WD_REPEATS_REGION domain-containing protein

Overview
NameWD_REPEATS_REGION domain-containing protein
Smed IDSMED30028454
Length (bp)1922
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of WD_REPEATS_REGION domain-containing protein (SMED30028454) t-SNE clustered cells

Violin plots show distribution of expression levels for WD_REPEATS_REGION domain-containing protein (SMED30028454) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of WD_REPEATS_REGION domain-containing protein (SMED30028454) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for WD_REPEATS_REGION domain-containing protein (SMED30028454) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30028454

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
zeta neoblastSMED30028454SMESG000005136.1 dd_Smed_v4_20962_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Human
Match: TAF5 (TATA-box binding protein associated factor 5 [Source:HGNC Symbol;Acc:HGNC:11539])

HSP 1 Score: 149.058 bits (375), Expect = 7.144e-37
Identity = 93/296 (31.42%), Postives = 147/296 (49.66%), Query Frame = 1
Query:  922 DNADNAQFDLISGHSGAVYEMSWSKNQQLLISASSDGTVKCWRTATKDCMTTFSAPG-PIWSVDLSPLSENLLVCGTNKESINVYALDHPDPIRQFSRDIHGAVTCVRFHGNDNYIASGGVDRTVRLFDIRSGTLVRSFTGHKGIVSSLRFSLDGKYLISGCEMGKVNIWDLTSSNWLLKSLSSDDYSGNSRGAVMNMDLCRNLQLLVVGRREGQIDVWDYRALIGSNAEQQGRSYETNQFGSSLCTETDSDESMLYLVTDPRRAGLCDTLYTKTFPVMALQFNRRDILHCCVFYS 1806
            D    ++  ++ GHSG VY  S+S ++  L+S+S DGTV+ W   T  C+  +     P+W    SP      V G +     ++A DH  P+R F+  +   V C RFH N NY+A+G  DRTVRL+D+ +G  VR FTGHKG + SL FS +G++L +G   G+V +WD+         L   +  G++   V ++   R+ ++L  G  +  + +WD        A +     ET+ F ++       + S   L+          T  TK+ PV+ L F RR+++     YS
Sbjct:  529 DEKTASELKILYGHSGPVYGASFSPDRNYLLSSSEDGTVRLWSLQTFTCLVGYKGHNYPVWDTQFSPYG-YYFVSGGHDRVARLWATDHYQPLRIFAGHL-ADVNCTRFHPNSNYVATGSADRTVRLWDVLNGNCVRIFTGHKGPIHSLTFSPNGRFLATGATDGRVLLWDIG------HGLMVGELKGHT-DTVCSLRFSRDGEILASGSMDNTVRLWD--------AIKAFEDLETDDFTTATGHINLPENSQELLL---------GTYMTKSTPVVHLHFTRRNLVLAAGAYS 798          

HSP 2 Score: 86.6557 bits (213), Expect = 5.188e-17
Identity = 53/173 (30.64%), Postives = 92/173 (53.18%), Query Frame = 1
Query:  157 YSEFYK----FVKNSSTIHHPQLRVFLYPVFVHIYFHLLSTGQTDQANKFLTRFAKSQEIIYKRDILDL-QMFPLSCGDGHNCLLDIFRANKFAVRISRLSWEYVQQNFLENKIMKDLSNLINENLKIDLIEKFPRNEMEIDCCRGGFSGESIPEENL------LVFDPDLSV 642
            Y E+Y     F++ S   H  +L    YP+FVH+Y  L+     ++A  F  +F   QE  Y+ D+  L  +       G+  +LD FR +KF +RISR S++ ++++ L+ K    + N++ E+L ID+ +  PR++ +ID   G  +GE+  E N       L+ +P++ V
Sbjct:  214 YEEYYSGLKHFIECSLDCHRAELSQLFYPLFVHMYLELVYNQHENEAKSFFEKFHGDQECYYQDDLRVLSSLTKKEHMKGNETMLD-FRTSKFVLRISRDSYQLLKRH-LQEKQNNQIWNIVQEHLYIDIFDGMPRSKQQIDAMVGSLAGEAKREANKSKVFFGLLKEPEIEV 384          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Human
Match: TAF5L (TATA-box binding protein associated factor 5 like [Source:HGNC Symbol;Acc:HGNC:17304])

HSP 1 Score: 132.88 bits (333), Expect = 4.579e-32
Identity = 125/490 (25.51%), Postives = 221/490 (45.10%), Query Frame = 1
Query:  154 QYSEFYKFVKNSSTIHHPQLRVFLYPVFVHIYFHLLSTGQTDQANKFLTRFAKS--QEIIYKRDILDLQMFPLSCGDGHNCLLDIFRANKFAVRISRLSWEYVQQNFLENKIMKDLSNLINENLKIDLIEKFPRNEMEIDCCRGGFSGESIPEENLLVFDPDL--------SVIDLQDPNIKRSK--PSAMTSQKRRLIERKCEESSTLEDVTDQLSFDSILHGVGGLGNSVGICAAFSKDCDFLAVGTVTGDIYVNWHRTSCRDYPPDNADNAQFDLISGHSGAVYEMSWSKNQQLLISASSDGTVKCWRTATKDCMTTFSAPG-PIWSVDLSPLSENLLVCGTNKESINVYALDHPDPIRQFSRDIHGAVTCVRFHGNDNYIASGGVDRTVRLFDIRSGTLVRSFTGHKGIVSSLRFSLDGKYLISGCEMGKVNIWDLTSSNWLLKSLSSDDYSGNSRGAVMNMDLCRNLQLLVVGRREGQIDVWDYR 1584
            Q+     F+ +S + H  ++   LYP+FV+++ +L+          F +RF     Q    K  I  LQ          N  L  F  NK+ VR+   S+ Y+ + +L++     L  ++  ++ +D ++   R + ++       SG S   EN  +  PD+        + +++   +IKR K  P ++T+    +       +  L + T ++S DS L   G   + + + +  SK             I++        D   DNA   +  ++ GH G VY   +  +   L+S S D +++ W   +      +     P+W +D+SP S      G++  +  +++ D   P+R ++  +   V CV+FH N NY+A+G  D+TVRL+  + G  VR FTGH+G V SL FS +GKYL S  E  ++ +WDL S   L K L    ++ N    + ++    +  L+     +  + VWD R
Sbjct:   73 QFGRLRNFLTDSDSQHSHEVMPLLYPLFVYLHLNLVQNSPKSTVESFYSRFHGMFLQNASQKDVIEQLQTTQTIQDILSNFKLRAFLDNKYVVRLQEDSYNYLIR-YLQSDNNTALCKVLTLHIHLD-VQPAKRTDYQLYA-----SGSSSRSENNGLEPPDMPSPILQNEAALEVLQESIKRVKDGPPSLTT----ICFYAFYNTEQLLN-TAEISPDSKLLAAGFDNSCIKLWSLRSKKLKSEPHQVDVSRIHLACDILEEEDDEDDNA-GTEMKILRGHCGPVYSTRFLADSSGLLSCSEDMSIRYWDLGSFTNTVLYQGHAYPVWDLDISPYSL-YFASGSHDRTARLWSFDRTYPLRIYAGHL-ADVDCVKFHPNSNYLATGSTDKTVRLWSAQQGNSVRLFTGHRGPVLSLAFSPNGKYLASAGEDQRLKLWDLASGT-LYKELRG--HTDN----ITSLTFSPDSGLIASASMDNSVRVWDIR 540          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Human
Match: TAF5L (TATA-box binding protein associated factor 5 like [Source:HGNC Symbol;Acc:HGNC:17304])

HSP 1 Score: 132.88 bits (333), Expect = 4.579e-32
Identity = 125/490 (25.51%), Postives = 221/490 (45.10%), Query Frame = 1
Query:  154 QYSEFYKFVKNSSTIHHPQLRVFLYPVFVHIYFHLLSTGQTDQANKFLTRFAKS--QEIIYKRDILDLQMFPLSCGDGHNCLLDIFRANKFAVRISRLSWEYVQQNFLENKIMKDLSNLINENLKIDLIEKFPRNEMEIDCCRGGFSGESIPEENLLVFDPDL--------SVIDLQDPNIKRSK--PSAMTSQKRRLIERKCEESSTLEDVTDQLSFDSILHGVGGLGNSVGICAAFSKDCDFLAVGTVTGDIYVNWHRTSCRDYPPDNADNAQFDLISGHSGAVYEMSWSKNQQLLISASSDGTVKCWRTATKDCMTTFSAPG-PIWSVDLSPLSENLLVCGTNKESINVYALDHPDPIRQFSRDIHGAVTCVRFHGNDNYIASGGVDRTVRLFDIRSGTLVRSFTGHKGIVSSLRFSLDGKYLISGCEMGKVNIWDLTSSNWLLKSLSSDDYSGNSRGAVMNMDLCRNLQLLVVGRREGQIDVWDYR 1584
            Q+     F+ +S + H  ++   LYP+FV+++ +L+          F +RF     Q    K  I  LQ          N  L  F  NK+ VR+   S+ Y+ + +L++     L  ++  ++ +D ++   R + ++       SG S   EN  +  PD+        + +++   +IKR K  P ++T+    +       +  L + T ++S DS L   G   + + + +  SK             I++        D   DNA   +  ++ GH G VY   +  +   L+S S D +++ W   +      +     P+W +D+SP S      G++  +  +++ D   P+R ++  +   V CV+FH N NY+A+G  D+TVRL+  + G  VR FTGH+G V SL FS +GKYL S  E  ++ +WDL S   L K L    ++ N    + ++    +  L+     +  + VWD R
Sbjct:   73 QFGRLRNFLTDSDSQHSHEVMPLLYPLFVYLHLNLVQNSPKSTVESFYSRFHGMFLQNASQKDVIEQLQTTQTIQDILSNFKLRAFLDNKYVVRLQEDSYNYLIR-YLQSDNNTALCKVLTLHIHLD-VQPAKRTDYQLYA-----SGSSSRSENNGLEPPDMPSPILQNEAALEVLQESIKRVKDGPPSLTT----ICFYAFYNTEQLLN-TAEISPDSKLLAAGFDNSCIKLWSLRSKKLKSEPHQVDVSRIHLACDILEEEDDEDDNA-GTEMKILRGHCGPVYSTRFLADSSGLLSCSEDMSIRYWDLGSFTNTVLYQGHAYPVWDLDISPYSL-YFASGSHDRTARLWSFDRTYPLRIYAGHL-ADVDCVKFHPNSNYLATGSTDKTVRLWSAQQGNSVRLFTGHRGPVLSLAFSPNGKYLASAGEDQRLKLWDLASGT-LYKELRG--HTDN----ITSLTFSPDSGLIASASMDNSVRVWDIR 540          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Human
Match: KATNB1 (katanin regulatory subunit B1 [Source:HGNC Symbol;Acc:HGNC:6217])

HSP 1 Score: 83.5741 bits (205), Expect = 4.378e-16
Identity = 64/212 (30.19%), Postives = 98/212 (46.23%), Query Frame = 1
Query:  952 ISGHSGAVYEMSWSKNQ-QLLISASSDGTVKCWRTATKDCMTTFSA-PGPIWSVDLSPLSENLLVCGTNKESINVYALDHPDPIRQFSRDIHGAVTC-VRFHGNDNYIASGGVDRTVRLFDIRSGTLVRSFTGHKGIVSSLRFSLDGKYLISGCEMGKVNIWDLTSSNWLLKSLSSDDYSGNSRGAVMNMDLCRNLQLLVVGRREGQIDVWD 1578
            I  H+  V  +   K   +LL +   D  V  W     +C+ + +    P+ SV L+   E L+V G+   SI V+ L+    +R      H A  C + FH    ++ASG  D  ++L+DIR    V  + GH   V  LRFS DGK+L S  +   V +WDLT+   +       ++ G++ G V  ++   N  LL  G  +  I  WD
Sbjct:   16 IVAHASNVSSLVLGKASGRLLATGGDDCRVNLWSINKPNCIMSLTGHTSPVESVRLN-TPEELIVAGSQSGSIRVWDLEAAKILRTLMG--HKANICSLDFHPYGEFVASGSQDTNIKLWDIRRKGCVFRYRGHSQAVRCLRFSPDGKWLASAADDHTVKLWDLTAGKMM------SEFPGHT-GPVNVVEFHPNEYLLASGSSDRTIRFWD 217          

HSP 2 Score: 72.4034 bits (176), Expect = 1.361e-12
Identity = 43/162 (26.54%), Postives = 80/162 (49.38%), Query Frame = 1
Query:  952 ISGHSGAVYEMSWSKNQQLLISASSDGTVKCW-RTATKDCMTTFSAPGPIWSVDLSPLSENLLVCGTNKESINVYALDHPDPIRQFSRDIHGAVTCVRFHGNDNYIASGGVDRTVRLFDIRSGTLVRSFTGHKGIVSSLRFSLDGKYLISGCEMGKVNIWDL 1434
            ++GH+  V  +  +  ++L+++ S  G+++ W   A K   T       I S+D  P  E  +  G+   +I ++ +     + ++ R    AV C+RF  +  ++AS   D TV+L+D+ +G ++  F GH G V+ + F  +   L SG     +  WDL
Sbjct:   59 LTGHTSPVESVRLNTPEELIVAGSQSGSIRVWDLEAAKILRTLMGHKANICSLDFHPYGE-FVASGSQDTNIKLWDIRRKGCVFRY-RGHSQAVRCLRFSPDGKWLASAADDHTVKLWDLTAGKMMSEFPGHTGPVNVVEFHPNEYLLASGSSDRTIRFWDL 218          

HSP 3 Score: 59.6918 bits (143), Expect = 1.147e-8
Identity = 40/153 (26.14%), Postives = 67/153 (43.79%), Query Frame = 1
Query:  952 ISGHSGAVYEMSWSKNQQLLISASSDGTVKCWRTATKDCMTTFSAPG-PIWSVDLSPLSENLLVCGTNKESINVYALDHPDPIRQFSRDIHGAVTCVRFHGNDNYIASGGVDRTVRLFDIRSGTLVRSFTGHKGIVSSLRFSLDGKYLISGCE 1407
            + GH   +  + +    + + S S D  +K W    K C+  +      +  +  SP     L    +  ++ ++ L     + +F     G V  V FH N+  +ASG  DRT+R +D+    +V    G  G V S+ F+ DG  L SGC+
Sbjct:  101 LMGHKANICSLDFHPYGEFVASGSQDTNIKLWDIRRKGCVFRYRGHSQAVRCLRFSP-DGKWLASAADDHTVKLWDLTAGKMMSEFPGHT-GPVNVVEFHPNEYLLASGSSDRTIRFWDLEKFQVVSCIEGEPGPVRSVLFNPDGCCLYSGCQ 251          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Human
Match: GNB2 (G protein subunit beta 2 [Source:HGNC Symbol;Acc:HGNC:4398])

HSP 1 Score: 77.7962 bits (190), Expect = 1.648e-15
Identity = 50/168 (29.76%), Postives = 82/168 (48.81%), Query Frame = 1
Query:  952 ISGHSGAVYEMSWSKNQQLLISASSDGTVKCWRTATKDCMTTFSAPGP-IWSVDLSPLSENLLVCGTNKESINVYALDHPDPIRQFSRDI---HGAVTCVRFHGNDNYIASGGVDRTVRLFDIRSGTLVRSFTGHKGIVSSLRFSLDGKYLISGCEMGKVNIWDLTSS 1443
            + GH   +Y M W  + +LL+SAS DG +  W + T + +         + +   +P S N + CG      ++Y+L   +   + SR++    G ++C RF  ++  I S G D T  L+DI +G     F GH G V SL  + DG+  +SG     + +WD+  S
Sbjct:   51 LRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAP-SGNFVACGGLDNICSIYSLKTREGNVRVSRELPGHTGYLSCCRFLDDNQIITSSG-DTTCALWDIETGQQTVGFAGHSGDVMSLSLAPDGRTFVSGACDASIKLWDVRDS 216          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Celegans
Match: taf-5 (TAF (TBP-associated transcription factor) family [Source:UniProtKB/TrEMBL;Acc:G5EF68])

HSP 1 Score: 120.939 bits (302), Expect = 1.848e-28
Identity = 112/464 (24.14%), Postives = 211/464 (45.47%), Query Frame = 1
Query:  385 NCLLDIFRANKFAVRISRLSWEYVQQNFLENKIMKDLSNLINENLKIDLIEKFPRNEMEIDCCRGGFSGESIP--EENLLVFDPDLSVID---LQDPNIKRSKPSAMTSQKRRLIERKCEESS--TLEDVTDQLSFD--SILHGVGGLG-----NSVGICAA-------------FSKDCDFLAVGTVTGDIYVNW-----HRTSCRDYP---------PDNADNAQFDL--------ISGHSGAVYEMSWSKNQQLLISASSDGTVKCWRTATKDCMTTFSAPGPIWSVDLSPLSENLLVCGTNKESINVYALDHPDPIRQFSRDIHGAVTCVRFHGNDNYIASGGVDRTVRLFDIRSGTLVRSFTGHKGIVSSLRFSLDGKYLISGCEMGKVNIWDLTSSNWLLKSLSSDDYSGNSRGAVMNMDLCRNLQLLVVGRREGQIDVWDYRALIGSN-AEQQGRSY 1626
            N  + I R NKF VR+SR + ++++   ++ +++  + N+I +++ I+  ++   N   I+   GG  G +    + + ++F    SV+    +Q+   +++K        +++ +  C ++    L  +++ L  +  + L  VG +      + V IC               F+ D   +A+G     I +N           RD            DN  +  FDL         +GH G V+ +++S +++LLIS++ D TV+ W   T+     +  P  +W                +K +  +++ D   P+R F+ D +G V C+ +H N NYIA G  DR VR++D+ SGT VR F+GHK  + +++FS  G+Y++S   +G + IWDL     +   ++       ++G++      R+  +  V      I ++    LIG+  A  Q  SY
Sbjct:  160 NEHVHILRENKFLVRLSRPTLKHLES--IQTRVI-GVKNIIAKHICIENADEVSTNRTTIETQMGGILGVTSKSDKRHKMMF----SVLKDELMQNIEKRKTKGKDWKDMGKKM-QTHCPQADRIPLPPISEHLREERRNWLRDVGKMAIISAESPVSICMYTTVNAPIGVASCDFTDDSSLIAMGLSDSSIVMNAMDPMNKMKKLRDMEFLDKIDIETADNVQSQMFDLQGSTTSVRYTGHGGPVFSVNFSPDRRLLISSAGDRTVRLWSMETQRNAVIYRTPAVVWQAQFCSRGYYFATASADKTAA-MWSTDRMHPLRIFA-DPYGDVGCIDYHPNCNYIAGGSDDRYVRVWDVCSGTRVRIFSGHKASIIAVKFSPCGRYIVSLDAIGNLMIWDLAYQRLVAAEITE---QAGTKGSIT---FSRDGGVFAVSHGNSSIQLYSLDTLIGTVLAAGQNDSY 607          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Celegans
Match: taf-5 (TAF (TBP-associated transcription factor) family [Source:UniProtKB/TrEMBL;Acc:G5EF68])

HSP 1 Score: 120.939 bits (302), Expect = 1.848e-28
Identity = 112/464 (24.14%), Postives = 211/464 (45.47%), Query Frame = 1
Query:  385 NCLLDIFRANKFAVRISRLSWEYVQQNFLENKIMKDLSNLINENLKIDLIEKFPRNEMEIDCCRGGFSGESIP--EENLLVFDPDLSVID---LQDPNIKRSKPSAMTSQKRRLIERKCEESS--TLEDVTDQLSFD--SILHGVGGLG-----NSVGICAA-------------FSKDCDFLAVGTVTGDIYVNW-----HRTSCRDYP---------PDNADNAQFDL--------ISGHSGAVYEMSWSKNQQLLISASSDGTVKCWRTATKDCMTTFSAPGPIWSVDLSPLSENLLVCGTNKESINVYALDHPDPIRQFSRDIHGAVTCVRFHGNDNYIASGGVDRTVRLFDIRSGTLVRSFTGHKGIVSSLRFSLDGKYLISGCEMGKVNIWDLTSSNWLLKSLSSDDYSGNSRGAVMNMDLCRNLQLLVVGRREGQIDVWDYRALIGSN-AEQQGRSY 1626
            N  + I R NKF VR+SR + ++++   ++ +++  + N+I +++ I+  ++   N   I+   GG  G +    + + ++F    SV+    +Q+   +++K        +++ +  C ++    L  +++ L  +  + L  VG +      + V IC               F+ D   +A+G     I +N           RD            DN  +  FDL         +GH G V+ +++S +++LLIS++ D TV+ W   T+     +  P  +W                +K +  +++ D   P+R F+ D +G V C+ +H N NYIA G  DR VR++D+ SGT VR F+GHK  + +++FS  G+Y++S   +G + IWDL     +   ++       ++G++      R+  +  V      I ++    LIG+  A  Q  SY
Sbjct:  160 NEHVHILRENKFLVRLSRPTLKHLES--IQTRVI-GVKNIIAKHICIENADEVSTNRTTIETQMGGILGVTSKSDKRHKMMF----SVLKDELMQNIEKRKTKGKDWKDMGKKM-QTHCPQADRIPLPPISEHLREERRNWLRDVGKMAIISAESPVSICMYTTVNAPIGVASCDFTDDSSLIAMGLSDSSIVMNAMDPMNKMKKLRDMEFLDKIDIETADNVQSQMFDLQGSTTSVRYTGHGGPVFSVNFSPDRRLLISSAGDRTVRLWSMETQRNAVIYRTPAVVWQAQFCSRGYYFATASADKTAA-MWSTDRMHPLRIFA-DPYGDVGCIDYHPNCNYIAGGSDDRYVRVWDVCSGTRVRIFSGHKASIIAVKFSPCGRYIVSLDAIGNLMIWDLAYQRLVAAEITE---QAGTKGSIT---FSRDGGVFAVSHGNSSIQLYSLDTLIGTVLAAGQNDSY 607          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Celegans
Match: taf-5 (TAF (TBP-associated transcription factor) family [Source:UniProtKB/TrEMBL;Acc:G5EF68])

HSP 1 Score: 120.939 bits (302), Expect = 1.848e-28
Identity = 112/464 (24.14%), Postives = 211/464 (45.47%), Query Frame = 1
Query:  385 NCLLDIFRANKFAVRISRLSWEYVQQNFLENKIMKDLSNLINENLKIDLIEKFPRNEMEIDCCRGGFSGESIP--EENLLVFDPDLSVID---LQDPNIKRSKPSAMTSQKRRLIERKCEESS--TLEDVTDQLSFD--SILHGVGGLG-----NSVGICAA-------------FSKDCDFLAVGTVTGDIYVNW-----HRTSCRDYP---------PDNADNAQFDL--------ISGHSGAVYEMSWSKNQQLLISASSDGTVKCWRTATKDCMTTFSAPGPIWSVDLSPLSENLLVCGTNKESINVYALDHPDPIRQFSRDIHGAVTCVRFHGNDNYIASGGVDRTVRLFDIRSGTLVRSFTGHKGIVSSLRFSLDGKYLISGCEMGKVNIWDLTSSNWLLKSLSSDDYSGNSRGAVMNMDLCRNLQLLVVGRREGQIDVWDYRALIGSN-AEQQGRSY 1626
            N  + I R NKF VR+SR + ++++   ++ +++  + N+I +++ I+  ++   N   I+   GG  G +    + + ++F    SV+    +Q+   +++K        +++ +  C ++    L  +++ L  +  + L  VG +      + V IC               F+ D   +A+G     I +N           RD            DN  +  FDL         +GH G V+ +++S +++LLIS++ D TV+ W   T+     +  P  +W                +K +  +++ D   P+R F+ D +G V C+ +H N NYIA G  DR VR++D+ SGT VR F+GHK  + +++FS  G+Y++S   +G + IWDL     +   ++       ++G++      R+  +  V      I ++    LIG+  A  Q  SY
Sbjct:  160 NEHVHILRENKFLVRLSRPTLKHLES--IQTRVI-GVKNIIAKHICIENADEVSTNRTTIETQMGGILGVTSKSDKRHKMMF----SVLKDELMQNIEKRKTKGKDWKDMGKKM-QTHCPQADRIPLPPISEHLREERRNWLRDVGKMAIISAESPVSICMYTTVNAPIGVASCDFTDDSSLIAMGLSDSSIVMNAMDPMNKMKKLRDMEFLDKIDIETADNVQSQMFDLQGSTTSVRYTGHGGPVFSVNFSPDRRLLISSAGDRTVRLWSMETQRNAVIYRTPAVVWQAQFCSRGYYFATASADKTAA-MWSTDRMHPLRIFA-DPYGDVGCIDYHPNCNYIAGGSDDRYVRVWDVCSGTRVRIFSGHKASIIAVKFSPCGRYIVSLDAIGNLMIWDLAYQRLVAAEITE---QAGTKGSIT---FSRDGGVFAVSHGNSSIQLYSLDTLIGTVLAAGQNDSY 607          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Celegans
Match: lin-23 (F-box/WD repeat-containing protein lin-23 [Source:UniProtKB/Swiss-Prot;Acc:Q09990])

HSP 1 Score: 77.7962 bits (190), Expect = 1.103e-14
Identity = 55/215 (25.58%), Postives = 100/215 (46.51%), Query Frame = 1
Query:  922 DNADNAQFDLISGHSGAVYEMSWSKNQQLLISASSDGTVKCWRTATKDCMTTFS-----------APG-----------PIW-------------------SVDLSPLSENLLVCGTNKESINVYALDHPDPIRQFSRDIHGAVTCVRFHGNDNYIASGGVDRTVRLFDIRSGTLVRSFTGHKGIVSSLRFSLDGKYLISGCEMGKVNIWDLTSS 1443
            D  D +   ++SGH+G+V  + +  + +++IS SSD TV+ W   T +C+ T             A G            +W                   +V++    +  +V  +   +I V+++D  + +R  +    G + C+++ G    + SG  D T+RL+DI SG  +R   GH+ +V  +RF  D K ++SG   GK+ +WDL ++
Sbjct:  193 DRKDYSCSRILSGHTGSVLCLQY--DNRVIISGSSDATVRVWDVETGECIKTLIHHCEAVLHLRFANGIMVTCSKDRSIAVWDMVSPRDITIRRVLVGHRAAVNVVDFDDRYIVSASGDRTIKVWSMDTLEFVRTLAGHRRG-IACLQYRG--RLVVSGSSDNTIRLWDIHSGVCLRVLEGHEELVRCIRF--DEKRIVSGAYDGKIKVWDLQAA 400          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Celegans
Match: lin-23 (F-box/WD repeat-containing protein lin-23 [Source:UniProtKB/Swiss-Prot;Acc:Q09990])

HSP 1 Score: 77.411 bits (189), Expect = 1.208e-14
Identity = 55/215 (25.58%), Postives = 100/215 (46.51%), Query Frame = 1
Query:  922 DNADNAQFDLISGHSGAVYEMSWSKNQQLLISASSDGTVKCWRTATKDCMTTFS-----------APG-----------PIW-------------------SVDLSPLSENLLVCGTNKESINVYALDHPDPIRQFSRDIHGAVTCVRFHGNDNYIASGGVDRTVRLFDIRSGTLVRSFTGHKGIVSSLRFSLDGKYLISGCEMGKVNIWDLTSS 1443
            D  D +   ++SGH+G+V  + +  + +++IS SSD TV+ W   T +C+ T             A G            +W                   +V++    +  +V  +   +I V+++D  + +R  +    G + C+++ G    + SG  D T+RL+DI SG  +R   GH+ +V  +RF  D K ++SG   GK+ +WDL ++
Sbjct:  193 DRKDYSCSRILSGHTGSVLCLQY--DNRVIISGSSDATVRVWDVETGECIKTLIHHCEAVLHLRFANGIMVTCSKDRSIAVWDMVSPRDITIRRVLVGHRAAVNVVDFDDRYIVSASGDRTIKVWSMDTLEFVRTLAGHRRG-IACLQYRG--RLVVSGSSDNTIRLWDIHSGVCLRVLEGHEELVRCIRF--DEKRIVSGAYDGKIKVWDLQAA 400          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Fly
Match: Taf5 (gene:FBgn0010356 transcript:FBtr0088240)

HSP 1 Score: 172.94 bits (437), Expect = 1.765e-45
Identity = 157/618 (25.40%), Postives = 267/618 (43.20%), Query Frame = 1
Query:  157 YSEFYKFVKNSSTIHHPQLRVFLYPVFVHIYFHLLSTGQTDQANKFLTRFAKSQEIIYKRDILDLQMFPLSCGDGHNCLLDIFRANKFAVRISRLSWEYVQQNFLENKIMKDLSNLINENLKIDLIEKFPRNEMEIDCCRGGFSGESIPEEN-LLVFDPDLSVIDLQ---------------------------------------DPN---IKR-SKPSAMTSQKRRLIERKCEESSTLEDVTDQLS---FDSILHGVGGLGNSVGICAAFSKDCDFLAVGTVTGDIYVNWHRT-----------SCRDYPPDNAD-NAQF---------DLISGHSGAVYEMSWSKNQQLLISASSDGTVKCWRTATKDCMTTFSAPG-PIWSVDLSPLSENLLVCGTNKESINVYALDHPDPIRQFSRDIHGAVTCVRFHGNDNYIASGGVDRTVRLFDIRSGTLVRSFTGHKGIVSSLRFSLDGKYLISGCEMGKVNIWDLTSSNWLLKSLSSDDYSGNSRGAVMNMDLCRNLQLLVVGRREGQIDVWDYRALIGSNAEQQGRSYETNQFGSSLCTETDSDESMLYLVTDPRRAGLCDTLYTKTFPVMALQFNRRDILHCCVFY 1803
            Y E   FV++S  I+  +L + LYP+ V IYF +L++G  ++A +F+ ++    +  Y   + +L +         N L+     +KF +R+SR S    +++ ++++  + +++++++ L  D  E   RN+++     G   GE+  ++N + V+   L  +D Q                                       DPN   I R   P    S K   ++   E S  L    DQL    F ++L+   G+      CA  S D   LA G     + + W  T           S R+   ++AD N +            + GH+G VY  +++    LL+S S D T++ W   T  C+ T+     P+W V  +P     + C  +K +  ++A D    +R F   +   V CV+FH N NY+A+G  DRTVRL+D  +G  VR  TGHKG VSSL FS  G+YL SG     + IWDL++ + +   L            V  +   R+  +L     +  + +WD+  +           Y +N    ++    D ++  +YL+          T  +K  P ++L F RR++L C   +
Sbjct:  120 YKELRTFVEDSLDIYKHELSMVLYPILVQIYFKILASGLREKAKEFIEKYKCDLDGYYIEGLFNLLLLSKPEELLENDLVVAMEQDKFVIRMSRDSHSLFKRH-IQDRRQEVVADIVSKYLHFDTYEGMARNKLQCVATAGSHLGEAKRQDNKMRVYYGLLKEVDFQTLTTPAPAPEEEDDDPDAPDRPKKKKPKKDPLLSKKSKSDPNAPSIDRIPLPELKDSDKLLKLKALREASKRLALSKDQLPSAVFYTVLNSHQGV-----TCAEISDDSTMLACGFGDSSVRI-WSLTPAKLRTLKDADSLRELDKESADINVRMLDDRSGEVTRSLMGHTGPVYRCAFAPEMNLLLSCSEDSTIRLWSLLTWSCVVTYRGHVYPVWDVRFAPHGYYFVSCSYDK-TARLWATDSNQALRVFVGHL-SDVDCVQFHPNSNYVATGSSDRTVRLWDNMTGQSVRLMTGHKGSVSSLAFSACGRYLASGSVDHNIIIWDLSNGSLVTTLL-------RHTSTVTTITFSRDGTVLAAAGLDNNLTLWDFHKVT--------EDYISNHI--TVSHHQDENDEDVYLMR---------TFPSKNSPFVSLHFTRRNLLMCVGLF 702          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Fly
Match: can (gene:FBgn0011569 transcript:FBtr0076299)

HSP 1 Score: 119.013 bits (297), Expect = 1.723e-27
Identity = 94/351 (26.78%), Postives = 161/351 (45.87%), Query Frame = 1
Query:  802 GNSVGICAAFSKDCDFLAVGTVTGDIYV--------------NWHRTSCRDYPPDNADNAQFDLIS--------GHSGAVYEMSWSKNQQLLISASSDGTVKCWRTATKDCMTTFSAP-GPIWSVDLSPLSENLLVCGTNKESINVYALDHPDPIRQFSRDIHGAVTCVRFHGNDNYIASGGVDRTVRLFDIRSGTLVRSFTGHKGIVSSLRFSLDGKYLISGCEMGKVNIWDLTSSNWLLKSLSSDDYSGNSRGAVMNMDLCRNLQLLVVGRREGQIDVWDYRALIGSNAEQQGRSYETNQFGSSLCTETDSDESMLYLVTDPRRAGLCDTLYTKTFPVMALQFNRRDIL 1785
             + V ICA FS+    LA+GTV+  +YV               W +    D      D    D I         GH G VY  S++   + LI+ S D +V+ W   +  C+  FS    P+  V  +P         ++  +  V+  D+  P R     +     C+ FH N +Y+A+G  D TVR++DI     VR F GHK  +++L +S+ G+YL+SG +   + IWD T++  L++      +  + + ++  M++  +  +LVVG ++ Q+ +WD+  +I  N   + +    NQ G    T+  S  ++           L  + +TK  P   ++F RR++L
Sbjct:  552 SDEVVICATFSEGNSMLALGTVSSKVYVFSLKPSKLVQVKAAQWLKN--LDTGMAGVDKDMIDPIKKFTRRTLYGHQGPVYGCSFNPEDRFLITCSEDFSVRLWCLLSWSCVVIFSGHLAPVCFVVFAPRG-YYFATASDDCTARVWMQDNTKPARILQGHLAELGVCL-FHPNRHYMATGSADCTVRIWDIVKAVQVRIFRGHKSRITALIYSICGRYLVSGGDDNLIMIWD-TANEILMQ------FFDHHKASINTMEISLDNNILVVGGQDCQLTLWDFEQVI-KNYLNRAKISMKNQAG----TQESSANNL-----------LVSSFFTKGEPFYMIRFTRRNLL 875          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Fly
Match: wda (gene:FBgn0039067 transcript:FBtr0084387)

HSP 1 Score: 102.449 bits (254), Expect = 3.106e-22
Identity = 58/168 (34.52%), Postives = 90/168 (53.57%), Query Frame = 1
Query:  952 ISGHSGAVYEMSWSKNQQLLISASSDGTVKCWRTATKDCMTTFSAPG-PIWSVDLSPLSENLLVCGTNKESINVYALDHPDPIRQFSRDIHGAVTCVRFHGNDNYIASGGVDRTVRLFDIRSGTLVRSFTGHKGIVSSLRFSLDGKYLISGCEMGKVNIWDLTSSNWL 1452
            + GH+  V ++ +S +  L+ S S D T++CWR     C   + +   PIW +D SP+ +  +V G+   S  +++L+    +  ++      V CV FH N NYIA+G  D +VRL+   SG L+R F   +  V+ L FS DGK L +  E  KV I+DL +   L
Sbjct:  493 LRGHTKGVTDVRFSAHYPLMYSVSKDATMRCWRAHNLHCAAIYRSHNYPIWCLDESPVGQ-YVVTGSKDLSARLWSLEKEHALIIYAGHTQD-VECVAFHPNGNYIATGSADHSVRLWCATSGKLMRVFADCRQAVTQLAFSPDGKMLAAAGEETKVRIFDLAAGAQL 658          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Fly
Match: wds (gene:FBgn0040066 transcript:FBtr0308566)

HSP 1 Score: 81.6481 bits (200), Expect = 2.482e-16
Identity = 59/215 (27.44%), Postives = 100/215 (46.51%), Query Frame = 1
Query:  952 ISGHSGAVYEMSWSKNQQLLISASSDGTVKCWRTATKDCMTTFSA-----PGPIWSVDLSPLSENLLVCGTNKESINVYALDHPDPIRQFSRDIHGAVTCVRFHGNDNYIASGGVDRTVRLFDIRSGTLVRSFTGHKGIVSSLRFSLDGKYLISGCEMGKVNIWDLTSSNWLLKSLSSDDYSGNSRGAVMNMDLCRNLQLLVVGRREGQIDVWDY 1581
            ++GH+ AV  + +S N + L S+S+D  +K W         T S          WS D       LLV G++ +++ V+ L     ++   +     V C  F+   N I SG  D +VR++D+R+G  +++   H   VS++ F+ DG  ++S    G   IWD T+S   LK+L  DD        V  +    N + ++    +  + +WDY
Sbjct:   68 LAGHTKAVSAVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSD-----SRLLVSGSDDKTLKVWELSTGKSLKTL-KGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVRTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWD-TASGQCLKTLIDDD-----NPPVSFVKFSPNGKYILAATLDNTLKLWDY 270          

HSP 2 Score: 72.0182 bits (175), Expect = 3.142e-13
Identity = 57/209 (27.27%), Postives = 97/209 (46.41%), Query Frame = 1
Query:  952 ISGHSGAVYEMSWSKNQQLLISASSDGTVKCWRTATKDCMTTFSA-PGPIWSVDLSPLSENLLVCGTNKESINVYAL----------DHPDPIR--QFSRDI------------------------------HGAVTCVRFHGNDNYIASGGVDRTVRLFDIRSGTLVRSFTGHKGIVSSL--RFSLD-GKYLISGCEMGKVNIWDLTS 1440
            ISGH   + +++WS + +LL+S S D T+K W  +T   + T       ++  + +P S NL+V G+  ES+ ++ +           H DP+    F+RD                               +  V+ V+F  N  YI +  +D T++L+D   G  ++++TGHK     +   FS+  GK+++SG E   V IW+L S
Sbjct:  110 ISGHKLGISDVAWSSDSRLLVSGSDDKTLKVWELSTGKSLKTLKGHSNYVFCCNFNPQS-NLIVSGSFDESVRIWDVRTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNMVYIWNLQS 317          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Fly
Match: wds (gene:FBgn0040066 transcript:FBtr0070438)

HSP 1 Score: 81.6481 bits (200), Expect = 2.482e-16
Identity = 59/215 (27.44%), Postives = 100/215 (46.51%), Query Frame = 1
Query:  952 ISGHSGAVYEMSWSKNQQLLISASSDGTVKCWRTATKDCMTTFSA-----PGPIWSVDLSPLSENLLVCGTNKESINVYALDHPDPIRQFSRDIHGAVTCVRFHGNDNYIASGGVDRTVRLFDIRSGTLVRSFTGHKGIVSSLRFSLDGKYLISGCEMGKVNIWDLTSSNWLLKSLSSDDYSGNSRGAVMNMDLCRNLQLLVVGRREGQIDVWDY 1581
            ++GH+ AV  + +S N + L S+S+D  +K W         T S          WS D       LLV G++ +++ V+ L     ++   +     V C  F+   N I SG  D +VR++D+R+G  +++   H   VS++ F+ DG  ++S    G   IWD T+S   LK+L  DD        V  +    N + ++    +  + +WDY
Sbjct:   68 LAGHTKAVSAVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSD-----SRLLVSGSDDKTLKVWELSTGKSLKTL-KGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVRTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWD-TASGQCLKTLIDDD-----NPPVSFVKFSPNGKYILAATLDNTLKLWDY 270          

HSP 2 Score: 72.0182 bits (175), Expect = 3.142e-13
Identity = 57/209 (27.27%), Postives = 97/209 (46.41%), Query Frame = 1
Query:  952 ISGHSGAVYEMSWSKNQQLLISASSDGTVKCWRTATKDCMTTFSA-PGPIWSVDLSPLSENLLVCGTNKESINVYAL----------DHPDPIR--QFSRDI------------------------------HGAVTCVRFHGNDNYIASGGVDRTVRLFDIRSGTLVRSFTGHKGIVSSL--RFSLD-GKYLISGCEMGKVNIWDLTS 1440
            ISGH   + +++WS + +LL+S S D T+K W  +T   + T       ++  + +P S NL+V G+  ES+ ++ +           H DP+    F+RD                               +  V+ V+F  N  YI +  +D T++L+D   G  ++++TGHK     +   FS+  GK+++SG E   V IW+L S
Sbjct:  110 ISGHKLGISDVAWSSDSRLLVSGSDDKTLKVWELSTGKSLKTLKGHSNYVFCCNFNPQS-NLIVSGSFDESVRIWDVRTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNMVYIWNLQS 317          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Zebrafish
Match: taf5 (TAF5 RNA polymerase II, TATA box binding protein (TBP)-associated factor [Source:ZFIN;Acc:ZDB-GENE-051120-180])

HSP 1 Score: 210.305 bits (534), Expect = 2.518e-58
Identity = 166/623 (26.65%), Postives = 280/623 (44.94%), Query Frame = 1
Query:  157 YSEFYKFVKNSSTIHHPQLRVFLYPVFVHIYFHLLSTGQTDQANKFLTRFAKSQEIIYKRDILDLQMFPLSCG-------DGHNCLLDIFRANKFAVRISRLSWEYVQQNFLENKIMKDLSNLINENLKIDLIEKFPRNEMEIDCCRGGFSGESIPEENL------LVFDPDLSV----------------------IDLQDPNIKRSKPSAMTSQKRRLIERKCEESSTLEDVT----------------DQLSFDSILHGVGGLGNSVGICAAFSKDCDFLAVGTVTGDIYVNWHRTSCR---------------------DYPPDNADNAQFDLISGHSGAVYEMSWSKNQQLLISASSDGTVKCWRTATKDCMTTFSAPG-PIWSVDLSPLSENLLVCGTNKESINVYALDHPDPIRQFSRDIHGAVTCVRFHGNDNYIASGGVDRTVRLFDIRSGTLVRSFTGHKGIVSSLRFSLDGKYLISGCEMGKVNIWDLTSSNWLLKSLSSDDYSGNSRGAVMNMDLCRNLQLLVVGRREGQIDVWDYRALIGSNAEQQGRSYETNQFGSSLCTETDSDESMLYLVTDPRRAGLCDTLYTKTFPVMALQFNRRDILHCCVFYS 1806
            YS+  KF+++    H  +L    YP+FVH+Y  L+      +A  F  +F+  QE  Y+ D+  L      CG        G+  LLD FR ++F +RISR S++ ++++ L+ +    + N+I E+L ID+ +  PR++ +ID   G  +GE+  E N       L+ +P++ V                       D      K+  P+A   Q+ R+   + ++S  L+ +                   + F + L+   GL         F+ D   +A G     + V W  T  +                     +   D   +++  ++ GHSG VY +S+S ++  L+S+S DGT++ W   T  C+  +     P+W    SP      V G +     ++A DH  P+R F+  +   VTC RFH N NY+A+G  DRTVRL+D+ +G  VR FTGHKG + SL FS +GK+L SG   G+V +WD+         L   +  G++ G +  +   R+ +++  G  +  + +WD    I           ET+ F ++           ++L  D  +  L  T ++K+  V+ L F RR++L     Y+
Sbjct:  174 YSDLKKFIESVLDCHRAELSQLFYPLFVHMYLELVYNNHESEAKAFFDKFSGDQECYYEDDLRVL------CGLTKKEHMKGNEALLD-FRTSRFVLRISRDSYQLLKRH-LQERQNNQIWNIIQEHLYIDIFDGMPRSKSQIDSMSGSLAGEARREVNKVKVFYGLLKEPEIEVPLDDEDEEAENEEGKPKKKKTKKDSMGSKSKKQDPNA--PQQNRIPLPELKDSDKLDKIMYMKESTKRIRLGPETLPSICFYTFLNAYQGL-----TAVDFTDDSSLIAGGFADSTVRV-WSVTPKKLRKVKSAADLNLIDKESDDVLERIMDEKTSSESKILHGHSGPVYGVSFSPDRNYLLSSSEDGTIRLWSLQTFTCLVGYKGHNYPVWDTQFSPFG-YYFVSGGHDRVARLWATDHYQPLRIFAGHL-ADVTCTRFHPNSNYVATGSSDRTVRLWDVLNGNCVRIFTGHKGPIHSLAFSPNGKFLASGSTDGRVLLWDIG------HGLMIAELKGHT-GTIYALKFSRDGEIIASGSIDNTVRLWDVMRAID--------DVETDDFTAA--------TGHIHL-PDNSQELLLGTYHSKSTAVIHLHFTRRNLLLAAGSYN 754          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Zebrafish
Match: taf5l (TAF5-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associated factor [Source:ZFIN;Acc:ZDB-GENE-030131-5987])

HSP 1 Score: 114.775 bits (286), Expect = 2.918e-26
Identity = 72/227 (31.72%), Postives = 117/227 (51.54%), Query Frame = 1
Query:  922 DNADNAQFDLISGHSGAVYEMSWSKNQQLLISASSDGTVKCWRTATKDCMTTFSAPG-PIWSVDLSPLSENLLVCGTNKESINVYALDHPDPIRQFSRDIHGAVTCVRFHGNDNYIASGGVDRTVRLFDIRSGTLVRSFTGHKGIVSSLRFSLDGKYLISGCEMGKVNIWDLTSSNWLLKSLSSDDYSGNSRGAVMNMDLCRNLQLLVVGRREGQIDVWDYRALIGS 1599
            ++A  ++   + GHSG VY  ++  +   L+S S D TV+ W   +      +     P+W VD+SP S       ++  +  +++     P+R ++  +   V CV+FH N NYIA+G  D+TVRL+  + G  VR FTGH+G V +L FS +GKYL S  E  ++ +WDL S   L K     D  G++   + ++   ++  L+     +  + VWD R   GS
Sbjct:  340 EDASGSEIKTLRGHSGPVYRTAFLTDASGLLSCSEDSTVRYWDLKSFTNTVLYRGHAYPVWDVDVSPCSL-YFSTASHDRTARLWSFARTYPLRLYAGHLSD-VDCVKFHPNSNYIATGSTDKTVRLWSTQQGASVRLFTGHRGPVLTLAFSPNGKYLASAGEDQRLKLWDLASGG-LFK-----DLRGHT-DTISSLSFSQDSSLVASASMDNTVRVWDIRNAHGS 557          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Zebrafish
Match: gnb4b (guanine nucleotide binding protein (G protein), beta polypeptide 4b [Source:ZFIN;Acc:ZDB-GENE-041114-167])

HSP 1 Score: 78.1814 bits (191), Expect = 2.046e-15
Identity = 52/165 (31.52%), Postives = 79/165 (47.88%), Query Frame = 1
Query:  952 ISGHSGAVYEMSWSKNQQLLISASSDGTVKCWRTATKDCMTTFSAPGP-IWSVDLSPLSENLLVCGTNKESINVYALDHPDPIRQFSRDIHGA---VTCVRFHGNDNYIASGGVDRTVRLFDIRSGTLVRSFTGHKGIVSSLRFSLDGKYLISGCEMGKVNIWDL 1434
            + GH   +Y M W  + +LL+SAS DG +  W   T + M         + +   +P S N + CG      + Y+L   +   + +R++ G    ++C RF  ++  I S G D T  L+DI +G    SFTGH G V SL  S D K  +SG       +WD+
Sbjct:   51 LRGHLAKIYAMHWGSDSRLLVSASQDGKLIIWDGYTTNKMHAIPLRSSWVMTCAYAP-SGNYVACGGLDNICSTYSLKTREGNVRVNRELAGHTGYLSCCRFLDDNQIITSSG-DTTCALWDIETGQQTTSFTGHTGDVMSLSVSPDSKTFVSGACDASAKLWDI 213          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Zebrafish
Match: strap (serine/threonine kinase receptor associated protein [Source:ZFIN;Acc:ZDB-GENE-040426-1110])

HSP 1 Score: 77.7962 bits (190), Expect = 5.018e-15
Identity = 46/164 (28.05%), Postives = 81/164 (49.39%), Query Frame = 1
Query:  937 AQFDLISGHSGAVYEMSWSKNQQLLISASSDGTVKCWRTATKDCMTTFSAPGPIWSVDLSPLSENLLVCGTNKESINVYALDHPDPIRQFSRDIHGAVTCVRFHGNDNYIASGGVDRTVRLFDIRSGTLVRSFTGHKGIVSSLRFSLDGKYLISGCEMGKVNIW 1428
            A+   I+GH+ A+ +  W  N Q ++SA+ D T++ W   T + + T S    + S++  P  E L++  T   +I  Y     D I+  + D   ++     H + ++  +GG D  +  +D  +   + S+ GH G V  +RFS DG+   SG E G + +W
Sbjct:  134 AEPQEIAGHTSAIKKALWCNNDQQILSAADDKTIRLWDKNTNEAVKTLSFDASVSSMEYIPDGETLVI--TYGRTIAFYNAHSLDLIK--TVDAPASIHSASLHPDKDFFVAGGDDFKLYKYDYTTKEEMESYKGHFGPVHCVRFSPDGELYASGSEDGTLRLW 293          

HSP 2 Score: 50.0618 bits (118), Expect = 5.497e-6
Identity = 46/169 (27.22%), Postives = 78/169 (46.15%), Query Frame = 1
Query:  898 TSCRDYPPDNADNAQFDLIS---GHSGAVYEMSWSKNQQLLISASSDGTVKCWRTATKDCMTTFSAPGPIWSVDLSPLSENLLVCGTNKESINVYALDHPDPIRQFSRDIHGAVTCVRFHGNDNYIASGGVDRTVRLFDIRSGTLVRSFTGHKGIVSSLRFSLDGKYLI 1395
            ++C+D  P        D I    GH GAV+  + +       +A++D T K W   T D + T +    + SV+ +  S N L+ G N + + +Y L  P+   Q       A+    +  ND  I S   D+T+RL+D  +   V++ +     VSS+ +  DG+ L+
Sbjct:   34 SACKDGKPMLRQGDTGDWIGTFLGHKGAVWGATLNTEATKAATAAADFTAKVWDAVTGDEVLTLAHKHIVKSVNFTQDS-NYLLTGGNDKVLRIYDLSKPEAEPQEIAGHTSAIKKALWCNNDQQILSAADDKTIRLWDKNTNEAVKTLS-FDASVSSMEYIPDGETLV 200          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Zebrafish
Match: gnb4b (guanine nucleotide binding protein (G protein), beta polypeptide 4b [Source:ZFIN;Acc:ZDB-GENE-041114-167])

HSP 1 Score: 77.7962 bits (190), Expect = 5.470e-15
Identity = 52/165 (31.52%), Postives = 79/165 (47.88%), Query Frame = 1
Query:  952 ISGHSGAVYEMSWSKNQQLLISASSDGTVKCWRTATKDCMTTFSAPGP-IWSVDLSPLSENLLVCGTNKESINVYALDHPDPIRQFSRDIHGA---VTCVRFHGNDNYIASGGVDRTVRLFDIRSGTLVRSFTGHKGIVSSLRFSLDGKYLISGCEMGKVNIWDL 1434
            + GH   +Y M W  + +LL+SAS DG +  W   T + M         + +   +P S N + CG      + Y+L   +   + +R++ G    ++C RF  ++  I S G D T  L+DI +G    SFTGH G V SL  S D K  +SG       +WD+
Sbjct:   51 LRGHLAKIYAMHWGSDSRLLVSASQDGKLIIWDGYTTNKMHAIPLRSSWVMTCAYAP-SGNYVACGGLDNICSTYSLKTREGNVRVNRELAGHTGYLSCCRFLDDNQIITSSG-DTTCALWDIETGQQTTSFTGHTGDVMSLSVSPDSKTFVSGACDASAKLWDI 213          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Xenopus
Match: myadm (myeloid-associated differentiation marker [Source:Xenbase;Acc:XB-GENE-966240])

HSP 1 Score: 149.828 bits (377), Expect = 2.694e-37
Identity = 93/296 (31.42%), Postives = 146/296 (49.32%), Query Frame = 1
Query:  922 DNADNAQFDLISGHSGAVYEMSWSKNQQLLISASSDGTVKCWRTATKDCMTTFSAPG-PIWSVDLSPLSENLLVCGTNKESINVYALDHPDPIRQFSRDIHGAVTCVRFHGNDNYIASGGVDRTVRLFDIRSGTLVRSFTGHKGIVSSLRFSLDGKYLISGCEMGKVNIWDLTSSNWLLKSLSSDDYSGNSRGAVMNMDLCRNLQLLVVGRREGQIDVWDYRALIGSNAEQQGRSYETNQFGSSLCTETDSDESMLYLVTDPRRAGLCDTLYTKTFPVMALQFNRRDILHCCVFYS 1806
            D   +++  ++ GHSG VY  S+S ++  L+S+S DGT++ W   T  C+  +     P+W    SP      V G +     ++A DH  P+R F+  +   V C RFH N NYIA+G  DRTVRL+D+ +G  VR FTGHKG + SL F+ +GK+L +G   G+V +WD+         L   +  G++   V  +   R+ ++L  G  +  + +WD          +     +T+ F SS       + S   L+          T  TK+ PV+ L F RR++L     Y+
Sbjct:  500 DEKSSSEMKVLYGHSGPVYATSFSPDRNYLLSSSEDGTIRLWSLQTFTCLVAYKGHNYPVWDTQFSPYG-YYFVSGGHDRVARLWATDHYQPLRIFAGHL-ADVICTRFHPNSNYIATGSTDRTVRLWDVLNGNCVRIFTGHKGPIHSLAFTPNGKFLATGASDGRVLLWDIG------HGLMVGELKGHT-NTVYALRFSRDGEILSSGSMDNTVRLWD--------TVKAFEDLDTDDFTSSAGHINFHENSQDLLLG---------TFMTKSTPVIHLHFTRRNLLLAAGAYT 769          

HSP 2 Score: 82.8037 bits (203), Expect = 8.868e-16
Identity = 49/160 (30.63%), Postives = 85/160 (53.12%), Query Frame = 1
Query:  157 YSEFY----KFVKNSSTIHHPQLRVFLYPVFVHIYFHLLSTGQTDQANKFLTRFAKSQEIIYKRDILDLQMFPLSCGDGH----NCLLDIFRANKFAVRISRLSWEYVQQNFLENKIMKDLSNLINENLKIDLIEKFPRNEMEIDCCRGGFSGESIPEEN 612
            Y E+Y    +F+++    H  +L    YP+FVH+Y  L+      +A  F  +F   QE  Y+    DL++       GH      +LD FR +KF +RISR S++ ++++ L+ +    + +++ E+L ID+ +  PR++ +ID   G  SGE+  E N
Sbjct:  191 YEEYYSGLKRFIESVLDCHRAELSQLFYPLFVHMYLELVYNQHEQKAKSFFEKFHGDQECYYED---DLRILASLSKKGHMMGNETILD-FRTSKFVLRISRDSYQLLKRH-LQERQNNQIWSIVQEHLYIDIFDGMPRSKQQIDAMVGSLSGEAKREAN 345          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Xenopus
Match: myadm (myeloid-associated differentiation marker [Source:Xenbase;Acc:XB-GENE-966240])

HSP 1 Score: 149.828 bits (377), Expect = 2.965e-37
Identity = 93/296 (31.42%), Postives = 146/296 (49.32%), Query Frame = 1
Query:  922 DNADNAQFDLISGHSGAVYEMSWSKNQQLLISASSDGTVKCWRTATKDCMTTFSAPG-PIWSVDLSPLSENLLVCGTNKESINVYALDHPDPIRQFSRDIHGAVTCVRFHGNDNYIASGGVDRTVRLFDIRSGTLVRSFTGHKGIVSSLRFSLDGKYLISGCEMGKVNIWDLTSSNWLLKSLSSDDYSGNSRGAVMNMDLCRNLQLLVVGRREGQIDVWDYRALIGSNAEQQGRSYETNQFGSSLCTETDSDESMLYLVTDPRRAGLCDTLYTKTFPVMALQFNRRDILHCCVFYS 1806
            D   +++  ++ GHSG VY  S+S ++  L+S+S DGT++ W   T  C+  +     P+W    SP      V G +     ++A DH  P+R F+  +   V C RFH N NYIA+G  DRTVRL+D+ +G  VR FTGHKG + SL F+ +GK+L +G   G+V +WD+         L   +  G++   V  +   R+ ++L  G  +  + +WD          +     +T+ F SS       + S   L+          T  TK+ PV+ L F RR++L     Y+
Sbjct:  506 DEKSSSEMKVLYGHSGPVYATSFSPDRNYLLSSSEDGTIRLWSLQTFTCLVAYKGHNYPVWDTQFSPYG-YYFVSGGHDRVARLWATDHYQPLRIFAGHL-ADVICTRFHPNSNYIATGSTDRTVRLWDVLNGNCVRIFTGHKGPIHSLAFTPNGKFLATGASDGRVLLWDIG------HGLMVGELKGHTN-TVYALRFSRDGEILSSGSMDNTVRLWD--------TVKAFEDLDTDDFTSSAGHINFHENSQDLLLG---------TFMTKSTPVIHLHFTRRNLLLAAGAYT 775          

HSP 2 Score: 83.5741 bits (205), Expect = 5.079e-16
Identity = 49/160 (30.63%), Postives = 85/160 (53.12%), Query Frame = 1
Query:  157 YSEFY----KFVKNSSTIHHPQLRVFLYPVFVHIYFHLLSTGQTDQANKFLTRFAKSQEIIYKRDILDLQMFPLSCGDGH----NCLLDIFRANKFAVRISRLSWEYVQQNFLENKIMKDLSNLINENLKIDLIEKFPRNEMEIDCCRGGFSGESIPEEN 612
            Y E+Y    +F+++    H  +L    YP+FVH+Y  L+      +A  F  +F   QE  Y+    DL++       GH      +LD FR +KF +RISR S++ ++++ L+ +    + +++ E+L ID+ +  PR++ +ID   G  SGE+  E N
Sbjct:  191 YEEYYSGLKRFIESVLDCHRAELSQLFYPLFVHMYLELVYNQHEQKAKSFFEKFHGDQECYYED---DLRILASLSKKGHMMGNETILD-FRTSKFVLRISRDSYQLLKRH-LQERQNNQIWSIVQEHLYIDIFDGMPRSKQQIDAMVGSLSGEAKREAN 345          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Xenopus
Match: myadm (myeloid-associated differentiation marker [Source:Xenbase;Acc:XB-GENE-966240])

HSP 1 Score: 149.443 bits (376), Expect = 3.345e-37
Identity = 93/296 (31.42%), Postives = 146/296 (49.32%), Query Frame = 1
Query:  922 DNADNAQFDLISGHSGAVYEMSWSKNQQLLISASSDGTVKCWRTATKDCMTTFSAPG-PIWSVDLSPLSENLLVCGTNKESINVYALDHPDPIRQFSRDIHGAVTCVRFHGNDNYIASGGVDRTVRLFDIRSGTLVRSFTGHKGIVSSLRFSLDGKYLISGCEMGKVNIWDLTSSNWLLKSLSSDDYSGNSRGAVMNMDLCRNLQLLVVGRREGQIDVWDYRALIGSNAEQQGRSYETNQFGSSLCTETDSDESMLYLVTDPRRAGLCDTLYTKTFPVMALQFNRRDILHCCVFYS 1806
            D   +++  ++ GHSG VY  S+S ++  L+S+S DGT++ W   T  C+  +     P+W    SP      V G +     ++A DH  P+R F+  +   V C RFH N NYIA+G  DRTVRL+D+ +G  VR FTGHKG + SL F+ +GK+L +G   G+V +WD+         L   +  G++   V  +   R+ ++L  G  +  + +WD          +     +T+ F SS       + S   L+          T  TK+ PV+ L F RR++L     Y+
Sbjct:  479 DEKSSSEMKVLYGHSGPVYATSFSPDRNYLLSSSEDGTIRLWSLQTFTCLVAYKGHNYPVWDTQFSPYG-YYFVSGGHDRVARLWATDHYQPLRIFAGHL-ADVICTRFHPNSNYIATGSTDRTVRLWDVLNGNCVRIFTGHKGPIHSLAFTPNGKFLATGASDGRVLLWDIG------HGLMVGELKGHTN-TVYALRFSRDGEILSSGSMDNTVRLWD--------TVKAFEDLDTDDFTSSAGHINFHENSQDLLL---------GTFMTKSTPVIHLHFTRRNLLLAAGAYT 748          

HSP 2 Score: 83.5741 bits (205), Expect = 4.118e-16
Identity = 49/160 (30.63%), Postives = 85/160 (53.12%), Query Frame = 1
Query:  157 YSEFY----KFVKNSSTIHHPQLRVFLYPVFVHIYFHLLSTGQTDQANKFLTRFAKSQEIIYKRDILDLQMFPLSCGDGH----NCLLDIFRANKFAVRISRLSWEYVQQNFLENKIMKDLSNLINENLKIDLIEKFPRNEMEIDCCRGGFSGESIPEEN 612
            Y E+Y    +F+++    H  +L    YP+FVH+Y  L+      +A  F  +F   QE  Y+    DL++       GH      +LD FR +KF +RISR S++ ++++ L+ +    + +++ E+L ID+ +  PR++ +ID   G  SGE+  E N
Sbjct:  164 YEEYYSGLKRFIESVLDCHRAELSQLFYPLFVHMYLELVYNQHEQKAKSFFEKFHGDQECYYED---DLRILASLSKKGHMMGNETILD-FRTSKFVLRISRDSYQLLKRH-LQERQNNQIWSIVQEHLYIDIFDGMPRSKQQIDAMVGSLSGEAKREAN 318          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Xenopus
Match: rxfp3 (relaxin family peptide receptor 3 [Source:Xenbase;Acc:XB-GENE-478939])

HSP 1 Score: 138.272 bits (347), Expect = 6.265e-34
Identity = 123/488 (25.20%), Postives = 224/488 (45.90%), Query Frame = 1
Query:  154 QYSEFYKFVKNSSTIHHPQLRVFLYPVFVHIYFHLLSTGQTDQANKFLTRF-AKSQEIIYKRDILDLQMFPLSCGDGH-NCLLDIFRANKFAVRISRLSWEYVQQNFLENKIMKDLSNLINENLKIDLIEKFPRNEMEIDCCRGGFS-GESIPEENLLVFDPDL---SVIDLQDPNIKRSK--PSAMTSQKRRLIERKCEESSTLEDVTDQLSFDSILHGVGGLGNSVGICAAFSKDCDFLAVGTVTGDIYVNWHRTSCR--DYPPDNADNAQFDLISGHSGAVYEMSWSKNQQLLISASSDGTVKCWRTATKDCMTTFSAPG-PIWSVDLSPLSENLLVCGTNKESINVYALDHPDPIRQFSRDIHGAVTCVRFHGNDNYIASGGVDRTVRLFDIRSGTLVRSFTGHKGIVSSLRFSLDGKYLISGCEMGKVNIWDLTSSNWLLKSLSSDDYSGNSRGAVMNMDLCRNLQLLVVGRREGQIDVWDYR 1584
            Q++    F+ ++ + H  ++   LYP+FV+++  ++        + F +RF     +   +RDI++     ++  D H NC L  F  NK+ V +   S+ Y+ + FL++     L   +  ++++D ++   R E ++    G  S GE+   +   V  P L   + +D     IK+ K  P ++T+          +  +T E     +S DS L   G   + V + +  SK      +      + V+  R +C   +   D     +  ++ GHSG VY   +  +   L+S S D +++ W          +     P+W +D+SP S       ++  +  ++  D   P+R ++  +   V C++FH N NY+A+G  D+TVRL+  + G  VR FTGH+G V +L FS +GKYL S  E  ++ +WDL S   L K L    ++ N    + ++    +  L+     +  + VWD R
Sbjct:   73 QFARLRNFLSDADSPHSQEVTTLLYPLFVYLHLDMVQNSLKSAVDSFYSRFHGMFMQHPGQRDIVEQLQTTMTMQDIHSNCKLRAFLDNKYVVCLQEDSYHYLLR-FLQSDNNTALCKALALHIQLD-VQPVKRTEYQLYNSMGSSSRGENNSLDQSDVPTPILQNEAALDQLQDCIKKVKDGPPSLTTISFYAFYNTEQLLNTAE-----ISPDSRLLAAGFDSSCVKLWSLKSKK-----LKAEPHKVDVSRIRLACDVLEEEEDEQAGTEMKILRGHSGPVYRTCFLSDSSGLLSCSEDTSIRYWNLENFTNTVLYQGHAHPVWDLDVSPCSL-FFASASHDRTGRLWCFDRTFPLRIYAGHL-SDVDCIKFHPNSNYLATGSTDKTVRLWSTQQGNSVRLFTGHRGPVLALAFSPNGKYLASAGEDQRLKLWDLASGT-LYKELRG--HTDN----ISSLTFSPDSSLIASASMDNSVRVWDIR 539          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Xenopus
Match: rxfp3 (relaxin family peptide receptor 3 [Source:Xenbase;Acc:XB-GENE-478939])

HSP 1 Score: 132.88 bits (333), Expect = 3.154e-32
Identity = 122/485 (25.15%), Postives = 221/485 (45.57%), Query Frame = 1
Query:  163 EFYKFVKNSSTIHHPQLRVFLYPVFVHIYFHLLSTGQTDQANKFLTRF-AKSQEIIYKRDILDLQMFPLSCGDGH-NCLLDIFRANKFAVRISRLSWEYVQQNFLENKIMKDLSNLINENLKIDLIEKFPRNEMEIDCCRGGFS-GESIPEENLLVFDPDL---SVIDLQDPNIKRSK--PSAMTSQKRRLIERKCEESSTLEDVTDQLSFDSILHGVGGLGNSVGICAAFSKDCDFLAVGTVTGDIYVNWHRTSCR--DYPPDNADNAQFDLISGHSGAVYEMSWSKNQQLLISASSDGTVKCWRTATKDCMTTFSAPG-PIWSVDLSPLSENLLVCGTNKESINVYALDHPDPIRQFSRDIHGAVTCVRFHGNDNYIASGGVDRTVRLFDIRSGTLVRSFTGHKGIVSSLRFSLDGKYLISGCEMGKVNIWDLTSSNWLLKSLSSDDYSGNSRGAVMNMDLCRNLQLLVVGRREGQIDVWDYR 1584
            E    + ++ + H  ++   LYP+FV+++  ++        + F +RF     +   +RDI++     ++  D H NC L  F  NK+ V +   S+ Y+ + FL++     L   +  ++++D ++   R E ++    G  S GE+   +   V  P L   + +D     IK+ K  P ++T+          +  +T E     +S DS L   G   + V + +  SK      +      + V+  R +C   +   D     +  ++ GHSG VY   +  +   L+S S D +++ W          +     P+W +D+SP S       ++  +  ++  D   P+R ++  +   V C++FH N NY+A+G  D+TVRL+  + G  VR FTGH+G V +L FS +GKYL S  E  ++ +WDL S   L K L    ++ N    + ++    +  L+     +  + VWD R
Sbjct:   41 EMAANLTDADSPHSQEVTTLLYPLFVYLHLDMVQNSLKSAVDSFYSRFHGMFMQHPGQRDIVEQLQTTMTMQDIHSNCKLRAFLDNKYVVCLQEDSYHYLLR-FLQSDNNTALCKALALHIQLD-VQPVKRTEYQLYNSMGSSSRGENNSLDQSDVPTPILQNEAALDQLQDCIKKVKDGPPSLTTISFYAFYNTEQLLNTAE-----ISPDSRLLAAGFDSSCVKLWSLKSK-----KLKAEPHKVDVSRIRLACDVLEEEEDEQAGTEMKILRGHSGPVYRTCFLSDSSGLLSCSEDTSIRYWNLENFTNTVLYQGHAHPVWDLDVSPCSL-FFASASHDRTGRLWCFDRTFPLRIYAGHL-SDVDCIKFHPNSNYLATGSTDKTVRLWSTQQGNSVRLFTGHRGPVLALAFSPNGKYLASAGEDQRLKLWDLASGT-LYKELRG--HTDN----ISSLTFSPDSSLIASASMDNSVRVWDIR 504          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Mouse
Match: Taf5 (TATA-box binding protein associated factor 5 [Source:MGI Symbol;Acc:MGI:2442144])

HSP 1 Score: 149.443 bits (376), Expect = 3.205e-37
Identity = 93/296 (31.42%), Postives = 147/296 (49.66%), Query Frame = 1
Query:  922 DNADNAQFDLISGHSGAVYEMSWSKNQQLLISASSDGTVKCWRTATKDCMTTFSAPG-PIWSVDLSPLSENLLVCGTNKESINVYALDHPDPIRQFSRDIHGAVTCVRFHGNDNYIASGGVDRTVRLFDIRSGTLVRSFTGHKGIVSSLRFSLDGKYLISGCEMGKVNIWDLTSSNWLLKSLSSDDYSGNSRGAVMNMDLCRNLQLLVVGRREGQIDVWDYRALIGSNAEQQGRSYETNQFGSSLCTETDSDESMLYLVTDPRRAGLCDTLYTKTFPVMALQFNRRDILHCCVFYS 1806
            D    ++  ++ GHSG VY  S+S ++  L+S+S DGTV+ W   T  C+  +     P+W    SP      V G +     ++A DH  P+R F+  +   V C RFH N NY+A+G  DRTVRL+D+ +G  VR FTGHKG + SL FS +G++L +G   G+V +WD+         L   +  G++   V ++   R+ ++L  G  +  + +WD        A +     ET+ F ++       + S   L+          T  TK+ PV+ L F RR+++     YS
Sbjct:  530 DEKTASELKILYGHSGPVYGASFSPDRNYLLSSSEDGTVRLWSLQTFTCLVGYKGHNYPVWDTQFSPYG-YYFVSGGHDRVARLWATDHYQPLRIFAGHL-ADVNCTRFHPNSNYVATGSADRTVRLWDVLNGNCVRIFTGHKGPIHSLTFSPNGRFLATGATDGRVLLWDIG------HGLMVGELKGHT-DTVCSLRFSRDGEILASGSMDNTVRLWD--------AVKAFEDLETDDFTTATGHINLPENSQELLL---------GTYMTKSTPVVHLHFTRRNLVLAAGAYS 799          

HSP 2 Score: 86.2705 bits (212), Expect = 5.043e-17
Identity = 50/157 (31.85%), Postives = 85/157 (54.14%), Query Frame = 1
Query:  157 YSEFYK----FVKNSSTIHHPQLRVFLYPVFVHIYFHLLSTGQTDQANKFLTRFAKSQEIIYKRDILDL-QMFPLSCGDGHNCLLDIFRANKFAVRISRLSWEYVQQNFLENKIMKDLSNLINENLKIDLIEKFPRNEMEIDCCRGGFSGESIPEEN 612
            Y E+Y     F++ S   H  +L    YP+FVH+Y  L+     ++A  F  +F   QE  Y+ D+  L  +       G+  +LD FR +KF +RISR S++ ++++ L+ K    + N++ E+L ID+ +  PR++ +ID   G  +GE+  E N
Sbjct:  215 YEEYYSGLKHFIECSLDCHRAELSQLFYPLFVHMYLELVYNQHENEAKSFFEKFHGDQECYYQDDLRVLSSLTKKEHMKGNETMLD-FRTSKFVLRISRDSYQLLKRH-LQEKQNNQIWNIVQEHLYIDIFDGMPRSKQQIDAMVGSLAGEAKREAN 369          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Mouse
Match: Taf5l (TATA-box binding protein associated factor 5 like [Source:MGI Symbol;Acc:MGI:1919039])

HSP 1 Score: 139.043 bits (349), Expect = 2.688e-34
Identity = 125/489 (25.56%), Postives = 221/489 (45.19%), Query Frame = 1
Query:  154 QYSEFYKFVKNSSTIHHPQLRVFLYPVFVHIYFHLLSTGQTDQANKFLTRFAKS--QEIIYKRDILDLQMFPLSCGDGHNCLLDIFRANKFAVRISRLSWEYVQQNFLENKIMKDLSNLINENLKIDLIEKFPRNEMEIDCCRGGFSGESIPEENLLVFDPDL---SVIDLQDPNIKRSK--PSAMTSQKRRLIERKCEESSTLEDVTDQLSFDSILHGVGGLGNSVGICAAFSKDCDFLAVGTVTGDIYVNWHRTSCRDYPPDNADNAQFDLISGHSGAVYEMSWSKNQQLLISASSDGTVKCWRTATKDCMTTFSAPG-PIWSVDLSPLSENLLVCGTNKESINVYALDHPDPIRQFSRDIHGAVTCVRFHGNDNYIASGGVDRTVRLFDIRSGTLVRSFTGHKGIVSSLRFSLDGKYLISGCEMGKVNIWDLTSSNWLLKSLSSDDYSGNSRG---AVMNMDLCRNLQLLVVGRREGQIDVWDYRA 1587
            Q+     F+ +S + +  ++   LYP+FV+++ +L+ +G       F +RF     Q    K  I  LQ          N  L  F  NK+ VR+   S+ Y+ + +L++     L  ++  ++ +D ++   R + ++    G    E+   E   V  P L   + +++   +IKR K  P ++T+    +       +  L + T ++S DS L   G   + + + +  SK          T  I +        +   DN    +  ++ GH G VY   +  +   L+S S D +++ W   +      +     P+W VD+SP S      G++  +  +++ D   P+R ++  +   V CV+FH N NY+A+G  D+TVRL+  + G  VR FTGH+G V SL FS +GKYL S  E  ++ +WDL S   L K L         RG   ++ ++    +  L+     +  + VWD R+
Sbjct:   73 QFGRLRSFLTDSDSQYSREVMPLLYPLFVYLHLNLVQSGPKSTVESFYSRFHGMFLQNASQKDVIEQLQTTQTIQDILSNFQLRAFLDNKYVVRLQEDSYNYLIR-YLQSDNNTALCKVLAVHIHLD-VQPAKRTDYQLYASGGSSRTENSSLEPPEVPSPILQNEAALEVLQESIKRVKDGPPSLTT----ICFYAFYNTEQLLN-TAEISSDSKLLAAGFDNSCIKLWSLRSKKLKSEPHHVDTSRIRLACDTLEEEENEEDNT-GTEMKILRGHCGPVYSTRFLADSSGLLSCSEDMSIRYWDLGSFTNTVLYQGHAYPVWDVDISPFSL-YFASGSHDRTARLWSFDRTYPLRIYAGHL-ADVDCVKFHPNSNYLATGSTDKTVRLWSAQQGNSVRLFTGHRGPVLSLSFSPNGKYLASAGEDQRLKLWDLASGT-LFKEL---------RGHTDSITSLAFSPDSGLIASASMDNSVRVWDIRS 541          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Mouse
Match: Taf5l (TATA-box binding protein associated factor 5 like [Source:MGI Symbol;Acc:MGI:1919039])

HSP 1 Score: 139.043 bits (349), Expect = 2.688e-34
Identity = 125/489 (25.56%), Postives = 221/489 (45.19%), Query Frame = 1
Query:  154 QYSEFYKFVKNSSTIHHPQLRVFLYPVFVHIYFHLLSTGQTDQANKFLTRFAKS--QEIIYKRDILDLQMFPLSCGDGHNCLLDIFRANKFAVRISRLSWEYVQQNFLENKIMKDLSNLINENLKIDLIEKFPRNEMEIDCCRGGFSGESIPEENLLVFDPDL---SVIDLQDPNIKRSK--PSAMTSQKRRLIERKCEESSTLEDVTDQLSFDSILHGVGGLGNSVGICAAFSKDCDFLAVGTVTGDIYVNWHRTSCRDYPPDNADNAQFDLISGHSGAVYEMSWSKNQQLLISASSDGTVKCWRTATKDCMTTFSAPG-PIWSVDLSPLSENLLVCGTNKESINVYALDHPDPIRQFSRDIHGAVTCVRFHGNDNYIASGGVDRTVRLFDIRSGTLVRSFTGHKGIVSSLRFSLDGKYLISGCEMGKVNIWDLTSSNWLLKSLSSDDYSGNSRG---AVMNMDLCRNLQLLVVGRREGQIDVWDYRA 1587
            Q+     F+ +S + +  ++   LYP+FV+++ +L+ +G       F +RF     Q    K  I  LQ          N  L  F  NK+ VR+   S+ Y+ + +L++     L  ++  ++ +D ++   R + ++    G    E+   E   V  P L   + +++   +IKR K  P ++T+    +       +  L + T ++S DS L   G   + + + +  SK          T  I +        +   DN    +  ++ GH G VY   +  +   L+S S D +++ W   +      +     P+W VD+SP S      G++  +  +++ D   P+R ++  +   V CV+FH N NY+A+G  D+TVRL+  + G  VR FTGH+G V SL FS +GKYL S  E  ++ +WDL S   L K L         RG   ++ ++    +  L+     +  + VWD R+
Sbjct:   73 QFGRLRSFLTDSDSQYSREVMPLLYPLFVYLHLNLVQSGPKSTVESFYSRFHGMFLQNASQKDVIEQLQTTQTIQDILSNFQLRAFLDNKYVVRLQEDSYNYLIR-YLQSDNNTALCKVLAVHIHLD-VQPAKRTDYQLYASGGSSRTENSSLEPPEVPSPILQNEAALEVLQESIKRVKDGPPSLTT----ICFYAFYNTEQLLN-TAEISSDSKLLAAGFDNSCIKLWSLRSKKLKSEPHHVDTSRIRLACDTLEEEENEEDNT-GTEMKILRGHCGPVYSTRFLADSSGLLSCSEDMSIRYWDLGSFTNTVLYQGHAYPVWDVDISPFSL-YFASGSHDRTARLWSFDRTYPLRIYAGHL-ADVDCVKFHPNSNYLATGSTDKTVRLWSAQQGNSVRLFTGHRGPVLSLSFSPNGKYLASAGEDQRLKLWDLASGT-LFKEL---------RGHTDSITSLAFSPDSGLIASASMDNSVRVWDIRS 541          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Mouse
Match: Katnb1 (katanin p80 (WD40-containing) subunit B 1 [Source:MGI Symbol;Acc:MGI:1921437])

HSP 1 Score: 83.5741 bits (205), Expect = 2.720e-16
Identity = 64/212 (30.19%), Postives = 99/212 (46.70%), Query Frame = 1
Query:  952 ISGHSGAVYEMSWSK-NQQLLISASSDGTVKCWRTATKDCMTTFSA-PGPIWSVDLSPLSENLLVCGTNKESINVYALDHPDPIRQFSRDIHGAVTC-VRFHGNDNYIASGGVDRTVRLFDIRSGTLVRSFTGHKGIVSSLRFSLDGKYLISGCEMGKVNIWDLTSSNWLLKSLSSDDYSGNSRGAVMNMDLCRNLQLLVVGRREGQIDVWD 1578
            I  H+  V  +   K + +LL +   D  V  W     +C+ + +    P+ SV L+   E L+V G+   SI V+ L+    +R      H A  C + FH    ++ASG  D  ++L+DIR    V  + GH   V  LRFS DGK+L S  +   V +WDLT+   +       ++ G++ G V  ++   N  LL  G  +  I  WD
Sbjct:   16 IVAHASNVSSLVLGKASGRLLATGGDDCRVNLWSINKPNCIMSLTGHTSPVESVRLN-TPEELIVAGSQSGSIRVWDLEAAKILRTLMG--HKANICSLDFHPYGEFVASGSQDTNIKLWDIRRKGCVFRYRGHSQAVRCLRFSPDGKWLASAADDHTVKLWDLTAGKMM------SEFPGHT-GPVNVVEFHPNEYLLASGSSDRTIRFWD 217          

HSP 2 Score: 72.7886 bits (177), Expect = 8.237e-13
Identity = 43/162 (26.54%), Postives = 80/162 (49.38%), Query Frame = 1
Query:  952 ISGHSGAVYEMSWSKNQQLLISASSDGTVKCWR-TATKDCMTTFSAPGPIWSVDLSPLSENLLVCGTNKESINVYALDHPDPIRQFSRDIHGAVTCVRFHGNDNYIASGGVDRTVRLFDIRSGTLVRSFTGHKGIVSSLRFSLDGKYLISGCEMGKVNIWDL 1434
            ++GH+  V  +  +  ++L+++ S  G+++ W   A K   T       I S+D  P  E  +  G+   +I ++ +     + ++ R    AV C+RF  +  ++AS   D TV+L+D+ +G ++  F GH G V+ + F  +   L SG     +  WDL
Sbjct:   59 LTGHTSPVESVRLNTPEELIVAGSQSGSIRVWDLEAAKILRTLMGHKANICSLDFHPYGE-FVASGSQDTNIKLWDIRRKGCVFRY-RGHSQAVRCLRFSPDGKWLASAADDHTVKLWDLTAGKMMSEFPGHTGPVNVVEFHPNEYLLASGSSDRTIRFWDL 218          

HSP 3 Score: 60.077 bits (144), Expect = 6.476e-9
Identity = 40/153 (26.14%), Postives = 67/153 (43.79%), Query Frame = 1
Query:  952 ISGHSGAVYEMSWSKNQQLLISASSDGTVKCWRTATKDCMTTFSAPG-PIWSVDLSPLSENLLVCGTNKESINVYALDHPDPIRQFSRDIHGAVTCVRFHGNDNYIASGGVDRTVRLFDIRSGTLVRSFTGHKGIVSSLRFSLDGKYLISGCE 1407
            + GH   +  + +    + + S S D  +K W    K C+  +      +  +  SP     L    +  ++ ++ L     + +F     G V  V FH N+  +ASG  DRT+R +D+    +V    G  G V S+ F+ DG  L SGC+
Sbjct:  101 LMGHKANICSLDFHPYGEFVASGSQDTNIKLWDIRRKGCVFRYRGHSQAVRCLRFSP-DGKWLASAADDHTVKLWDLTAGKMMSEFPGHT-GPVNVVEFHPNEYLLASGSSDRTIRFWDLEKFQVVSCIEGEPGPVRSVLFNPDGCCLYSGCQ 251          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Mouse
Match: Gnb2 (guanine nucleotide binding protein (G protein), beta 2 [Source:MGI Symbol;Acc:MGI:95784])

HSP 1 Score: 77.7962 bits (190), Expect = 1.091e-15
Identity = 50/168 (29.76%), Postives = 82/168 (48.81%), Query Frame = 1
Query:  952 ISGHSGAVYEMSWSKNQQLLISASSDGTVKCWRTATKDCMTTFSAPGP-IWSVDLSPLSENLLVCGTNKESINVYALDHPDPIRQFSRDI---HGAVTCVRFHGNDNYIASGGVDRTVRLFDIRSGTLVRSFTGHKGIVSSLRFSLDGKYLISGCEMGKVNIWDLTSS 1443
            + GH   +Y M W  + +LL+SAS DG +  W + T + +         + +   +P S N + CG      ++Y+L   +   + SR++    G ++C RF  ++  I S G D T  L+DI +G     F GH G V SL  + DG+  +SG     + +WD+  S
Sbjct:   51 LRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAP-SGNFVACGGLDNICSIYSLKTREGNVRVSRELPGHTGYLSCCRFLDDNQIITSSG-DTTCALWDIETGQQTVGFAGHSGDVMSLSLAPDGRTFVSGACDASIKLWDVRDS 216          
BLAST of WD_REPEATS_REGION domain-containing protein vs. UniProt/SwissProt
Match: sp|P49846|TAF5_DROME (Transcription initiation factor TFIID subunit 5 OS=Drosophila melanogaster OX=7227 GN=Taf5 PE=1 SV=1)

HSP 1 Score: 172.94 bits (437), Expect = 1.769e-44
Identity = 157/618 (25.40%), Postives = 267/618 (43.20%), Query Frame = 1
Query:  157 YSEFYKFVKNSSTIHHPQLRVFLYPVFVHIYFHLLSTGQTDQANKFLTRFAKSQEIIYKRDILDLQMFPLSCGDGHNCLLDIFRANKFAVRISRLSWEYVQQNFLENKIMKDLSNLINENLKIDLIEKFPRNEMEIDCCRGGFSGESIPEEN-LLVFDPDLSVIDLQ---------------------------------------DPN---IKR-SKPSAMTSQKRRLIERKCEESSTLEDVTDQLS---FDSILHGVGGLGNSVGICAAFSKDCDFLAVGTVTGDIYVNWHRT-----------SCRDYPPDNAD-NAQF---------DLISGHSGAVYEMSWSKNQQLLISASSDGTVKCWRTATKDCMTTFSAPG-PIWSVDLSPLSENLLVCGTNKESINVYALDHPDPIRQFSRDIHGAVTCVRFHGNDNYIASGGVDRTVRLFDIRSGTLVRSFTGHKGIVSSLRFSLDGKYLISGCEMGKVNIWDLTSSNWLLKSLSSDDYSGNSRGAVMNMDLCRNLQLLVVGRREGQIDVWDYRALIGSNAEQQGRSYETNQFGSSLCTETDSDESMLYLVTDPRRAGLCDTLYTKTFPVMALQFNRRDILHCCVFY 1803
            Y E   FV++S  I+  +L + LYP+ V IYF +L++G  ++A +F+ ++    +  Y   + +L +         N L+     +KF +R+SR S    +++ ++++  + +++++++ L  D  E   RN+++     G   GE+  ++N + V+   L  +D Q                                       DPN   I R   P    S K   ++   E S  L    DQL    F ++L+   G+      CA  S D   LA G     + + W  T           S R+   ++AD N +            + GH+G VY  +++    LL+S S D T++ W   T  C+ T+     P+W V  +P     + C  +K +  ++A D    +R F   +   V CV+FH N NY+A+G  DRTVRL+D  +G  VR  TGHKG VSSL FS  G+YL SG     + IWDL++ + +   L            V  +   R+  +L     +  + +WD+  +           Y +N    ++    D ++  +YL+          T  +K  P ++L F RR++L C   +
Sbjct:  120 YKELRTFVEDSLDIYKHELSMVLYPILVQIYFKILASGLREKAKEFIEKYKCDLDGYYIEGLFNLLLLSKPEELLENDLVVAMEQDKFVIRMSRDSHSLFKRH-IQDRRQEVVADIVSKYLHFDTYEGMARNKLQCVATAGSHLGEAKRQDNKMRVYYGLLKEVDFQTLTTPAPAPEEEDDDPDAPDRPKKKKPKKDPLLSKKSKSDPNAPSIDRIPLPELKDSDKLLKLKALREASKRLALSKDQLPSAVFYTVLNSHQGV-----TCAEISDDSTMLACGFGDSSVRI-WSLTPAKLRTLKDADSLRELDKESADINVRMLDDRSGEVTRSLMGHTGPVYRCAFAPEMNLLLSCSEDSTIRLWSLLTWSCVVTYRGHVYPVWDVRFAPHGYYFVSCSYDK-TARLWATDSNQALRVFVGHL-SDVDCVQFHPNSNYVATGSSDRTVRLWDNMTGQSVRLMTGHKGSVSSLAFSACGRYLASGSVDHNIIIWDLSNGSLVTTLL-------RHTSTVTTITFSRDGTVLAAAGLDNNLTLWDFHKVT--------EDYISNHI--TVSHHQDENDEDVYLMR---------TFPSKNSPFVSLHFTRRNLLMCVGLF 702          
BLAST of WD_REPEATS_REGION domain-containing protein vs. UniProt/SwissProt
Match: sp|O13282|TAF5_SCHPO (Transcription initiation factor TFIID subunit 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=taf5 PE=1 SV=1)

HSP 1 Score: 148.673 bits (374), Expect = 1.652e-36
Identity = 135/603 (22.39%), Postives = 252/603 (41.79%), Query Frame = 1
Query:  151 DQYSEFYK----FVKNSSTIHHPQLRVFLYPVFVHIYFHLLSTGQTDQANKFLTRFAKSQEIIYKRDILDLQMFPLSCGDGHNCLLDIFRANKFAVRISRLSWEYVQQNFLENK------IMKDLSNLINENLKIDLIEKFPR--NEMEIDCCRGGFSGES-----------------IPEENLLVFDPDLSVIDLQDPNIKRSKPSAMTSQKRRLIERKCEES-----------------STLEDVTD---------QLSFDSILHGVGGLGNSVGICAAFSKDCDFLAVGTVTGDIYVNWHRTSCRDYPPDNA---DNAQFDLISGHSGAVYEMSWSKNQQLLISASSDGTVKCWRTATKDCMTTFSA-PGPIWSVDLSPLSENLLVCGTNKESINVYALDHPDPIRQFSRDIHGAVTCVRFHGNDNYIASGGVDRTVRLFDIRSGTLVRSFTGHKGIVSSLRFSLDGKYLISGCEMGKVNIWDLTSSNWLLKSLSSDDYSGNSRGAVMNMDLCRNLQLLVVGRREGQIDVWDYRALIGSNAEQQGRSYETNQFGSSLCTETDSDESMLYLVTDPRRAGLCDTLYTKTFPVMALQFNRRDI 1782
            D Y+  Y     +V +S  ++  +L   L+P+FVH Y +LLS    + A +F   F      ++  D+ +L+   L      +     +R NK+ +  SR++++ +     EN       I+K    LIN+++ I ++   P      ++   + G +G+S                 + +E   + + DL   D+   N   ++   +  + R+L E   E++                 S +E V D         + S  S+        N+   CA FS D   +A G     I +   +   +  P   +    +    L+S HSG VY  ++S + + L+S S D + + W   TK  +  +    GP+W V   P   +     ++ ++  +++ DH  P+R F+  +   V CV FH N  Y+ +G  D+T RL+D+  G  VR F GH   V+++  + DG  + S    G +++WD+ +    +K++         RG + ++   R   +LV G  +  +  WD   +  +N      S  T    +    +T +   + +  +  +       LYTK  P+  + F RR++
Sbjct:   55 DAYTHTYTILRDWVDSSLELYKAELHRILFPIFVHSYLNLLSQDHYEAAKQFYELFKDDHTDLHDFDVKNLKSLSLPSHVAEDRTAQQYRQNKYQLHFSRITFDLLLHFLFENVSNGGSIIIK----LINQHIDIHIVPGRPTVLENAKVINEQEGITGQSFERGDAQLQPVKLQQMPMDKEMEKIVEMDLEEEDMMHQNDPNNQSPKLLKEFRKLHEPNAEDAPSRDYIPLPPHKGVDILSEVEAVKDWSKRLHLGPRASLPSVCMYTFHHTNNNMNCAEFSPDSTMIACGFQESYIRLWSIKADKKSLPKSTSVEDSDGSVRLLS-HSGPVYGTTFSPDNKYLLSCSEDASARLWSVDTKTALVAYKGHTGPVWDVAFGPFG-HYFATASHDQTAQLWSCDHIYPLRVFAGHL-SDVDCVTFHPNSAYVLTGSSDKTCRLWDVHRGHSVRVFNGHTQPVTAVAIAPDGHTMASADSEGLIHLWDIGTGR-RIKTMR------GHRGNIYSLSFSRESTVLVSGGSDCTVRAWD---VFKTNYNNPVSSSLTGSVVTPFSAKTSTFNEVNWSTSPDQMVA----LYTKQTPIFNVSFTRRNL 636          
BLAST of WD_REPEATS_REGION domain-containing protein vs. UniProt/SwissProt
Match: sp|Q15542|TAF5_HUMAN (Transcription initiation factor TFIID subunit 5 OS=Homo sapiens OX=9606 GN=TAF5 PE=1 SV=3)

HSP 1 Score: 149.058 bits (375), Expect = 3.431e-36
Identity = 93/296 (31.42%), Postives = 147/296 (49.66%), Query Frame = 1
Query:  922 DNADNAQFDLISGHSGAVYEMSWSKNQQLLISASSDGTVKCWRTATKDCMTTFSAPG-PIWSVDLSPLSENLLVCGTNKESINVYALDHPDPIRQFSRDIHGAVTCVRFHGNDNYIASGGVDRTVRLFDIRSGTLVRSFTGHKGIVSSLRFSLDGKYLISGCEMGKVNIWDLTSSNWLLKSLSSDDYSGNSRGAVMNMDLCRNLQLLVVGRREGQIDVWDYRALIGSNAEQQGRSYETNQFGSSLCTETDSDESMLYLVTDPRRAGLCDTLYTKTFPVMALQFNRRDILHCCVFYS 1806
            D    ++  ++ GHSG VY  S+S ++  L+S+S DGTV+ W   T  C+  +     P+W    SP      V G +     ++A DH  P+R F+  +   V C RFH N NY+A+G  DRTVRL+D+ +G  VR FTGHKG + SL FS +G++L +G   G+V +WD+         L   +  G++   V ++   R+ ++L  G  +  + +WD        A +     ET+ F ++       + S   L+          T  TK+ PV+ L F RR+++     YS
Sbjct:  529 DEKTASELKILYGHSGPVYGASFSPDRNYLLSSSEDGTVRLWSLQTFTCLVGYKGHNYPVWDTQFSPYG-YYFVSGGHDRVARLWATDHYQPLRIFAGHL-ADVNCTRFHPNSNYVATGSADRTVRLWDVLNGNCVRIFTGHKGPIHSLTFSPNGRFLATGATDGRVLLWDIG------HGLMVGELKGHT-DTVCSLRFSRDGEILASGSMDNTVRLWD--------AIKAFEDLETDDFTTATGHINLPENSQELLL---------GTYMTKSTPVVHLHFTRRNLVLAAGAYS 798          

HSP 2 Score: 86.6557 bits (213), Expect = 2.491e-16
Identity = 53/173 (30.64%), Postives = 92/173 (53.18%), Query Frame = 1
Query:  157 YSEFYK----FVKNSSTIHHPQLRVFLYPVFVHIYFHLLSTGQTDQANKFLTRFAKSQEIIYKRDILDL-QMFPLSCGDGHNCLLDIFRANKFAVRISRLSWEYVQQNFLENKIMKDLSNLINENLKIDLIEKFPRNEMEIDCCRGGFSGESIPEENL------LVFDPDLSV 642
            Y E+Y     F++ S   H  +L    YP+FVH+Y  L+     ++A  F  +F   QE  Y+ D+  L  +       G+  +LD FR +KF +RISR S++ ++++ L+ K    + N++ E+L ID+ +  PR++ +ID   G  +GE+  E N       L+ +P++ V
Sbjct:  214 YEEYYSGLKHFIECSLDCHRAELSQLFYPLFVHMYLELVYNQHENEAKSFFEKFHGDQECYYQDDLRVLSSLTKKEHMKGNETMLD-FRTSKFVLRISRDSYQLLKRH-LQEKQNNQIWNIVQEHLYIDIFDGMPRSKQQIDAMVGSLAGEAKREANKSKVFFGLLKEPEIEV 384          
BLAST of WD_REPEATS_REGION domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8C092|TAF5_MOUSE (Transcription initiation factor TFIID subunit 5 OS=Mus musculus OX=10090 GN=Taf5 PE=1 SV=1)

HSP 1 Score: 148.288 bits (373), Expect = 6.278e-36
Identity = 92/296 (31.08%), Postives = 147/296 (49.66%), Query Frame = 1
Query:  922 DNADNAQFDLISGHSGAVYEMSWSKNQQLLISASSDGTVKCWRTATKDCMTTFSAPG-PIWSVDLSPLSENLLVCGTNKESINVYALDHPDPIRQFSRDIHGAVTCVRFHGNDNYIASGGVDRTVRLFDIRSGTLVRSFTGHKGIVSSLRFSLDGKYLISGCEMGKVNIWDLTSSNWLLKSLSSDDYSGNSRGAVMNMDLCRNLQLLVVGRREGQIDVWDYRALIGSNAEQQGRSYETNQFGSSLCTETDSDESMLYLVTDPRRAGLCDTLYTKTFPVMALQFNRRDILHCCVFYS 1806
            D    ++  ++ GHSG VY  S+S ++  L+S+S DGTV+ W   T  C+  +     P+W    SP      V G +     ++A DH  P+R F+  +   V C R+H N NY+A+G  DRTVRL+D+ +G  VR FTGHKG + SL FS +G++L +G   G+V +WD+         L   +  G++   V ++   R+ ++L  G  +  + +WD        A +     ET+ F ++       + S   L+          T  TK+ PV+ L F RR+++     YS
Sbjct:  530 DEKTASELKILYGHSGPVYGASFSPDRNYLLSSSEDGTVRLWSLQTFTCLVGYKGHNYPVWDTQFSPYG-YYFVSGGHDRVARLWATDHYQPLRIFAGHL-ADVNCTRYHPNSNYVATGSADRTVRLWDVLNGNCVRIFTGHKGPIHSLTFSPNGRFLATGATDGRVLLWDIG------HGLMVGELKGHT-DTVCSLRFSRDGEILASGSMDNTVRLWD--------AVKAFEDLETDDFTTATGHINLPENSQELLL---------GTYMTKSTPVVHLHFTRRNLVLAAGAYS 799          

HSP 2 Score: 83.9593 bits (206), Expect = 1.847e-15
Identity = 52/173 (30.06%), Postives = 91/173 (52.60%), Query Frame = 1
Query:  157 YSEFYK----FVKNSSTIHHPQLRVFLYPVFVHIYFHLLSTGQTDQANKFLTRFAKSQEIIYKRDILDL-QMFPLSCGDGHNCLLDIFRANKFAVRISRLSWEYVQQNFLENKIMKDLSNLINENLKIDLIEKFPRNEMEIDCCRGGFSGESIPEENL------LVFDPDLSV 642
            Y E+Y     F++ S   H  +L    YP+FVH+Y  L+     ++A  F  +F   QE  Y+ D+  L  +       G+  +LD FR +KF +RI R S++ ++++ L+ K    + N++ E+L ID+ +  PR++ +ID   G  +GE+  E N       L+ +P++ V
Sbjct:  215 YEEYYSGLKHFIECSLDCHRAELSQLFYPLFVHMYLELVYNQHENEAKSFFEKFHGDQECYYQDDLRVLSSLTKKEHMKGNETMLD-FRTSKFVLRIYRDSYQLLKRH-LQEKQNNQIWNIVQEHLYIDIFDGMPRSKQQIDAMVGSLAGEAKREANKSKVFFGLLKEPEIEV 385          
BLAST of WD_REPEATS_REGION domain-containing protein vs. UniProt/SwissProt
Match: sp|O74319|TAF73_SCHPO (Transcription initiation factor TFIID subunit taf73 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=taf73 PE=1 SV=1)

HSP 1 Score: 145.976 bits (367), Expect = 1.301e-35
Identity = 131/534 (24.53%), Postives = 224/534 (41.95%), Query Frame = 1
Query:  196 IHHPQLRVFLYPVFVHIYFHLLSTGQTDQANKFLTRFAKSQEIIYKRDILDLQMFPLSCGDGHNCLLDIFRANKFAVRISRLSWEYVQQNFLENK------IMKDLSNLINENLKIDLIE-------------KFPRNEMEIDCCRGGFSGES-----------------IPEENLLVFDPDLSVIDLQDPNIKRSKPSAMTSQKRRLIERKCEES-----STLEDVTD------------------QLSFDSILHGVGGLGNSVGI-----------CAAFSKDCDFLAVGTVTGDIYVNWHRTSCRDYPPDNADNA--QFDLISGHSGAVYEMSWSKNQQLLISASSDGTVKCWRTATKDCMTTFSAP-GPIWSVDLSPLSENLLVCGTNKESINVYALDHPDPIRQFSRDIHGAVTCVRFHGNDNYIASGGVDRTVRLFDIRSGTLVRSFTGHKGIVSSLRFSLDGKYLISGCEMGKVNIWDLTSSNWLLKSLSSDDYSGNSRGAVMNMDLCRNLQLLVVGRREGQIDVWD 1578
            ++ P+L+  LYP+FVH Y  LL     + A  F   F    E+++  DI  L    ++       +  ++R NK+ +  +R +++ + Q   EN+      I++ L+  I+  + +  +E                +NE  I   + G  G S                 + EE +      L V D +D   +    + +    + L+E   E+      STLE  +D                  +   +S++ G      SV +           CAAFS D    A+G     I++ +  T+    P   + N   Q   + GH+  V+ +S S  ++ ++S S DG  + W   TK  +  ++    PIW V  SP         ++ ++  ++ ++H  P+R F       V CV FH N  Y+A+G  D T R++D+R+G  VR F  H   VS+L  S DG  L S  E G + +WDL SSN   + +S   +S      V ++    + ++LV G  +  ++ WD
Sbjct:   77 LYKPKLQKVLYPIFVHSYLDLLQKNDPEMAIYFFESFRIEHEVLHGYDIRALAQLKIASDVEEIEIAQLYRKNKYRINFTRSTFDLLVQFLFENEVNGSGIIIRLLNQYIDIKITMPQVEGKEDPNVQAVYEMDEAKNEQTIISEQEGIPGHSEQLLDYNKQSIQLGLRPLSEEVVTTLKNLLEVKD-KDVEGRNEALNKILHPAKNLVELLTEKENLINESTLESPSDPPLPPTKMKDIDYFVSLLESEQNSLILGKNATDPSVFMYTMHNTLSAVNCAAFSDDASMFALGCADSSIHL-YSSTNNGPQPLVGSQNEPLQKSSLIGHTRPVFGVSISPQKEFILSCSEDGFTRLWSKDTKSTIVKYAGHNAPIWDVQFSPFGY-YFATASHDQTARLWDVEHAAPLRVFVGH-QNDVDCVSFHPNAAYLATGSSDHTTRMWDVRTGGTVRVFNAHHSPVSALCMSADGLSLASADESGIIKVWDLRSSN---QHVSFVKHS----SIVYSLSFSYDNKILVSGGADTDVNFWD 599          
BLAST of WD_REPEATS_REGION domain-containing protein vs. TrEMBL
Match: A0A1J1J8S1 (CLUMA_CG020300, isoform A OS=Clunio marinus OX=568069 GN=CLUMA_CG020300 PE=4 SV=1)

HSP 1 Score: 217.238 bits (552), Expect = 3.505e-58
Identity = 185/678 (27.29%), Postives = 295/678 (43.51%), Query Frame = 1
Query:   31 DLLTLFELIGKYNLTETRIILK----------------CXXXXXXXXXXXXXXXXXDQYSEFYKFVKNSSTIHHPQLRVFLYPVFVHIYFHLLSTGQTDQANKFLTRFAKSQEIIYKRDILDLQMFPLSCGDGHNCLLDIFRANKFAVRISRLSWEYVQQNFLENKIMKDLSNLINENLKIDLIEKFPRNEMEIDCCRGGFSGESIPEENL------LVFDPDLSVIDLQDPNI-------------------------KRSK--PSAMTSQKRRLIE----RKCEESSTLEDVTDQLSFDSILHGVGGLGNSVGIC-------------AAFSKDCDFLAVGTVTGDIYVNWHRT--SCRDYPP-------------------DNADNAQFDLISGHSGAVYEMSWSKNQQLLISASSDGTVKCWRTATKDCMTTFSAP-GPIWSVDLSPLSENLLVCGTNKESINVYALDHPDPIRQFSRDIHGAVTCVRFHGNDNYIASGGVDRTVRLFDIRSGTLVRSFTGHKGIVSSLRFSLDGKYLISGCEMGKVNIWDLTSSNWLLKSLSSDDYSGNSRGAVMNMDLCRNLQLLVVGRREGQIDVWDYRA----LIGSNAEQQGRSYETNQFGSSLCTETDSDESMLYLVTDPRRAGLCDTLYTKTFPVMALQFNRRDILH 1788
            DLL + +++ KYNL  T  ILK                 +S +    S    +S    Y E  KFV +S  I+  +L + LYPVFVH+Y  L+  G  +QA K + +F   QE  Y+ D+  L+M         N L D F++N+F +RISR +   ++++  E K    + N++NE+L  DL E   RN+ + D   G   GE+  ++N       L+ + D   +  Q P                           K+SK  P+A +S +  + +     K E+   L +   +++         G  N   +C             A  S+D   LA+G     I + W  T    R+  P                   D+       +  GH+G VY  S++ ++ LL+S S D T++ W   T  C+  +     P+W V  SP     + C  +K +  ++  D   P+R F+  +   V C  FH N NY+A+G  DRTVRL+D+ SG  VR  TGHKG + SL FS+DG+YL+SG    +V +WDL   + L+ SL      G++   + ++   R+  +L  G  +  +++WD+      L+G N               ++    D  +   YL+          T  TK  P + L F RR++L+
Sbjct:    6 DLLAVLQVLKKYNLKGTETILKQEANLTDLPENFNHDASDSVLQAYQSEGDPNSYESCYIELLKFVDSSLDIYKYELSMILYPVFVHMYIELVYNGHEEQAKKLMKKFGPEQEYYYQSDLKKLEMITKRDQMSGNDLTDTFKSNEFIIRISRDTLSLLKRHLQEKK-ASVVMNIVNEHLYFDLYEGVARNKKQCDATAGAILGEARRQDNKVKVYYGLLKETDFQQMTTQAPPPEEDDDEGPDSDKPKKKKQKKDSLFSKKSKTDPNAPSSDRIPIPQLRDNDKAEKIRALREAQKRVNL--------GPDNLPSVCYYTLLNSIYSVTSAEISEDSSLLAIGFSDSTIKI-WSLTPSKLRELKPAEMLKEIDRDVDDVLVRMMDDRKAETSRVFHGHTGPVYRCSFTFDRSLLLSCSEDSTIRLWSLQTWSCLVVYKGHLNPVWDVKFSPHGHYFVSCSHDK-TARIWTTDSHQPLRIFTGHL-ADVDCCVFHPNSNYVATGSSDRTVRLWDVLSGNHVRLMTGHKGPIYSLAFSIDGRYLVSGSSDTRVLVWDLAHGH-LIASL-----EGHT-STIHSLCFSRDGTILATGALDCNLNIWDFSKLCDDLVGENV--------------NVSHNPDVKKGEQYLLR---------TFPTKQSPFLTLHFTRRNLLY 641          
BLAST of WD_REPEATS_REGION domain-containing protein vs. TrEMBL
Match: R7T522 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_225253 PE=4 SV=1)

HSP 1 Score: 214.927 bits (546), Expect = 2.681e-57
Identity = 184/665 (27.67%), Postives = 294/665 (44.21%), Query Frame = 1
Query:   34 LLTLFELIGKYNLTETRIILKCXXXXXXXXXXXXXXXX--------------XDQYSEFY----KFVKNSSTIHHPQLRVFLYPVFVHIYFHLLSTGQTDQANKFLTRFAKSQEIIYKRDILDLQMFPLSCGDGHNCLLDIFRANKFAVRISRLSWEYVQQNFLENKIMKDLSNLINENLKIDLIEKFPRNEMEIDCCRGGFSGESI---------------PEENLLVFDPD-------------------LSVIDLQDPN---IKRSKPSAMTSQ----KRRLIERKCEESSTLEDVTDQLSFDSILHGVGGLGNSVGICAAFSKDCDFLAVGTVTGDIYVNWHRTSCR-------------DYPPDNADNAQFD--------LISGHSGAVYEMSWSKNQQLLISASSDGTVKCWRTATKDCMTTFSAPG-PIWSVDLSPLSENLLVCGTNKESINVYALDHPDPIRQFSRDIHGAVTCVRFHGNDNYIASGGVDRTVRLFDIRSGTLVRSFTGHKGIVSSLRFSLDGKYLISGCEMGKVNIWDLTSSNWLLKSLSSDDYSGNSRGAVMNMDLCRNLQLLVVGRREGQIDVWDYRALIGSNAEQQGRSYETNQFGSSLCTETDSDESMLYLVTDPRRAGLCDTLYTKTFPVMALQFNRRDIL 1785
            LL + +++ KYNL +T ++LK E+ +TE       S+                 +Y  FY     F++ S  IH  +L + LYPVFVH+Y  L+      QA +F  +F+  QE  Y+ D++ L     +     N LLD F+ +KF +R+SR S+ +++++ LE K +  L  +I ++L ID+ +  PR + +ID   GG  GE+                PE N+ V D D                   L+     DPN   + R     MT Q    K R  +      +   +    + F ++L+   G+  SV  C    +D   +A G     I V W  T  +             D   D+      D        L+ GHSGAVY  S++ ++  ++S S DGT++ W   T   +  +     P+W V  SPL    + CG ++ +  V++ DH  P+R FS  +   V  V+FH N NYIA+G  DRTV L+D+ +G  VR  TGHK  + SL FS  G+YL S      V IWDL + + L+  L         +  + ++   R   LL  G  +  + +W++  L+  +                   E +S   + +   +   A    +  TK+ P+++L F RR++L
Sbjct:    6 LLAVLQVLKKYNLKDTELLLKKEAHVTEDEVKAEPSASGVTDVLAAYKSEGDPRRYESFYSSLKNFIEKSLDIHKCELSMVLYPVFVHMYLELVYNHHEQQAIQFFYKFSADQEWYYQEDLVQLATVTKAEHMAGNQLLDNFKGSKFTIRMSRDSYNHLKRHLLEQK-LNILLTIIQDHLFIDVFDGVPRTKQQIDATAGGMCGEARREANKTKVLYGLLKEPEINITVEDEDEGQETDDKPKKKKAKKDSQLNKKQKHDPNAPQLTRIPLPEMTDQMKLEKARAFKEGLRRINLSAETLPSICFYTLLNSYHGV-TSVDFC----EDSSLMAAGFADSQIRV-WTMTPNKLRAIKTSDDLNIIDKEADDVYERLMDDRTSVDCRLLCGHSGAVYATSFTPDRTQMVSCSEDGTIRLWSLLTWSNLVCYKGHNFPVWDVHFSPLGHYFVSCGHDR-TARVWSTDHFQPLRIFSGHV-ADVDTVQFHPNCNYIATGSSDRTVCLWDLLNGNCVRVMTGHKAPIYSLIFSPCGRYLASAGADKNVLIWDLANGD-LISQLKG------HKDTIFSLCFSRGGALLASGGLDNIVRLWNFSKLLEDH-------------------ENESTVFVFFFYRNESSAYEIMSYPTKSTPILSLHFTRRNLL 635          
BLAST of WD_REPEATS_REGION domain-containing protein vs. TrEMBL
Match: A0A3B5AQR8 (TAF5 RNA polymerase II, TATA box binding protein (TBP)-associated factor OS=Stegastes partitus OX=144197 PE=4 SV=1)

HSP 1 Score: 215.698 bits (548), Expect = 8.861e-57
Identity = 172/615 (27.97%), Postives = 272/615 (44.23%), Query Frame = 1
Query:  157 YSEFYKFVKNSSTIHHPQLRVFLYPVFVHIYFHLLSTGQTDQANKFLTRFAKSQEIIYKRDILDLQ-MFPLSCGDGHNCLLDIFRANKFAVRISRLSWEYVQQNFLENKIMKDLSNLINENLKIDLIEKFPRNEMEIDCCRGGFSGESIPEENL------LVFDPDL-----------------------------SVIDLQDPNIKRSK----PSAMTSQKRRLIERKCEESSTLEDVTDQLS---FDSILHGVGGLGNSVGICAAFSKDCDFLAVGTVTGDIYVNWHRTSCR---------------------DYPPDNADNAQFDLISGHSGAVYEMSWSKNQQLLISASSDGTVKCWRTATKDCMTTFSAPG-PIWSVDLSPLSENLLVCGTNKESINVYALDHPDPIRQFSRDIHGAVTCVRFHGNDNYIASGGVDRTVRLFDIRSGTLVRSFTGHKGIVSSLRFSLDGKYLISGCEMGKVNIWDLTSSNWLLKSLSSDDYSGNSRGAVMNMDLCRNLQLLVVGRREGQIDVWDYRALIGSNAEQQGRSYETNQFGSSLCTETDSDESMLYLVTDPRRAGLCDTLYTKTFPVMALQFNRRDILHCCVFYS 1806
            YS   +F++     H  +L    YP+FVH+Y  L+     ++A  F  +F+  QE  Y+ D+  L  +       G+  LLD FR +KF +RISR S++ ++++ L+ +    + N+I E+L ID+ +  PR++ +ID   G  +GE+  E N       L+ +P++                             S    QDPN         P    S K   I    E +  +   TD L    F S L+   GL         F+ D   +A G     + V W  T  +                     +   D    ++  ++ GHSG VY +S+S ++  L+S+S DGTV+ W   T  C+  +     P+W    SP      V G +     ++A DH  P+R FS  +   +TC RFH N NY+A+G  DRT+RL+D+ +G  VR FTGHKG + +L FS +GK+L SG   G+V +WD+         L   +  G++   V ++   R+ +LL  G  +  + +WD        A +     ET+ F ++       D S   L+          T  TK+ PV+ L F RR++L     Y+
Sbjct:  199 YSGLKRFIETVLDCHRAELSQVFYPLFVHMYLELVYNNHENEAKAFFEKFSGDQECYYEDDLRVLSSLTKKEHMRGNETLLD-FRTSKFVLRISRDSYQLLKRH-LQERQNNQIWNIIQEHLYIDIFDGMPRSKSQIDAMSGSLAGEAKREANKAKVYYGLLKEPEIELPLDDEDEEAENEEGKPKKKKPKKDSMGSKSKKQDPNAPSQNRIPLPELKDSDKLDKIMYMKEATKRIRLGTDNLPSICFYSFLNAYQGL-----TAVDFTDDSSLIAGGFADSTVRV-WSVTPKKLRKVKSAADLNLIDKESDDVLERIMDEKTASESKILYGHSGPVYGISFSPDRNYLLSSSEDGTVRLWSLQTFTCLVGYKGHNYPVWDTQFSPYG-YYFVSGGHDRVARLWATDHYQPLRMFSGHL-ADITCTRFHPNSNYVATGSSDRTIRLWDVLNGNCVRIFTGHKGPIHALAFSPNGKFLASGATDGRVLLWDIG------HGLMVGELKGHA-DTVYSLRFSRDGELLASGSMDNTVRLWD--------AMKAFDDLETDDFTAATGHVHLQDNSQELLL---------GTYMTKSTPVIHLHFTRRNLLLAAGAYN 779          
BLAST of WD_REPEATS_REGION domain-containing protein vs. TrEMBL
Match: A0A3B4F605 (TAF5 RNA polymerase II, TATA box binding protein (TBP)-associated factor OS=Pundamilia nyererei OX=303518 PE=4 SV=1)

HSP 1 Score: 214.542 bits (545), Expect = 1.477e-56
Identity = 169/608 (27.80%), Postives = 272/608 (44.74%), Query Frame = 1
Query:  157 YSEFYKFVKNSSTIHHPQLRVFLYPVFVHIYFHLLSTGQTDQANKFLTRFAKSQEIIYKRDILDLQ-MFPLSCGDGHNCLLDIFRANKFAVRISRLSWEYVQQNFLENKIMKDLSNLINENLKIDLIEKFPRNEMEIDCCRGGFSGESIPEENL------LVFDPDL-----------------------------SVIDLQDPNIKRSK----PSAMTSQKRRLIERKCEESSTLEDVTDQLS---FDSILHGVGGLGNSVGICAAFSKDCDFLAVGTVTGDIYVNWHRTSCR---------------------DYPPDNADNAQFDLISGHSGAVYEMSWSKNQQLLISASSDGTVKCWRTATKDCMTTFSAPG-PIWSVDLSPLSENLLVCGTNKESINVYALDHPDPIRQFSRDIHGAVTCVRFHGNDNYIASGGVDRTVRLFDIRSGTLVRSFTGHKGIVSSLRFSLDGKYLISGCEMGKVNIWDLTSSNWLLKSLSSDDYSGNSRGAVMNMDLCRNLQLLVVGRREGQIDVWDYRALIGSNAEQQGRSYETNQFGSSLCTETDSDESMLYLVTDPRRAGLCDTLYTKTFPVMALQFNRRDIL 1785
            YS+  KF++     H  +L    YP+FVH+Y  L+      +A  F  +F+  QE  Y+ D+  L  +       G+  LLD FR +KF +RISR S++ ++++ L+ +    + N+I E+L ID+ +  PR++ +ID   G  +GE+  E N       L+ +P++                             S    QDPN         P    S K   I    E +  +   +D L    F + L+   GL         F+ D   +A G     + V W  T  +                     +   D    ++  ++ GHSG VY +S+S ++  L+S+S DGTV+ W   T  C+  +     P+W    SP      V G +     ++A DH  P+R FS  +   +TC RFH N NY+A+G  DRT+R++D+ SG  VR FTGHKG + SL FS +GK+L SG   G+V +WD+         L   +  G++   + ++   R+ ++L  G  +  + +WD        A +     ET+ F ++           ++L  D  +  L  T  TK+ PV+ L F RR++L
Sbjct:  169 YSDLKKFIETVLDCHRAELSQVFYPLFVHMYLELVYNNHESEAKAFFEKFSGDQECYYEEDLRVLSGLTKKEHMRGNETLLD-FRTSKFVLRISRDSYQLLKRH-LQERQNNQIWNIIQEHLYIDIFDGMPRSKSQIDAMSGSLAGEAKREANKTKVYYGLLKEPEIELPLDDEDEEAENEEGKPKKKKPKKDSMGSKSKKQDPNAPSQNRIPLPELKDSDKLDKIMYMKEATKRIRLGSDNLPSVCFYTFLNAYQGL-----TAVDFTDDSSLIAGGFADSTVRV-WSVTPKKLRKVKSAADLNLIDKESDDVLERIMDEKTASELKIMYGHSGPVYGISFSPDRNYLLSSSEDGTVRLWSLLTFTCLVAYKGHNYPVWDTQFSPYG-YYFVSGGHDRVARLWATDHYQPLRIFSGHL-ADITCTRFHPNSNYVATGSSDRTIRVWDVLSGNCVRIFTGHKGPIHSLAFSPNGKFLASGATDGRVLLWDIG------HGLMVGELKGHT-DTIYSLRFSRDGEILASGSMDNTVRLWD--------AMKAFDDLETDDFTAA--------TGHIHL-QDNSQELLLGTYTTKSTPVIHLHFTRRNLL 742          
BLAST of WD_REPEATS_REGION domain-containing protein vs. TrEMBL
Match: A0A1A7Y5S1 (TAF5 RNA polymerase II, TATA box binding protein (TBP)-associated factor OS=Iconisemion striatum OX=60296 GN=TAF5 PE=4 SV=1)

HSP 1 Score: 214.157 bits (544), Expect = 2.835e-56
Identity = 169/615 (27.48%), Postives = 274/615 (44.55%), Query Frame = 1
Query:  157 YSEFYKFVKNSSTIHHPQLRVFLYPVFVHIYFHLLSTGQTDQANKFLTRFAKSQEIIYKRDILDL-QMFPLSCGDGHNCLLDIFRANKFAVRISRLSWEYVQQNFLENKIMKDLSNLINENLKIDLIEKFPRNEMEIDCCRGGFSGESIPEENL------LVFDPDL-----------------------------SVIDLQDPNIKRSK----PSAMTSQKRRLIERKCEESSTLEDVTDQLS---FDSILHGVGGLGNSVGICAAFSKDCDFLAVGTVTGDIYVNWHRTSCR---------------------DYPPDNADNAQFDLISGHSGAVYEMSWSKNQQLLISASSDGTVKCWRTATKDCMTTFSAPG-PIWSVDLSPLSENLLVCGTNKESINVYALDHPDPIRQFSRDIHGAVTCVRFHGNDNYIASGGVDRTVRLFDIRSGTLVRSFTGHKGIVSSLRFSLDGKYLISGCEMGKVNIWDLTSSNWLLKSLSSDDYSGNSRGAVMNMDLCRNLQLLVVGRREGQIDVWDYRALIGSNAEQQGRSYETNQFGSSLCTETDSDESMLYLVTDPRRAGLCDTLYTKTFPVMALQFNRRDILHCCVFYS 1806
            YS   +F+++    H  +L    YP+FVH+Y  L+      +A  F  +F+  QE  Y++D+  L  +       G+  LLD FR +KF +RISR S++ ++++ L+ +    + N+I E+L ID+ +  PR++ +ID   G  +GE+  E N       L+ +P++                             S    QDPN         P    S K   I    E +  +   +D L    F + L+   GL         F+ D   +A G     + V W  T  +                     +   D    ++  ++ GHSG VY +S+S ++  L+S+S DGT++ W   T  C+  +     P+W    SP      V G +     ++A DH  P+R F+  + G +TC RFH N NY+A+G  DRT+RL+DI +G  VR FTGHKG + +L FS +GK+L SG   G+V +WD+         L   +  G++   V ++   R+ ++L  G  +  + +WD        A +     ET+ F ++       D S   L+          T  TK+ PV+ L F RR++L     Y+
Sbjct:  174 YSGLKRFIESVLDCHRAELSQLFYPLFVHMYLELVYNNHESEAKAFFDKFSGDQECYYEQDLRILCSLTKKEHMKGNETLLD-FRTSKFVLRISRDSYQLLKRH-LQERQNNQIWNIIQEHLYIDIFDGMPRSKSQIDTMSGSLAGEARREANKAKVYYGLLKEPEIELPLDDEDEEAENEEGKPKKKKPKKDSMGSKSKKQDPNAPSQTRIPLPELKDSDKLDKIMYMKESTKRIRLGSDNLPSICFYTFLNAYQGL-----TAVDFTDDSSLIAGGFADSTVRV-WSVTPKKLRKVKSAADLNLIDKESDDVLERIMDEKTASELKILYGHSGPVYGISFSPDRNYLLSSSEDGTIRLWSLQTFTCLVGYKGHNYPVWDTQFSPYGY-YFVSGGHDRVARLWATDHYQPLRIFAGHL-GDITCTRFHPNSNYVATGSSDRTIRLWDILNGNCVRIFTGHKGPIHTLAFSPNGKFLASGATDGRVLLWDIG------HGLMVGELKGHT-DTVYSLRFSRDGEILASGSMDNTVRLWD--------AMKAFDDLETDDFTAATGHIHLQDNSQELLLG---------TYMTKSTPVIHLHFTRRNLLLAAGAYN 754          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Cavefish
Match: taf5 (TATA-box binding protein associated factor 5 [Source:NCBI gene;Acc:103038729])

HSP 1 Score: 208.764 bits (530), Expect = 6.084e-58
Identity = 164/617 (26.58%), Postives = 274/617 (44.41%), Query Frame = 1
Query:  157 YSEFYKFVKNSSTIHHPQLRVFLYPVFVHIYFHLLSTGQTDQANKFLTRFAKSQEIIYKRDILDLQ-MFPLSCGDGHNCLLDIFRANKFAVRISRLSWEYVQQNFLENKIMKDLSNLINENLKIDLIEKFPRNEMEIDCCRGGFSGESIPEENL------LVFDPDLSV----------------------IDLQDPNIKRSKPSAMTSQKRRLIERKCEESSTLEDVT----------------DQLSFDSILHGVGGLGNSVGICAAFSKDCDFLAVGTVTGDIYVNWHRTSCR---------------------DYPPDNADNAQFDLISGHSGAVYEMSWSKNQQLLISASSDGTVKCWRTATKDCMTTFSAPG-PIWSVDLSPLSENLLVCGTNKESINVYALDHPDPIRQFSRDIHGAVTCVRFHGNDNYIASGGVDRTVRLFDIRSGTLVRSFTGHKGIVSSLRFSLDGKYLISGCEMGKVNIWDLTSSNWLLKSLSSDDYSGNSRGAVMNMDLCRNLQLLVVGRREGQIDVWDYRALIGSNAEQQGRSYETNQFGSSLCTETDSDESMLYLVTDPRRAGLCDTLYTKTFPVMALQFNRRDILHCCVFYS 1806
            YS   KF+++    H  +L    YP+FVH+Y  L+      +A  F  +F   QE  Y+ D+  L  +       G+  LLD FR ++F +RISR S++ ++++ L+ +    + N+I E+L ID+ +  PR++ +ID   G  +GE+  E+N       L+ +P++ V                       D      K+  P+A   Q+ R+   + ++S  L+ +                   + F + L+   GL         F+ D   LA G     + V W  T  +                     +   D    ++  ++ GHSG VY +S+S ++  L+S+S DGT++ W   T  C+  +     P+W    SP      V G +     ++A DH  P+R F+  +   +TC RFH N NY+A+G  DRT+RL+D+ +G  VR  TGHKG + SL FS +GKYL SG   G+V +WD+         L   +  G++   +  +   R+ ++L  G  +  + +WD        A +     ET+ F ++       D S   L+          T  +K+ PV+ L F RR++L     Y+
Sbjct:  146 YSGLKKFIESVLDCHRAELSQLFYPLFVHMYLELVYNNHESEAKSFFEKFNGDQECYYQDDLRVLSGLTKKEHMKGNETLLD-FRTSRFVLRISRDSYQLLKRH-LQERQNNQIWNIIQEHLYIDIFDGMPRSKSQIDSMSGSLAGEAKREDNKTKVYYGLLKEPEIEVPLDDEDEEAENEEGKPKKKKPKKDSMGSKSKKQDPNA--PQQNRIPLPELKDSDKLDKIMYMKEATKRIRLGPESLPSICFYTFLNAYQGL-----TAVDFTDDSSLLAGGFADSTVRV-WSVTPKKLRKVKSAADLGMIDKESDDVLERIMDEKTASECKILYGHSGPVYGVSFSPDRNYLLSSSEDGTIRLWSLQTFTCLVAYKGHNYPVWDTQFSPYG-YYFVSGGHDRVARLWATDHYQPLRMFAGHL-ADITCTRFHPNSNYVATGSADRTIRLWDVLNGHCVRVLTGHKGPIHSLAFSPNGKYLASGSTDGRVLLWDIG------HGLMIGELKGHT-DTIYALRFSRDGEILASGSMDNTVRLWD--------AIRAFDDVETDDFTAATGHVHLPDNSQELLLG---------TYLSKSTPVIHLHFTRRNLLLSAGAYN 726          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Cavefish
Match: taf5 (TATA-box binding protein associated factor 5 [Source:NCBI gene;Acc:103038729])

HSP 1 Score: 208.764 bits (530), Expect = 6.084e-58
Identity = 164/617 (26.58%), Postives = 274/617 (44.41%), Query Frame = 1
Query:  157 YSEFYKFVKNSSTIHHPQLRVFLYPVFVHIYFHLLSTGQTDQANKFLTRFAKSQEIIYKRDILDLQ-MFPLSCGDGHNCLLDIFRANKFAVRISRLSWEYVQQNFLENKIMKDLSNLINENLKIDLIEKFPRNEMEIDCCRGGFSGESIPEENL------LVFDPDLSV----------------------IDLQDPNIKRSKPSAMTSQKRRLIERKCEESSTLEDVT----------------DQLSFDSILHGVGGLGNSVGICAAFSKDCDFLAVGTVTGDIYVNWHRTSCR---------------------DYPPDNADNAQFDLISGHSGAVYEMSWSKNQQLLISASSDGTVKCWRTATKDCMTTFSAPG-PIWSVDLSPLSENLLVCGTNKESINVYALDHPDPIRQFSRDIHGAVTCVRFHGNDNYIASGGVDRTVRLFDIRSGTLVRSFTGHKGIVSSLRFSLDGKYLISGCEMGKVNIWDLTSSNWLLKSLSSDDYSGNSRGAVMNMDLCRNLQLLVVGRREGQIDVWDYRALIGSNAEQQGRSYETNQFGSSLCTETDSDESMLYLVTDPRRAGLCDTLYTKTFPVMALQFNRRDILHCCVFYS 1806
            YS   KF+++    H  +L    YP+FVH+Y  L+      +A  F  +F   QE  Y+ D+  L  +       G+  LLD FR ++F +RISR S++ ++++ L+ +    + N+I E+L ID+ +  PR++ +ID   G  +GE+  E+N       L+ +P++ V                       D      K+  P+A   Q+ R+   + ++S  L+ +                   + F + L+   GL         F+ D   LA G     + V W  T  +                     +   D    ++  ++ GHSG VY +S+S ++  L+S+S DGT++ W   T  C+  +     P+W    SP      V G +     ++A DH  P+R F+  +   +TC RFH N NY+A+G  DRT+RL+D+ +G  VR  TGHKG + SL FS +GKYL SG   G+V +WD+         L   +  G++   +  +   R+ ++L  G  +  + +WD        A +     ET+ F ++       D S   L+          T  +K+ PV+ L F RR++L     Y+
Sbjct:  146 YSGLKKFIESVLDCHRAELSQLFYPLFVHMYLELVYNNHESEAKSFFEKFNGDQECYYQDDLRVLSGLTKKEHMKGNETLLD-FRTSRFVLRISRDSYQLLKRH-LQERQNNQIWNIIQEHLYIDIFDGMPRSKSQIDSMSGSLAGEAKREDNKTKVYYGLLKEPEIEVPLDDEDEEAENEEGKPKKKKPKKDSMGSKSKKQDPNA--PQQNRIPLPELKDSDKLDKIMYMKEATKRIRLGPESLPSICFYTFLNAYQGL-----TAVDFTDDSSLLAGGFADSTVRV-WSVTPKKLRKVKSAADLGMIDKESDDVLERIMDEKTASECKILYGHSGPVYGVSFSPDRNYLLSSSEDGTIRLWSLQTFTCLVAYKGHNYPVWDTQFSPYG-YYFVSGGHDRVARLWATDHYQPLRMFAGHL-ADITCTRFHPNSNYVATGSADRTIRLWDVLNGHCVRVLTGHKGPIHSLAFSPNGKYLASGSTDGRVLLWDIG------HGLMIGELKGHT-DTIYALRFSRDGEILASGSMDNTVRLWD--------AIRAFDDVETDDFTAATGHVHLPDNSQELLLG---------TYLSKSTPVIHLHFTRRNLLLSAGAYN 726          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Cavefish
Match: taf5l (TATA-box binding protein associated factor 5 like [Source:NCBI gene;Acc:103041723])

HSP 1 Score: 120.168 bits (300), Expect = 4.778e-28
Identity = 74/218 (33.94%), Postives = 116/218 (53.21%), Query Frame = 1
Query:  937 AQFDLISGHSGAVYEMSWSKNQQLLISASSDGTVKCWRTATKDCMTTFSAPG-PIWSVDLSPLSENLLVCGTNKE-SINVYALDHPDPIRQFSRDIHGAVTCVRFHGNDNYIASGGVDRTVRLFDIRSGTLVRSFTGHKGIVSSLRFSLDGKYLISGCEMGKVNIWDLTSSNWLLKSLSSDDYSGNSRGAVMNMDLCRNLQLLVVGRREGQIDVWDYR 1584
            ++   + GH G VY  ++  +   L+S S D TV+ W   +   +  +     P+W VD+SP S  L  C  +++ +  ++      P+R ++  +   V CV+FH N NYIA+G  D+TVRL+  + G+ VR FTGH+G V SL FS +GKYL S  E  +V +WDL S   L K     D  G++  +VM++    +  L+     +  + VWD R
Sbjct:  345 SEIKTLRGHCGPVYRTAFLTDSSGLLSCSEDSTVRYWDLNSFTNVALYRGHAYPVWDVDVSPCS--LYFCTASQDRTARLWTFQRTYPLRLYAGHL-ADVDCVKFHPNSNYIATGSTDKTVRLWSTQQGSSVRLFTGHRGPVLSLAFSPNGKYLASAGEDQRVKLWDLASGT-LFK-----DLRGHT-DSVMSLSFSPDSALVASAALDNSVRVWDIR 552          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Cavefish
Match: strap (serine/threonine kinase receptor associated protein [Source:NCBI gene;Acc:111193019])

HSP 1 Score: 82.0333 bits (201), Expect = 1.593e-16
Identity = 49/165 (29.70%), Postives = 82/165 (49.70%), Query Frame = 1
Query:  934 NAQFDLISGHSGAVYEMSWSKNQQLLISASSDGTVKCWRTATKDCMTTFSAPGPIWSVDLSPLSENLLVCGTNKESINVYALDHPDPIRQFSRDIHGAVTCVRFHGNDNYIASGGVDRTVRLFDIRSGTLVRSFTGHKGIVSSLRFSLDGKYLISGCEMGKVNIW 1428
             A+   ISGH+ AV +  W  N Q ++SA+ D T++ W   T + + T S    + S++  P  E L++  T   +I  Y     DPI+  + D   ++     H + ++  +GG D  +  +D  +   + S+ GH G V  +RFS DG+   SG E G + +W
Sbjct:  133 EAEPQEISGHTSAVKKALWCNNDQQILSAADDRTIRLWDRNTGEAVKTLSFEASVSSMEYIPDGEILVI--TYGRTIAFYKAHTLDPIK--TVDAPASIHSASLHPDKDFFVAGGDDFKLYKYDYTTKEEMESYKGHFGPVHCVRFSPDGELYASGSEDGTLRLW 293          

HSP 2 Score: 59.6918 bits (143), Expect = 3.498e-9
Identity = 49/169 (28.99%), Postives = 81/169 (47.93%), Query Frame = 1
Query:  898 TSCRDYPPDNADNAQFDLIS---GHSGAVYEMSWSKNQQLLISASSDGTVKCWRTATKDCMTTFSAPGPIWSVDLSPLSENLLVCGTNKESINVYALDHPDPIRQFSRDIHGAVTCVRFHGNDNYIASGGVDRTVRLFDIRSGTLVRSFTGHKGIVSSLRFSLDGKYLI 1395
            ++C+D  P        D I    GH GAV+  + +K      +A++D + K W   T D + T +    + SV+ +  S N L+ G N + + +Y L  P+   Q       AV    +  ND  I S   DRT+RL+D  +G  V++ +  +  VSS+ +  DG+ L+
Sbjct:   34 SACKDGKPMLRQGDTGDWIGTFLGHKGAVWGATLNKEATKAATAAADFSAKVWDAVTGDEVLTLAHKHIVKSVNFTQDS-NCLLTGGNDKLLRIYDLSKPEAEPQEISGHTSAVKKALWCNNDQQILSAADDRTIRLWDRNTGEAVKTLS-FEASVSSMEYIPDGEILV 200          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Cavefish
Match: wdr5 (WD repeat domain 5 [Source:NCBI gene;Acc:103033424])

HSP 1 Score: 81.2629 bits (199), Expect = 2.771e-16
Identity = 57/195 (29.23%), Postives = 97/195 (49.74%), Query Frame = 1
Query:  952 ISGHSGAVYEMSWSKNQQLLISASSDGTVKCWRTATKDCMTTFSA-PGPIWSVDLSPLSENLLVCGTNKESINVYALD----------HPDPIR--QFSRD------------------IHGAVTCVRFHGNDNYIASGGVDRTVRLFDIRSGTLVRSFTGHKGIVSSL--RFSLD-GKYLISGCEMGKVNIWDL 1434
            ISGH   + +++WS +  LL+SAS D T+K W  ++  C+ T       ++  + +P S NL+V G+  ES+ ++ +           H DP+    F+RD                   +  V+ V+F  N  YI +  +D T++L+D   G  ++++TGHK     +   FS+  GK+++SG E   V IW+L
Sbjct:   83 ISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQS-NLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSPQLLLFNWDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNMVYIWNL 276          

HSP 2 Score: 62.3882 bits (150), Expect = 4.174e-10
Identity = 41/165 (24.85%), Postives = 78/165 (47.27%), Query Frame = 1
Query:  952 ISGHSGAVYEMSWSKNQQLLISASSDGTVKCWRTATKDCMTTFSA-----PGPIWSVDLSPLSENLLVCGTNKESINVYALDHPDPIRQFSRDIHGAVTCVRFHGNDNYIASGGVDRTVRLFDIRSGTLVRSFTGHKGIVSSLRFSLDGKYLISGCEMGKVNIWD 1431
            ++GH+ AV  + +S + + L S+S+D  +K W         T S          WS D      NLLV  ++ +++ ++ +     ++   +     V C  F+   N I SG  D +VR++D+++G  +++   H   VS++ F+ DG  ++S      +  WD
Sbjct:   41 LAGHTKAVSSVKFSPSGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSD-----SNLLVSASDDKTLKIWDVSSGKCLKTL-KGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSPQLLLFNWD 199          

HSP 3 Score: 50.447 bits (119), Expect = 2.957e-6
Identity = 36/138 (26.09%), Postives = 67/138 (48.55%), Query Frame = 1
Query: 1186 PDPIRQFSRDIH-GAVTCVRFHGNDNYIASGGVDRTVRLFDIRSGTLVRSFTGHKGIVSSLRFSLDGKYLISGCEMGKVNIWDLTSSNWLLKSLSSDDYSGNSRGAVMNMDLCRNL----QLLVVGRREGQIDVWDYR 1584
            P+   +F+   H  AV+ V+F  +  ++AS   D+ ++++    G   ++ +GHK  +S + +S D   L+S  +   + IWD++S    LK+L      G+S     N   C N      L+V G  +  + +WD +
Sbjct:   33 PNYTLKFTLAGHTKAVSSVKFSPSGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGK-CLKTL-----KGHS-----NYVFCCNFNPQSNLIVSGSFDESVRIWDVK 159          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Sea Lamprey
Match: taf5l (TAF5-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associated factor [Source:ZFIN;Acc:ZDB-GENE-030131-5987])

HSP 1 Score: 108.227 bits (269), Expect = 5.603e-25
Identity = 73/226 (32.30%), Postives = 115/226 (50.88%), Query Frame = 1
Query:  922 DNADNAQFDLISGHSGAVYEMSWSKNQQLLISASSDGTVKCW--RTATKDCMTTFSAPGPIWSVDLSPLSENLLVC-GTNKESINVYALDHPDPIRQFSRDIHGAVTCVRFHGNDNYIASGGVDRTVRLFDIRSGTLVRSFTGHKGIVSSLRFSLDGKYLISGCEMGKVNIWDLTSSNWLLKSL--SSDDYSGNSRGAVMNMDLCRNLQLLVVGRREGQIDVWDYR 1584
            +++  +    +  HSG VY + +      L+S S D +V+ W  RT T   +    A  P+W VD+S L   L  C G++  +  ++  +   P+R ++  +   V  VRFH N +Y+A+G  DRTVRL+  + G+  R FTGH+G V +L FS  G+ L SG E  +V +WD+  S  ++K L   SDD        +  +    +   L  G  +G + VWD R
Sbjct:  329 EDSKGSDVKTLRAHSGPVYAVRFLPGGAGLLSCSEDASVRFWDPRTFTNTAVYQGHAY-PVWDVDVSAL--GLYFCSGSHDRTARLWVPERAFPLRVYAGHV-SDVNVVRFHPNGSYVATGSADRTVRLWSAQQGSAARLFTGHRGAVLALAFSPGGRLLASGGEDQRVRLWDI-GSGAIVKELRGHSDD--------ITCLSFSPDGSALASGSSDGSVRVWDVR 541          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009560.1 (pep scaffold:Pmarinus_7.0:GL479618:22463:45788:1 gene:ENSPMAG00000008637.1 transcript:ENSPMAT00000009560.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 71.633 bits (174), Expect = 2.852e-14
Identity = 47/165 (28.48%), Postives = 79/165 (47.88%), Query Frame = 1
Query:  952 ISGHSGAVYEMSWSKNQQLLISASSDGTVKCWRTATKDCMTTFSAPGP-IWSVDLSPLSENLLVCGTNKESINVYALDHPDPIRQFSRDI---HGAVTCVRFHGNDNYIASGGVDRTVRLFDIRSGTLVRSFTGHKGIVSSLRFSLDGKYLISGCEMGKVNIWDL 1434
            + GH   +Y M W  + +LL+SAS DG +  W + T + +         + +   +P S + + CG      ++Y L   +   + SR++    G ++C RF  ++  I S G D T  L+DI +     +FTGH G V SL  + D +  +SG       +WD+
Sbjct:   51 LRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAP-SGSYVACGGLDNICSIYNLKTREGNVRVSRELPGHTGYLSCCRFLDDNQIITSSG-DTTCALWDIETAQQTTTFTGHTGDVMSLSLAPDSRTFVSGACDASAKLWDV 213          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Sea Lamprey
Match: strap (serine/threonine kinase receptor associated protein [Source:ZFIN;Acc:ZDB-GENE-040426-1110])

HSP 1 Score: 72.7886 bits (177), Expect = 3.996e-14
Identity = 47/165 (28.48%), Postives = 81/165 (49.09%), Query Frame = 1
Query:  934 NAQFDLISGHSGAVYEMSWSKNQQLLISASSDGTVKCWRTATKDCMTTFSAPGPIWSVDLSPLSENLLVCGTNKESINVYALDHPDPIRQFSRDIHGAVTCVRFHGNDNYIASGGVDRTVRLFDIRSGTLVRSFTGHKGIVSSLRFSLDGKYLISGCEMGKVNIW 1428
            +A+  L+SGH+  V   +W   ++L+IS + D T++ W  AT   + + + P    S++  P  E +++  T   +I  Y     + I+QF  +   ++     H       +GG D  +  FD  +G  + S+ GH G V  +RFS DG+   SG E G + +W
Sbjct:  133 DAEPQLLSGHTSGV-RRAWCTGEKLIISVADDKTIRLWDRATGTEVKSVTLPMSASSMEYLPNDEIVVI--TYSRTIAFYNALTLELIKQF--EASASINSASLHPEKECFIAGGEDFKLYKFDYTTGEELESYKGHFGPVHCVRFSPDGELYASGSEDGTLRLW 292          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Sea Lamprey
Match: POC1A (POC1 centriolar protein A [Source:HGNC Symbol;Acc:HGNC:24488])

HSP 1 Score: 73.559 bits (179), Expect = 4.820e-14
Identity = 44/161 (27.33%), Postives = 83/161 (51.55%), Query Frame = 1
Query:  952 ISGHSGAVYEMSWSKNQQLLISASSDGTVKCWRTATKDCMTTFSAPGP-IWSVDLSPLSENLLVCGTNKESINVYALDHPDPIRQFSRDIHGA-VTCVRFHGNDNYIASGGVDRTVRLFDIRSGTLVRSFTGHKGIVSSLRFSLDGKYLISGCEMGKVNIW 1428
            ++ HS  V    +S + +L++S S D TV+ W + +++C+ TF   G  +  VD  P    +   GT+  ++ V+ +     ++ +   +HGA V  + FH   NY+ +   D T+++ D+  G L  +  GH+G  +++ FS  G +  SG    +V +W
Sbjct:  140 LNQHSNWVRSAKFSPDGRLIVSGSDDRTVRVWDSNSRECVHTFYEHGGFVNQVDFHPSGTCIAAAGTDN-TVKVWDIRMNKLLQHY--QVHGAAVNSLSFHPTGNYLITASNDSTLKVLDLVEGRLFYTLHGHQGPATAVAFSRAGDFFASGGSDEQVMVW 297          

HSP 2 Score: 70.4774 bits (171), Expect = 4.675e-13
Identity = 57/230 (24.78%), Postives = 102/230 (44.35%), Query Frame = 1
Query:  949 LISGHSGAVYEMSWSKNQQLLISASSDGTVKCWRTATKDCMTTFSAPGP-IWSVDLSPLSENLLVCGTNKESINVYALDHPDPIRQFSRDIHGA-VTCVRFHGNDNYIASGGVDRTVRLFDIRSGTLVRSFTGHKGIVSSLRFSLDGKYLISGCEMGKVNIWDLTSSNWLLKSLSSDDYSGNSRGAVMNMDLCRNLQLLVVGRREGQIDVW-------DYRALIGSNAEQ 1611
            +   H+  V  +S+S + Q L++AS D ++K W    +  + + +     + S   SP    L+V G++  ++ V+  +  + +  F    HG  V  V FH +   IA+ G D TV+++DIR   L++ +  H   V+SL F   G YLI+      + + DL     L  +L         +G    +   R       G  + Q+ VW       DY  ++ S+ ++
Sbjct:   97 VFKAHTATVRSVSFSADGQSLVTASDDKSIKVWTVHRQKFLYSLNQHSNWVRSAKFSP-DGRLIVSGSDDRTVRVWDSNSRECVHTFYE--HGGFVNQVDFHPSGTCIAAAGTDNTVKVWDIRMNKLLQHYQVHGAAVNSLSFHPTGNYLITASNDSTLKVLDLVEGR-LFYTLH------GHQGPATAVAFSRAGDFFASGGSDEQVMVWKTNFDSVDYSEVLRSHKQR 316          

HSP 3 Score: 65.855 bits (159), Expect = 1.385e-11
Identity = 51/164 (31.10%), Postives = 79/164 (48.17%), Query Frame = 1
Query:  958 GHSGAVYEMSWSKNQQLLISASSDGTVKCWRTATKDCMTTFSA-PGPIWSVDLSPLSENLLVCGTNKESINVYALDHPDPIRQ---FSRDIHGA-VTCVRFHGNDNYIASGGVDRTVRLFDIRSGTLVRSFTGHKGIVSSLRFSLDGKYLISGCEMGKVNIWDL 1434
            GH  AV  + +S +  L++SAS D TV+ W  + K   T F A    + SV  S   ++L V  ++ +SI V+ +      RQ   +S + H   V   +F  +   I SG  DRTVR++D  S   V +F  H G V+ + F   G  + +      V +WD+
Sbjct:   58 GHKDAVMSVQFSPSGHLVVSASRDKTVRLWVPSVKGESTVFKAHTATVRSVSFSADGQSL-VTASDDKSIKVWTVH-----RQKFLYSLNQHSNWVRSAKFSPDGRLIVSGSDDRTVRVWDSNSRECVHTFYEHGGFVNQVDFHPSGTCIAAAGTDNTVKVWDI 215          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Sea Lamprey
Match: wdr61 (WD repeat domain 61 [Source:NCBI gene;Acc:393827])

HSP 1 Score: 68.5514 bits (166), Expect = 8.077e-13
Identity = 60/235 (25.53%), Postives = 109/235 (46.38%), Query Frame = 1
Query:  940 QFDLISGHSGAVYEMSWSKNQQ----LLISASSDGTVKCWRTATKDCMTTFSAPGP---IWSVDLSP---------LSENL----LVCGTNKESINVYALDHPDPIRQFSRDIHGAVTCVRFHGNDNYIASGGVDRTVRLFDIRSGTLVRSFTGHKGIVSSLRFSLDGKYLISGCEMGKVNIWDLTSSNWLLKSLSSDDYSGNSRGAVMNMDLCRNLQLLVVGRREGQIDVWDYR 1584
            QF     H  A++ ++W KN++     +I+ S D  VKCW+ A +     ++  G    + SVD+SP         L  NL    L CG+  ++I+        P+  +S         V F  +  ++++G     + +F I SG    +       + SL +S DGK+L SG   G +NI+D+++   LL +L +    G++   + ++    + QLL+    +G I ++D +
Sbjct:    8 QFKQEQAHEDAIWSVAWGKNEKDGTDNIITGSVDDLVKCWKWADEKLELQWTLEGHQLGVVSVDISPTGALAASSSLDANLRLWDLECGSELKTIDA------GPVDAWS---------VAFSPDSRFLSTGSHMGKINIFGIESGKKESTLDTRGKFILSLAYSPDGKHLASGAIDGIINIFDISTGK-LLHTLEAWARGGHAM-PIRSLTFSPDSQLLITASDDGYIKIYDVQ 225          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Yeast
Match: TAF5 (Subunit (90 kDa) of TFIID and SAGA complexes; involved in RNA polymerase II transcription initiation and in chromatin modification [Source:SGD;Acc:S000000402])

HSP 1 Score: 127.102 bits (318), Expect = 6.123e-31
Identity = 84/328 (25.61%), Postives = 150/328 (45.73%), Query Frame = 1
Query:  820 CAAFSKDCDFLAVGTVTGDIYV------NWHRTSCRDYPPDNADNAQFDLISGHSGAVYEMSWSKNQQLLISASSDGTVKCWRTATKDCMTTFSAPG-PIWSVDLSPLSENLLVCGTNKESINVYALDHPDPIRQFSRDIHGAVTCVRFHGNDNYIASGGVDRTVRLFDIRSGTLVRSFTGHKGIVSSLRFSLDGKYLISGCEMGKVNIWDLTSSNWLLKSLSSDDYSGNSRGAVMNMDLCRNLQLLVVGRREGQIDVWDYRALIGSNAEQQGRSYETNQFGSSLCTETDSDESMLYLVTDPRRAGLCDTLYTKTFPVMALQFNRRDI 1782
            C  FS DC   A G     I +      + +  +      D  ++     + GHSG VY  S+S + + L+S S D TV+ W   T   + ++     P+W V  SPL  +     ++ ++  +++ DH  P+R F+  ++  V CV FH N  Y+ +G  D+T R++D+ +G  VR F GH   V S+    DG++L +G E G +N+WD+ +   L +        G+ + A+ ++   +   +L+ G  +  + VWD +      + +    +       +     D  E        P  + L  + YTK  PV  ++F+R ++
Sbjct:  471 CLDFSDDCRIAAAGFQDSYIKIWSLDGSSLNNPNIALNNNDKDEDPTCKTLVGHSGTVYSTSFSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVSFSPLG-HYFATASHDQTARLWSCDHIYPLRIFAGHLND-VDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVISIAVCPDGRWLSTGSEDGIINVWDIGTGKRLKQ------MRGHGKNAIYSLSYSKEGNVLISGGADHTVRVWDLKKATTEPSAEPDEPFIGYLGDVTASINQDIKEYGRRRTVIP-TSDLVASFYTKKTPVFKVKFSRSNL 789          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Yeast
Match: DIP2 (Nucleolar protein; specifically associated with the U3 snoRNA, part of the large ribonucleoprotein complex known as the small subunit (SSU) processome, required for 18S rRNA biogenesis, part of the active pre-rRNA processing complex [Source:SGD;Acc:S000004119])

HSP 1 Score: 60.8474 bits (146), Expect = 4.321e-10
Identity = 49/172 (28.49%), Postives = 74/172 (43.02%), Query Frame = 1
Query:  922 DNADNAQFDLIS-GHSGAVYEMSWSKNQQLLISASSDGTVKCWRTATKDCMTTFSAPGPIWSVDLSPLSENLLVCGTNKESINVYALDHPDPIRQFSRDIHGAVTCVRFHGNDNYIASGGVDRTVRLFDIRSGTLVRSFTGHKGIVSSLRFSLDGKYLISGCEMGKVNIWDL 1434
            D A ++  D I   H  A++ +  + + + L++ S+D TVK W                          EN LV GT  + + V  L H D   + + DI     CVR   +D Y+A   +D TV++F + S     S  GHK  V S+  S D K +I+      + IW L
Sbjct:  458 DLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFKV----------------------ENSLVPGTKNKFLPVLKLHH-DTTLELTDDI----LCVRVSPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGL 602          

HSP 2 Score: 55.8398 bits (133), Expect = 1.735e-8
Identity = 39/154 (25.32%), Postives = 70/154 (45.45%), Query Frame = 1
Query: 1156 ESINVYALDHPDPIRQFS-------RDIHGA----VTCVRFHGNDNYIASGGVDRTVRLFDIRSGTLVRSFTGHKGIVSSLRFSLDGKYLISGCEMGKVNIWDLTSSNWLLKSLSSDDYSGNSRGAVMNMDLCRNLQLLVVGRREGQIDVWDYR 1584
            E +N++ +   D + + S        D  GA     T +  H + + +A G  D  ++++D+ S T++ +F GHK  ++ L+F   G  LISG +   + +WDL     L K  S  D         +    C+    L+   ++G I +WD +
Sbjct:   47 EDVNIWDIKTGDLVSKLSDGLPPGASDARGAKPAECTYLEAHKDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKD--------SITGFWCQGEDWLISTSKDGMIKLWDLK 192          

HSP 3 Score: 48.1358 bits (113), Expect = 3.458e-6
Identity = 36/160 (22.50%), Postives = 77/160 (48.12%), Query Frame = 1
Query: 1135 LVCGTNKESINVYALDH-------PDPIRQFSRDIHGAVTCVRFH--GNDNYIASGGVDRTVRLFDIRSGTLVRSFTGHKGIVSSLRFSLDGKYLISGCEMGKVNIWDLTSSNWLLKSLSSDDYSGNSRGAVMNMDLCRNLQLLVVGRREGQIDVWDYRA 1587
            LV  T+  +I  Y++ +       P P++  + ++ G  T VR     +DN + +   + ++++++I++   +R+F    G   + +F   G  +I G   G++ ++DL SS+ L      D        A+ ++DL  + + LV G  +  +  WD++ 
Sbjct:  353 LVLTTSSNTIEYYSIPYEKRDPTSPAPLKTHTIELQGQRTDVRSIDISDDNKLLATASNGSLKIWNIKTHKCIRTFEC--GYALTCKFLPGGLLVILGTRNGELQLFDLASSSLL------DTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFKV 504          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Yeast
Match: MDV1 (Peripheral protein of cytosolic face of mitochondrial outer membrane; required for mitochondrial fission; interacts with Fis1p and with the self-assembled oligomeric form of the dynamin-related GTPase Dnm1p; contains WD repeats; MDV1 has a paralog, CAF4, that arose from the whole genome duplication [Source:SGD;Acc:S000003648])

HSP 1 Score: 59.3066 bits (142), Expect = 1.287e-9
Identity = 61/230 (26.52%), Postives = 101/230 (43.91%), Query Frame = 1
Query:  889 WHRTSCRDYPPDNADNAQFDLISGHSGAVYEMSWSKNQQLLISASSDGTVKCWRTATKDCMTTFSAPGPIWSVDLSPLSENLLVCGTNKESINVYALDHPDPIRQFSRDIHGAVTCVRFHGNDNYIASGGVDRTVRLFDIRSGTLVRSFTGHKGIVSSLRFSLDGKYLISGCEMGKVNIWDLTSSNWLLKSLSSDDYSGNSRGAVMNMDLCRNLQLLVVGRREGQIDVWD 1578
            +  T     P ++ D+        H+  V  +S   +   L+S S D T++ W   +  C+ T         +DLS    N+L   TN +      L      ++  R   GA+        D  +A+G  D  VRL+D+RSG ++R+  GH   ++SL+F  D   L++G     V IWDL +   LL    +  YS      V+++DL +    +VV   E  + ++D
Sbjct:  477 YQETQNLTSPTNHIDSPCVHTFEAHTDEVTALSL--DPSFLVSGSQDRTIRQWDLRSGKCLQT---------IDLS--FANVLTTSTNVDLSKSTLL-----TQRNERPSIGALQSF-----DAALATGTKDGVVRLWDLRSGKVIRTLKGHTDAITSLKF--DSACLVTGSYDRTVRIWDLRTG--LLNKFHA--YS----APVLSLDLFQENAAVVVA-DEPSVQIYD 672          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Yeast
Match: TIF34 (eIF3i subunit of the eukaryotic translation initiation factor 3 (eIF3); subunit of the core complex of eIF3; essential for translation; stimulates rate of ribosomal scanning during translation reinitiation; eIF3 is also involved in programmed stop codon readthrough [Source:SGD;Acc:S000004754])

HSP 1 Score: 54.6842 bits (130), Expect = 1.653e-8
Identity = 38/166 (22.89%), Postives = 72/166 (43.37%), Query Frame = 1
Query:  952 ISGHSGAVYEMSWSKNQQLLISASSDGTVKCWRTATKDCMTTFSAPGPIWSVDLSPLSENLLV----CGTNKESINVYALDHPDPIRQFSR----DIHG--------AVTCVRFHGNDNYIASGGVDRTVRLFDIRSG-TLVRSFTGHKGIVSSLRFSLDGKYLIS 1398
            + GH+G ++ +      +  ++ S+D ++K W  +   C+ T+ +P P+  V+ SP     L        N  SIN+Y ++      + ++     IH         A T   +     YI +G  D  +  +D+ +    V S   H+  +S ++FS D  Y I+
Sbjct:   48 LDGHTGTIWSIDVDCFTKYCVTGSADYSIKLWDVSNGQCVATWKSPVPVKRVEFSPCGNYFLAILDNVMKNPGSINIYEIERDSATHELTKVSEEPIHKIITHEGLDAATVAGWSTKGKYIIAGHKDGKISKYDVSNNYEYVDSIDLHEKSISDMQFSPDLTYFIT 213          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Yeast
Match: RSA4 (WD-repeat protein involved in ribosome biogenesis; may interact with ribosomes; required for maturation and efficient intra-nuclear transport or pre-60S ribosomal subunits, localizes to the nucleolus [Source:SGD;Acc:S000000668])

HSP 1 Score: 55.4546 bits (132), Expect = 1.761e-8
Identity = 67/317 (21.14%), Postives = 131/317 (41.32%), Query Frame = 1
Query:  781 LHGVGGLGNSVGICAAFSKDCDFLAVGTVTGDIYVNWHRTSCRDYPPDNADNAQFDLISGHSGAVYEMSWSK-------NQQLLISASSDGTVKCWRTATKDCMTTFSAPGPIWSVDLSPLS-ENLLVCGTNKESINVY---------------------------------ALDH-------PDPIRQFSRDIHGAVTCVRFHGNDNYIASGGVDRTVRLFD-IRSGTLVRSFTGHKGIVSSLRFSLDGKYLISGCEMGKVNIWDLTSSNWLLKSLSSDDYSGNSRGAVMNMDLCRNLQLLVVGRREGQIDVWDYR 1584
            +H + G  N V +C ++S D + +A G++   I         R + P +      D + GHS  +  +SW         ++  L S+S DGT+K W T ++ C  T S  G   SV       + LL  G++  ++ V+                                 A DH       P+  ++ + + +  + C +   ++  + +   D T+ L++ ++S   +   TGH+ +V+ + FS DG+Y++S      + +WD     ++        + G+   +V  +    + +LLV   ++  + VWD R
Sbjct:  179 MHTLKGHYNWV-LCVSWSPDGEVIATGSMDNTI---------RLWDPKSG-QCLGDALRGHSKWITSLSWEPIHLVKPGSKPRLASSSKDGTIKIWDTVSRVCQYTMS--GHTNSVSCVKWGGQGLLYSGSHDRTVRVWDINSQGRCINILKSHAHWVNHLSLSTDYALRIGAFDHTGKKPSTPEEAQKKALENYEKI-CKKNGNSEEMMVTASDDYTMFLWNPLKSTKPIARMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDGKFI------STFRGHV-ASVYQVAWSSDCRLLVSCSKDTTLKVWDVR 474          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Nematostella
Match: EDO33060 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7ST98])

HSP 1 Score: 199.134 bits (505), Expect = 8.816e-56
Identity = 153/609 (25.12%), Postives = 263/609 (43.19%), Query Frame = 1
Query:  151 DQYSEFYKFVKNSSTIHHPQLRVFLYPVFVHIYFHLLSTGQTDQANKFLTRFAKSQEIIYKRDILDLQMFPLSCGDGHNCLLDIFRANKFAVRISRLSWEYVQQNFLENKIMKDLSNLINENLKIDLIEKFPRNEMEIDCCRGGFSGESIPEENL------LVFDPDLSV--------------------------------IDLQDPNIKRSKPSAMTS----QKRRLIERKCEESSTLEDVTDQLSFDSILHGVGGLGNSVGICAAFSKDCDFLAVGTVTGDIYVNWHRTSCRD---YPP------------------DNADNAQFDLISGHSGAVYEMSWSKNQQLLISASSDGTVKCWRTATKDCMTTFSAPG-PIWSVDLSPLSENLLVCGTNKESINVYALDHPDPIRQFSRDIHGAVTCVRFHGNDNYIASGGVDRTVRLFDIRSGTLVRSFTGHKGIVSSLRFSLDGKYLISGCEMGKVNIWDLTSSNWLLKSLSSDDYSGNSRGAVMNMDLCRNLQLLVVGRREGQIDVWDYRALIGSNAEQQGRSYETNQFGSSLCTETDSDESMLYLVTDPRRAGLCDTLYTKTFPVMALQFNRRDIL 1785
            D Y+    FV+ S  ++ P+L + LYP+F+H+Y  L+  G  +QA  F  +F +SQE  ++ DI  L         G+N  +   R+NKF +R+SR +++ ++++  E + M+ L ++I ++L  D+ E  PRN+  +D   GG +GE+  E N       L  +PDL +                                 +   P + R     M       K +++    ++     +V   + F S+L+   G+      CA  S+D   L+ G     I + W  T  +     PP                  D+   ++   + GHSG V+ +S   + + L+S S D T++ W   T   +  +     P+W V   P   +     ++  +  +++ DH  P+R F+  +   V  + FH N NYIA+G  DRTVRL+DI++G+ VR FTGHK  V SL FS +G++LIS     ++ +WDL     + +     D        V ++   R+  +L     +  I +W+                      S  C + + D+   +   D   + L  +  TK  P+  L F  R++L
Sbjct:   20 DYYTSLQAFVEKSLDLYKPELAMILYPLFIHMYLELVYKGHENQAQSFFNKFRQSQEDYHEEDIKKLSAMTRREHMGNNDFIATLRSNKFVIRMSRDTYQILKKHLQELQ-METLLSIIQQHLHFDVFEGRPRNKQAVDATSGGITGEATFEANKTKVLYGLQPEPDLGITIEDDNEEEDDKDKPKKKKPKKENGPGRKKFEFNPNAPPLNRIPFPEMKDSDKIHKAQILRESAKKLKLSAEVLPSICFYSLLNANEGVN-----CATISEDAALLSAGFEDSTIRI-WTLTPRKLRMLKPPSELNKIDKEAEDVMERIMDDRTASESRRLVGHSGPVFAVSIDHDNKFLLSCSEDKTIRLWSLFTFTTLVAYRGHNYPVWDVQFCPRG-HYFASTSHDRTARLWSTDHQQPLRIFAGHV-SDVNVIAFHPNCNYIATGSSDRTVRLWDIQTGSSVRLFTGHKAAVQSLAFSRNGRHLISSGVDTRLLVWDLAEGTLVAELKGHTD-------TVYSLCFSRDGTILASAGLDNCIKLWN---------------------TSVFCNQDEDDDDGRHAGLDKSSSCLLGSYSTKKTPIHCLHFTFRNLL 591          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Nematostella
Match: EDO29288 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T426])

HSP 1 Score: 110.538 bits (275), Expect = 1.280e-27
Identity = 60/162 (37.04%), Postives = 92/162 (56.79%), Query Frame = 1
Query:  952 ISGHSGAVYEMSWSKNQQLLISASSDGTVKCWRTATKDCMTTFSAPG-PIWSVDLSPLSENLLVCGTNKESINVYALDHPDPIRQFSRDIHGAVTCVRFHGNDNYIASGGVDRTVRLFDIRSGTLVRSFTGHKGIVSSLRFSLDGKYLISGCEMGKVNIWDL 1434
            + GHSG V+ +S   + + L+S S D T++ W   T   +  +     P+W V   P   +     ++  +  +++ DH  P+R F+  +   V  V FH N NYIA+G  DRTVRL+DI++G+ VR FTGHK  V SL FS +G++LIS     ++ +WDL
Sbjct:   17 LVGHSGPVFAVSIDHDNKFLLSCSEDKTIRLWSLFTFTTLVAYRGHNYPVWDVQFCPRG-HYFASTSHDRTARLWSTDHQQPLRIFAGHV-SDVNKVAFHPNCNYIATGSSDRTVRLWDIQTGSSVRLFTGHKAAVQSLAFSRNGRHLISSGVDTRLLVWDL 176          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Nematostella
Match: EDO43158 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZJ8])

HSP 1 Score: 104.76 bits (260), Expect = 9.173e-24
Identity = 102/370 (27.57%), Postives = 164/370 (44.32%), Query Frame = 1
Query:  403 FRANKFAVRISRLSWEYVQQNFLENKIMKDLSNLINENLKIDLIEKFPRNEMEIDCCRGGFSGESIPEENLLVFDPDLSVIDLQDPNIKRSKPSAMTSQKRRLIERKCEESSTLEDVTDQLSFDSILHGVGGLG---NSVGICAAFSKDCDFLAVGTVT--------GDIYVNWHRTSCRDYPPDNADNAQFDL----ISGHSGAVYEMSWSKNQQLLISASSDGTVKCWRTATKDCMTTFSAPG-PIWSVDLSPLSENLLVCGTNKESINVYALDHPDPIRQFSRDIHGAVTCVRFHGNDNYIASGGVDRTVRLFDIRSGTLVRSFTGHKGIVSSLRFSLDGKYLISGCEMGKVNIWDLTSSNWLLKSL 1464
            FR +K+ +R+S   + Y  Q +L +     L  L++ N  I++  + P      D       GE   ++N        S  D++   I   K  A     +  I R     + L  V    +F++   G+  +G   +S  IC  F  +  F+ + ++T        G +          D  P+N       L    + GHSG VY   +    ++L+SAS D TV+ W   +   +  +     P+WS+DLS  S      G+   S  ++  ++  P+R       G    V+FH N  Y+A+G  DRT RL+D++SG  VR F GHKG V  L  S DG++L+S  +   + +WDL + + LLK L
Sbjct:  161 FRRSKYVLRLSSKVFTYFMQ-YLRSSDRVLLLQLLSRNFSIEISNRKPGQSTNGDI------GEEEVDDNTSHVK---SAKDVKQTKISAQKEDASLLALKNSIARIRGGPACLPSVC-LYTFNNAYQGLSSVGISPDSTLICGGF--EDSFIQLWSLTPKKIVQPIGKMTDVSKIILSPDIIPENPRIETTSLGTVTLRGHSGPVYATCFGSEGKILLSASEDTTVRLWSLHSYSNIVQYKGHNHPVWSLDLSAQSL-YFATGSQDSSARLWNTEYNYPLRFHVFGFQG----VKFHPNCTYLATGSSDRTCRLWDLQSGNCVRLFRGHKGSVLVLAISPDGQHLLSAGDDRSIRVWDLAAGS-LLKEL 511          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Nematostella
Match: EDO45346 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTA6])

HSP 1 Score: 85.5001 bits (210), Expect = 9.637e-18
Identity = 49/160 (30.63%), Postives = 83/160 (51.88%), Query Frame = 1
Query:  952 ISGHSGAVYEMSWSKNQQLLISASSDGTVKCWRTATKDCMTTFSAPGP-IWSVDLSPLSENLLVCGTNKESINVYALDHPDPIRQFSRDIHGAVTCVRFHGNDNYIASGGVDRTVRLFDIRSGTLVRSFTGHKGIVSSLRFSLDGKYLISGCEMGKVNIW 1428
            ++ H   V    +S + +L++S S D T+K W   +KDC+ TF  PG  + SV+  P S   +  G    ++ V+ +     ++ +     GAV  V FH + NY+ S   D T+++ D+  G L  +  GH+G  +S+ FS +G+Y  SG    +V +W
Sbjct:  140 LNAHMNWVRCAKFSPDGRLIVSGSDDKTIKLWDRTSKDCVHTFYDPGGFVNSVEFHP-SGTCIAAGGTDSTVKVWDIRMNKLLQHYQAHT-GAVNSVSFHPSGNYLVSASSDTTLKILDLMEGRLFYTLHGHQGPATSVVFSRNGEYFASGSSDEQVMVW 297          

HSP 2 Score: 79.337 bits (194), Expect = 1.026e-15
Identity = 57/210 (27.14%), Postives = 98/210 (46.67%), Query Frame = 1
Query:  949 LISGHSGAVYEMSWSKNQQLLISASSDGTVKCWRTATKDCMTTFSAP-GPIWSVDLSPLSENLLVCGTNKESINVYALDHPDPIRQFSRDIHGAVTCVRFHGNDNYIASGGVDRTVRLFDIRSGTLVRSFTGHKGIVSSLRFSLDGKYLISGCEMGKVNIWDLTSSNWLLKSLSSDDYSGNSRGAVMNMDLCRNLQLLVVGRREGQIDVW 1575
            +   H+  V  + +S + Q L++AS D ++K W    +  + + +A    +     SP    L+V G++ ++I ++     D +  F  D  G V  V FH +   IA+GG D TV+++DIR   L++ +  H G V+S+ F   G YL+S      + I DL     L  +L         +G   ++   RN +    G  + Q+ VW
Sbjct:   97 VFKAHTATVRSVDFSGDGQSLLTASDDKSLKVWTVHRQKFLYSLNAHMNWVRCAKFSP-DGRLIVSGSDDKTIKLWDRTSKDCVHTF-YDPGGFVNSVEFHPSGTCIAAGGTDSTVKVWDIRMNKLLQHYQAHTGAVNSVSFHPSGNYLVSASSDTTLKILDLMEGR-LFYTLH------GHQGPATSVVFSRNGEYFASGSSDEQVMVW 297          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Nematostella
Match: EDO33297 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSL6])

HSP 1 Score: 77.7962 bits (190), Expect = 1.988e-15
Identity = 61/211 (28.91%), Postives = 100/211 (47.39%), Query Frame = 1
Query:  952 ISGHSGAVYEMSWSKNQQLLISASSDGTVKCWRTATKDCMTTFSA-PGPIWSVDLSPLSENLLVCGTNKESINVYALD----------HPDPIR--QFSRDIHGA--------------------------------VTCVRFHGNDNYIASGGVDRTVRLFDIRSGTLVRSFTGHKGIVSSL--RFSLDG-KYLISGCEMGKVNIWDLTS 1440
            I+GH   + +++WS + + L+SAS D T+K W  AT  C+ T       ++  + +P S NL+V G+  ES+ ++ +           H DP+    F+RD  GA                                V+ V+F  N  YI +  +D T++L+D   G  ++++TGHK     +   FS+ G K+++SG E  KV IW+L S
Sbjct:  103 ITGHKLGISDVAWSTDSRHLVSASDDKTLKIWDFATGKCLKTLKGHSNYVFCCNFNPQS-NLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVTAVHFNRD--GALIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCVFANFSVTGGKWIVSGSEDHKVYIWNLQS 310          

HSP 2 Score: 70.8626 bits (172), Expect = 3.623e-13
Identity = 52/215 (24.19%), Postives = 97/215 (45.12%), Query Frame = 1
Query:  952 ISGHSGAVYEMSWSKNQQLLISASSDGTVKCWRTATKDCMTTFSA-----PGPIWSVDLSPLSENLLVCGTNKESINVYALDHPDPIRQFSRDIHGAVTCVRFHGNDNYIASGGVDRTVRLFDIRSGTLVRSFTGHKGIVSSLRFSLDGKYLISGCEMGKVNIWDLTSSNWLLKSLSSDDYSGNSRGAVMNMDLCRNLQLLVVGRREGQIDVWDY 1581
            ++GH+ AV  + +S N + L S+S+D  +K W         T +          WS D        LV  ++ +++ ++       ++   +     V C  F+   N I SG  D +VR++D+++G  +++   H   V+++ F+ DG  ++S    G   IWD T+S   LK+L  DD        V  +    N + ++    +  + +WDY
Sbjct:   61 LTGHNKAVSSVKFSHNGEWLASSSADKVIKIWGAYDGKFEKTITGHKLGISDVAWSTD-----SRHLVSASDDKTLKIWDFATGKCLKTL-KGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVTAVHFNRDGALIVSSSYDGLCRIWD-TASGQCLKTLIDDD-----NPPVSFVKFSPNGKYILAATLDNTLKLWDY 263          

HSP 3 Score: 54.299 bits (129), Expect = 7.811e-8
Identity = 34/124 (27.42%), Postives = 61/124 (49.19%), Query Frame = 1
Query: 1225 AVTCVRFHGNDNYIASGGVDRTVRLFDIRSGTLVRSFTGHKGIVSSLRFSLDGKYLISGCEMGKVNIWDLTSSNWLLKSLSSDDYSGNSRGAVMNMDLCRNL----QLLVVGRREGQIDVWDYR 1584
            AV+ V+F  N  ++AS   D+ ++++    G   ++ TGHK  +S + +S D ++L+S  +   + IWD  +    LK+L      G+S     N   C N      L+V G  +  + +WD +
Sbjct:   67 AVSSVKFSHNGEWLASSSADKVIKIWGAYDGKFEKTITGHKLGISDVAWSTDSRHLVSASDDKTLKIWDFATGK-CLKTL-----KGHS-----NYVFCCNFNPQSNLIVSGSFDESVRIWDVK 179          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Medaka
Match: taf5 (TATA-box binding protein associated factor 5 [Source:NCBI gene;Acc:101175542])

HSP 1 Score: 195.667 bits (496), Expect = 3.183e-53
Identity = 165/618 (26.70%), Postives = 271/618 (43.85%), Query Frame = 1
Query:  157 YSEFYKFVKNSSTIHHPQLRVFLYPVFVHIYFHLLSTGQTDQANKFLTRFAKSQEIIYKRDILDL-QMFPLSCGDGHNCLLDIFRANKFAVRISRLSWEYVQQNFLENKIMKDLSNLINENLKIDLIEKFPRNEMEIDCCRGGFSGESIPEENL------LVFDPDLSV----------------------IDLQDPNIKRSKPSAMTSQKRRLIE----RKCEESSTLEDVTDQLS----------FDSILHGVGGLGNSVGICAAFSKDCDFLAVGTVTGDIYVNWHRTSCRDYPPDNADNAQFDLISGHSGAVYE-----------------------MSWSKNQQLLISASSDGTVKCWRTATKDCMTTFSAPG-PIWSVDLSPLSENLLVCGTNKESINVYALDHPDPIRQFSRDIHGAVTCVRFHGNDNYIASGGVDRTVRLFDIRSGTLVRSFTGHKGIVSSLRFSLDGKYLISGCEMGKVNIWDLTSSNWLLKSLSSDDYSGNSRGAVMNMDLCRNLQLLVVGRREGQIDVWDYRALIGSNAEQQGRSYETNQFGSSLCTETDSDESMLYLVTDPRRAGLCDTLYTKTFPVMALQFNRRDILHCCVFYSG 1809
            YS+  KF+++    H  +L    YP+FVH+Y  L+      +A  F  +F+  QE  Y+ D+  L  +       G+  LLD FR +KF +RISR S++ ++++ L+ +    + N+I E+L ID+ +  PR++ +ID   G  +GE+  E N       L+ +P++ V                       D      K+  P+A    +  L E     K ++   +++ T ++           F + L+   GL         F+ D   +A G     + V W  T  +     +A  A  +LI   S  V E                       +S+S ++  L+S S DGTV+ W   T  C+  +     P+W    SP      V G +     ++A DH  P+R F+  +   VTC RFH N NY+ +G  DRT+RL+D+ +G  VR FTGHKG + +L FS +GK+L SG   G+V +WD+         L   +  G++   V  +   R+ ++L  G  +  + +WD        A +     ET+ F ++       D S   L+          T  +K+ PV+ L F RR++L     Y+ 
Sbjct:  166 YSDLKKFIESVLDCHRAELSQVFYPLFVHMYLELVYNNHESEAKAFFEKFSGDQECYYEDDLRVLSSLTKKEHMRGNETLLD-FRTSKFVLRISRDSYQLLKRH-LQERQNNQIWNIIQEHLYIDIFDGMPRSKSQIDAMSGSLAGEAKREANKAKVYYGLLKEPEIEVPLDDEDEEAENEEGKPKKKKPKKDSMGSKSKKQDPNAPLQNRIPLPELKDSDKLDKIMYMKESTKRIRLGRENLPSICFYTFLNAYQGL-----TAVDFTDDSSLIAGGFADSTVRV-WSVTPKKLRKVKSA--ADLNLIDKESDDVLERIMDEKTASESKILYGHSGPVYGISFSPDRNYLLSCSEDGTVRLWSLLTFTCLVGYKGHNYPVWDTQFSPYG-YYFVSGGHDRVARLWATDHYQPLRIFAGHL-ADVTCTRFHPNSNYVVTGSSDRTIRLWDVLTGNCVRIFTGHKGPIHTLAFSPNGKFLASGATDGRVLLWDIG------HGLMVSELKGHT-DTVYALRFSRDGEILASGSMDNTVRLWD--------AAKAFDDLETDDFTAATGHIHLQDNSQELLL---------GTYMSKSTPVVHLHFTRRNLLLAAGSYAA 747          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Medaka
Match: taf5l (TATA-box binding protein associated factor 5 like [Source:NCBI gene;Acc:101159161])

HSP 1 Score: 118.242 bits (295), Expect = 1.705e-27
Identity = 71/223 (31.84%), Postives = 115/223 (51.57%), Query Frame = 1
Query:  922 DNADNAQFDLISGHSGAVYEMSWSKNQQLLISASSDGTVKCWRTATKDCMTTFSAPG-PIWSVDLSPLSENLLVCGTNKESINVYALDHPDPIRQFSRDIHGAVTCVRFHGNDNYIASGGVDRTVRLFDIRSGTLVRSFTGHKGIVSSLRFSLDGKYLISGCEMGKVNIWDLTSSNWLLKSLSSDDYSGNSRGAVMNMDLCRNLQLLVVGRREGQIDVWDYRA 1587
            +N   ++   + GHSG VY  ++  +   L+S S D T++ W   +      +     P+W VD+SP S     C  ++ +  ++      P+R ++  +   V C++FH N NY+A+G  D+TVRL+  + G  VR FTGH+G V SL FS +GKYL S  E  +V +WDL S   L K     D  G++  +V ++    +  L+     +  + VWD R+
Sbjct:  340 ENGCGSEIKTLRGHSGPVYRTAFLTDSSGLLSCSEDTTIRYWDLGSFTNTVLYQGHAYPVWDVDVSPCSLYFGSCSQDR-TARLWTFSRTYPLRIYAGHL-SDVDCIKFHPNSNYLATGSTDKTVRLWSTQQGASVRLFTGHRGPVLSLAFSPNGKYLASAGEDQRVKLWDLASGT-LFK-----DLRGHT-DSVTSLSFSPDSSLVASSSMDNSVRVWDIRS 553          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Medaka
Match: gnb3a (G protein subunit beta 3 [Source:NCBI gene;Acc:101155714])

HSP 1 Score: 77.411 bits (189), Expect = 6.345e-15
Identity = 53/165 (32.12%), Postives = 79/165 (47.88%), Query Frame = 1
Query:  952 ISGHSGAVYEMSWSKNQQLLISASSDGTVKCWRTATKDCMTTFSAPGP-IWSVDLSPLSENLLVCGTNKESINVYALDHPDPIRQFSRDIH---GAVTCVRFHGNDNYIASGGVDRTVRLFDIRSGTLVRSFTGHKGIVSSLRFSLDGKYLISGCEMGKVNIWDL 1434
            + GH   +Y M WS + +L +SAS DG +  W T T + +         + +   +P S NL+ CG      ++Y L   D   +  R++    G ++C RF  +   I S G D T  L+DI +GT    F GH+G   SL  S D K+ ISG       +WD+
Sbjct:   51 LRGHLAKIYAMHWSTDAKLCVSASQDGKLIVWDTITTNKVNAIPLKSSWVMTCAYAP-SGNLVACGGLDNMCSIYNLKGKDGNVKVMRELAAHTGYLSCCRFISDSEIITSSG-DCTCVLWDIETGTQKTVFAGHQGDCMSLAVSPDFKFFISGACDFTAKLWDI 213          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Medaka
Match: wdr5 (WD repeat domain 5 [Source:NCBI gene;Acc:101166483])

HSP 1 Score: 77.0258 bits (188), Expect = 6.853e-15
Identity = 55/215 (25.58%), Postives = 101/215 (46.98%), Query Frame = 1
Query:  952 ISGHSGAVYEMSWSKNQQLLISASSDGTVKCWRTATKDCMTTFSA-----PGPIWSVDLSPLSENLLVCGTNKESINVYALDHPDPIRQFSRDIHGAVTCVRFHGNDNYIASGGVDRTVRLFDIRSGTLVRSFTGHKGIVSSLRFSLDGKYLISGCEMGKVNIWDLTSSNWLLKSLSSDDYSGNSRGAVMNMDLCRNLQLLVVGRREGQIDVWDY 1581
            ++GH+ AV  + +S + + L S+S+D  +K W         T S          WS D      NLLV  ++ +++ ++ ++    ++   +     V C  F+   N I SG  D +VR++D+++G  +++   H   VS++ F+ DG  ++S    G   IWD T+S   LK+L  DD        V  +    N + ++    +  + +WDY
Sbjct:   41 LAGHTKAVSSVKFSPSGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSD-----SNLLVSASDDKTLKIWDVNSGKCLKTL-KGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWD-TASGQCLKTLIDDD-----NPPVSFVKFSPNGKYILAATLDNTLKLWDY 243          

HSP 2 Score: 75.0998 bits (183), Expect = 3.016e-14
Identity = 57/207 (27.54%), Postives = 96/207 (46.38%), Query Frame = 1
Query:  952 ISGHSGAVYEMSWSKNQQLLISASSDGTVKCWRTATKDCMTTFSA-PGPIWSVDLSPLSENLLVCGTNKESINVYALD----------HPDPIR--QFSRD------------------------------IHGAVTCVRFHGNDNYIASGGVDRTVRLFDIRSGTLVRSFTGHKGIVSSL--RFSLD-GKYLISGCEMGKVNIWDL 1434
            ISGH   + +++WS +  LL+SAS D T+K W   +  C+ T       ++  + +P S NL+V G+  ES+ ++ +           H DP+    F+RD                               +  V+ V+F  N  YI +  +D T++L+D   G  ++++TGHK     +   FS+  GK+++SG E   V IW+L
Sbjct:   83 ISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVNSGKCLKTLKGHSNYVFCCNFNPQS-NLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNMVYIWNL 288          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Medaka
Match: wdr61 (WD repeat domain 61 [Source:NCBI gene;Acc:101172406])

HSP 1 Score: 75.485 bits (184), Expect = 1.570e-14
Identity = 48/175 (27.43%), Postives = 91/175 (52.00%), Query Frame = 1
Query:  952 ISGHSGAVYEMSWSKNQQLLISASSDGTVKCWRTATKDCMTTFSAPGPI--WSVDLSPLSENLLVCGTNKESINVYALDHPDPIRQFSRDIHGA-VTCVRFHGNDNYIASGGVDRTVRLFDIRSGTLVRSFTGHKGIVSSLRFSLDGKYLISGCEMGKVNIWDLTSSNWLLKSLS 1467
            + GH   V  +  S N  +  S+S D  ++ W   +   + +  A GP+  WSV  SP S+  +  G++   +N++ ++     +++S D  G  +  + +  +  Y+ASG +D  + +FDI +G L+ +  GH   + SL FS D + L++  + G + I+D+  +N L  +LS
Sbjct:   60 LEGHQLGVVSVDISHNGAIAASSSLDAHIRLWDLESGKQIKSIDA-GPVDAWSVAFSPDSK-YIATGSHHGKVNIFGVESSK--KEYSLDTRGKFILSIAYSPDGKYLASGAIDGIINIFDIATGKLLHTLEGHAMPIRSLTFSPDSQLLVTASDDGYIKIYDVQHAN-LAATLS 229          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000005136.1 (SMESG000005136.1)

HSP 1 Score: 1186.02 bits (3067), Expect = 0.000e+0
Identity = 592/603 (98.18%), Postives = 596/603 (98.84%), Query Frame = 1
Query:   22 MTRDLLTLFELIGKYNLTETRIILKCXXXXXXXXXXXXXXXXXDQYSEFYKFVKNSSTIHHPQLRVFLYPVFVHIYFHLLSTGQTDQANKFLTRFAKSQEIIYKRDILDLQMFPLSCGDGHNCLLDIFRANKFAVRISRLSWEYVQQNFLENKIMKDLSNLINENLKIDLIEKFPRNEMEIDCCRGGFSGESIPEENLLVFDPDLSVIDLQDPNIKRSKPSAMTSQKRRLIERKCEESSTLEDVTDQLSFDSILHGVGGLGNSVGICAAFSKDCDFLAVGTVTGDIYVNWHRTSCRDYPPDNADNAQFDLISGHSGAVYEMSWSKNQQLLISASSDGTVKCWRTATKDCMTTFSAPGPIWSVDLSPLSENLLVCGTNKESINVYALDHPDPIRQFSRDIHGAVTCVRFHGNDNYIASGGVDRTVRLFDIRSGTLVRSFTGHKGIVSSLRFSLDGKYLISGCEMGKVNIWDLTSSNWLLKSLSSDDYSGNSRGAVMNMDLCRNLQLLVVGRREGQIDVWDYRALIGSNAEQQGRSYETNQFGSSLCTETDSDESMLYLVTDPRRAGLCDTLYTKTFPVMALQFNRRDILHCCVFYSGLLRDRSP 1830
            MTRDLLTLFELI KYNLTETRIILKCESGITESMSSITSSSLSDQYSEFYKFV NSSTIHHPQLRVFLYPVFVHIYFHLLSTGQTDQANKFLTRFAKSQEIIYKRDILDLQMFPLSCGDGHNCLLDIFRANKFAVRISRLSWEYVQQNFLENKIMKDLSNLINENLKIDLIEKFPRNEMEIDCCRGGFSGESIPEENLLVFDPDLSVIDLQ PNIKRSKPSAMTSQKRRLIERKC+ESSTLEDVTDQLSFDSILHGV GLGNSVGICAAFSKDCDFLAVGTVTGDIYVNWHRTSCRDYPPDNADNAQFDLISGHSGAVYEMSWSKNQQLLISASSDGTVKCWRTATKDC+ TFSAPGPIWSVDLSPLSENLLVCGTNKESINVYALDHP+PIRQFSRDIHGAVTCVRFHGNDNYIASGGVDRTVRLFDIRSGTLVRSFTGHKGIVSSLRFSLDGKYLISGCEMGK NIWDLTSSNWLLKSLSSD YSGNSRGAVMNMDLCRNLQLLVVGRREGQIDVWDYRALIGSNAEQQGRSYETNQFGSSLCTETDSDESMLYLVTDPRRAGLCDTLYTKTFPVMALQF+RRDILHCCVFYSGLLRDRSP
Sbjct:    1 MTRDLLTLFELIEKYNLTETRIILKCESGITESMSSITSSSLSDQYSEFYKFVNNSSTIHHPQLRVFLYPVFVHIYFHLLSTGQTDQANKFLTRFAKSQEIIYKRDILDLQMFPLSCGDGHNCLLDIFRANKFAVRISRLSWEYVQQNFLENKIMKDLSNLINENLKIDLIEKFPRNEMEIDCCRGGFSGESIPEENLLVFDPDLSVIDLQVPNIKRSKPSAMTSQKRRLIERKCKESSTLEDVTDQLSFDSILHGVCGLGNSVGICAAFSKDCDFLAVGTVTGDIYVNWHRTSCRDYPPDNADNAQFDLISGHSGAVYEMSWSKNQQLLISASSDGTVKCWRTATKDCIATFSAPGPIWSVDLSPLSENLLVCGTNKESINVYALDHPNPIRQFSRDIHGAVTCVRFHGNDNYIASGGVDRTVRLFDIRSGTLVRSFTGHKGIVSSLRFSLDGKYLISGCEMGKANIWDLTSSNWLLKSLSSDAYSGNSRGAVMNMDLCRNLQLLVVGRREGQIDVWDYRALIGSNAEQQGRSYETNQFGSSLCTETDSDESMLYLVTDPRRAGLCDTLYTKTFPVMALQFSRRDILHCCVFYSGLLRDRSP 603          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000013017.1 (SMESG000013017.1)

HSP 1 Score: 357.836 bits (917), Expect = 4.388e-114
Identity = 239/699 (34.19%), Postives = 360/699 (51.50%), Query Frame = 1
Query:   31 DLLTLFELIGKYNLTETRIILKCXXXXXXXXXXXXXX------XXXDQYSEFYKFVKNSSTIHHPQLRVFLYPVFVHIYFHLLSTGQTDQANKFLTRFAKSQEIIYKRDILDLQMFPLSCGDGH--NCLLDIFRANKFAVRISRLSWEYVQQNFLENKIMKDLSNLINENLKIDLIEKFP------------------------------------------RNEMEIDCCRGGFSGESIPEEN---LLVFDPDLS-VIDLQDPNIKRSKPSAMTSQKRRLIERKCEESSTL-----------EDV--TDQL------------------SFDSILHGVGGLGNSVGICAAFSKDCDFLAVGTVTGDIYV---NWHRTSCRDYPPD-----------------NADNAQFDLISGHSGAVYEMSWSKNQQLLISASSDGTVKCWRTATKDCMTTFSAPG-PIWSVDLSPLSENLLVCGTNKESINVYALDHPDPIRQFSRDIHGAVTCVRFHGNDNYIASGGVDRTVRLFDIRSGTLVRSFTGHKGIVSSLRFSLDGKYLISGCEMGKVNIWDLTSSNWLLKSLSSDDYSGNSRGAVMNMDLCRNLQLLVVGRREGQIDVWDYRALIGSNAEQQGR-----SYETNQFGSSLCTETDSDESMLYLVTDPRRAGLCDTLYTKTFPVMALQFNRRDILHCC 1794
            D   LF L+ KYNL ET   LK E+ I+++             SL++QY++  +FV+N+  +H  +L+V LYPVFVHIY HL+S  Q  QAN F   F   QE IY +D++ L+ F  S  D H  N + ++F +N+F++RI R S+ Y ++ FL++K M DL+NLIN+ LK+D+ E  P                                          R EM+ +C         I +E+   L  F+ ++   ID   P + R     ++SQ R  I++   E ++L           ED+  TD +                    + +++ +G L N  G  AAF++DC  LA+G  TG +++   N    S      D                 N   A +  + GH+G VY+++WS ++  +++ASSDGTV+ W   T   +  +   G P+W+VD +P+  + L  G N   +N+YA D+  P+R+F  D +G VTCV+FH N NY+ASG  DR VRLFDIRSG +VRSFTGHKG ++ L+FS DG++L+SGC+ G VNIWDL   + L+ SL+       + G + ++  CR+  +L VGR+ GQ+D+W+Y  +I +N E   R       E N+F            +M+   T P    + D LYTK  P++ LQFNRR++L CC
Sbjct:   15 DFKKLFSLLNKYNLKETEEKLKLEAKISDNFIHEIKKDSDICFSLTEQYAKLREFVENAMLLHKAELQVLLYPVFVHIYLHLISLDQIVQANDFFKIFVSYQEEIYHKDLITLREF--SSHDQHMKNSIFEVFNSNEFSLRICRSSFIYFKKMFLDDKSMMDLANLINQRLKVDIYEGLPRTQGEITLRRGALFGESTSEKNVKPVLYGNLKDPLLESVVKRRAEMQNECGDETGKKRKIKKESPTKLTSFNRNVGGKIDSISPEMNRVPLPQLSSQDREYIKQMYLEINSLPRLRRKRRLFNEDIGRTDNILPLENNQIDKQRYLREGIPLNCVMYTMGNL-NGQGTAAAFNEDCSMLAMGLSTGILHIRCLNGDNMSTLKSSDDLGQIILSDPNINNRIMANMSGAVYKELKGHAGGVYDIAWSTDRNQVLTASSDGTVRLWCMMTWTNLAKYQDGGEPLWAVDFAPVYGHYLATGGNDRCVNLYAADNLKPLRRFVGDCYGPVTCVKFHNNVNYVASGSTDRVVRLFDIRSGGMVRSFTGHKGTLNCLQFSDDGRFLLSGCDAGSVNIWDLGIPSGLMDSLNLTGGKDMTGGPITSLSFCRDGAVLAVGRQAGQVDIWNYTKIIKTNLEDSDRIADEIKLENNEF------------TMVGKRTHPLDC-IIDILYTKKTPILNLQFNRRNML-CC 696          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000024482.1 (SMESG000024482.1)

HSP 1 Score: 83.9593 bits (206), Expect = 8.079e-17
Identity = 60/176 (34.09%), Postives = 93/176 (52.84%), Query Frame = 1
Query:  958 GHSGAVYEMSWSKNQQLLISASSDGTVKCWRTATKDCMTTFSA-PGPIWSVDLSPLSENL-LVCGTNKESINVYALDHPDPIRQFSRDIHGA---VTCVRFHGNDNYIASGGVDRTVRLFDIRSGTLVRSFTGHKGIVSSLRFSLDGKYLISGCEMGKVNIWDLTSSNWLLKSLSS 1470
            GH  A+  + +S   QL+ SAS D TV+ W  + K     F A    + SVD+S   +NL +V G++ ++I V+ +      ++FS  ++     V CVRF  +   IAS   D+T++L+D  +   + +F  H G V SL F  +G Y+ SG     VNIWD+   N LL+  +S
Sbjct:   54 GHEDAILSVKFSPTGQLVASASRDKTVRLWVPSIKGESLVFRAHTATVRSVDIS--CDNLEMVTGSDDKTIKVWKMHR----QKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAFHPNGSYIASGGTDSHVNIWDI-RMNKLLQHYTS 222          

HSP 2 Score: 62.3882 bits (150), Expect = 6.378e-10
Identity = 40/157 (25.48%), Postives = 77/157 (49.04%), Query Frame = 1
Query:  961 HSGAVYEMSWSKNQQLLISASSDGTVKCWRTATKDCMTTFSAPGP-IWSVDLSPLSENLLVCGTNKESINVYALDHPDPIRQFSRDIHGAVTCVRFHGNDNYIASGGVDRTVRLFDIRSGTLVRSFTGHKGIVSSLRFSLDGKYLISGCEMGKVNIW 1428
            H   V  + +S + QL+ S+S D T+K W    ++C+ TF   G  + S+   P    +   GT+   +N++ +     ++ ++      V  V FH + N++ S   D +++++D+  G L+ +  GH+G +    FS  G+   SG    +V +W
Sbjct:  139 HKNWVRCVRFSSDGQLIASSSDDKTIKLWDRHNQECIHTFQEHGGFVPSLAFHPNGSYIASGGTDSH-VNIWDIRMNKLLQHYTSHT-SPVNAVSFHPSGNFLISSSDDSSMKIYDLLEGRLLYTVQGHEGPILGTAFSHCGEMFASGGADHQVFLW 293          

HSP 3 Score: 52.373 bits (124), Expect = 7.553e-7
Identity = 44/169 (26.04%), Postives = 78/169 (46.15%), Query Frame = 1
Query: 1228 VTCVRFHGNDNYIASGGVDRTVRLFDIRSGTLVRSFTGHKGIVSSLRFSLDGKYLISGCEMGKVNIWDLTSSNWLLKSLSSDDYSGNSRGA-VMNMDL-CRNLQLLVVGRREGQIDVWDYRALIGSNAEQQGRSYETNQFGSSL-CTETDSDESMLYLVTDPRRAGLCD 1725
            VTCV F+ N + +ASGG+D  + +++ +  T    F GH+  + S++FS  G+ + S      V +W        + S+  +     +  A V ++D+ C NL+ +V G  +  I VW           +Q  SY  N+  + + C    SD  ++   +D +   L D
Sbjct:   17 VTCVDFNPNSSQLASGGIDSCLMIWNFKPQTRAYRFVGHEDAILSVKFSPTGQLVASASRDKTVRLW--------VPSIKGESLVFRAHTATVRSVDISCDNLE-MVTGSDDKTIKVW--------KMHRQKFSYSLNEHKNWVRCVRFSSDGQLIASSSDDKTIKLWD 168          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000018712.1 (SMESG000018712.1)

HSP 1 Score: 73.559 bits (179), Expect = 7.304e-14
Identity = 50/165 (30.30%), Postives = 81/165 (49.09%), Query Frame = 1
Query:  952 ISGHSGAVYEMSWSKNQQLLISASSDGTVKCWRTATKDCMTTFSAPGP-IWSVDLSPLSENLLVCGTNKESINVYALDHPDPIRQFSRDI---HGAVTCVRFHGNDNYIASGGVDRTVRLFDIRSGTLVRSFTGHKGIVSSLRFSLDGKYLISGCEMGKVNIWDL 1434
            + GH   +Y M WS + + L+SAS DG +  W   + + +         + +   +P S N + CG      ++Y+L   +   + SR++    G ++C RF  +DN I +   D T  L+DI +G  V +FTGH G V SL  + D +  +SG       +WDL
Sbjct:   51 LRGHLAKIYAMHWSSDSRNLVSASQDGKLIVWDGYSTNKVHAIPLRSSWVMTCAYAP-SGNYVACGGLDNICSIYSLKTREGNVRVSRELPGHTGYLSCCRFI-DDNQIVTSSGDVTCGLWDIETGQQVATFTGHTGDVMSLSLAPDMRTFVSGACDASAKLWDL 213          
BLAST of WD_REPEATS_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000026747.1 (SMESG000026747.1)

HSP 1 Score: 73.9442 bits (180), Expect = 1.132e-13
Identity = 46/158 (29.11%), Postives = 82/158 (51.90%), Query Frame = 1
Query:  958 GHSGAVYEMSWSKNQQLLISASSDGTVKCWRTATKDCMTTFSAPG-PIWSVDLSPLSENLLVCGTNKESINVYALDHPDPIRQFSRDIHGAVTCVRFHGNDNYIASGGVDRTVRLFDIRSGTLVR---SFTGHKGIVSSLRFSLDGKYLISGCEMGKV 1419
            GHS  V  + ++     ++++S DG+++ W   T   + T++    PIW +  +P  +     G    S+ ++     +P+R+    + G++  V F+ + NY+ SGG D  VRL+DIR+G  VR   +  G KGI  ++ FS  G  +I G + G +
Sbjct:  248 GHSMMVTSVQFTSQSDQILTSSLDGSIRVWNEETGVSIETYTDNAFPIWDIASNPRIDACFASGAFDGSVCLWDAHRENPVRKMIGHL-GSIKAVLFYKSGNYMVSGGDDGQVRLWDIRTGNCVRLWEAADGSKGI-EAVAFSETGNEIICGTDAGLI 403          
The following BLAST results are available for this feature:
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TAF57.144e-3731.42TATA-box binding protein associated factor 5 [Sour... [more]
TAF5L4.579e-3225.51TATA-box binding protein associated factor 5 like ... [more]
TAF5L4.579e-3225.51TATA-box binding protein associated factor 5 like ... [more]
KATNB14.378e-1630.19katanin regulatory subunit B1 [Source:HGNC Symbol;... [more]
GNB21.648e-1529.76G protein subunit beta 2 [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
taf-51.848e-2824.14TAF (TBP-associated transcription factor) family ... [more]
taf-51.848e-2824.14TAF (TBP-associated transcription factor) family ... [more]
taf-51.848e-2824.14TAF (TBP-associated transcription factor) family ... [more]
lin-231.103e-1425.58F-box/WD repeat-containing protein lin-23 [Source... [more]
lin-231.208e-1425.58F-box/WD repeat-containing protein lin-23 [Source... [more]
back to top
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Taf51.765e-4525.40gene:FBgn0010356 transcript:FBtr0088240[more]
can1.723e-2726.78gene:FBgn0011569 transcript:FBtr0076299[more]
wda3.106e-2234.52gene:FBgn0039067 transcript:FBtr0084387[more]
wds2.482e-1627.44gene:FBgn0040066 transcript:FBtr0308566[more]
wds2.482e-1627.44gene:FBgn0040066 transcript:FBtr0070438[more]
back to top
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
taf52.518e-5826.65TAF5 RNA polymerase II, TATA box binding protein (... [more]
taf5l2.918e-2631.72TAF5-like RNA polymerase II, p300/CBP-associated f... [more]
gnb4b2.046e-1531.52guanine nucleotide binding protein (G protein), be... [more]
strap5.018e-1528.05serine/threonine kinase receptor associated protei... [more]
gnb4b5.470e-1531.52guanine nucleotide binding protein (G protein), be... [more]
back to top
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
myadm2.694e-3731.42myeloid-associated differentiation marker [Source:... [more]
myadm2.965e-3731.42myeloid-associated differentiation marker [Source:... [more]
myadm3.345e-3731.42myeloid-associated differentiation marker [Source:... [more]
rxfp36.265e-3425.20relaxin family peptide receptor 3 [Source:Xenbase;... [more]
rxfp33.154e-3225.15relaxin family peptide receptor 3 [Source:Xenbase;... [more]
back to top
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Taf53.205e-3731.42TATA-box binding protein associated factor 5 [Sour... [more]
Taf5l2.688e-3425.56TATA-box binding protein associated factor 5 like ... [more]
Taf5l2.688e-3425.56TATA-box binding protein associated factor 5 like ... [more]
Katnb12.720e-1630.19katanin p80 (WD40-containing) subunit B 1 [Source:... [more]
Gnb21.091e-1529.76guanine nucleotide binding protein (G protein), be... [more]
back to top
BLAST of WD_REPEATS_REGION domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P49846|TAF5_DROME1.769e-4425.40Transcription initiation factor TFIID subunit 5 OS... [more]
sp|O13282|TAF5_SCHPO1.652e-3622.39Transcription initiation factor TFIID subunit 5 OS... [more]
sp|Q15542|TAF5_HUMAN3.431e-3631.42Transcription initiation factor TFIID subunit 5 OS... [more]
sp|Q8C092|TAF5_MOUSE6.278e-3631.08Transcription initiation factor TFIID subunit 5 OS... [more]
sp|O74319|TAF73_SCHPO1.301e-3524.53Transcription initiation factor TFIID subunit taf7... [more]
back to top
BLAST of WD_REPEATS_REGION domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1J1J8S13.505e-5827.29CLUMA_CG020300, isoform A OS=Clunio marinus OX=568... [more]
R7T5222.681e-5727.67Uncharacterized protein OS=Capitella teleta OX=283... [more]
A0A3B5AQR88.861e-5727.97TAF5 RNA polymerase II, TATA box binding protein (... [more]
A0A3B4F6051.477e-5627.80TAF5 RNA polymerase II, TATA box binding protein (... [more]
A0A1A7Y5S12.835e-5627.48TAF5 RNA polymerase II, TATA box binding protein (... [more]
back to top
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
taf56.084e-5826.58TATA-box binding protein associated factor 5 [Sour... [more]
taf56.084e-5826.58TATA-box binding protein associated factor 5 [Sour... [more]
taf5l4.778e-2833.94TATA-box binding protein associated factor 5 like ... [more]
strap1.593e-1629.70serine/threonine kinase receptor associated protei... [more]
wdr52.771e-1629.23WD repeat domain 5 [Source:NCBI gene;Acc:103033424... [more]
back to top
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
taf5l5.603e-2532.30TAF5-like RNA polymerase II, p300/CBP-associated f... [more]
ENSPMAT00000009560.12.852e-1428.48pep scaffold:Pmarinus_7.0:GL479618:22463:45788:1 g... [more]
strap3.996e-1428.48serine/threonine kinase receptor associated protei... [more]
POC1A4.820e-1427.33POC1 centriolar protein A [Source:HGNC Symbol;Acc:... [more]
wdr618.077e-1325.53WD repeat domain 61 [Source:NCBI gene;Acc:393827][more]
back to top
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
TAF56.123e-3125.61Subunit (90 kDa) of TFIID and SAGA complexes; invo... [more]
DIP24.321e-1028.49Nucleolar protein; specifically associated with th... [more]
MDV11.287e-926.52Peripheral protein of cytosolic face of mitochondr... [more]
TIF341.653e-822.89eIF3i subunit of the eukaryotic translation initia... [more]
RSA41.761e-821.14WD-repeat protein involved in ribosome biogenesis;... [more]
back to top
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO330608.816e-5625.12Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO292881.280e-2737.04Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO431589.173e-2427.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO453469.637e-1830.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO332971.988e-1528.91Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of WD_REPEATS_REGION domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
taf53.183e-5326.70TATA-box binding protein associated factor 5 [Sour... [more]
taf5l1.705e-2731.84TATA-box binding protein associated factor 5 like ... [more]
gnb3a6.345e-1532.12G protein subunit beta 3 [Source:NCBI gene;Acc:101... [more]
wdr56.853e-1525.58WD repeat domain 5 [Source:NCBI gene;Acc:101166483... [more]
wdr611.570e-1427.43WD repeat domain 61 [Source:NCBI gene;Acc:10117240... [more]
back to top
BLAST of WD_REPEATS_REGION domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000005136.10.000e+098.18SMESG000005136.1[more]
SMESG000013017.14.388e-11434.19SMESG000013017.1[more]
SMESG000024482.18.079e-1734.09SMESG000024482.1[more]
SMESG000018712.17.304e-1430.30SMESG000018712.1[more]
SMESG000026747.11.132e-1329.11SMESG000026747.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30028454 ID=SMED30028454|Name=WD_REPEATS_REGION domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1922bp
CAAAATTCAAACTTTTATTAAATGACCCGAGATTTATTAACCTTATTTGA
ATTGATTGGGAAATATAATTTAACAGAGACTAGAATTATTTTGAAATGTG
AATCTGGAATTACTGAATCAATGAGCTCTATTACCAGTTCGTCTTTGAGT
GACCAATATTCTGAATTTTATAAATTTGTTAAAAATTCATCAACCATTCA
TCACCCCCAATTACGAGTTTTCCTCTATCCGGTATTTGTGCATATTTATT
TCCACTTGCTCTCTACAGGACAAACTGATCAGGCTAATAAGTTCTTAACA
AGGTTTGCCAAATCTCAAGAGATCATTTATAAACGCGATATTTTGGATTT
GCAAATGTTTCCTCTGTCATGTGGAGATGGTCACAATTGTTTATTGGACA
TTTTTCGTGCCAATAAATTTGCTGTTAGAATTTCTAGACTCAGTTGGGAA
TATGTTCAACAGAATTTCCTGGAAAATAAAATTATGAAAGATCTGTCTAA
TCTCATCAATGAGAATCTGAAAATCGATTTAATTGAAAAATTTCCTCGAA
ATGAAATGGAAATAGATTGCTGTCGAGGGGGATTTTCCGGAGAATCAATT
CCCGAGGAAAATCTGCTGGTATTTGATCCAGATTTATCCGTTATTGATTT
GCAAGATCCTAATATCAAGCGATCAAAGCCGTCAGCTATGACTAGTCAAA
AGAGACGATTGATTGAAAGAAAATGTGAAGAGTCGAGCACGTTAGAAGAT
GTGACGGATCAGTTGTCGTTCGACAGCATTTTGCACGGAGTTGGTGGGCT
CGGTAACAGTGTTGGGATTTGTGCAGCATTCAGTAAGGATTGCGATTTTT
TAGCTGTTGGGACCGTGACTGGTGATATATATGTTAACTGGCATCGTACC
AGTTGTCGCGATTATCCCCCTGACAATGCGGATAATGCACAATTCGATCT
GATTTCAGGTCATTCAGGTGCAGTTTATGAGATGAGCTGGTCGAAAAATC
AGCAGTTATTGATTTCTGCTTCAAGTGACGGCACAGTAAAATGCTGGCGC
ACCGCAACAAAAGATTGCATGACAACATTTTCTGCGCCTGGACCGATTTG
GTCAGTCGACTTGTCACCGTTATCCGAAAATTTGTTGGTTTGCGGCACCA
ACAAGGAATCGATCAATGTGTACGCACTCGATCATCCCGATCCAATTAGG
CAGTTTTCACGTGATATCCATGGAGCAGTTACTTGCGTTAGATTCCATGG
CAACGACAATTATATCGCGTCAGGGGGCGTTGACAGGACTGTGCGACTAT
TTGACATACGTTCAGGAACGCTTGTCAGGTCATTCACTGGTCACAAGGGA
ATTGTTAGTTCTCTTCGCTTTTCATTGGATGGGAAATATTTGATCAGTGG
ATGTGAAATGGGCAAAGTAAATATTTGGGATTTAACCAGCTCTAATTGGC
TGCTCAAATCCCTCTCATCCGATGACTACAGTGGGAATTCAAGGGGGGCC
GTGATGAATATGGATTTATGCAGGAATCTCCAATTATTGGTAGTTGGACG
CAGAGAGGGACAGATTGATGTGTGGGACTATCGTGCATTGATTGGTTCGA
ATGCGGAGCAACAGGGCAGGAGCTATGAGACCAATCAGTTCGGTAGTTCT
CTTTGCACTGAGACTGATTCAGATGAATCGATGCTGTACTTGGTTACTGA
CCCAAGACGAGCTGGACTTTGTGATACTTTGTACACCAAAACGTTCCCGG
TAATGGCTTTGCAATTTAATCGTCGTGATATTCTTCATTGTTGCGTGTTT
TACAGTGGCCTCTTAAGAGATCGGTCCCCGTAATCCACTGAATTATTCCA
GAAATTTATCCTAATTTTTAGTGTTTACAACTGCTAATATATTTTTCTAA
ATTGTTATTTGTTGCTGCCGTG
back to top

protein sequence of SMED30028454-orf-1

>SMED30028454-orf-1 ID=SMED30028454-orf-1|Name=SMED30028454-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=604bp
MTRDLLTLFELIGKYNLTETRIILKCESGITESMSSITSSSLSDQYSEFY
KFVKNSSTIHHPQLRVFLYPVFVHIYFHLLSTGQTDQANKFLTRFAKSQE
IIYKRDILDLQMFPLSCGDGHNCLLDIFRANKFAVRISRLSWEYVQQNFL
ENKIMKDLSNLINENLKIDLIEKFPRNEMEIDCCRGGFSGESIPEENLLV
FDPDLSVIDLQDPNIKRSKPSAMTSQKRRLIERKCEESSTLEDVTDQLSF
DSILHGVGGLGNSVGICAAFSKDCDFLAVGTVTGDIYVNWHRTSCRDYPP
DNADNAQFDLISGHSGAVYEMSWSKNQQLLISASSDGTVKCWRTATKDCM
TTFSAPGPIWSVDLSPLSENLLVCGTNKESINVYALDHPDPIRQFSRDIH
GAVTCVRFHGNDNYIASGGVDRTVRLFDIRSGTLVRSFTGHKGIVSSLRF
SLDGKYLISGCEMGKVNIWDLTSSNWLLKSLSSDDYSGNSRGAVMNMDLC
RNLQLLVVGRREGQIDVWDYRALIGSNAEQQGRSYETNQFGSSLCTETDS
DESMLYLVTDPRRAGLCDTLYTKTFPVMALQFNRRDILHCCVFYSGLLRD
RSP*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0006886intracellular protein transport
GO:0015031protein transport
GO:0016192vesicle-mediated transport
GO:0006351transcription, DNA-templated
GO:0006355regulation of transcription, DNA-templated
GO:0043966histone H3 acetylation
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0030117membrane coat
GO:0000932P-body
GO:0005634nucleus
GO:0016607nuclear speck
GO:0030914STAGA complex
GO:0033276transcription factor TFTC complex
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
Vocabulary: INTERPRO
TermDefinition
IPR037264TFIID_NTD2_sf
IPR036322WD40_repeat_dom_sf
IPR015943WD40/YVTN_repeat-like_dom_sf
IPR017986WD40_repeat_dom
IPR001680WD40_repeat
IPR007582TFIID_NTD2
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0003713transcription coactivator activity
GO:0004402histone acetyltransferase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001680WD40 repeatSMARTSM00320WD40_4coord: 346..385
e-value: 0.45
score: 19.2
coord: 431..470
e-value: 8.5E-8
score: 41.9
coord: 304..343
e-value: 1.0E-6
score: 38.3
coord: 474..519
e-value: 53.0
score: 6.1
coord: 388..428
e-value: 3.8E-7
score: 39.7
IPR001680WD40 repeatPFAMPF00400WD40coord: 399..428
e-value: 4.4E-6
score: 27.3
coord: 433..470
e-value: 5.3E-4
score: 20.7
coord: 312..342
e-value: 5.2E-5
score: 23.9
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 438..479
score: 12.346
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 311..352
score: 14.953
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 403..437
score: 10.943
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 358..594
e-value: 6.6E-36
score: 125.9
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 234..357
e-value: 1.8E-15
score: 59.0
IPR037264TFIID subunit TAF5, NTD2 domain superfamilyGENE3DG3DSA:1.25.40.500coord: 25..172
e-value: 2.3E-25
score: 91.5
IPR037264TFIID subunit TAF5, NTD2 domain superfamilySUPERFAMILYSSF160897Taf5 N-terminal domain-likecoord: 41..171
IPR007582TFIID subunit TAF5, NTD2 domainPFAMPF04494TFIID_NTD2coord: 40..166
e-value: 1.4E-21
score: 77.1
IPR007582TFIID subunit TAF5, NTD2 domainCDDcd08044TAF5_NTD2coord: 44..172
e-value: 2.31751E-23
score: 93.797
NoneNo IPR availablePANTHERPTHR19879TRANSCRIPTION INITIATION FACTOR TFIIDcoord: 12..588
NoneNo IPR availableCDDcd00200WD40coord: 267..521
e-value: 2.22995E-39
score: 144.015
IPR017986WD40-repeat-containing domainPROSITEPS50294WD_REPEATS_REGIONcoord: 311..528
score: 29.425
IPR036322WD40-repeat-containing domain superfamilySUPERFAMILYSSF50978WD40 repeat-likecoord: 265..520