (28.30%), Postives = 47/106 (44.34%), Query Frame = 3
Query:  192 TINGEQFIIQNCKNARIYLLDHIGSITVDDCTDCDIVIGPVKTSIFIRDCNKCNFMVACQQFRTRDCRNLNVFLSCTSQP-IIEATSKFKVGSYQLYYPDLAEQFE 506
            T  G    I  C  + IY+L  + S+T+  C D  IV+G V T++ I  C    F++   Q     C N +  L   ++P I+       +  Y  +YP L E  +
Sbjct:  326 TYAGSNLKIHRCHYSYIYVLCPLRSVTITKCHDSTIVLGCVNTAVNIIGCQNVLFIMISNQVSMSACLNCSFHLCTPTRPLILTGNEGLTLAPYHTFYPKLEEHLK 431          
BLAST of Protein XRP2 vs. Ensembl Medaka
Match: rp2 (RP2 activator of ARL3 GTPase [Source:NCBI gene;Acc:101168112])

HSP 1 Score: 198.364 bits (503), Expect = 1.894e-55
Identity = 89/180 (49.44%), Postives = 128/180 (71.11%), Query Frame = 3
Query:   96 PPEYSWDQKKKLNPKDYTIENCNDSCTGRLPQTINGEQFIIQNCKNARIYLLDHIGSITVDDCTDCDIVIGPVKTSIFIRDCNKCNFMVACQQFRTRDCRNLNVFLSCTSQPIIEATSKFKVGSYQLYYPDLAEQFEKANLSPFNCIWSDIHDFSHDSEQGSNFSFIHEETKPFDIITSP 635
            P +YSWD+++K++   YT++   D   GRLP T+NGEQF+IQ C+N  I++LDH  +IT+DDC +C IV+GPVK S+F RDC     +VACQQFRTRDC+ ++VFL C +QPIIE+++  K G +Q +YP+LA  F+ A LS FN  WS+IHDF+  S + +N+S + E +   D + +P
Sbjct:   39 PKQYSWDKREKVDLSHYTLKELKDVTVGRLPGTLNGEQFVIQECENCNIFVLDHSATITIDDCVNCRIVLGPVKGSVFFRDCKDIKCVVACQQFRTRDCQKMDVFLCCATQPIIESSTGMKFGCFQYFYPELAFHFKDAGLSIFNNNWSNIHDFTPVSGE-NNWSLLPEASSVLDFVPTP 217          
BLAST of Protein XRP2 vs. Ensembl Medaka
Match: rp2 (RP2 activator of ARL3 GTPase [Source:NCBI gene;Acc:101168112])

HSP 1 Score: 182.57 bits (462), Expect = 6.150e-50
Identity = 83/173 (47.98%), Postives = 120/173 (69.36%), Query Frame = 3
Query:  117 QKKKLNPKDYTIENCNDSCTGRLPQTINGEQFIIQNCKNARIYLLDHIGSITVDDCTDCDIVIGPVKTSIFIRDCNKCNFMVACQQFRTRDCRNLNVFLSCTSQPIIEATSKFKVGSYQLYYPDLAEQFEKANLSPFNCIWSDIHDFSHDSEQGSNFSFIHEETKPFDIITSP 635
            ++  ++   YT++   D   GRLP T+NGEQF+IQ C+N  I++LDH  +IT+DDC +C IV+GPVK S+F RDC     +VACQQFRTRDC+ ++VFL C +QPIIE+++  K G +Q +YP+LA  F+ A LS FN  WS+IHDF+  S + +N+S + E +   D + +P
Sbjct:   42 ERSAVDLSHYTLKELKDVTVGRLPGTLNGEQFVIQECENCNIFVLDHSATITIDDCVNCRIVLGPVKGSVFFRDCKDIKCVVACQQFRTRDCQKMDVFLCCATQPIIESSTGMKFGCFQYFYPELAFHFKDAGLSIFNNNWSNIHDFTPVSGE-NNWSLLPEASSVLDFVPTP 213          
BLAST of Protein XRP2 vs. Ensembl Medaka
Match: tbcc (tubulin folding cofactor C [Source:ZFIN;Acc:ZDB-GENE-041008-103])

HSP 1 Score: 70.4774 bits (171), Expect = 3.698e-12
Identity = 37/154 (24.03%), Postives = 70/154 (45.45%), Query Frame = 3
Query:  156 NCNDSCTGRLPQTINGEQFIIQNCKNARIYLLDHIGSITVDDCTDCDIVIGPVKTSIFIRDCNKCNFMVACQQFRTRDCRNLNVFLSCTSQPIIEATSKFKVGSYQLYYPDLAEQFEKANLSPFNCIWSDIHDFS--HDSEQGSNFSFIHEETK 611
            N ++    +  + +     ++ +  N ++ L     ++ +   + C+I+ GPV TS+F+  C+      ACQQ RT +  +  V+L  TS+ IIE  S      +   YP + + F  + L      W+ + DF+         N++ I EE +
Sbjct:  189 NMSNEVLIKTAEELQSRDVLLSHLTNCKVRLFGSPSTVHLKHISSCEILCGPVSTSVFVDHCSSSTLAFACQQLRTHNATDTQVYLHVTSRAIIEDCSGLSFAPFSWTYPTMEQDFTVSGLDRNRNNWNQVDDFNWLAAGTHSPNWTVIPEEER 342          
BLAST of Protein XRP2 vs. Planmine SMEST
Match: SMESG000053338.1 (SMESG000053338.1)

HSP 1 Score: 322.398 bits (825), Expect = 6.399e-98
Identity = 151/151 (100.00%), Postives = 151/151 (100.00%), Query Frame = 3
Query:  228 KNARIYLLDHIGSITVDDCTDCDIVIGPVKTSIFIRDCNKCNFMVACQQFRTRDCRNLNVFLSCTSQPIIEATSKFKVGSYQLYYPDLAEQFEKANLSPFNCIWSDIHDFSHDSEQGSNFSFIHEETKPFDIITSPASVLNSNEAKEHGDS 680
            KNARIYLLDHIGSITVDDCTDCDIVIGPVKTSIFIRDCNKCNFMVACQQFRTRDCRNLNVFLSCTSQPIIEATSKFKVGSYQLYYPDLAEQFEKANLSPFNCIWSDIHDFSHDSEQGSNFSFIHEETKPFDIITSPASVLNSNEAKEHGDS
Sbjct:  121 KNARIYLLDHIGSITVDDCTDCDIVIGPVKTSIFIRDCNKCNFMVACQQFRTRDCRNLNVFLSCTSQPIIEATSKFKVGSYQLYYPDLAEQFEKANLSPFNCIWSDIHDFSHDSEQGSNFSFIHEETKPFDIITSPASVLNSNEAKEHGDS 271          

HSP 2 Score: 143.28 bits (360), Expect = 5.547e-36
Identity = 68/70 (97.14%), Postives = 70/70 (100.00%), Query Frame = 1
Query: 3673 SVNNDNNFANILMKIEITDSRKLSVVPYTLGNRRNMLTDGACQIPSLVILYNNRGEERKLAYDILRYGIE 3882
            S+NNDNNFANILMK+EITDSRKLSVVPYTLGNRRNMLTDGACQIPSLVILYNNRGEERKLAYDILRYGIE
Sbjct:  271 SINNDNNFANILMKMEITDSRKLSVVPYTLGNRRNMLTDGACQIPSLVILYNNRGEERKLAYDILRYGIE 340          
BLAST of Protein XRP2 vs. Planmine SMEST
Match: SMESG000053338.1 (SMESG000053338.1)

HSP 1 Score: 321.627 bits (823), Expect = 7.157e-98
Identity = 151/151 (100.00%), Postives = 151/151 (100.00%), Query Frame = 3
Query:  228 KNARIYLLDHIGSITVDDCTDCDIVIGPVKTSIFIRDCNKCNFMVACQQFRTRDCRNLNVFLSCTSQPIIEATSKFKVGSYQLYYPDLAEQFEKANLSPFNCIWSDIHDFSHDSEQGSNFSFIHEETKPFDIITSPASVLNSNEAKEHGDS 680
            KNARIYLLDHIGSITVDDCTDCDIVIGPVKTSIFIRDCNKCNFMVACQQFRTRDCRNLNVFLSCTSQPIIEATSKFKVGSYQLYYPDLAEQFEKANLSPFNCIWSDIHDFSHDSEQGSNFSFIHEETKPFDIITSPASVLNSNEAKEHGDS
Sbjct:  107 KNARIYLLDHIGSITVDDCTDCDIVIGPVKTSIFIRDCNKCNFMVACQQFRTRDCRNLNVFLSCTSQPIIEATSKFKVGSYQLYYPDLAEQFEKANLSPFNCIWSDIHDFSHDSEQGSNFSFIHEETKPFDIITSPASVLNSNEAKEHGDS 257          

HSP 2 Score: 143.28 bits (360), Expect = 4.661e-36
Identity = 68/70 (97.14%), Postives = 70/70 (100.00%), Query Frame = 1
Query: 3673 SVNNDNNFANILMKIEITDSRKLSVVPYTLGNRRNMLTDGACQIPSLVILYNNRGEERKLAYDILRYGIE 3882
            S+NNDNNFANILMK+EITDSRKLSVVPYTLGNRRNMLTDGACQIPSLVILYNNRGEERKLAYDILRYGIE
Sbjct:  257 SINNDNNFANILMKMEITDSRKLSVVPYTLGNRRNMLTDGACQIPSLVILYNNRGEERKLAYDILRYGIE 326          
BLAST of Protein XRP2 vs. Planmine SMEST
Match: SMESG000053338.1 (SMESG000053338.1)

HSP 1 Score: 321.627 bits (823), Expect = 8.840e-98
Identity = 151/151 (100.00%), Postives = 151/151 (100.00%), Query Frame = 3
Query:  228 KNARIYLLDHIGSITVDDCTDCDIVIGPVKTSIFIRDCNKCNFMVACQQFRTRDCRNLNVFLSCTSQPIIEATSKFKVGSYQLYYPDLAEQFEKANLSPFNCIWSDIHDFSHDSEQGSNFSFIHEETKPFDIITSPASVLNSNEAKEHGDS 680
            KNARIYLLDHIGSITVDDCTDCDIVIGPVKTSIFIRDCNKCNFMVACQQFRTRDCRNLNVFLSCTSQPIIEATSKFKVGSYQLYYPDLAEQFEKANLSPFNCIWSDIHDFSHDSEQGSNFSFIHEETKPFDIITSPASVLNSNEAKEHGDS
Sbjct:  117 KNARIYLLDHIGSITVDDCTDCDIVIGPVKTSIFIRDCNKCNFMVACQQFRTRDCRNLNVFLSCTSQPIIEATSKFKVGSYQLYYPDLAEQFEKANLSPFNCIWSDIHDFSHDSEQGSNFSFIHEETKPFDIITSPASVLNSNEAKEHGDS 267          

HSP 2 Score: 143.28 bits (360), Expect = 4.742e-36
Identity = 68/70 (97.14%), Postives = 70/70 (100.00%), Query Frame = 1
Query: 3673 SVNNDNNFANILMKIEITDSRKLSVVPYTLGNRRNMLTDGACQIPSLVILYNNRGEERKLAYDILRYGIE 3882
            S+NNDNNFANILMK+EITDSRKLSVVPYTLGNRRNMLTDGACQIPSLVILYNNRGEERKLAYDILRYGIE
Sbjct:  267 SINNDNNFANILMKMEITDSRKLSVVPYTLGNRRNMLTDGACQIPSLVILYNNRGEERKLAYDILRYGIE 336          
BLAST of Protein XRP2 vs. Planmine SMEST
Match: SMESG000053338.1 (SMESG000053338.1)

HSP 1 Score: 322.013 bits (824), Expect = 9.328e-98
Identity = 151/151 (100.00%), Postives = 151/151 (100.00%), Query Frame = 3
Query:  228 KNARIYLLDHIGSITVDDCTDCDIVIGPVKTSIFIRDCNKCNFMVACQQFRTRDCRNLNVFLSCTSQPIIEATSKFKVGSYQLYYPDLAEQFEKANLSPFNCIWSDIHDFSHDSEQGSNFSFIHEETKPFDIITSPASVLNSNEAKEHGDS 680
            KNARIYLLDHIGSITVDDCTDCDIVIGPVKTSIFIRDCNKCNFMVACQQFRTRDCRNLNVFLSCTSQPIIEATSKFKVGSYQLYYPDLAEQFEKANLSPFNCIWSDIHDFSHDSEQGSNFSFIHEETKPFDIITSPASVLNSNEAKEHGDS
Sbjct:  131 KNARIYLLDHIGSITVDDCTDCDIVIGPVKTSIFIRDCNKCNFMVACQQFRTRDCRNLNVFLSCTSQPIIEATSKFKVGSYQLYYPDLAEQFEKANLSPFNCIWSDIHDFSHDSEQGSNFSFIHEETKPFDIITSPASVLNSNEAKEHGDS 281          

HSP 2 Score: 143.28 bits (360), Expect = 6.212e-36
Identity = 68/70 (97.14%), Postives = 70/70 (100.00%), Query Frame = 1
Query: 3673 SVNNDNNFANILMKIEITDSRKLSVVPYTLGNRRNMLTDGACQIPSLVILYNNRGEERKLAYDILRYGIE 3882
            S+NNDNNFANILMK+EITDSRKLSVVPYTLGNRRNMLTDGACQIPSLVILYNNRGEERKLAYDILRYGIE
Sbjct:  281 SINNDNNFANILMKMEITDSRKLSVVPYTLGNRRNMLTDGACQIPSLVILYNNRGEERKLAYDILRYGIE 350          
BLAST of Protein XRP2 vs. Planmine SMEST
Match: SMESG000053338.1 (SMESG000053338.1)

HSP 1 Score: 319.316 bits (817), Expect = 2.888e-96
Identity = 151/151 (100.00%), Postives = 151/151 (100.00%), Query Frame = 3
Query:  228 KNARIYLLDHIGSITVDDCTDCDIVIGPVKTSIFIRDCNKCNFMVACQQFRTRDCRNLNVFLSCTSQPIIEATSKFKVGSYQLYYPDLAEQFEKANLSPFNCIWSDIHDFSHDSEQGSNFSFIHEETKPFDIITSPASVLNSNEAKEHGDS 680
            KNARIYLLDHIGSITVDDCTDCDIVIGPVKTSIFIRDCNKCNFMVACQQFRTRDCRNLNVFLSCTSQPIIEATSKFKVGSYQLYYPDLAEQFEKANLSPFNCIWSDIHDFSHDSEQGSNFSFIHEETKPFDIITSPASVLNSNEAKEHGDS
Sbjct:  166 KNARIYLLDHIGSITVDDCTDCDIVIGPVKTSIFIRDCNKCNFMVACQQFRTRDCRNLNVFLSCTSQPIIEATSKFKVGSYQLYYPDLAEQFEKANLSPFNCIWSDIHDFSHDSEQGSNFSFIHEETKPFDIITSPASVLNSNEAKEHGDS 316          

HSP 2 Score: 142.895 bits (359), Expect = 1.601e-35
Identity = 68/70 (97.14%), Postives = 70/70 (100.00%), Query Frame = 1
Query: 3673 SVNNDNNFANILMKIEITDSRKLSVVPYTLGNRRNMLTDGACQIPSLVILYNNRGEERKLAYDILRYGIE 3882
            S+NNDNNFANILMK+EITDSRKLSVVPYTLGNRRNMLTDGACQIPSLVILYNNRGEERKLAYDILRYGIE
Sbjct:  316 SINNDNNFANILMKMEITDSRKLSVVPYTLGNRRNMLTDGACQIPSLVILYNNRGEERKLAYDILRYGIE 385          

HSP 3 Score: 139.428 bits (350), Expect = 2.256e-34
Identity = 63/64 (98.44%), Postives = 64/64 (100.00%), Query Frame = 3
Query:   33 MGSILCCDKNSDEESQHIVSKPPEYSWDQKKKLNPKDYTIENCNDSCTGRLPQTINGEQFIIQN 224
            MGSILCCDKNSDEESQHIVSKPPEYSWDQKKKLNPKDYTIENCNDSCTGRLP+TINGEQFIIQN
Sbjct:    1 MGSILCCDKNSDEESQHIVSKPPEYSWDQKKKLNPKDYTIENCNDSCTGRLPRTINGEQFIIQN 64          
The following BLAST results are available for this feature:
BLAST of Protein XRP2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RP24.094e-5847.32RP2 activator of ARL3 GTPase [Source:HGNC Symbol;A... [more]
TBCC1.211e-1428.89tubulin folding cofactor C [Source:HGNC Symbol;Acc... [more]
SETMAR1.277e-1235.71SET domain and mariner transposase fusion gene [So... [more]
SETMAR1.746e-1235.71SET domain and mariner transposase fusion gene [So... [more]
SETMAR2.015e-636.67SET domain and mariner transposase fusion gene [So... [more]
back to top
BLAST of Protein XRP2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
rpi-21.860e-3233.72pep chromosome:WBcel235:IV:1711279:1714179:1 gene:... [more]
back to top
BLAST of Protein XRP2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
TBCC4.753e-1226.23gene:FBgn0051961 transcript:FBtr0077484[more]
TBCC4.753e-1226.23gene:FBgn0051961 transcript:FBtr0077485[more]
back to top
BLAST of Protein XRP2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rp21.141e-5547.40RP2 activator of ARL3 GTPase [Source:NCBI gene;Acc... [more]
rp21.141e-5547.40RP2 activator of ARL3 GTPase [Source:NCBI gene;Acc... [more]
tbcc1.022e-1125.37tubulin folding cofactor C [Source:ZFIN;Acc:ZDB-GE... [more]
tbccd15.146e-827.50TBCC domain containing 1 [Source:NCBI gene;Acc:100... [more]
tbccd15.146e-827.50TBCC domain containing 1 [Source:NCBI gene;Acc:100... [more]
back to top
BLAST of Protein XRP2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
pdia62.639e-5847.45protein disulfide isomerase family A member 6 [Sou... [more]
rbm116.710e-925.55RNA binding motif protein 11 [Source:Xenbase;Acc:X... [more]
tbccd12.020e-623.57TBCC domain containing 1 [Source:NCBI gene;Acc:549... [more]
back to top
BLAST of Protein XRP2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rp24.088e-5747.00retinitis pigmentosa 2 homolog [Source:MGI Symbol;... [more]
Rp26.411e-5747.00retinitis pigmentosa 2 homolog [Source:MGI Symbol;... [more]
Rp26.411e-5747.00retinitis pigmentosa 2 homolog [Source:MGI Symbol;... [more]
Rp21.330e-5647.00retinitis pigmentosa 2 homolog [Source:MGI Symbol;... [more]
Rp22.387e-4750.31retinitis pigmentosa 2 homolog [Source:MGI Symbol;... [more]
back to top
BLAST of Protein XRP2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5ZHN4|XRP2_CHICK3.418e-5850.82Protein XRP2 OS=Gallus gallus OX=9031 GN=RP2 PE=2 ... [more]
sp|O75695|XRP2_HUMAN1.966e-5747.32Protein XRP2 OS=Homo sapiens OX=9606 GN=RP2 PE=1 S... [more]
sp|Q8AVX5|XRP2_XENLA3.355e-5748.47Protein XRP2 OS=Xenopus laevis OX=8355 GN=rp2 PE=2... [more]
sp|Q9EPK2|XRP2_MOUSE4.485e-5647.00Protein XRP2 OS=Mus musculus OX=10090 GN=Rp2 PE=1 ... [more]
sp|F1QC45|XRP2_DANRE8.612e-5547.40Protein XRP2 OS=Danio rerio OX=7955 GN=rp2 PE=1 SV... [more]
back to top
BLAST of Protein XRP2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8HUD91.492e-6054.59Protein XRP2 OS=Macrostomum lignano OX=282301 GN=B... [more]
H2YQW13.571e-5954.55C-CAP/cofactor C-like domain-containing protein OS... [more]
F7AG499.710e-5957.22Protein XRP2 OS=Ciona intestinalis OX=7719 PE=3 SV... [more]
A0A1W2W4R61.132e-5857.22Protein XRP2 OS=Ciona intestinalis OX=7719 GN=LOC1... [more]
A0A1W5BJR81.143e-5857.22Protein XRP2 OS=Ciona intestinalis OX=7719 GN=LOC1... [more]
back to top
BLAST of Protein XRP2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
rp29.477e-5741.44RP2 activator of ARL3 GTPase [Source:NCBI gene;Acc... [more]
tbcc2.340e-1025.37tubulin folding cofactor C [Source:NCBI gene;Acc:1... [more]
tbccd11.178e-721.19TBCC domain containing 1 [Source:NCBI gene;Acc:103... [more]
back to top
BLAST of Protein XRP2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
tbcc2.246e-1729.29tubulin folding cofactor C [Source:ZFIN;Acc:ZDB-GE... [more]
TBCCD19.509e-1124.52TBCC domain containing 1 [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of Protein XRP2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein XRP2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO362233.830e-5546.77Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO490571.007e-1432.84Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO305257.382e-728.30Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein XRP2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
rp21.894e-5549.44RP2 activator of ARL3 GTPase [Source:NCBI gene;Acc... [more]
rp26.150e-5047.98RP2 activator of ARL3 GTPase [Source:NCBI gene;Acc... [more]
tbcc3.698e-1224.03tubulin folding cofactor C [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of Protein XRP2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000053338.16.399e-98100.00SMESG000053338.1[more]
SMESG000053338.17.157e-98100.00SMESG000053338.1[more]
SMESG000053338.18.840e-98100.00SMESG000053338.1[more]
SMESG000053338.19.328e-98100.00SMESG000053338.1[more]
SMESG000053338.12.888e-96100.00SMESG000053338.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30028470 ID=SMED30028470|Name=Protein XRP2|organism=Schmidtea mediterranea sexual|type=transcript|length=4355bp
CCTATAAATAAATATTTAGCGTAATATTTAAGATGGGATCCATACTGTGT
TGCGATAAAAATTCTGATGAAGAATCTCAGCACATAGTTTCGAAACCACC
TGAATATTCATGGGATCAAAAAAAGAAGCTTAATCCTAAAGATTATACTA
TAGAAAATTGCAATGACTCATGTACTGGTAGACTTCCTCAAACTATTAAT
GGCGAGCAATTCATTATTCAAAATTGTAAAAATGCGCGAATTTACTTGCT
AGATCATATTGGTTCAATTACTGTGGATGACTGTACAGATTGTGATATTG
TTATTGGACCGGTGAAGACAAGTATTTTTATCCGGGACTGCAATAAATGT
AATTTTATGGTGGCTTGTCAACAGTTTCGAACTCGCGATTGTCGGAACTT
AAATGTGTTTTTATCATGCACTTCGCAGCCCATTATCGAGGCAACCTCGA
AATTCAAAGTTGGCTCATATCAGTTGTATTATCCGGATCTAGCAGAGCAA
TTTGAAAAAGCAAATTTGAGTCCTTTTAATTGCATTTGGTCAGATATTCA
TGACTTTTCACATGACTCAGAACAAGGATCAAATTTTTCATTTATTCATG
AAGAAACAAAACCTTTTGATATTATCACTTCTCCAGCATCTGTACTAAAT
TCTAATGAAGCTAAAGAACACGGCGATTCAAGTGAGATCTGTTTTTTTAT
AATCTTGTACCTTTTTGTCACATTGGACGATTGTTTATAATTATTGTGTA
ATATAATTAATTTCTTAGGAGACTTTGTTTTTTCTACTCCTTCTTTGGCA
GCATTGATTTCATCTTACAGAGAAAAACAAGCAATATTGCCATCAATATT
CAAATAATCTTCATATTCATCTAAGCTTTTTGCATTATTTTCATCTGTTG
ATATCGATATATGATGGTATAATCTATTTTAACCTTCACGCGCCTAAGCG
GAGTGCATTTGTTCACAAAAACTTTTATTTTTTAAACCGTTTGTAATATA
ATAATGATATGTATCTGATAAGATTTGTATTCCATTCATTTGGATATCTT
TGTAGATTACTACATCTTATAAACGTCTCTAACATTGGATTAATTGAATT
ACATCTATGTTTTACATCAAGATTTCGATGAATTTCATAATCAAGTTCAT
TACAAATGTTTTATTGCAAAATGTCGTTATGAACTATTGAACGTTTGAAA
AATTTCACAATAGCATGAACCGTATATTATATCTCGGTTAGGCTGATTAT
TTCGGAACCTTCAGATTCTGCATCATCATCATTAAACCTAGAATAACCTT
CATCATCTTTATCAAATTTTACATATCCATTATTATCCCTGTCGTCAGTG
TCTCTTATTAAGCTTCACTATCAAAATTTTGACTGTTATTTTTTGATTTT
TTGAAATAAAATGTATTAGAAAGTGCAAGGTGGAGACCATGTTTTAAACA
TAATTGGACTTCTGCCGAACATTTTTTACTGTATGTAACCCATTCATTGG
TGGTAGCTCCAATGTATCCTTCGAAAGACAGATGAAAACCTTTAAAATGG
TCAGCCACACTCAGCTGAATCTTTGCAAAGTTGCATGATCCAATAATTCT
TACCAATTCTATGTTCAATACTTTGCCAGTTTTATCATGTGCATTTATGT
TCATATAATGGGGTTGTCCAGAACTTACCCATTCGTCCAAGGTTATACTA
AATTTCTCACCTTTTTTTGGCCTCATCAAAAAACTTACAATTGTTCACTT
CTGTTCTGTATTTTTTACATTTAGCTTTATTTTTAAAACTGTTAGCAGCT
GAAATTTTTGTAAAATATTCTCATATTGCTGCCGGCGACATTATTTGGGT
ATATTTTTGATTTTGAAAAAAATCCTTTCAAAAAATTAATATTTGTTAAA
AAAATTAGTGGAAAAAATAGTTACATATTTAATATTGTTACATTTGTATA
GTGGAAAAATAACTATTTAATATTGTTAATTAGATAAGCCAATATAATTT
TCCGTTTAATACCAAACAAAATCAACAATACAATCAATAAATCTCAATTT
AATTATCTGAAATTTAAATGCCAAATGAAATGACATAAAGCAGATGTCAG
AATTAATACGAAACAGAGGAATGAAAAATAAATAAGACCATTAAGTTACT
TAAATTTGCATAAATATATGCGACAGCAATTAAAATATTGAACATATATA
AATATGAATTTTAATAAAATATATTTTTTTCAAAACCGTAATCCCCAATT
TTGCGACGCGGTTTACGGTTTTGGTTTCTGAGGTTGAAAATCCTGGTTTC
AGTTTCCGGTTAACCGAACCGTCCAACCTCTAGTTACACCTAGTTATTGC
ATAACCCATTAAAATGTTGAATTCAGTTTTTTGATTTGGATCATTTAATC
AAAATCCATTCTAATCATAAAATAAAATACTGATAGATAGCCCAAAGATA
AAGAAAAAGAAACTCTGTAAAATATGGATGGTTAAAAGATAAGATTTGTT
TACTGATAATTCAAATATCCTAAAATTATCAAACACAATTATTTAAATTC
ACATTTCCTTGAGTCACATAAATCTTATTCTTTTATTGTGCTGAATTTTA
CAGATTTTATCCATAAGTTTCTGCATATTATAAAACATTTTCTCACCTCC
TCAAAAAATTAGACAAAAATATTGTCAAAAGTGTTTGTTATTATGGTAAA
TTAAACACCAATTCAATACACTTCAAACATTGTTTTGTCATGAACCAAAT
GATTATTTATAAAGACAAAATTTAAATAAATCGAGTAAATAAATTACATA
AATCCTGAAAATGGTTCGAAATTTTTGAAAGAGGTGATTTCGACATTTTT
TATAAGCCACGTTTTGGGCGACCATCTTTGATCGACGACGATGTTGTTAA
GACCATGTTGGAGCAAAATCCTTTTCTGACAACATCGGCGATCGCAGAAA
GACTTAATTCAGCTCAGCAAACCATTTCGGACCATGTTCGGATGATAGGA
TTGGTGTGGAAATATTCAAGATGGATGTCACATTTATTAAGTCAGAAGAA
TTTGGATTATCGAGTCACAATATTCACATCTCTACGAGCTCGGAACAAAA
TCGAGAACAAAAACAAATTAATATGCATACAATTAATACTAACAACTAAA
TATTAAAAATTTTGCCGAGCCAATGCTTTTAAGGATCGTTTAAATTGATA
TAAAATGAAAATACTATATGAATATGTATTTTCCTCTTTCGGAATAGATA
TTGTAAATTATATTTCTCCCAGATGAAATATGCTAAAAGACTTCAAATAG
ATATTGGGCACAAAACAAATTAAGCATAAACAGATTGATATGACTCTTGA
GCAATTTCTTACTTTGGAGTTAGGGCTATAATGTGGCATTAAAAATTTGA
AAACGAAAATAATTTTGGACTCATTCCTAAGGCTTTCAAGCTTTGCTCTT
TTCTCCTTGAACTGTTTCTGTCGATATCTCCGGTAAACGATACTTTGGTG
TTCAATTGAATACATCAAAAATTTATATAATATATTTTTTTAATACACTT
ATCTAATATAAAAGTAAAATATGAATTTGTTGGACAAGTTTTTGAAACAG
TGCCAGTCTGAATTGGATGGAATTATAGAAACTTCATTTCATATTTTACA
TATTTTTATTTTTTTTTGCATTTCAGTTAATAATGACAATAATTTTGCAA
ATATTCTAATGAAAATAGAAATAACTGATTCTCGTAAGTTATCAGTGGTA
CCGTATACCCTTGGAAATCGCCGCAATATGTTAACGGATGGTGCTTGTCA
AATTCCTTCTTTGGTTATATTATATAATAACCGTGGCGAGGAGAGGAAAT
TGGCCTATGACATATTACGATATGGGATTGAGGTGAATTTAGTTATTGTC
ATTTTATTACCGGCTTTAGTGATATATTTGAGTGTTTCGTTCATTATATT
GTGAATTAGCGGTTGTCTCTCTGAATATTAAATTCCAGGGCAGGAAAAGC
GCTGTATTTAGAAGTTCTCATGGAAGTTATAGTGGATTGAAAAGATTTCA
TATTTCCCTTTCTAATTCACGTGTACGGAGTTATGGCTGTAATTTTCGAA
TGTTGGATTTGGAGATCACATTAGACTAGTTAACTTTGCTAGTGCGCTAC
GGACAATACTCTAATATGTTAATAATTCAAAACTCTAGAAACGAGTTATA
ACGGTTTTTTAAATGCATATTTCTTAAATTGATAGAATTTTTTATTGCGA
TTTTATAAATCTGATTCATAGCCAAATTTTGTCGAAAATATTATGTCGAG
AATATTTTGGCTAGAACCAATATTATTATTTTTTAAATCAACCTAATTAG
AAAAC
back to top

protein sequence of SMED30028470-orf-1

>SMED30028470-orf-1 ID=SMED30028470-orf-1|Name=SMED30028470-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=123bp
MRPKKGEKFSITLDEWVSSGQPHYMNINAHDKTGKVLNIELVRIIGSCNF
AKIQLSVADHFKGFHLSFEGYIGATTNEWVTYSKKCSAEVQLCLKHGLHL
ALSNTFYFKKSKNNSQNFDSEA*
back to top

protein sequence of SMED30028470-orf-2

>SMED30028470-orf-2 ID=SMED30028470-orf-2|Name=SMED30028470-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=128bp
MNLLDKFLKQCQSELDGIIETSFHILHIFIFFCISVNNDNNFANILMKIE
ITDSRKLSVVPYTLGNRRNMLTDGACQIPSLVILYNNRGEERKLAYDILR
YGIEVNLVIVILLPALVIYLSVSFIIL*
back to top

protein sequence of SMED30028470-orf-3

>SMED30028470-orf-3 ID=SMED30028470-orf-3|Name=SMED30028470-orf-3|organism=Schmidtea mediterranea sexual|type=polypeptide|length=236bp
MGSILCCDKNSDEESQHIVSKPPEYSWDQKKKLNPKDYTIENCNDSCTGR
LPQTINGEQFIIQNCKNARIYLLDHIGSITVDDCTDCDIVIGPVKTSIFI
RDCNKCNFMVACQQFRTRDCRNLNVFLSCTSQPIIEATSKFKVGSYQLYY
PDLAEQFEKANLSPFNCIWSDIHDFSHDSEQGSNFSFIHEETKPFDIITS
PASVLNSNEAKEHGDSSEICFFIILYLFVTLDDCL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0001947heart looping
GO:0010842retina layer formation
GO:0035845photoreceptor cell outer segment organization
GO:0042461photoreceptor cell development
GO:0045494photoreceptor cell maintenance
GO:0048793pronephros development
GO:0060041retina development in camera-type eye
GO:0061371determination of heart left/right asymmetry
GO:0000902cell morphogenesis
GO:0007010cytoskeleton organization
GO:0043547positive regulation of GTPase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR006599CARP_motif
IPR016098CAP/MinC_C
IPR012945Tubulin-bd_cofactor_C_dom
IPR017901C-CAP_CF_C-like
IPR013912Adenylate_cyclase-assoc_CAP_C
Vocabulary: molecular function
TermDefinition
GO:0003779actin binding
GO:0000166nucleotide binding
GO:0005096GTPase activator activity
GO:0005525GTP binding