Zinc finger protein castor-like protein 1

Overview
NameZinc finger protein castor-like protein 1
Smed IDSMED30028462
Length (bp)1599
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Zinc finger protein castor-like protein 1 (SMED30028462) t-SNE clustered cells

Violin plots show distribution of expression levels for Zinc finger protein castor-like protein 1 (SMED30028462) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Zinc finger protein castor-like protein 1 (SMED30028462) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Zinc finger protein castor-like protein 1 (SMED30028462) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30028462

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30028462SMESG000024266.1 dd_Smed_v4_2206_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30028462SMESG000024266.1 dd_Smed_v4_2206_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30028462SMESG000024266.1 dd_Smed_v4_2206_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Zinc finger protein castor-like protein 1 vs. TrEMBL
Match: A0A2C9JYF3 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106072911 PE=4 SV=1)

HSP 1 Score: 82.8037 bits (203), Expect = 1.089e-12
Identity = 47/136 (34.56%), Postives = 74/136 (54.41%), Query Frame = 1
Query:  466 LSQKHQTNAKSLPKRLWKPKSFDFDEFFTTQVKRFTANDVCNSRCQMLYKDHYHCFAENGNCSEVMKGKDQLRQHGKRHSVAEELTNLEFK------SC--SKCQTEETKSHYHCSYANCNFVSSDLS-NLDRLAH 846
            LS K +T   ++  +   P+  + DE +   + R+TAND C SRC  LYKDHYHC  E   C  + K KD +R H + H + + +T L ++      +C  + CQ ++ ++HYHC++ NC  +  D +    RL H
Sbjct: 1130 LSNKRKT---AIAHKHSSPEKRERDESWKKYLIRYTANDACYSRCSCLYKDHYHCRVE--GCQVIFKSKDGVRSHARFHDLQDSITPLVYRHFTSGQACNETNCQYDQKEAHYHCNWTNCTHIVPDSAPTFARLEH 1260          
BLAST of Zinc finger protein castor-like protein 1 vs. TrEMBL
Match: A0A3S1BR51 (Uncharacterized protein OS=Elysia chlorotica OX=188477 GN=EGW08_019329 PE=4 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 5.153e-12
Identity = 47/147 (31.97%), Postives = 74/147 (50.34%), Query Frame = 1
Query:  433 VLTSTQTEPLDLSQKHQTNAKSLPKRLWKPKSFDFDEFFTTQVKRFTANDVCNSRCQMLYKDHYHCFAENGNCSEVMKGKDQLRQHGKRHSVAEELTNLEFKSCS--------KCQTEETKSHYHCSYANCN-FVSSDLSNLDRLAH 846
            V  S QT  + L+ + +     +P +L   +  + DE +   + R+TAND C SRC  LYKDHYHC  E   C    K KD +R H + H + + ++ + F++ S         C+  + + HYHC++ +CN  + S      RL H
Sbjct:   86 VAGSGQTPQVFLNPQGRVWGLHIPIKLADKR--ERDETWKKYLIRYTANDACYSRCACLYKDHYHCRTE--GCKVTFKSKDGVRGHARFHELQDSISPMVFRAVSGNGVCPFEGCRYSKLEDHYHCNWVDCNQVIPSSAPTFARLEH 228          
BLAST of Zinc finger protein castor-like protein 1 vs. TrEMBL
Match: A0A0L8ICD7 (Uncharacterized protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22019506mg PE=4 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 1.435e-11
Identity = 45/118 (38.14%), Postives = 69/118 (58.47%), Query Frame = 1
Query:  532 DFDEFFTTQVKRFTANDVCNSRCQMLYKDHYHCFAENGNCSEVMKGKDQLRQHGKRHSVAEELTN---LEFKS----CSKCQTEETKSHYHCSYANCNFVSS-DLSNLDRLAHVESVH 861
            D DE + T +KR+TAND CN RC  LYKDHYHC  +   C+ + + KD +R+H + H + + +T+   + +KS      KC+    + H+HC Y+ CNF +S   ++  RL H +  H
Sbjct:  475 DKDENWKTYLKRYTANDPCNPRCDYLYKDHYHC--QVLGCTVMYRSKDGVREHARFHELQDHITSNCYILYKSNEPCLQKCEFNLKEKHFHCQYSACNFSTSYSDASFARLEHYQLQH 590          
BLAST of Zinc finger protein castor-like protein 1 vs. TrEMBL
Match: K1R6H0 (Zinc finger protein castor-like protein 1 OS=Crassostrea gigas OX=29159 GN=CGI_10025689 PE=4 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 1.446e-11
Identity = 48/138 (34.78%), Postives = 69/138 (50.00%), Query Frame = 1
Query:  457 PLDLSQKHQTNAKSLPKRLWKPKSFDFDEFFTTQVKRFTANDVCNSRCQMLYKDHYHCFAENGNCSEVMKGKDQLRQHGKRHSVAEELTNLEFKSCS-------KCQTEETKSHYHCSYANC-NFVSSDLSNLDRLAH 846
            PL LS+    N +   +R         DE +   + R+TAND CNSRCQ LYKDHYHC  E   C  + K KD +R+H + H + + +T + +   S        CQ    ++HYHC ++ C + V  +     RL H
Sbjct:  808 PLLLSKAAANNTQERKER---------DESWKNYLIRYTANDPCNSRCQYLYKDHYHCRVE--GCLVLFKSKDGVREHARFHELQDRITPVAYVMYSDTDTCPENCQYSNKQTHYHCIWSGCTHVVPHEGPTFGRLEH 934          
BLAST of Zinc finger protein castor-like protein 1 vs. TrEMBL
Match: A0A1S3HZK2 (zinc finger protein castor homolog 1 OS=Lingula unguis OX=7574 GN=LOC106159656 PE=4 SV=1)

HSP 1 Score: 78.1814 bits (191), Expect = 2.812e-11
Identity = 44/124 (35.48%), Postives = 69/124 (55.65%), Query Frame = 1
Query:  502 PKRLWKPKSFDFDEFFTTQVKRFTANDVCNSRCQMLYKDHYHCFAENGNCSEVMKGKDQLRQHGKRHSVAEELTNLEF------KSCSK--CQTEETKSHYHCSYANCNFVSSDLSNL-DRLAH 846
            P +L   K+   D+ +   + R+TAND CNSRC+ LYKDHYHC      C+ V + K+ +R+H + H   +++++L +      + CS+  C     + HYHC +ANC  V S   ++  RL H
Sbjct:  893 PTKLQVTKNNVKDDSWKGILTRYTANDPCNSRCEYLYKDHYHCNIT--GCNMVFRSKEGVREHARNHEQQDKISDLTYMQFNESEQCSQELCPYARKEKHYHCLWANCQRVISSTGDIFARLTH 1014          
BLAST of Zinc finger protein castor-like protein 1 vs. Planmine SMEST
Match: SMESG000024266.1 (SMESG000024266.1)

HSP 1 Score: 629.787 bits (1623), Expect = 0.000e+0
Identity = 352/356 (98.88%), Postives = 353/356 (99.16%), Query Frame = 1
Query:  244 MEKIEEYYEKNNLNQKPDQSEEFVKIENELKKXXXXXXXXXXXXXXXXXXXXXXXXXQNAIPPVLTSTQTEPLDLSQKHQTNAKSLPKRLWKPKSFDFDEFFTTQVKRFTANDVCNSRCQMLYKDHYHCFAENGNCSEVMKGKDQLRQHGKRHSVAEELTNLEFKSCSKCQTEETKSHYHCSYANCNFVSSDLSNLDRLAHVESVHCXXXXXXXXXXXXXXXXSTKRCKLVHENVDKPESILSLSDLPNHISPISPGSFDNQFMDTNSDPFDTRDNARCRSQIIAPRSKFTKSIVFDEIENSVLFNIREEGKHLYKLGTCVRLFCNLKKADHYHCPICDVGSSKIDLYLRHLKRHK 1311
            MEKIEEYYEKNNLNQKPDQSEEFVKIENELKKILSNSADNIDNNIILSLIKLLLLNSQNAIPPVLTSTQTEPLDLSQKHQT+AKSLPKRLWKPKSFDFDEFFTTQVKRFTANDVCNSRCQMLYKDHYHCFAENGNCSEVMKGKDQLRQHGKRHSVAEELTNLEFKSCSKCQTEETKSHYHCSYANCNFVSSDLSNLDRLAHVESVHCNILLKRANNNINKNKISTKRCKLVHENVDKPESILSLSDLPNHISPIS GSFDNQFMDTNSDPFD RDNARC SQIIAPRSKFTKSIVFDEIENSVLFNIREEGKHLYKLGTCVRLFCNLKKADHYHCPICDVGSSKIDLYLRHLKRHK
Sbjct:    1 MEKIEEYYEKNNLNQKPDQSEEFVKIENELKKILSNSADNIDNNIILSLIKLLLLNSQNAIPPVLTSTQTEPLDLSQKHQTDAKSLPKRLWKPKSFDFDEFFTTQVKRFTANDVCNSRCQMLYKDHYHCFAENGNCSEVMKGKDQLRQHGKRHSVAEELTNLEFKSCSKCQTEETKSHYHCSYANCNFVSSDLSNLDRLAHVESVHCNILLKRANNNINKNKISTKRCKLVHENVDKPESILSLSDLPNHISPISSGSFDNQFMDTNSDPFDPRDNARCHSQIIAPRSKFTKSIVFDEIENSVLFNIREEGKHLYKLGTCVRLFCNLKKADHYHCPICDVGSSKIDLYLRHLKRHK 356          
BLAST of Zinc finger protein castor-like protein 1 vs. Planmine SMEST
Match: SMESG000024266.1 (SMESG000024266.1)

HSP 1 Score: 603.979 bits (1556), Expect = 0.000e+0
Identity = 330/356 (92.70%), Postives = 333/356 (93.54%), Query Frame = 1
Query:  244 MEKIEEYYEKNNLNQKPDQSEEFVKIENELKKXXXXXXXXXXXXXXXXXXXXXXXXXQNAIPPVLTSTQTEPLDLSQKHQTNAKSLPKRLWKPKSFDFDEFFTTQVKRFTANDVCNSRCQMLYKDHYHCFAENGNCSEVMKGKDQLRQHGKRHSVAEELTNLEFKSCSKCQTEETKSHYHCSYANCNFVSSDLSNLDRLAHVESVHCXXXXXXXXXXXXXXXXSTKRCKLVHENVDKPESILSLSDLPNHISPISPGSFDNQFMDTNSDPFDTRDNARCRSQIIAPRSKFTKSIVFDEIENSVLFNIREEGKHLYKLGTCVRLFCNLKKADHYHCPICDVGSSKIDLYLRHLKRHK 1311
            MEKIEEYYEKNNLNQKPDQSEEFVKIENELKKILSNSADNIDNNIILSLIKLLLLNSQNAIPPVLTSTQTEPLDLSQKHQT+AKSLPKRLWKPKSFDFDEFFTTQVKRFTANDVCNSRCQMLYKDHYHCFAENGNCSEVMKGKDQLRQHGKRHSVAEELTNLEFKSCSKCQTEETKSHYHCSYANCNFVSSDLSNLDR  +  +                NKISTKRCKLVHENVDKPESILSLSDLPNHISPIS GSFDNQFMDTNSDPFD RDNARC SQIIAPRSKFTKSIVFDEIENSVLFNIREEGKHLYKLGTCVRLFCNLKKADHYHCPICDVGSSKIDLYLRHLKRHK
Sbjct:    1 MEKIEEYYEKNNLNQKPDQSEEFVKIENELKKILSNSADNIDNNIILSLIKLLLLNSQNAIPPVLTSTQTEPLDLSQKHQTDAKSLPKRLWKPKSFDFDEFFTTQVKRFTANDVCNSRCQMLYKDHYHCFAENGNCSEVMKGKDQLRQHGKRHSVAEELTNLEFKSCSKCQTEETKSHYHCSYANCNFVSSDLSNLDRANNNINK---------------NKISTKRCKLVHENVDKPESILSLSDLPNHISPISSGSFDNQFMDTNSDPFDPRDNARCHSQIIAPRSKFTKSIVFDEIENSVLFNIREEGKHLYKLGTCVRLFCNLKKADHYHCPICDVGSSKIDLYLRHLKRHK 341          
BLAST of Zinc finger protein castor-like protein 1 vs. Planmine SMEST
Match: SMESG000038913.1 (SMESG000038913.1)

HSP 1 Score: 59.3066 bits (142), Expect = 5.899e-9
Identity = 30/94 (31.91%), Postives = 53/94 (56.38%), Query Frame = 1
Query:  547 FTTQVKRFTANDVCNSRCQMLYKDHYHCFAENGNCSEVMKGKDQLRQHGKRHSVAEELTNLEFKSCSKCQTEETKS------HYHCSYANCNFV 810
            +   V++FT+NDVC + C + +KDH+HC   N N S   K K+++  H +RH + + L    +++C+      T +      HYHC + NC+++
Sbjct:  499 WLNDVRKFTSNDVCTNHCSLAFKDHFHCLFLNCNVS--YKKKEKILDHCRRHRLDKALLMSCYQNCTDNSHINTDNPIQNPCHYHCKWNNCSYI 590          
BLAST of Zinc finger protein castor-like protein 1 vs. Planmine SMEST
Match: SMESG000038913.1 (SMESG000038913.1)

HSP 1 Score: 59.3066 bits (142), Expect = 5.952e-9
Identity = 30/94 (31.91%), Postives = 53/94 (56.38%), Query Frame = 1
Query:  547 FTTQVKRFTANDVCNSRCQMLYKDHYHCFAENGNCSEVMKGKDQLRQHGKRHSVAEELTNLEFKSCSKCQTEETKS------HYHCSYANCNFV 810
            +   V++FT+NDVC + C + +KDH+HC   N N S   K K+++  H +RH + + L    +++C+      T +      HYHC + NC+++
Sbjct:  500 WLNDVRKFTSNDVCTNHCSLAFKDHFHCLFLNCNVS--YKKKEKILDHCRRHRLDKALLMSCYQNCTDNSHINTDNPIQNPCHYHCKWNNCSYI 591          
The following BLAST results are available for this feature:
BLAST of Zinc finger protein castor-like protein 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Zinc finger protein castor-like protein 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Zinc finger protein castor-like protein 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Zinc finger protein castor-like protein 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Zinc finger protein castor-like protein 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Zinc finger protein castor-like protein 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Zinc finger protein castor-like protein 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Zinc finger protein castor-like protein 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2C9JYF31.089e-1234.56Uncharacterized protein OS=Biomphalaria glabrata O... [more]
A0A3S1BR515.153e-1231.97Uncharacterized protein OS=Elysia chlorotica OX=18... [more]
A0A0L8ICD71.435e-1138.14Uncharacterized protein OS=Octopus bimaculoides OX... [more]
K1R6H01.446e-1134.78Zinc finger protein castor-like protein 1 OS=Crass... [more]
A0A1S3HZK22.812e-1135.48zinc finger protein castor homolog 1 OS=Lingula un... [more]
back to top
BLAST of Zinc finger protein castor-like protein 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Zinc finger protein castor-like protein 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Zinc finger protein castor-like protein 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Zinc finger protein castor-like protein 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Zinc finger protein castor-like protein 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Zinc finger protein castor-like protein 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000024266.10.000e+098.88SMESG000024266.1[more]
SMESG000024266.10.000e+092.70SMESG000024266.1[more]
SMESG000038913.15.899e-931.91SMESG000038913.1[more]
SMESG000038913.15.952e-931.91SMESG000038913.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30028462 ID=SMED30028462|Name=Zinc finger protein castor-like protein 1|organism=Schmidtea mediterranea sexual|type=transcript|length=1599bp
GTTCACTTACTTTACTGTATCTTACCATCGGTGATTATAGATTATTTCAA
CTGTTGGTTTGTCGTTATGGTAACGAATGTGTTCAAAGATGTGCATTAAG
AGTGCTGTAGTATATTCAATAAACAGTTGAACTGTATTGGGTAAGTGTGC
ATTTGTTTCGTACAAATTTGTTTCTGAGCTGAATTTCAAATCGATTGCTA
ATTCAAATATAAATCCAGATTGATCGGCGTTGGAAATTCGTCAATGGAAA
AAATCGAGGAATATTATGAGAAAAATAATTTGAACCAAAAACCAGATCAG
AGTGAAGAGTTTGTGAAAATCGAAAATGAATTGAAGAAAATTTTATCGAA
CTCTGCTGACAATATTGATAATAATATTATCCTAAGCCTTATAAAACTGC
TTCTGTTAAATTCCCAGAATGCCATACCCCCGGTATTAACATCTACCCAA
ACAGAACCATTAGATCTTTCTCAAAAACACCAAACTAATGCAAAATCATT
ACCAAAGCGTCTTTGGAAACCGAAATCTTTCGATTTTGATGAATTTTTCA
CGACGCAAGTCAAAAGATTTACCGCAAATGATGTTTGCAATTCCAGATGT
CAAATGCTGTACAAAGATCACTATCATTGTTTTGCTGAAAATGGAAACTG
TTCCGAAGTAATGAAAGGAAAAGATCAACTAAGACAGCATGGGAAACGTC
ACAGCGTTGCAGAAGAATTGACAAATCTAGAATTCAAGTCTTGTTCAAAA
TGCCAAACTGAAGAAACCAAAAGTCATTATCATTGCTCATATGCCAATTG
TAATTTCGTGTCGAGTGATTTGTCCAATTTGGACAGGTTGGCTCATGTTG
AATCAGTTCATTGTAATATATTATTGAAAAGAGCAAACAACAATATCAAT
AAGAATAAAATTTCTACCAAACGCTGCAAATTAGTGCATGAAAATGTCGA
CAAACCTGAAAGTATTCTTTCATTAAGTGACCTTCCGAATCATATCTCAC
CGATATCACCTGGATCCTTCGACAATCAATTTATGGACACAAACAGTGAT
CCATTCGATACTAGGGATAATGCAAGGTGTCGCAGTCAAATAATAGCCCC
CCGCAGCAAGTTTACCAAGTCAATTGTATTTGATGAAATTGAAAATTCTG
TTTTATTCAATATCCGAGAGGAAGGAAAGCATTTATACAAATTGGGCACA
TGCGTCCGATTATTTTGCAATTTGAAGAAAGCAGACCATTATCACTGTCC
GATTTGTGATGTCGGCTCCAGTAAGATAGATTTGTATCTCAGGCATTTGA
AAAGACACAAATAAAATTTTATGTTTTATTCTGAATAAAATTTGAAATTT
TCTGATCTCTTGCCAAATGATTCTTGCTACCATATTTATGTATATTCTGA
CCGAGTCCGCTGGATTGGAACTTATACATATAAAGGATCTTTGCTTTCCG
CCAACTCGTAATTAATATTTATTGTGTATATTGGATTGGAAACACTATTT
TTTAGGAAAATAAAACAACTACAATTTATTGTTTTGTGGTAACCCTTCGG
AATTTTGGGGTGTCAATTTATTATTTTTCAATAATATATCAGATTTACG
back to top

protein sequence of SMED30028462-orf-1

>SMED30028462-orf-1 ID=SMED30028462-orf-1|Name=SMED30028462-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=357bp
MEKIEEYYEKNNLNQKPDQSEEFVKIENELKKILSNSADNIDNNIILSLI
KLLLLNSQNAIPPVLTSTQTEPLDLSQKHQTNAKSLPKRLWKPKSFDFDE
FFTTQVKRFTANDVCNSRCQMLYKDHYHCFAENGNCSEVMKGKDQLRQHG
KRHSVAEELTNLEFKSCSKCQTEETKSHYHCSYANCNFVSSDLSNLDRLA
HVESVHCNILLKRANNNINKNKISTKRCKLVHENVDKPESILSLSDLPNH
ISPISPGSFDNQFMDTNSDPFDTRDNARCRSQIIAPRSKFTKSIVFDEIE
NSVLFNIREEGKHLYKLGTCVRLFCNLKKADHYHCPICDVGSSKIDLYLR
HLKRHK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000101muscle cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR013087Znf_C2H2_type
IPR015880Znf_C2H2-like
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR013087Zinc finger C2H2-typeSMARTSM00355c2h2final6coord: 179..206
e-value: 34.0
score: 8.5
coord: 333..355
e-value: 0.12
score: 21.5