SMED30028457

Overview
NameSMED30028457
Smed IDSMED30028457
Length (bp)1615
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30028457 (SMED30028457) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30028457 (SMED30028457) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30028457 (SMED30028457) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30028457 (SMED30028457) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30028457

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30028457 SmedASXL_012871SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30028457 SmedASXL_012871SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X1 cellSMED30028457 SmedASXL_060644SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SMED30028457 vs. Ensembl Zebrafish
Match: CABZ01030006.1 (pep scaffold:GRCz11:KN150258.1:33006:36502:-1 gene:ENSDARG00000114113.1 transcript:ENSDART00000182402.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CABZ01030006.1)

HSP 1 Score: 114.39 bits (285), Expect = 1.229e-27
Identity = 63/186 (33.87%), Postives = 95/186 (51.08%), Query Frame = -3
Query:  672 IRNWCKTCHMCQKNKI-TRHTKSNLKELPERGKFNVIHIDIVGPLP-SVNNKKYILTIIDRDTSWPEAIPISEISSGLTTRTFENEWIARYRVPEIIITDNGKQFISFTFKELCQKHNIDHRHTTAYHPQCNGKVERFHRTLKSALRSHSEDGNKNCANELPLVFLGLHQVISEDTGISPSQTVFG 1223
            I+ + K C  CQ  K   R     L+++       +  +DI+GP+P S    +Y+L  +D  + W E  P+   ++         E + R+ VP+ I++D G QF+S  F ELC K NI  + TTAYHPQ N   ER +RTLKS +    ED +K     LP +   L+  I E  G++P++   G
Sbjct:    5 IKKYVKNCAKCQVTKWDNRKPAGKLQQVTTSRPNEMWRVDIMGPMPKSGKQNEYLLVFVDYFSKWVELFPMRHATAQTIATILRQEMLTRWGVPDFILSDRGAQFVSSLFTELCGKWNITPKLTTAYHPQTN-MTERVNRTLKSMIAGFVEDNHKTWDTYLPELRFALNSAIQESIGMTPAELHLG 189          
BLAST of SMED30028457 vs. Ensembl Zebrafish
Match: FO704673.1 (pep chromosome:GRCz11:12:14545475:14551077:-1 gene:ENSDARG00000112601.1 transcript:ENSDART00000188717.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:FO704673.1)

HSP 1 Score: 99.3673 bits (246), Expect = 2.660e-21
Identity = 79/300 (26.33%), Postives = 129/300 (43.00%), Query Frame = -3
Query:  465 PHRRAQIRNWCKTCHMCQKNKITRHTKSNLKE---LPERGKFNVIHIDIVGPLPSVNNKKYILTIIDRDTSWPEAIPISEISSGLTTRTFENEWIAR-YRVPEIIITDNGKQFISFTFKELCQKHNIDHRHTTAYHPQCNGKVERFHRTLKSALRSHSEDGNKNCANELPLVFLGLHQVISEDTGISPSQTVFGTDS-------------------------------RLLGDIRCKRKRKQKWKEYLPNDLKTCKYVWLKVE------TKTALKPMYDGPFSFINRSPDFKTFEIQLPT 1241
            P     I  + K+C +C ++K  R   S L +   +P R  ++ + ID V  LP+ NN   IL IIDR +     IP+  + + + T     + + R Y +PE I++D G QF S  +K  C++ +I+   T+ YHP+ NG+VER ++ +   LR++        +N LP      + +    TG++P Q + G                                  RL   IR +R    + +   PN  +  + VWL             L P Y GPF  + R  +  T+ ++LP 
Sbjct: 1011 PKMNQDITTFVKSCAVCAQSKTPRELPSGLLQPLPIPHR-PWSHLSIDFVTDLPNSNNYTTILVIIDRFSKACRLIPLKGLPTAMETALELFQHVFRVYGIPEDIVSDRGPQFTSKVWKAFCKQLDINVSLTSGYHPESNGQVERLNQEIGRYLRTYCSREQDKWSNFLPWAEYAQNSLTHSSTGLTPFQCILGYQPPMFPWSGEPSMVPSVDDWVQRSEEVWNSAHVRLQRAIRTQRINADQRRRPNPN-YQPGQRVWLSTRDLRLRLPSRKLSPRYVGPFKILKRINNV-TYRLELPA 1307          
BLAST of SMED30028457 vs. Ensembl Zebrafish
Match: CR354395.2 (pep chromosome:GRCz11:12:13553730:13556536:-1 gene:ENSDARG00000101547.2 transcript:ENSDART00000166396.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CR354395.2)

HSP 1 Score: 95.5153 bits (236), Expect = 3.466e-20
Identity = 56/200 (28.00%), Postives = 96/200 (48.00%), Query Frame = -3
Query:  654 PHRRAQIRNWCKTCHMCQKNKITRHTKSNLKE---LPERGKFNVIHIDIVGPLPSVNNKKYILTIIDRDTSWPEAIPISEISSGL-TTRTFENEWIARYRVPEIIITDNGKQFISFTFKELCQKHNIDHRHTTAYHPQCNGKVERFHRTLKSALRSHSEDGNKNCANELPLVFLGLHQVISEDTGISPSQTVFGTDSRLL 1241
            P     + N+ + C +CQ  K +  T + L +   +P+R  ++ I +D +  LP   N   ILT++DR +     IP+ ++ S   T     N     + +P+ I++D G QF S  +  LC+  NI+   T+ YHPQ NG+ E  ++ +   LRS+      +C+  L       + +I   TGI+P + + G    L 
Sbjct:  681 PSLTKDVINYVQKCKICQSTKASHQTPAGLLQPLPVPQR-PWSHIAVDFITDLPVSQNNTVILTVVDRFSKACRLIPLPKLPSAFETAEALCNHVFRMFGLPDDIVSDRGSQFTSRVWSALCKNLNINVSLTSGYHPQSNGQTEHMNQEVIRFLRSYCHQQQHDCSRYLMWAEYAQNSLIKPATGITPFKCILGYQPPLF 879          
BLAST of SMED30028457 vs. Ensembl Zebrafish
Match: CU929458.1 (pep chromosome:GRCz11:11:43363075:43368382:1 gene:ENSDARG00000114395.1 transcript:ENSDART00000179934.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CU929458.1)

HSP 1 Score: 93.5893 bits (231), Expect = 1.980e-19
Identity = 55/192 (28.65%), Postives = 94/192 (48.96%), Query Frame = -3
Query:  654 NWCKTCHMCQKNKITRHTKSNLKE---LPERGKFNVIHIDIVGPLPSVNNKKYILTIIDRDTSWPEAIPISEISSGL-TTRTFENEWIARYRVPEIIITDNGKQFISFTFKELCQKHNIDHRHTTAYHPQCNGKVERFHRTLKSALRSHSEDGNKNCANELPLVFLGLHQVISEDTGISPSQTVFGTDSRLL 1217
            N+ + C +CQ  K +  T + L +   +P+R  ++ I +D +  LP   N   ILT++DR +     IP+ ++ S   T     N     + +P+ I++D G QF S  +  LC+  NI+   T+ YHPQ NG+ ER ++ +   LRS+      + +  L       + +I   TGI+P + + G    L 
Sbjct: 1031 NYVQKCEICQSTKASHQTPAGLLQPLPVPQR-PWSHIAVDFITDLPVSQNNTVILTVVDRFSKACRLIPLPKLPSAFETAEALCNHVFRMFGLPDDIVSDRGSQFTSRVWSALCKNLNINVSLTSGYHPQSNGQTERMNQEVIRFLRSYCHQQQHDWSRYLMWAEYAQNSLIKPATGITPFKCILGYQPPLF 1221          
BLAST of SMED30028457 vs. Ensembl Zebrafish
Match: BX571665.1 (pep chromosome:GRCz11:17:35431724:35437222:1 gene:ENSDARG00000111789.1 transcript:ENSDART00000190293.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:BX571665.1)

HSP 1 Score: 93.2041 bits (230), Expect = 2.760e-19
Identity = 55/192 (28.65%), Postives = 94/192 (48.96%), Query Frame = -3
Query:  654 NWCKTCHMCQKNKITRHTKSNLKE---LPERGKFNVIHIDIVGPLPSVNNKKYILTIIDRDTSWPEAIPISEISSGL-TTRTFENEWIARYRVPEIIITDNGKQFISFTFKELCQKHNIDHRHTTAYHPQCNGKVERFHRTLKSALRSHSEDGNKNCANELPLVFLGLHQVISEDTGISPSQTVFGTDSRLL 1217
            N+ + C +CQ  K +  T + L +   +P+R  ++ I +D +  LP   N   ILT++DR +     IP+ ++ S   T     N     + +P+ I++D G QF S  +  LC+  NI+   T+ YHPQ NG+ ER ++ +   LRS+      + +  L       + +I   TGI+P + + G    L 
Sbjct: 1024 NYVQKCKICQSTKASHQTPAGLLQPLPVPQR-PWSHIAVDFITDLPVSQNNTVILTVVDRFSKACRLIPLPKLPSAFETAEALCNHVFRMFGLPDDIVSDRGSQFTSRVWSALCKNLNINVSLTSGYHPQSNGQTERMNQEVIRFLRSYCHQQQHDWSRYLMWAEYAQNSLIKPATGITPFKCILGYQPPLF 1214          
BLAST of SMED30028457 vs. Ensembl Xenopus
Match: mybl2 (MYB proto-oncogene like 2 [Source:Xenbase;Acc:XB-GENE-982419])

HSP 1 Score: 123.635 bits (309), Expect = 1.407e-30
Identity = 71/201 (35.32%), Postives = 106/201 (52.74%), Query Frame = -3
Query:  645 PHRRAQIRNWCKTCHMCQKNKITRHTKSNLKELPE-RGKFNVIHIDIVGPL-PSVNNKKYILTIIDRDTSWPEAIPISEISSGLTTRTFENEWIARYRVPEIIITDNGKQFISFTFKELCQKHNIDHRHTTAYHPQCNGKVERFHRTLKSALRSHSEDGNKNCANELPLVFLGLHQVISEDTGISPSQTVFGTDSRLLGDI 1241
            P    ++  +C +C  CQ +    H +S L  LP     F  I +D+VGP+  S    ++IL I+D  T +PEAIP+   SS    R   + + +R  +P+ I+TD G  F+S   KELC+   +    T+ YHPQ +G VERF++TLKS L+   +   KN    LP +   + +V    TG SP + ++G   R L DI
Sbjct:  107 PGLHGEVEQYCSSCPDCQYSAPRPHFRSPLVPLPVIETPFERIAMDLVGPIVKSARGHQHILVIMDYATRYPEAIPLRNTSSKSIARELVHVF-SRVGIPKEILTDQGTPFMSRVMKELCRLFKVVQLRTSVYHPQTDGLVERFNKTLKSMLKKVVDKDGKNWDYLLPYLMFAIREVPQSSTGYSPFELLYGRHPRGLLDI 306          
BLAST of SMED30028457 vs. Ensembl Xenopus
Match: ENSXETT00000023851.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:KV461115.1:7997:9051:-1 gene:ENSXETG00000015824.1 transcript:ENSXETT00000023851.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 119.013 bits (297), Expect = 5.480e-29
Identity = 66/198 (33.33%), Postives = 103/198 (52.02%), Query Frame = -3
Query:  660 PHRRAQIRNWCKTCHMCQK-NKITRHTKSNLKELPERGK-FNVIHIDIVGPL--PSVNNKKYILTIIDRDTSWPEAIPISEISSGLTTRTFENEWIARYRVPEIIITDNGKQFISFTFKELCQKHNIDHRHTTAYHPQCNGKVERFHRTLKSALRSHSEDGNKNCANELPLVFLGLHQVISEDTGISPSQTVFGTDSR 1241
            P    Q+  +C++C  CQ+  K     K  L+ LP  G+ F  + +D++GPL  PS   K+YILT++D  T +PEA+ +  I +         +  +R   P  I++D G QF+S   + L Q+  +    ++ YHPQ NG  ERF+ TLK+ LR+  E G  +    LP +     +V  E TG SP + ++G   R
Sbjct:  115 PGLSQQVAQFCRSCDSCQRVGKSGERNKHTLRPLPVIGEPFQRVAVDLIGPLSRPSRTGKQYILTMVDYATRYPEAVALRRIDAPAVADAL-IQIFSRVGFPSEILSDQGPQFMSQLLQCLWQRCGVTSLRSSPYHPQTNGLCERFNGTLKNMLRTFVEAGEGDWEKFLPCLLFAYREVPQESTGFSPFELLYGRRVR 311          
BLAST of SMED30028457 vs. Ensembl Xenopus
Match: ENSXETT00000023941.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:KV463742.1:21:4282:-1 gene:ENSXETG00000015734.1 transcript:ENSXETT00000023941.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 116.701 bits (291), Expect = 1.151e-26
Identity = 72/225 (32.00%), Postives = 114/225 (50.67%), Query Frame = -3
Query:  636 SNNQHIIRLPHRRAQ----------IRNWCKTCHMCQK-NKITRHTKSNLKELPERGK-FNVIHIDIVGPL--PSVNNKKYILTIIDRDTSWPEAIPISEISSGLTTRTFENEWIARYRVPEIIITDNGKQFISFTFKELCQKHNIDHRHTTAYHPQCNGKVERFHRTLKSALRSHSEDGNKNCANELPLVFLGLHQVISEDTGISPSQTVFGTDSRLLGDIRCK 1268
            + +Q + R  HR  Q          +  +C+TC  CQ+  +     K  L  LP   + F  + +D++GPL  PS + K+YILT++D  T +PEA+ + +I +         +  +R   P  I++D G QF S   + L Q+  +   H++ YHPQ NG  ERF+ TLK+ LR+  E G K+    LP +     +V  E TG SP + ++G   R   D+ C+
Sbjct:  649 AGHQGVTRTRHRLTQNFYWPGISQEVTRYCRTCDSCQRTGRANDKPKFPLCPLPIISEPFQRVAVDLIGPLSRPSRSGKQYILTVMDYATRYPEAVALRKIDAPTVADAL-IQIFSRVGFPSEILSDQGPQFTSQLLQCLWQRCGVRAIHSSPYHPQTNGLCERFNGTLKTMLRTFVESGEKDWERYLPHLLFAYREVPQESTGFSPFELLYGRRVRGPLDLLCE 872          
BLAST of SMED30028457 vs. Ensembl Xenopus
Match: nmbr (neuromedin B receptor [Source:Xenbase;Acc:XB-GENE-6074611])

HSP 1 Score: 103.219 bits (256), Expect = 1.110e-23
Identity = 57/153 (37.25%), Postives = 85/153 (55.56%), Query Frame = -3
Query:  789 PHRRAQIRNWCKTCHMCQKNKITRHTKSNLKELPE-RGKFNVIHIDIVGPL-PSVNNKKYILTIIDRDTSWPEAIPISEISSGLTTRTFENEWIARYRVPEIIITDNGKQFISFTFKELCQKHNIDHRHTTAYHPQCNGKVERFHRTLKSALR 1241
            P    ++  +C +C  CQ +    H +S L  LP     F  I +D+VGP+  S    ++IL I+D  T +PEAIP+   SS    R   + + +R  +P+ I+TD G  F+S   KELC+   +    T+ YHPQ +G VERF++TLKS L+
Sbjct:  174 PGLHGEVEQYCSSCPDCQYSAPRPHFRSPLVPLPVIETPFERIAMDLVGPIVKSARGHQHILVIMDYATRYPEAIPLRNTSSKSIARELVHVF-SRVGIPKEILTDQGTPFMSRVMKELCRLFKVVQLRTSVYHPQTDGLVERFNKTLKSMLK 325          
BLAST of SMED30028457 vs. Ensembl Xenopus
Match: anxa6 (annexin A6 [Source:Xenbase;Acc:XB-GENE-989741])

HSP 1 Score: 83.5741 bits (205), Expect = 2.883e-16
Identity = 46/140 (32.86%), Postives = 72/140 (51.43%), Query Frame = -3
Query:  636 IDRDTSWPEAIPISEISSGLTTRTFENEWIARYRVPEIIITDNGKQFISFTFKELCQKHNIDHRHTTAYHPQCNGKVERFHRTLKSALRSHSEDGNKNCANELPLVFLGLHQVISEDTGISPSQTVFGTDSRLLGDIRCK 1055
            +D  T +PEA+ + +I +         +  +R   P  I++D G QF S   + L Q+  +   H++ YHPQ NG  ERF+ TLK+ LR+  E G K+    LP +     +V  E TG SP + ++G   R   D+ C+
Sbjct:    1 MDYATRYPEAVALRKIDAPTVADAL-IQIFSRVGFPSEILSDQGPQFTSQLLQCLWQRCGVRAIHSSPYHPQTNGLCERFNGTLKTMLRTFVESGEKDWERYLPHLLFAYREVPQESTGFSPFELLYGRRVRGPLDLLCE 139          
BLAST of SMED30028457 vs. UniProt/SwissProt
Match: sp|Q09575|YRD6_CAEEL (Uncharacterized protein K02A2.6 OS=Caenorhabditis elegans OX=6239 GN=K02A2.6 PE=4 SV=1)

HSP 1 Score: 94.7449 bits (234), Expect = 6.800e-19
Identity = 61/190 (32.11%), Postives = 97/190 (51.05%), Query Frame = -3
Query:  672 AQIRNWCKTCHMCQKN-KITRHTKSNLKELPERGKFNVIHIDIVGPLPSVNNKKYILTIIDRDTSWPEAIPISEISSGLTTRTFENEWIARYRVPEIIITDNGKQFISFTFKELCQKHNIDHRHTTAYHPQCNGKVERFHRTLKSALRSHSEDG--NKNCANELPLVFLGL-HQVISEDTGISPSQTVFG 1229
            + I N  + C+ CQ+N K+ R    N   +PE   +  IHID  GPL    N  Y+L ++D  T + E + ++   S +TT     E  + +  PE II+DNG Q  S  F ++CQ H I+H+ +  Y+P+ NG  ERF  TLK  +     +G  N+   N+  + +    H  ++   G +P++  FG
Sbjct:  815 SDIENMVRHCNNCQENSKMPRVVPLNPWPVPE-APWKRIHIDFAGPL----NGCYLLVVVDAKTKYAE-VKLTRSISAVTTIDLLEEIFSIHGYPETIISDNGTQLTSHLFAQMCQSHGIEHKTSAVYYPRSNGAAERFVDTLKRGIAKIKGEGSVNQQILNKFLISYRNTPHSALN---GSTPAECHFG 995          
BLAST of SMED30028457 vs. UniProt/SwissProt
Match: sp|P23074|POL_SFV1 (Pro-Pol polyprotein OS=Simian foamy virus type 1 OX=338478 GN=pol PE=1 SV=3)

HSP 1 Score: 83.5741 bits (205), Expect = 2.045e-15
Identity = 51/183 (27.87%), Postives = 85/183 (46.45%), Query Frame = -3
Query:  663 CKTCHMCQKNKITRHTKSNLKELPERGKFNVIHIDIVGPLPSVNNKKYILTIIDRDTSWPEAIPISEISSGLTTRTFENEWIARYRVPEIIITDNGKQFISFTFKELCQKHNIDHRHTTAYHPQCNGKVERFHRTLKSALRSHSEDGNKNCANELPLVFLGLHQVISEDTGISPSQTVFGTDS 1211
            CK C +     +T  +   L+ +     F+  +ID +GPLP  N   ++L ++D  T +    P    S+  T +      +    +P+++ +D G  F S TF +  ++  I    +T YHPQ +GKVER +  +K  L            + LP+V L L+   S  +  +P Q +FG DS
Sbjct:  846 CKQCLVTNATNLT--SPPILRPVKPLKPFDKFYIDYIGPLPPSNGYLHVLVVVDSMTGFVWLYPTKAPSTSATVKALN--MLTSIAIPKVLHSDQGAAFTSSTFADWAKEKGIQLEFSTPYHPQSSGKVERKNSDIKRLLTKLLIGRPAKWYDLLPVVQLALNNSYSPSSKYTPHQLLFGVDS 1024          
BLAST of SMED30028457 vs. UniProt/SwissProt
Match: sp|P27401|POL_SFV3L (Pro-Pol polyprotein OS=Simian foamy virus type 3 (strain LK3) OX=11644 GN=pol PE=3 SV=2)

HSP 1 Score: 82.8037 bits (203), Expect = 3.021e-15
Identity = 58/196 (29.59%), Postives = 87/196 (44.39%), Query Frame = -3
Query:  663 PHRRAQIRNWCKTCHMCQ-KNKITRHTKSNLKELPER--GKFNVIHIDIVGPLPSVNNKKYILTIIDRDTSWPEAIPISEISSGLTTRTFENEWIARYRVPEIIITDNGKQFISFTFKELCQKHNIDHRHTTAYHPQCNGKVERFHRTLKSALRSHSEDGNKNCANELPLVFLGLHQVISEDTGISPSQTVFGTDS 1241
            P+ R  +    + C  C   N  T      L+  PER    F+   ID +GPLP  N   ++L ++D  T +    P    S+  T +      +    VP++I +D G  F S TF +  +   I    +T YHPQ +GKVER +  +K  L            + LP+V L L+   S  +  +P Q +FG DS
Sbjct:  833 PNLRKDVVKVIRQCKQCLVTNAATLAAPPILR--PERPVKPFDKFFIDYIGPLPPSNGYLHVLVVVDSMTGFVWLYPTKAPSTSATVKALN--MLTSIAVPKVIHSDQGAAFTSATFADWAKNKGIQLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPAKWYDLLPVVQLALNNSYSPSSKYTPHQLLFGIDS 1024          
BLAST of SMED30028457 vs. UniProt/SwissProt
Match: sp|Q87040|POL_SFVCP (Pro-Pol polyprotein OS=Simian foamy virus (isolate chimpanzee) OX=298339 GN=pol PE=3 SV=1)

HSP 1 Score: 82.4185 bits (202), Expect = 4.516e-15
Identity = 56/195 (28.72%), Postives = 86/195 (44.10%), Query Frame = -3
Query:  663 PHRRAQIRNWCKTCHMCQKNKITRHTKSNLKELPERGK--FNVIHIDIVGPLPSVNNKKYILTIIDRDTSWPEAIPISEISSGLTTRTFENEWIARYRVPEIIITDNGKQFISFTFKELCQKHNIDHRHTTAYHPQCNGKVERFHRTLKSALRSHSEDGNKNCANELPLVFLGLHQVISEDTGISPSQTVFGTDS 1241
            P+ R  +      C  C     +  T   +   P+R +  F+   ID +GPLP      Y+L I+D  T +    P    S+  T ++     +    +P++I +D G  F S TF E  ++  I    +T YHPQ +GKVER +  +K  L            + LP+V L L+   S     +P Q +FG DS
Sbjct:  834 PNMRKDVVKQLGRCKQCLITNASNKTSGPILR-PDRPQKPFDKFFIDYIGPLPPSQGYLYVLVIVDGMTGFTWLYPTKAPSTSATVKSLNV--LTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDS 1025          
BLAST of SMED30028457 vs. UniProt/SwissProt
Match: sp|P0CT40|TF29_SCHPO (Transposon Tf2-9 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=Tf2-9 PE=3 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 5.659e-15
Identity = 80/326 (24.54%), Postives = 138/326 (42.33%), Query Frame = -3
Query:  372 RAQIRNWCKTCHMCQKNKITRHTKSN-LKELPERGK-FNVIHIDIVGPLPSVNNKKYILTIIDRDTSWPEAIPISE-ISSGLTTRTFENEWIARYRVPEIIITDNGKQFISFTFKELCQKHNIDHRHTTAYHPQCNGKVERFHRTLKSALRSHSEDGNKNCANELPLVFLGLHQVISEDTGISPSQTVFGTDSRL-------LGDIRCKRKRK-----QKWKEYL-PNDLKTCKYVWLKVE---------------TKTA-------LKPMYDGPFSFINRS-PDFKTFEIQLPTRAIRVSVDKLKVAYLRDDSLVTHNLERGYVA 1232
            R QI+ + + CH CQ NK   H     L+ +P   + +  + +D +  LP  +    +  ++DR +     +P ++ I++  T R F+   IA +  P+ II DN   F S T+K+   K+N   + +  Y PQ +G+ ER ++T++  LR           + + LV    +  I   T ++P + V      L         D   +  ++     Q  KE+L  N++K  KY  +K++               TKT        L P + GPF  + +S P+   +E+ LP     +      V++L       HN E  Y  
Sbjct:  947 RKQIQEYVQNCHTCQINKSRNHKPYGPLQPIPPSERPWESLSMDFITALPESSGYNALFVVVDRFSKMAILVPCTKSITAEQTARMFDQRVIAYFGNPKEIIADNDHIFTSQTWKDFAHKYNFVMKFSLPYRPQTDGQTERTNQTVEKLLRCVCSTHPNTWVDHISLVQQSYNNAIHSATQMTPFEIVHRYSPALSPLELPSFSDKTDENSQETIQVFQTVKEHLNTNNIKMKKYFDMKIQEIEEFQPGDLVMVKRTKTGFLHKSNKLAPSFAGPFYVLQKSGPN--NYELDLPDSIKHMFSSTFHVSHLEK---YRHNSELNYAT 1267          
BLAST of SMED30028457 vs. TrEMBL
Match: A0A0A9ZAU6 (Integrase catalytic domain-containing protein (Fragment) OS=Lygus hesperus OX=30085 GN=CM83_15590 PE=4 SV=1)

HSP 1 Score: 219.935 bits (559), Expect = 2.451e-61
Identity = 118/287 (41.11%), Postives = 163/287 (56.79%), Query Frame = -3
Query:  411 PHRRAQIRNWCKTCHMCQKNKITRHTKSNLKELPERGKFNVIHIDIVGPLPSVNNKKYILTIIDRDTSWPEAIPISEISSGLTTRTFENEWIARYRVPEIIITDNGKQFISFTFKELCQKHNIDHRHTTAYHPQCNGKVERFHRTLKSALRSHSEDGNKNCANELPLVFLGLHQVISEDTGISPSQTVFGTDSRLLGDI---------RCKRKRKQKWKEYLPNDLKTCKYVWLKVET-KTALKPMYDGPFSFINRSPDFKTFEIQLPTRAIRVSVDKLKVAYLRDD 1241
            P    QIR     C  CQK+KI R+TK+ L+   +   F  +H+DIVGPLP    K++ LT IDR TSW E +P+++I++   T    + WI RY VP  I TD G+QF S  F  LC    I HRHT AYHPQ NGKVER+HR LK++L +       +  N LP+V LGL   IS D  +SP+   FG   RL GDI           +++ ++  K YLP  +K  KYV++K+ T  T L+P+Y+GPF  IN   + KT  + +     ++S+D+ K  Y+  D
Sbjct:   15 PRMNIQIREMVMLCEPCQKHKIHRNTKAPLQRFSDTAPFEHLHVDIVGPLPPSRGKRFCLTFIDRTTSWIECVPLADITAQTVTDAIMSTWITRYGVPTTITTDQGRQFESEVFSSLCNAMGIKHRHTNAYHPQSNGKVERWHRCLKASLSTQIR--RNDWVNNLPMVMLGLRNAISND-DLSPAARTFGAPLRLPGDIFQPTKNTSNHLRKEVQKVTKSYLPTTMKDAKYVYVKIPTITTGLEPLYEGPFPVINN--NGKTLTLIINGNETKISIDRCKPGYVLPD 296          
BLAST of SMED30028457 vs. TrEMBL
Match: A0A0K8S644 (Integrase catalytic domain-containing protein (Fragment) OS=Lygus hesperus OX=30085 PE=4 SV=1)

HSP 1 Score: 220.32 bits (560), Expect = 2.680e-61
Identity = 118/287 (41.11%), Postives = 163/287 (56.79%), Query Frame = -3
Query:  411 PHRRAQIRNWCKTCHMCQKNKITRHTKSNLKELPERGKFNVIHIDIVGPLPSVNNKKYILTIIDRDTSWPEAIPISEISSGLTTRTFENEWIARYRVPEIIITDNGKQFISFTFKELCQKHNIDHRHTTAYHPQCNGKVERFHRTLKSALRSHSEDGNKNCANELPLVFLGLHQVISEDTGISPSQTVFGTDSRLLGDI---------RCKRKRKQKWKEYLPNDLKTCKYVWLKVET-KTALKPMYDGPFSFINRSPDFKTFEIQLPTRAIRVSVDKLKVAYLRDD 1241
            P    QIR     C  CQK+KI R+TK+ L+   +   F  +H+DIVGPLP    K++ LT IDR TSW E +P+++I++   T    + WI RY VP  I TD G+QF S  F  LC    I HRHT AYHPQ NGKVER+HR LK++L +       +  N LP+V LGL   IS D  +SP+   FG   RL GDI           +++ ++  K YLP  +K  KYV++K+ T  T L+P+Y+GPF  IN   + KT  + +     ++S+D+ K  Y+  D
Sbjct:   22 PRMNIQIREMVMLCEPCQKHKIHRNTKAPLQRFSDTAPFEHLHVDIVGPLPPSRGKRFCLTFIDRTTSWIECVPLADITAQTVTDAIMSTWITRYGVPTTITTDQGRQFESEVFSSLCNAMGIKHRHTNAYHPQSNGKVERWHRCLKASLSTQIR--RNDWVNNLPMVMLGLRNAISND-DLSPAARTFGAPLRLPGDIFQPTKNTSNHLRKEVQKVTKSYLPTTMKDAKYVYVKIPTITTGLEPLYEGPFPVINN--NGKTLTLIINGNETKISIDRCKPGYVLPD 303          
BLAST of SMED30028457 vs. TrEMBL
Match: A0A2L2YVP0 (Integrase catalytic domain-containing protein (Fragment) OS=Parasteatoda tepidariorum OX=114398 PE=2 SV=1)

HSP 1 Score: 219.55 bits (558), Expect = 2.729e-60
Identity = 124/301 (41.20%), Postives = 169/301 (56.15%), Query Frame = -3
Query:  420 PHRRAQIRNWCKTCHMCQKNKITRHTKSNLKELPE-RGKFNVIHIDIVGPLPSVNNKKYILTIIDRDTSWPEAIPISEISSGLTTRTFENEWIARYRVPEIIITDNGKQFISFTFKELCQKHNIDHRHTTAYHPQCNGKVERFHRTLKSALRSHSEDGNKNCANELPLVFLGLHQVISEDTGISPSQTVFGTDSRLLGDI---------------RCKRKRKQ----------KWKEYLPNDLKTCKYVWLKVE-TKTALKPMYDGPFSFINRSPDFKTFEIQLPTRAIRVSVDKLKVAYL 1241
            P    +IR W KTC  CQK KI RHTKS   E  E   +F+++HID++GPLP    K Y LT IDR T W EAIPI +I++ + +R F   WI R+ VP  IITD G+QF S  F+ L        +HTT YHPQ NGKVERFHRTLK+A+++HS   N      LP V LGL  V+  DT  S +Q V+GT  ++ G+                R +R   Q            K ++  D K C +V+++V+  K  L+P Y+GPFS + +S   K F + +  + + +S+D+LK AYL
Sbjct:  263 PDMTKEIREWAKTCIQCQKVKIHRHTKSQFSEYQEPDARFSMVHIDLIGPLPPSEGKMYCLTCIDRYTCWMEAIPIPDITANIVSRAFYENWITRFGVPTQIITDQGRQFESQLFRSLAVICGAKVQHTTPYHPQSNGKVERFHRTLKTAIKAHS---NIRWTESLPTVLLGLRTVVRPDTNFSIAQMVYGTHIKVPGEFFTPPAKYMDPETFVTRLQRFMDQLRPAKSPIITSKKVFVHKDFKLCTHVFVRVDRVKKGLEPAYEGPFSVVEKSD--KYFSVLIKGKHVNISIDRLKPAYL 558          
BLAST of SMED30028457 vs. TrEMBL
Match: A0A2S2NV79 (Pro-Pol polyprotein (Fragment) OS=Schizaphis graminum OX=13262 GN=pol_69 PE=4 SV=1)

HSP 1 Score: 206.453 bits (524), Expect = 5.696e-57
Identity = 114/313 (36.42%), Postives = 173/313 (55.27%), Query Frame = -3
Query:  393 PHRRAQIRNWCKTCHMCQKNKITRHTKSNLKEL--PERGKFNVIHIDIVGPLPSVNNKKYILTIIDRDTSWPEAIPISEISSGLTTRTFENEWIARYRVPEIIITDNGKQFISFTFKELCQKHNIDHRHTTAYHPQCNGKVERFHRTLKSALRSHSEDGNKNCANELPLVFLGLHQVISEDTGISPSQTVFGTDSRLLGDIRCKRKRKQKWKE--------------------------YLPNDLKTCKYVWLKVETKTA-LKPMYDGPFSFINRSPDFKTFEIQLPTRAIRVSVDKLKVAY-LRDDSLVTHN 1241
            P    +IR W KTC  CQK+K+ RHT + L     P+R +F  IH+D+VGPLP  +  +Y+LT +DR T WPEA P+  +++     T    WIAR+ VP++I TD G+QF S   + L     I H  T+ YHPQ NG VERFHRTLK+AL +     + + +  LP+V L L   I  D+G +P++ VFG   RL G++      + K  +                          ++P  L +  +V+++V+ + A L+P Y+GP++ ++R    K +++QL  R   VSVD+LK A+ LR+D  + H+
Sbjct:   89 PGMNREIRRWVKTCEQCQKSKVHRHTATPLAVFTAPDR-RFGHIHLDLVGPLPVSDGARYLLTCVDRFTRWPEAWPVDNMTARTVASTLVTNWIARFGVPDVITTDQGRQFESDLMRALNSTFGIQHVRTSPYHPQANGLVERFHRTLKAALTAQE---SPHWSQRLPIVLLALRNTIKPDSGATPAELVFGATLRLPGELFHSAPPEAKSPDFVTALKSSMAELRPSPGSNHDPARRIFVPTQLDSVSHVFVRVDAQRAPLQPRYEGPYAVLDRKE--KDYKLQLGNRTSWVSVDRLKPAFVLREDPALDHS 395          
BLAST of SMED30028457 vs. TrEMBL
Match: A0A4Y2FKM9 (Retrovirus-related Pol polyprotein from transposon opus OS=Araneus ventricosus OX=182803 GN=pol_4433 PE=4 SV=1)

HSP 1 Score: 211.075 bits (536), Expect = 6.167e-57
Identity = 117/299 (39.13%), Postives = 172/299 (57.53%), Query Frame = -3
Query:  420 RAQIRNWCKTCHMCQKNKITRHTKSNLKE--LPERGKFNVIHIDIVGPLPSVNNKKYILTIIDRDTSWPEAIPISEISSGLTTRTFENEWIARYRVPEIIITDNGKQFISFTFKELCQKHNIDHRHTTAYHPQCNGKVERFHRTLKSALRSHSEDGNKNCANELPLVFLGLHQVISEDTGISPSQTVFGTDSRLLGD------IRCKRK----RKQKWKE---------------YLPNDLKTCKYVWLKVE-TKTALKPMYDGPFSFINRSPDFKTFEIQLPTRAIRVSVDKLKVAYL 1232
            + Q+  W KTC  CQK K+ RHTKS   E  +P+  +F+V+HID++GPLP     +Y LT IDR +SW EA+P+ +I++ +  R F N W++R+ VP  IITD G+QF S  F+ L         HTT+YHPQCNGK+ER HRTLK A++ H    N      LP V LGL   I  DT  S +Q V+GT  +L G+      IR  ++    + QK+ E               ++  DL++C YV+++++  K AL+P Y GP+  + R    K F + +  + + +++D+LK AYL
Sbjct:  298 KKQVGEWAKTCIRCQKCKVNRHTKSKFGEYQVPD-ARFSVVHIDLIGPLPPSEGMEYCLTCIDRFSSWMEAVPLPDITAEIVGRAFYNHWVSRFGVPAQIITDQGRQFESHLFRRLVSICGAKVSHTTSYHPQCNGKIERLHRTLKGAIKVHD---NIRWTESLPTVLLGLRAAIRPDTNHSIAQMVYGTTIKLPGEFFDPPTIRMNQETFVSKLQKFMEELKPMPSTSVKHQILFVHKDLRSCSYVFVRIDRVKKALEPPYKGPYVVVERFG--KYFTVLVKDKHVNITIDRLKPAYL 590          
BLAST of SMED30028457 vs. Ensembl Cavefish
Match: ENSAMXT00000036084.1 (pep primary_assembly:Astyanax_mexicanus-2.0:22:10187890:10192677:-1 gene:ENSAMXG00000031698.1 transcript:ENSAMXT00000036084.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 127.102 bits (318), Expect = 2.488e-30
Identity = 66/209 (31.58%), Postives = 114/209 (54.55%), Query Frame = -3
Query:  627 PHRRAQIRNWCKTCHMCQKNKITRHT--KSNLKELPERGK-FNVIHIDIVGPLPSV-NNKKYILTIIDRDTSWPEAIPISEISSGLTTRTFENEWIARYRVPEIIITDNGKQFISFTFKELCQKHNIDHRHTTAYHPQCNGKVERFHRTLKSALRSHSEDGNKNCANELPLVFLGLHQVISEDTGISPSQTVFGTDSRLLGDIRCKRKR 1241
            P  R  +  +C++CH+CQ           + L  +P  G+ F  + +D VGPLP   +  +Y+LTI+   T +PEAIP+ +I++ +  R    ++   + +P+++ +D G  F+S  F ++    NI H+ ++ YHP+  G +ERFH++LKS LR +  D  K     +PLV   + + + E  G SP+Q VF    R  G ++  ++R
Sbjct:  759 PGLRKDVVEFCRSCHVCQTTGKPNQVIPPAPLCPIPAIGEPFERVLVDCVGPLPKTKSGNQYLLTIMCAATRFPEAIPLRKITTPVVVRAL-IKYFTTFGLPKVVQSDQGTNFLSKLFAQVMATLNITHQVSSPYHPESQGALERFHQSLKSMLRKYCLDTGKEWDEGVPLVLFAVREAVQESLGFSPAQLVFAHSVR--GPLKVLKER 964          
BLAST of SMED30028457 vs. Ensembl Cavefish
Match: ENSAMXT00000050457.1 (pep primary_assembly:Astyanax_mexicanus-2.0:16:35130396:35133236:1 gene:ENSAMXG00000037162.1 transcript:ENSAMXT00000050457.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 125.176 bits (313), Expect = 8.548e-30
Identity = 69/221 (31.22%), Postives = 117/221 (52.94%), Query Frame = -3
Query:  591 PHRRAQIRNWCKTCHMCQKNKITRHT--KSNLKELPERGK-FNVIHIDIVGPLPSVN-NKKYILTIIDRDTSWPEAIPISEISSGLTTRTFENEWIARYRVPEIIITDNGKQFISFTFKELCQKHNIDHRHTTAYHPQCNGKVERFHRTLKSALRSHSEDGNKNCANELPLVFLGLHQVISEDTGISPSQTVFGTDSRLLGDIRCKRKRKQKWKEYLPNDL 1241
            P  R  + ++C++CH+CQ           + L  +P  G+ F  + ID VGPLP      +Y+LTI+   T +PEAIP+ +I++ +  +    ++   + +P ++ +D G  F+S  F ++ +  N+ H+ ++ YHPQ  G +ERFH++LKS LR +  D  K+    +PLV     + + E  G SP+Q  FG   R  G ++  ++  Q   E   N L
Sbjct:  690 PTLRKHVVSFCRSCHVCQNAGKPNQKVPPAPLYPIPVIGEPFERVLIDCVGPLPKTKAGNQYLLTIMCAATRFPEAIPLRKITASVVVKAL-IKFFTTFGLPRVVQSDQGTNFMSKLFSQVMKVLNVRHQISSPYHPQSQGALERFHQSLKSMLRKYCLDSGKDWDEGVPLVLFAAREAVQESLGFSPAQLFFGHLVR--GPLKVLKEALQGSSERCQNVL 907          
BLAST of SMED30028457 vs. Ensembl Cavefish
Match: ENSAMXT00000044431.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000182.1:892613:897532:1 gene:ENSAMXG00000038169.1 transcript:ENSAMXT00000044431.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 121.709 bits (304), Expect = 1.290e-28
Identity = 75/229 (32.75%), Postives = 123/229 (53.71%), Query Frame = -3
Query:  573 PHRRAQIRNWCKTCHMCQKNKITRHTKSNLKELPERG-KFNVIHIDIVGPLP-SVNNKKYILTIIDRDTSWPEAIPISEISSGLTTRTFENEWI---ARYRVPEIIITDNGKQFISFTFKELCQKHNIDHRHTTAYHPQCNGKVERFHRTLKSALRSHSEDGNKNCANELPLVFLGLHQVISEDTGISPSQTVFGTDSRLLGDIRCKRKRKQKWKEYLPNDLKT-CKYV 1241
            P   A++RN+C+ C +CQ     +   + L  LP  G  F  + +D+VGPLP S    +Y+L ++D  T +PEA+ + + +    TR+   E +   +R  +P+ I++D G  F+S   KE+C+   I H HT+ YHPQ +G VER+++TLK  LR   ++  +N    LP +   + +     TG +P + ++G   R L D+      K+ W E  P+  KT  +YV
Sbjct:  387 PSMEAEVRNFCQRCAVCQSTSPRKPAPAPLIPLPIIGVPFERLGMDLVGPLPKSARGHEYLLVLVDYATRYPEAVALRKAN----TRSIAKELVLLFSRVGLPKEILSDQGTPFVSNLMKEVCRLLKIKHLHTSIYHPQTDGLVERYNQTLKRMLRRLIDEDGRNWDLLLPYILFAVRETPQASTGFTPFELLYGRRPRGLLDV-----AKEAW-ESQPSPFKTVVEYV 605          
BLAST of SMED30028457 vs. Ensembl Cavefish
Match: ENSAMXT00000031772.1 (pep primary_assembly:Astyanax_mexicanus-2.0:25:18154377:18157850:-1 gene:ENSAMXG00000041112.1 transcript:ENSAMXT00000031772.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 119.398 bits (298), Expect = 9.172e-28
Identity = 72/254 (28.35%), Postives = 128/254 (50.39%), Query Frame = -3
Query:  528 PHRRAQIRNWCKTCHMCQKNKITRHT--KSNLKELPERGK-FNVIHIDIVGPLPSV-NNKKYILTIIDRDTSWPEAIPISEISSGLTTRTFENEWIARYRVPEIIITDNGKQFISFTFKELCQKHNIDHRHTTAYHPQCNGKVERFHRTLKSALRSHSEDGNKNCANELPLVFLGLHQVISEDTGISPSQTVFGTDSR----LLGDIRCKRKRKQ--------KWKEYLPNDLKTCKYVWLKVETKTALKPMYD 1241
            P  +  +  +C++C +CQ+          + L  +P  G+ F  + +D VGPLP   +  +++LT++   T +PEA P+ +IS+    +    ++ + + +P+II TD G  F+S  F ++ +   I H  +++YHP+  G +ERFH+TLKS LR +  D  +   + +P       + + E  G SP+Q VFG   R    LL +     K+++        K++E+L    +  K     V+ K  +K  YD
Sbjct:  770 PALKQDVTVFCRSCDVCQRTGKPNQVIPLAPLHPIPAVGEPFERVLVDCVGPLPRTKSGNQFLLTVMCAATRFPEAFPLRKISAPSVLKAL-TKFFSIFGLPKIIQTDQGTNFMSRVFSQVMKTLQIKHVVSSSYHPESQGALERFHQTLKSMLRKYCLDSGRQWDDGVPFALFATREAVQESLGFSPAQLVFGHSVRGPLKLLKESFLSDKKEETNVLDYVSKFREHLHAACQAAKTALCSVQGK--MKQHYD 1020          
BLAST of SMED30028457 vs. Ensembl Cavefish
Match: ENSAMXT00000039359.1 (pep primary_assembly:Astyanax_mexicanus-2.0:5:19359511:19362411:1 gene:ENSAMXG00000043892.1 transcript:ENSAMXT00000039359.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 117.472 bits (293), Expect = 2.755e-27
Identity = 62/198 (31.31%), Postives = 108/198 (54.55%), Query Frame = -3
Query:  660 PHRRAQIRNWCKTCHMCQ--KNKITRHTKSNLKELPERGK-FNVIHIDIVGPLP-SVNNKKYILTIIDRDTSWPEAIPISEISSGLTTRTFENEWIARYRVPEIIITDNGKQFISFTFKELCQKHNIDHRHTTAYHPQCNGKVERFHRTLKSALRSHSEDGNKNCANELPLVFLGLHQVISEDTGISPSQTVFGTDSR 1241
            P  +  +  +C+TCH CQ       +   + L  +P  G+ F  + +D VGPLP S +  +++LTI+   T +PEAIP+ +I++ +  R    ++ + + +P  + TD G  F+S  F+++ +  NI H  ++ YHP+  G +ERFH++LKSAL+ +  +  K     +PL+     + + E    SP+  VFG   R
Sbjct:   57 PSLKKDVAEYCRTCHTCQCVGKPNQKIPPAPLCPVPVMGEPFERVLVDCVGPLPKSKSGNQFLLTIMCTATRFPEAIPLRKITAPVIVRALV-KFFSTFGLPREVQTDQGTNFMSKIFQQVMKMLNIKHVVSSPYHPEFQGALERFHQSLKSALKRYCLETGKGWDEGVPLLLFAFREAVQESLSFSPADLVFGHTVR 253          
BLAST of SMED30028457 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004123.1 (pep scaffold:Pmarinus_7.0:GL477387:93825:107321:1 gene:ENSPMAG00000003764.1 transcript:ENSPMAT00000004123.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 64.3142 bits (155), Expect = 1.155e-11
Identity = 50/205 (24.39%), Postives = 88/205 (42.93%), Query Frame = -3
Query:  657 AQIRNWCKTCHMCQKNKITRHTKSNLKELPERGKFNVIHIDIVGPLPSVNNK-KYILTIIDRDTSWPEAIPISE-----ISSGLTTRTFENEWIARYRVPEIIITDNGKQFIS----FTFKELCQKHNIDH----RHTTAYHPQCNGKVERFHRTLKSALRSHSEDGNKNCANELPLVFLGLHQVISEDTGISPSQTVFGTDSRL 1229
            + ++N   +C +C+     R    ++K L   G + V+ +D++GPLP  +   +Y+L +ID  + W EA+P+ E     ++S LT          RY  P  + +  GK+F++       K+ C  H + +    R    +H   N  ++     + S    H  D        L    +G H      T  SP   +FG ++RL
Sbjct:  111 SDVKNLIASCGVCRNKGSRRVAMPSMKLLKASGPWEVLGLDVLGPLPVTSRANRYLLLLIDYFSKWAEAVPLIEKSQEHVASALTVV------FCRYGFPRKVFSSLGKEFVTQVNKIQHKKWCISHTLQNLCETRGPAGWHKATNQALKGCVNLVAS---QHPSDWESRVEQSLFEYRVGKHST----TQYSPFYLMFGREARL 302          
BLAST of SMED30028457 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004121.1 (pep scaffold:Pmarinus_7.0:GL477387:93825:107330:1 gene:ENSPMAG00000003764.1 transcript:ENSPMAT00000004121.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 60.077 bits (144), Expect = 3.502e-10
Identity = 31/113 (27.43%), Postives = 58/113 (51.33%), Query Frame = -3
Query:  909 AQIRNWCKTCHMCQKNKITRHTKSNLKELPERGKFNVIHIDIVGPLPSVNNK-KYILTIIDRDTSWPEAIPISE-----ISSGLTTRTFENEWIARYRVPEIIITDNGKQFIS 1229
            + ++N   +C +C+     R    ++K L   G + V+ +D++GPLP  +   +Y+L +ID  + W EA+P+ E     ++S LT          RY  P  + +  GK+F++
Sbjct:  111 SDVKNLIASCGVCRNKGSRRVAMPSMKLLKASGPWEVLGLDVLGPLPVTSRANRYLLLLIDYFSKWAEAVPLIEKSQEHVASALTV------VFCRYGFPRKVFSSLGKEFVT 217          
BLAST of SMED30028457 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009777.1 (pep scaffold:Pmarinus_7.0:GL476990:135790:139231:-1 gene:ENSPMAG00000008837.1 transcript:ENSPMAT00000009777.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 55.8398 bits (133), Expect = 7.939e-9
Identity = 43/199 (21.61%), Postives = 86/199 (43.22%), Query Frame = -3
Query:  657 IRNWCKTCHMCQKNKITRHTKSNLKELPERGKFNVIHIDIVGPLPSVNNK-KYILTIIDRDTSWPEAIPISEISSGLTTRTFENEWIARYRVPEIIITDNGKQFISFTFKELCQKHNIDHRHTTAYHPQCNGK------VERFHRTLKSALR---SHSEDGNKNCANELPLVFLGLHQVISEDTGISPSQTVFGTDSRL 1223
            IR++   C +C++    R + S++K L     + V+ +D++GP P+ +   +++L I+D  T W E  P+++ S+             R+  P+ +  +  +++++   +E+        RH     P C+G           HR    ALR   S +   +++   +L       H      T  SP   + G ++RL
Sbjct:  105 IRDYINACEICKQKSYKRSSISHVKLLKASYPWEVLGMDLLGPFPATSRAHRFVLLIVDYFTKWAELTPMTDQSAAHVVAALTTA-FHRFGFPKKLFCNVSEEYVAQINEEM-------FRH----FPMCSGLAISHLWANGAHRGTSQALRDCVSKATGRHRDWELQLEQRLFEYHTSKHSATRYSPFYLMLGREARL 291          
BLAST of SMED30028457 vs. Ensembl Medaka
Match: ENSORLT00000038086.1 (pep primary_assembly:ASM223467v1:8:23628267:23631428:1 gene:ENSORLG00000028632.1 transcript:ENSORLT00000038086.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 127.487 bits (319), Expect = 1.593e-30
Identity = 68/215 (31.63%), Postives = 120/215 (55.81%), Query Frame = -3
Query:  609 PHRRAQIRNWCKTCHMCQKNKITRHT--KSNLKELPERGK-FNVIHIDIVGPLPSV-NNKKYILTIIDRDTSWPEAIPISEISSGLTTRTFENEWIARYRVPEIIITDNGKQFISFTFKELCQKHNIDHRHTTAYHPQCNGKVERFHRTLKSALRSHSEDGNKNCANELPLVFLGLHQVISEDTGISPSQTVFGTDSRLLGDIRCKRKRKQKWKE 1241
            P  ++ +  +CKTCH+CQ       T  ++ L  +P  G+ F  + +D VGPLP   +  +Y+LT++   T +PEA+P+  I++   ++    ++   + +P +I TD G  F+S  F ++ Q+ +I H  ++AYHP+  G +ERFH+TLK+ LR + ++  K   + +PL+     +V  E  G SP++ V G   R  G ++     K++W E
Sbjct:  245 PGVKSDVTGYCKTCHVCQVVGKPNQTIPRAPLHPIPAIGEPFEHVLVDCVGPLPRTKSGNQYLLTMMCTATRFPEAVPLRTITATAVSKALV-KFFTLFGLPRVIQTDQGTNFMSRVFSQVLQQFSIKHCTSSAYHPESQGALERFHQTLKTMLRVYCQEFGKEWDDGVPLLLFAAREVTQESLGFSPAELVVGHTVR--GPLKL---LKERWLE 453          
BLAST of SMED30028457 vs. Ensembl Medaka
Match: ENSORLT00000041026.1 (pep primary_assembly:ASM223467v1:6:22718848:22725332:1 gene:ENSORLG00000029874.1 transcript:ENSORLT00000041026.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 124.405 bits (311), Expect = 2.024e-29
Identity = 66/200 (33.00%), Postives = 109/200 (54.50%), Query Frame = -3
Query:  660 PHRRAQIRNWCKTCHMCQ----KNKITRHTKSNLKELP-ERGKFNVIHIDIVGPLPSV-NNKKYILTIIDRDTSWPEAIPISEISSGLTTRTFENEWIARYRVPEIIITDNGKQFISFTFKELCQKHNIDHRHTTAYHPQCNGKVERFHRTLKSALRSHSEDGNKNCANELPLVFLGLHQVISEDTGISPSQTVFGTDSR 1241
            P  R+ + ++C+TCH+CQ     N++     + L  +P     F  + +D VGPLP      ++ILTI+   T +PEA+P+  I++ + T+    ++ + + +P++I TD G  F S  FKE+ +  NI H  +++YHP+  G +ERFH+TLKS +R H      +    LP +       + E  G SP++ VFG   R
Sbjct:  740 PGLRSDVIHYCRTCHICQLAGKPNQVV--PPAPLVPIPVHEEPFERVIVDCVGPLPKAKTGNQFILTIMCASTRFPEAVPLRRITANVITKALV-KFFSVFGLPKVIQTDQGTNFKSKVFKEVLKGLNIRHVTSSSYHPESQGALERFHQTLKSMVRKHCLASRMSWDESLPFLMFAARGAVQESLGFSPAELVFGHQVR 936          
BLAST of SMED30028457 vs. Ensembl Medaka
Match: ENSORLT00000031051.1 (uncharacterized LOC111947296 [Source:NCBI gene;Acc:111947296])

HSP 1 Score: 123.25 bits (308), Expect = 5.560e-29
Identity = 65/200 (32.50%), Postives = 109/200 (54.50%), Query Frame = -3
Query:  660 PHRRAQIRNWCKTCHMCQ----KNKITRHTKSNLKELP-ERGKFNVIHIDIVGPLPSV-NNKKYILTIIDRDTSWPEAIPISEISSGLTTRTFENEWIARYRVPEIIITDNGKQFISFTFKELCQKHNIDHRHTTAYHPQCNGKVERFHRTLKSALRSHSEDGNKNCANELPLVFLGLHQVISEDTGISPSQTVFGTDSR 1241
            P  ++ + ++C+TCH+CQ     N++     + L  +P     F  + +D VGPLP      ++ILTI+   T +PEA+P+  I++ + T+    ++ + + +P++I TD G  F S  FKE+ +  NI H  +++YHP+  G +ERFH+TLKS +R H      +    LP +       + E  G SP++ VFG   R
Sbjct:  740 PGLKSDVIHYCRTCHICQLAGKPNQVV--PPAPLVPIPVHEEPFERVIVDCVGPLPKAKTGNQFILTIMCASTRFPEAVPLRRITANVITKALV-KFFSVFGLPKVIQTDQGTNFKSKVFKEVLKGLNIRHVTSSSYHPESQGALERFHQTLKSMVRKHCLASRMSWDESLPFLMFAARGAVQESLGFSPAELVFGHQVR 936          
BLAST of SMED30028457 vs. Ensembl Medaka
Match: ENSORLT00000045127.1 (pep primary_assembly:ASM223467v1:10:587855:593081:1 gene:ENSORLG00000029202.1 transcript:ENSORLT00000045127.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 117.857 bits (294), Expect = 6.088e-29
Identity = 69/194 (35.57%), Postives = 95/194 (48.97%), Query Frame = -3
Query:  645 WCKTCHMCQKNKITRHTK---SNLKELPERGKFNVIHIDIVGPLPSVNNK-KYILTIIDRDTSWPEAIPISEISSGLTTRTFENEWIARYRVPEIIITDNGKQFISFTFKELCQKHNIDHRHTTAYHPQCNGKVERFHRTLKSALRSHSEDGNKNCANELPLVFLGLHQVISEDTGISPSQTVFGTDSRLLGDI 1214
            W + C  C  +K   H K   + ++ L     F  + ++I+GPLP   NK KYIL I D  + W EA P+    +    +    EW+ R+  P  I +D G+ F S  FKELC   +I    T+ YHPQ +G VERF+RTL S L    ED   N    LP V L     +   T  +P + +FG +  L  DI
Sbjct:    8 WVRECVDCSSSK--SHGKQPCAPMQTLVPSRPFERVALEILGPLPETPNKNKYILVISDYFSKWTEAFPLPNQEAQSIAKVLTEEWVCRFGAPRSIHSDQGRNFESTLFKELCSLLSIHKSRTSPYHPQSDGLVERFNRTLLSLLALFVEDNQLNWDKLLPYVMLAYRSSVHASTSFTPYRVLFGREIVLPVDI 199          
BLAST of SMED30028457 vs. Ensembl Medaka
Match: ENSORLT00000030488.1 (pep primary_assembly:ASM223467v1:10:1370717:1371853:1 gene:ENSORLG00000026262.1 transcript:ENSORLT00000030488.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 115.161 bits (287), Expect = 2.984e-28
Identity = 61/200 (30.50%), Postives = 108/200 (54.00%), Query Frame = -3
Query:  660 PHRRAQIRNWCKTCHMCQ----KNKITRHTKSNLKELP-ERGKFNVIHIDIVGPLPSV-NNKKYILTIIDRDTSWPEAIPISEISSGLTTRTFENEWIARYRVPEIIITDNGKQFISFTFKELCQKHNIDHRHTTAYHPQCNGKVERFHRTLKSALRSHSEDGNKNCANELPLVFLGLHQVISEDTGISPSQTVFGTDSR 1241
            P  ++ + ++C+TCH+CQ     N++     + L  +P     F  + +D VGPLP      ++ILTI+   T +PEA+P+  I++ + T+    ++ + + + ++I TD G  F    F+E+ ++ +I H  +++YHP+  G +ERFH+TLKS +R H      +    LP +       + E  G SP++ VFG   R
Sbjct:   70 PGLKSDVIHYCRTCHICQLAGKPNQVV--PPAPLVPIPVHEEPFERVIVDCVGPLPKAKTGNQFILTIMCASTRFPEAVPLKRITANVITKALL-KFFSVFGLSKVIQTDQGTNFKFKVFREVLKRLSIRHVTSSSYHPESQGALERFHQTLKSMVRKHCLASRMSWDESLPFLMFAARGAVQESLGFSPAELVFGHQVR 266          
BLAST of SMED30028457 vs. Planmine SMEST
Match: SMESG000055306.1 (SMESG000055306.1)

HSP 1 Score: 166.392 bits (420), Expect = 5.650e-49
Identity = 93/176 (52.84%), Postives = 105/176 (59.66%), Query Frame = -3
Query:  402 NGKQFISFTFKELCQKHNIDHRHTTAYHPQCNGKVERFHRTLKSALRSHSEDGNKNCANELPLVFLGLHQVISEDTGISPSQTVFGTDSRLLGDIRCKRKRKQKWKEYLPNDLKTCKYVWLKVETKTALKPMYDGPFSFINRSPDFKTFEIQLPTRAIRVSVDKLKVAYLRDDSLV 929
            N  QF+S TF ELC K+NI+H HTT    QCN KVERFHRTLKS LR+HSED N+N ANELPLV LG +   ++   +  +    GT                               VW K ET+TA KPM DG FS  NRSPD KTFEI+ PTR IRVSV KLKVAY RDDSLV
Sbjct:    3 NDIQFLSSTFMELCLKYNIEHIHTTTCQSQCNDKVERFHRTLKSTLRAHSEDPNRNLANELPLVLLGFY---NDKPCLELTVAYLGTSD-----------------------------VWFKEETRTAPKPMLDGLFSVTNRSPDLKTFEIKQPTRTIRVSVGKLKVAYFRDDSLV 146          
BLAST of SMED30028457 vs. Planmine SMEST
Match: SMESG000054366.1 (SMESG000054366.1)

HSP 1 Score: 166.392 bits (420), Expect = 5.650e-49
Identity = 93/176 (52.84%), Postives = 105/176 (59.66%), Query Frame = -3
Query:  402 NGKQFISFTFKELCQKHNIDHRHTTAYHPQCNGKVERFHRTLKSALRSHSEDGNKNCANELPLVFLGLHQVISEDTGISPSQTVFGTDSRLLGDIRCKRKRKQKWKEYLPNDLKTCKYVWLKVETKTALKPMYDGPFSFINRSPDFKTFEIQLPTRAIRVSVDKLKVAYLRDDSLV 929
            N  QF+S TF ELC K+NI+H HTT    QCN KVERFHRTLKS LR+HSED N+N ANELPLV LG +   ++   +  +    GT                               VW K ET+TA KPM DG FS  NRSPD KTFEI+ PTR IRVSV KLKVAY RDDSLV
Sbjct:    3 NDIQFLSSTFMELCLKYNIEHIHTTTCQSQCNDKVERFHRTLKSTLRAHSEDPNRNLANELPLVLLGFY---NDKPCLELTVAYLGTSD-----------------------------VWFKEETRTAPKPMLDGLFSVTNRSPDLKTFEIKQPTRTIRVSVGKLKVAYFRDDSLV 146          
BLAST of SMED30028457 vs. Planmine SMEST
Match: SMESG000000071.1 (SMESG000000071.1)

HSP 1 Score: 113.235 bits (282), Expect = 6.121e-27
Identity = 69/194 (35.57%), Postives = 97/194 (50.00%), Query Frame = -3
Query:  660 PHRRAQIRNWCKTCHMCQKNKITRHTKSNLKELPERGKFNVIHIDIVGPLPSVNNKKYILTIIDRDTSWPEAIPISEISSGLTTRTFENEWIARYRVPEIIITDNGKQFISFTFKELCQKHNIDHRHTTAYHPQCNGKVERFHRTLKSALRSHSEDGNKNCANELPLVFLGLHQVISEDTGISPSQTVFGTDSR 1241
            P+ R +I+ + KTC   Q NK T+   +     P R  F +IH++IVGPL   NN +                           R F   WI RY  P+ I+TD  +QF S  F+ LC+ +NI    TTA++PQ NGK+ER H+TLK +LR+ +ED  +N  N+ P + LGL    +     SP  T F  + R
Sbjct:  200 PNMRKEIKQFVKTCKRYQINKTTKKLLTQKVNFPSRQPFELIHVNIVGPLAPNNNYR---------------------QENKLVRKFN--WIGRYGQPKTIMTDQVRQFESQLFEMLCKIYNIKRNRTTAFNPQANGKIERLHKTLKESLRTKAED--RNWLNQPPTILLGLRNTPNSTDNESP-HTKFSVEKR 367          
BLAST of SMED30028457 vs. Planmine SMEST
Match: SMESG000027384.1 (SMESG000027384.1)

HSP 1 Score: 106.686 bits (265), Expect = 4.473e-26
Identity = 50/96 (52.08%), Postives = 67/96 (69.79%), Query Frame = -3
Query:  840 HIDIVGPLPSVNNKKYILTIID----RDTSWPEAIPISEISSGLTTRTFENEWIARYRVPEIIITDNGKQFISFTFKELCQKHNIDHRHTTAYHPQ 1115
             I++ G    + N+K  ++I+     + TSWPEAIPI +I S    +T E EWI+++  PEIIITDNGKQFIS +FK+LC K+NI+H HTT YHPQ
Sbjct:  125 QIEVNGKTNKIRNEKTFMSILLVHYLQSTSWPEAIPIGDIRSETVYKTMEREWISKFESPEIIITDNGKQFISSSFKKLCNKYNIEHLHTTPYHPQ 220          
BLAST of SMED30028457 vs. Planmine SMEST
Match: SMESG000038549.1 (SMESG000038549.1)

HSP 1 Score: 104.76 bits (260), Expect = 4.533e-23
Identity = 63/202 (31.19%), Postives = 99/202 (49.01%), Query Frame = -3
Query:  645 PHRRAQIRNWCKTCHMCQKNKITRHT-KSNLKELPERGK-FNVIHIDIVGPLP-SVNNKKYILTIIDRDTSWPEAIPISEISSGLTTRTFENEWIARYRVPEIIITDNGKQFISFTFKELCQKHNIDHRHTTAYHPQCNGKVERFHRTLKSALRSHSEDGNKNCANELPLVFLGLHQVISEDTGISPSQTVFGTDSRLLGDI 1241
            P+    +++W K C  C   K T    K+ LK +P   +   +I +DI+GPLP ++N   YIL + D  T +PEA  + +  +    +    E   RY  P+ I+TD G  F+S   KE+     I    T+ YHPQCNG  ERF+ TL   L ++ +   K+    + L  L     I   T +SP + ++G +  +  D+
Sbjct: 2575 PNMSESVKDWIKNCLTCATRKNTGTKWKAPLKPMPVPAEPMTMISMDILGPLPETLNGNIYILVVTDYLTKFPEAFAMKDQKAKTIAQKLVEEICCRYGTPKQILTDQGTNFMSEIMKEVTNYFKIAKLRTSPYHPQCNGLTERFNGTLIQMLSNYVDRYQKDWDEYINLCLLAYRMSIHAATKMSPFKLMYGRECNMPMDL 2776          
The following BLAST results are available for this feature:
BLAST of SMED30028457 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30028457 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30028457 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30028457 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CABZ01030006.11.229e-2733.87pep scaffold:GRCz11:KN150258.1:33006:36502:-1 gene... [more]
FO704673.12.660e-2126.33pep chromosome:GRCz11:12:14545475:14551077:-1 gene... [more]
CR354395.23.466e-2028.00pep chromosome:GRCz11:12:13553730:13556536:-1 gene... [more]
CU929458.11.980e-1928.65pep chromosome:GRCz11:11:43363075:43368382:1 gene:... [more]
BX571665.12.760e-1928.65pep chromosome:GRCz11:17:35431724:35437222:1 gene:... [more]
back to top
BLAST of SMED30028457 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mybl21.407e-3035.32MYB proto-oncogene like 2 [Source:Xenbase;Acc:XB-G... [more]
ENSXETT00000023851.15.480e-2933.33pep primary_assembly:Xenopus_tropicalis_v9.1:KV461... [more]
ENSXETT00000023941.11.151e-2632.00pep primary_assembly:Xenopus_tropicalis_v9.1:KV463... [more]
nmbr1.110e-2337.25neuromedin B receptor [Source:Xenbase;Acc:XB-GENE-... [more]
anxa62.883e-1632.86annexin A6 [Source:Xenbase;Acc:XB-GENE-989741][more]
back to top
BLAST of SMED30028457 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30028457 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q09575|YRD6_CAEEL6.800e-1932.11Uncharacterized protein K02A2.6 OS=Caenorhabditis ... [more]
sp|P23074|POL_SFV12.045e-1527.87Pro-Pol polyprotein OS=Simian foamy virus type 1 O... [more]
sp|P27401|POL_SFV3L3.021e-1529.59Pro-Pol polyprotein OS=Simian foamy virus type 3 (... [more]
sp|Q87040|POL_SFVCP4.516e-1528.72Pro-Pol polyprotein OS=Simian foamy virus (isolate... [more]
sp|P0CT40|TF29_SCHPO5.659e-1524.54Transposon Tf2-9 polyprotein OS=Schizosaccharomyce... [more]
back to top
BLAST of SMED30028457 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0A9ZAU62.451e-6141.11Integrase catalytic domain-containing protein (Fra... [more]
A0A0K8S6442.680e-6141.11Integrase catalytic domain-containing protein (Fra... [more]
A0A2L2YVP02.729e-6041.20Integrase catalytic domain-containing protein (Fra... [more]
A0A2S2NV795.696e-5736.42Pro-Pol polyprotein (Fragment) OS=Schizaphis grami... [more]
A0A4Y2FKM96.167e-5739.13Retrovirus-related Pol polyprotein from transposon... [more]
back to top
BLAST of SMED30028457 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000036084.12.488e-3031.58pep primary_assembly:Astyanax_mexicanus-2.0:22:101... [more]
ENSAMXT00000050457.18.548e-3031.22pep primary_assembly:Astyanax_mexicanus-2.0:16:351... [more]
ENSAMXT00000044431.11.290e-2832.75pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000031772.19.172e-2828.35pep primary_assembly:Astyanax_mexicanus-2.0:25:181... [more]
ENSAMXT00000039359.12.755e-2731.31pep primary_assembly:Astyanax_mexicanus-2.0:5:1935... [more]
back to top
BLAST of SMED30028457 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSPMAT00000004123.11.155e-1124.39pep scaffold:Pmarinus_7.0:GL477387:93825:107321:1 ... [more]
ENSPMAT00000004121.13.502e-1027.43pep scaffold:Pmarinus_7.0:GL477387:93825:107330:1 ... [more]
ENSPMAT00000009777.17.939e-921.61pep scaffold:Pmarinus_7.0:GL476990:135790:139231:-... [more]
back to top
BLAST of SMED30028457 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30028457 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30028457 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000038086.11.593e-3031.63pep primary_assembly:ASM223467v1:8:23628267:236314... [more]
ENSORLT00000041026.12.024e-2933.00pep primary_assembly:ASM223467v1:6:22718848:227253... [more]
ENSORLT00000031051.15.560e-2932.50uncharacterized LOC111947296 [Source:NCBI gene;Acc... [more]
ENSORLT00000045127.16.088e-2935.57pep primary_assembly:ASM223467v1:10:587855:593081:... [more]
ENSORLT00000030488.12.984e-2830.50pep primary_assembly:ASM223467v1:10:1370717:137185... [more]
back to top
BLAST of SMED30028457 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000055306.15.650e-4952.84SMESG000055306.1[more]
SMESG000054366.15.650e-4952.84SMESG000054366.1[more]
SMESG000000071.16.121e-2735.57SMESG000000071.1[more]
SMESG000027384.14.473e-2652.08SMESG000027384.1[more]
SMESG000038549.14.533e-2331.19SMESG000038549.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30028457 ID=SMED30028457|Name=SMED30028457|organism=Schmidtea mediterranea sexual|type=transcript|length=1615bp
GTATGATGGTATCTACCATGGTTTTAAGTGAAAGGAGGTTTTAAGATAAA
GATTCGTCTTTTTAGTTGCCTAAAGCCCAAGAATTGCAAAATGATTTGGT
GTCCAGTTCATCAGGATGAGTATATAACAGTGTTAACTTGGCACTGTTTT
ACACTTACCTGGCGCTCAGATAAATGTGACGAGAGCCATTAAAAGACGTT
AGATCCAAAGATTAATGAGAAAGGTGCTATGGATACGAATGTTTTAAATA
GTTAAATTATTAAATAATTAAAATATAAACTAACAATTTGAAAATATGTT
TTAAAGGTTTTATATCAAATATATAAACAAAGTTTTTATATTAAATTATC
AATAATAATTTAATATTAAATGGCTACATAGCCCCTTTCTAGGTTATGAG
TAACTAAACTGTCATCTCGAAGGTAAGCGACCTTAAGCTTGTCTACTGAA
ACCCGAATTGCTCTTGTTGGTAGTTGAATTTCGAATGTTTTGAAATCAGG
GCTGCGATTGATAAAAGAAAATGGTCCGTCATACATGGGTTTGAGTGCTG
TTTTTGTCTCCACTTTAAGCCAAACATATTTACATGTTTTGAGGTCATTT
GGCAAGTATTCTTTCCATTTTTGTTTCCGTTTTCGCTTACATCTGATGTC
CCCAAGTAAGCGACTGTCAGTTCCAAACACTGTTTGGCTTGGTGATATGC
CAGTATCTTCAGATATGACTTGGTGAAGCCCTAGAAAAACTAATGGTAAT
TCATTTGCACAATTTTTATTACCATCTTCCGAGTGTGATCTTAAGGCTGA
TTTGAGCGTTCGGTGGAACCTTTCAACTTTACCGTTGCATTGAGGATGAT
ATGCAGTGGTGTGTCTATGATCGATATTGTGCTTTTGACATAGTTCCTTG
AAAGTGAATGAAATAAATTGTTTACCGTTGTCCGTTATGATGATTTCAGG
AACTCTGTAGCGTGCTATCCATTCATTTTCAAAGGTTCTTGTTGTTAAAC
CACTTGATATTTCAGAAATTGGGATAGCTTCTGGCCAAGATGTATCTCTG
TCAATAATGGTAAGAATATACTTTTTATTATTGACTGAAGGCAATGGTCC
TACGATGTCTATATGTATCACGTTGAACTTGCCGCGTTCTGGAAGTTCTT
TGAGATTCGACTTTGTATGTCTTGTTATTTTATTTTTCTGACACATGTGG
CAGGTTTTGCACCAATTTCTGATTTGTGCTCTCCTGTGTGGTAACCTGAT
AATATGTTGATTATTTGATTGAATAAAAAAAACCATTTGGATGTTTCAGA
AAGTATTCAAGATCTATTTACTGGTAGGAAATAAGTCATAGGTCGCTTCT
ATGATGGTCAACTTGTTTACTTTGAGTTCTCATGTAGCAAATGCTGACAT
CGAATTAATTGATGAAGAGTATCCTTATTCATAGTCTGTACTTGCATTGC
ATTTGTTTTGGAGCTTCTTCTGACAATATCAAAATTAGTGCCATGGTTTC
AACAAAGTTTGAAATAAGCCAATAATAGAATGCCACAATCACAATGAAAC
CTTTCAAGATTTTGCCATCTTTTAGTCGATGGTAAATTGAATGAATTTTG
TCTTCATAAGGTGAT
back to top

protein sequence of SMED30028457-orf-1

>SMED30028457-orf-1 ID=SMED30028457-orf-1|Name=SMED30028457-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=307bp
MVFFIQSNNQHIIRLPHRRAQIRNWCKTCHMCQKNKITRHTKSNLKELPE
RGKFNVIHIDIVGPLPSVNNKKYILTIIDRDTSWPEAIPISEISSGLTTR
TFENEWIARYRVPEIIITDNGKQFISFTFKELCQKHNIDHRHTTAYHPQC
NGKVERFHRTLKSALRSHSEDGNKNCANELPLVFLGLHQVISEDTGISPS
QTVFGTDSRLLGDIRCKRKRKQKWKEYLPNDLKTCKYVWLKVETKTALKP
MYDGPFSFINRSPDFKTFEIQLPTRAIRVSVDKLKVAYLRDDSLVTHNLE
RGYVAI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR012337RNaseH-like_sf
IPR001584Integrase_cat-core
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
Vocabulary: biological process
TermDefinition
GO:0015074DNA integration