Lysosomal alpha-glucosidase

Overview
NameLysosomal alpha-glucosidase
Smed IDSMED30028453
Length (bp)2906
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Lysosomal alpha-glucosidase (SMED30028453) t-SNE clustered cells

Violin plots show distribution of expression levels for Lysosomal alpha-glucosidase (SMED30028453) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Lysosomal alpha-glucosidase (SMED30028453) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Lysosomal alpha-glucosidase (SMED30028453) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30028453

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30028453SMESG000005050.1 dd_Smed_v4_1062_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30028453SMESG000005050.1 dd_Smed_v4_1062_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30028453SMESG000005050.1 dd_Smed_v4_1062_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30028453SMESG000005054.1 dd_Smed_v4_5392_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30028453SMESG000005054.1 dd_Smed_v4_5392_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30028453SMESG000005050.1 dd_Smed_v6_1062_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Human
Match: GAA (glucosidase alpha, acid [Source:HGNC Symbol;Acc:HGNC:4065])

HSP 1 Score: 693.345 bits (1788), Expect = 0.000e+0
Identity = 347/820 (42.32%), Postives = 506/820 (61.71%), Query Frame = 2
Query:  170 QCSVPNNNYRLDCFPGSNANQNDCLARGCCWSPPETREYSQNNPTIPYCFFPIEYPNYQINSFTPTDRGFKARLTKQQKSFLRKEILNLNFEVIFETNTRLRIRITDPNVQRFEVPIQ---LGSPDPTPPSNIQYKFTMPTNGSFGFEVKRNSDGLSLFKT-FGPLLYSDQFIQISSLMSIQHVYGIGEQNRPFLHDLSTQWERIGLWARDNGIDTYNNLYGTHPFYMSLPDSGEAFGVYYFNSNAQEFVLQPAPAITYRTIGGILDIFIFSGGTPETTVSQYTELIGRPMLPPFWSLGFHLSKYGYKSIADVSNTLYRNINISIPIEVQWSDIDYMDKYKDFTSDPIRYPNFGSFVAHLNQSLGIKYIVIIDPGISIQSP-GVYSAYDEGLELNIFIKDANTKKDLISNVWPGETCFPDFTHPNASKYWSHQIQRFHSQVPIDGLWIDMNEPSNFYDGSRTGCALNNPYDYPFFVPTIRDGSLIKKTICSSSLHYNNVMHYNLHNLYGYTEAVATHSALLNTIPNKRPFILSRSTFSGSGKYTFHWTGDNSANWDQLANSIRQVLNFNMFGIPMTGADICGFNGDSNEELCIRWMQLGAFYPFMRNHNSIGAKAQDPASWSQEAQIIMKKSIIIRYVWLPNFYTLLVKSYLYGGTVMRPLSFQFYSDAETHEIERQFMIGSSMLVNPVVVQGARNVVAYFPAGIWYDATDLSVIYSG---------------KTGKWISLNAPLERTNVALRGGHALILSSL-VNSTEYSRKVINLVCILSMNQTAAGDLYWDDGESMDSYSGKKFSYFKFTATSSSVL 2566
            QC VP N+ R DC P     Q  C ARGCC+ P + +         P+CFFP  YP+Y++ + + ++ G+ A LT+   +F  K+IL L  +V+ ET  RL   I DP  +R+EVP++   + S  P+P  ++++     +   FG  V+R  DG  L  T   PL ++DQF+Q+S+ +  Q++ G+ E   P +  LST W RI LW RD       NLYG+HPFY++L D G A GV+  NSNA + VLQP+PA+++R+ GGILD++IF G  P++ V QY +++G P +PP+W LGFHL ++GY S A     +        P++VQW+D+DYMD  +DFT +   + +F + V  L+Q  G +Y++I+DP IS   P G Y  YDEGL   +FI +  T + LI  VWPG T FPDFT+P A  +W   +  FH QVP DG+WIDMNEPSNF  GS  GC  NN  + P +VP +  G+L   TIC+SS  + +  HYNLHNLYG TEA+A+H AL+      RPF++SRSTF+G G+Y  HWTGD  ++W+QLA+S+ ++L FN+ G+P+ GAD+CGF G+++EELC+RW QLGAFYPFMRNHNS+ +  Q+P S+S+ AQ  M+K++ +RY  LP+ YTL  ++++ G TV RPL  +F  D+ T  ++ Q + G ++L+ PV+  G   V  YFP G WYD   + V   G                 G+W++L APL+  NV LR G+ + L    + +TE  ++ + L   L+    A G+L+WDDGES++      ++   F A +++++
Sbjct:   81 QCDVPPNS-RFDCAPDKAITQEQCEARGCCYIPAK-QGLQGAQMGQPWCFFPPSYPSYKLENLSSSEMGYTATLTRTTPTFFPKDILTLRLDVMMETENRLHFTIKDPANRRYEVPLETPHVHSRAPSPLYSVEF-----SEEPFGVIVRRQLDGRVLLNTTVAPLFFADQFLQLSTSLPSQYITGLAEHLSPLM--LSTSWTRITLWNRDLAPTPGANLYGSHPFYLALEDGGSAHGVFLLNSNAMDVVLQPSPALSWRSTGGILDVYIFLGPEPKSVVQQYLDVVGYPFMPPYWGLGFHLCRWGYSSTAITRQVVENMTRAHFPLDVQWNDLDYMDSRRDFTFNKDGFRDFPAMVQELHQG-GRRYMMIVDPAISSSGPAGSYRPYDEGLRRGVFITN-ETGQPLIGKVWPGSTAFPDFTNPTALAWWEDMVAEFHDQVPFDGMWIDMNEPSNFIRGSEDGCP-NNELENPPYVPGVVGGTLQAATICASSHQFLST-HYNLHNLYGLTEAIASHRALVKAR-GTRPFVISRSTFAGHGRYAGHWTGDVWSSWEQLASSVPEILQFNLLGVPLVGADVCGFLGNTSEELCVRWTQLGAFYPFMRNHNSLLSLPQEPYSFSEPAQQAMRKALTLRYALLPHLYTLFHQAHVAGETVARPLFLEFPKDSSTWTVDHQLLWGEALLITPVLQAGKAEVTGYFPLGTWYDLQTVPVEALGSLPPPPAAPREPAIHSEGQWVTLPAPLDTINVHLRAGYIIPLQGPGLTTTESRQQPMALAVALTKGGEARGELFWDDGESLEVLERGAYTQVIFLARNNTIV 886          
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Human
Match: GAA (glucosidase alpha, acid [Source:HGNC Symbol;Acc:HGNC:4065])

HSP 1 Score: 693.345 bits (1788), Expect = 0.000e+0
Identity = 347/820 (42.32%), Postives = 506/820 (61.71%), Query Frame = 2
Query:  170 QCSVPNNNYRLDCFPGSNANQNDCLARGCCWSPPETREYSQNNPTIPYCFFPIEYPNYQINSFTPTDRGFKARLTKQQKSFLRKEILNLNFEVIFETNTRLRIRITDPNVQRFEVPIQ---LGSPDPTPPSNIQYKFTMPTNGSFGFEVKRNSDGLSLFKT-FGPLLYSDQFIQISSLMSIQHVYGIGEQNRPFLHDLSTQWERIGLWARDNGIDTYNNLYGTHPFYMSLPDSGEAFGVYYFNSNAQEFVLQPAPAITYRTIGGILDIFIFSGGTPETTVSQYTELIGRPMLPPFWSLGFHLSKYGYKSIADVSNTLYRNINISIPIEVQWSDIDYMDKYKDFTSDPIRYPNFGSFVAHLNQSLGIKYIVIIDPGISIQSP-GVYSAYDEGLELNIFIKDANTKKDLISNVWPGETCFPDFTHPNASKYWSHQIQRFHSQVPIDGLWIDMNEPSNFYDGSRTGCALNNPYDYPFFVPTIRDGSLIKKTICSSSLHYNNVMHYNLHNLYGYTEAVATHSALLNTIPNKRPFILSRSTFSGSGKYTFHWTGDNSANWDQLANSIRQVLNFNMFGIPMTGADICGFNGDSNEELCIRWMQLGAFYPFMRNHNSIGAKAQDPASWSQEAQIIMKKSIIIRYVWLPNFYTLLVKSYLYGGTVMRPLSFQFYSDAETHEIERQFMIGSSMLVNPVVVQGARNVVAYFPAGIWYDATDLSVIYSG---------------KTGKWISLNAPLERTNVALRGGHALILSSL-VNSTEYSRKVINLVCILSMNQTAAGDLYWDDGESMDSYSGKKFSYFKFTATSSSVL 2566
            QC VP N+ R DC P     Q  C ARGCC+ P + +         P+CFFP  YP+Y++ + + ++ G+ A LT+   +F  K+IL L  +V+ ET  RL   I DP  +R+EVP++   + S  P+P  ++++     +   FG  V+R  DG  L  T   PL ++DQF+Q+S+ +  Q++ G+ E   P +  LST W RI LW RD       NLYG+HPFY++L D G A GV+  NSNA + VLQP+PA+++R+ GGILD++IF G  P++ V QY +++G P +PP+W LGFHL ++GY S A     +        P++VQW+D+DYMD  +DFT +   + +F + V  L+Q  G +Y++I+DP IS   P G Y  YDEGL   +FI +  T + LI  VWPG T FPDFT+P A  +W   +  FH QVP DG+WIDMNEPSNF  GS  GC  NN  + P +VP +  G+L   TIC+SS  + +  HYNLHNLYG TEA+A+H AL+      RPF++SRSTF+G G+Y  HWTGD  ++W+QLA+S+ ++L FN+ G+P+ GAD+CGF G+++EELC+RW QLGAFYPFMRNHNS+ +  Q+P S+S+ AQ  M+K++ +RY  LP+ YTL  ++++ G TV RPL  +F  D+ T  ++ Q + G ++L+ PV+  G   V  YFP G WYD   + V   G                 G+W++L APL+  NV LR G+ + L    + +TE  ++ + L   L+    A G+L+WDDGES++      ++   F A +++++
Sbjct:   81 QCDVPPNS-RFDCAPDKAITQEQCEARGCCYIPAK-QGLQGAQMGQPWCFFPPSYPSYKLENLSSSEMGYTATLTRTTPTFFPKDILTLRLDVMMETENRLHFTIKDPANRRYEVPLETPHVHSRAPSPLYSVEF-----SEEPFGVIVRRQLDGRVLLNTTVAPLFFADQFLQLSTSLPSQYITGLAEHLSPLM--LSTSWTRITLWNRDLAPTPGANLYGSHPFYLALEDGGSAHGVFLLNSNAMDVVLQPSPALSWRSTGGILDVYIFLGPEPKSVVQQYLDVVGYPFMPPYWGLGFHLCRWGYSSTAITRQVVENMTRAHFPLDVQWNDLDYMDSRRDFTFNKDGFRDFPAMVQELHQG-GRRYMMIVDPAISSSGPAGSYRPYDEGLRRGVFITN-ETGQPLIGKVWPGSTAFPDFTNPTALAWWEDMVAEFHDQVPFDGMWIDMNEPSNFIRGSEDGCP-NNELENPPYVPGVVGGTLQAATICASSHQFLST-HYNLHNLYGLTEAIASHRALVKAR-GTRPFVISRSTFAGHGRYAGHWTGDVWSSWEQLASSVPEILQFNLLGVPLVGADVCGFLGNTSEELCVRWTQLGAFYPFMRNHNSLLSLPQEPYSFSEPAQQAMRKALTLRYALLPHLYTLFHQAHVAGETVARPLFLEFPKDSSTWTVDHQLLWGEALLITPVLQAGKAEVTGYFPLGTWYDLQTVPVEALGSLPPPPAAPREPAIHSEGQWVTLPAPLDTINVHLRAGYIIPLQGPGLTTTESRQQPMALAVALTKGGEARGELFWDDGESLEVLERGAYTQVIFLARNNTIV 886          
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Human
Match: MGAM (maltase-glucoamylase [Source:HGNC Symbol;Acc:HGNC:7043])

HSP 1 Score: 631.713 bits (1628), Expect = 0.000e+0
Identity = 346/841 (41.14%), Postives = 500/841 (59.45%), Query Frame = 2
Query:  164 ALQCSVPNNNYRLDCFPGSNANQNDCLARGCCWSPPETREYSQNNPTIPYCFFPIEYPNYQINSFTPTDRGFKARLTKQQKS-FLRKEILNLNFEVIFETNTRLRIRITDPNVQRFEVPIQ-LGSPDPTPPSNIQYKFTMPTNGSFGFEVKRNSDGLSLF-KTFGPLLYSDQFIQISSLMSIQHVYGIGEQ-NRPFLHDLSTQWERIGLWARD---NGIDTYNNLYGTHPFYMSLPD-SGEAFGVYYFNSNAQEFVLQPAPAITYRTIGGILDIFIFSGGTPETTVSQYTELIGRPMLPPFWSLGFHLSKYGYKSIADVSNTLYRNINISIPIEVQWSDIDYMDKYKDFTSDPIRYPNFGSFVAHLNQSLGIKYIVIIDPGISIQSPGV--YSAYDEGLELNIFIKDANTKKDLISNVWPGETCFPDFTHPNASKYWSHQIQRFHSQVPIDGLWIDMNEPSNFYDGSRTGCALNNPYDYPFFVPTIRDGSLIKKTICSSSLHYNNVMHYNLHNLYGYTEAVATHSALLNTIPNKRPFILSRSTFSGSGKYTFHWTGDNSANWDQLANSIRQVLNFNMFGIPMTGADICGFNGDSNEELCIRWMQLGAFYPFMRNHNSIGAKAQDPASWSQEAQII--MKKSIIIRYVWLPNFYTLLVKSYLYGGTVMRPLSFQFYSDAETHEIERQFMIGSSMLVNPVVVQGARNVVAYFPAGIWYDATDLSVIYSGKTGKW----ISLNAPLERTNVALRGGHALILSSLVNSTEYSRK-VINLVCILSMNQTAAGDLYWDDGESMDSYSGKKFSYFKFTATSSSVLINPEILGYSVLPSL--NSIIILG 2629
            + +C V N   R++C P     +  C  RGCCW+P       Q   ++P+C++   +  +   +   T+ GF ARL     S      + N+     ++T+ R   ++TD    RFEVP + + S      +++ Y+  + +   F  +V R S+   LF  + GPLL++DQF+Q+S+ +   +VYG+GE  ++ + HD++  W+   ++ RD   NG  T  NLYG   F++ L D SG +FGV+  NSNA E VLQPAPAITYRTIGGILD ++F G TPE  V +Y ELIGRP LP +W+LGFHLS+Y Y ++ ++   + RN    +P +VQ +DIDYMD+ +DFT D + +  F  FV  L+ + G K ++I+DP IS  S     Y  YD G ++ I++  ++    LI  VWPG+T FPD+T+PN + +W+ + + FH+QV  DG+WIDMNE SNF DGS +GC+ NN  + P F P I DG L  KT+C  ++ +     Y++HNLYGY+ AVAT  A     PNKR FIL+RSTF+GSGK+  HW GDN+A WD L  SI  VL FN+FGIPM G DICGF  D+ EELC RWMQLGAFYPF RNHN  G K QDPAS+  ++ ++   +  + IRY  LP  YTL  +++  G TV RPL  +FY D  T ++ +QF+ G  +L+ PV+ +GA  V+AY P  +WYD        +G   +W    + +  P ++  + LRGG+         +T  SRK  + L+  L  N+ A G+L+WD+GE+ D+ + K +   +F+ T + + +N     Y    +L  N I ILG
Sbjct:   87 SAECPVVNELERINCIPDQPPTKATCDQRGCCWNP-------QGAVSVPWCYYSKNHSYHVEGNLVNTNAGFTARLKNLPSSPVFGSNVDNVLLTAEYQTSNRFHFKLTDQTNNRFEVPHEHVQSFSGNAAASLTYQVEI-SRQPFSIKVTRRSNNRVLFDSSIGPLLFADQFLQLSTRLPSTNVYGLGEHVHQQYRHDMN--WKTWPIFNRDTTPNGNGT--NLYGAQTFFLCLEDASGLSFGVFLMNSNAMEVVLQPAPAITYRTIGGILDFYVFLGNTPEQVVQEYLELIGRPALPSYWALGFHLSRYEYGTLDNMREVVERNRAAQLPYDVQHADIDYMDERRDFTYDSVDFKGFPEFVNELHNN-GQKLVIIVDPAISNNSSSSKPYGPYDRGSDMKIWVNSSDGVTPLIGEVWPGQTVFPDYTNPNCAVWWTKEFELFHNQVEFDGIWIDMNEVSNFVDGSVSGCSTNN-LNNPPFTPRILDGYLFCKTLCMDAVQHWG-KQYDIHNLYGYSMAVATAEAAKTVFPNKRSFILTRSTFAGSGKFAAHWLGDNTATWDDLRWSIPGVLEFNLFGIPMVGPDICGFALDTPEELCRRWMQLGAFYPFSRNHNGQGYKDQDPASFGADSLLLNSSRHYLNIRYTLLPYLYTLFFRAHSRGDTVARPLLHEFYEDNSTWDVHQQFLWGPGLLITPVLDEGAEKVMAYVPDAVWYDYE------TGSQVRWRKQKVEMELPGDKIGLHLRGGYIFPTQQPNTTTLASRKNPLGLIIALDENKEAKGELFWDNGETKDTVANKVYLLCEFSVTQNRLEVNISQSTYKDPNNLAFNEIKILG 906          

HSP 2 Score: 563.148 bits (1450), Expect = 9.178e-174
Identity = 321/891 (36.03%), Postives = 495/891 (55.56%), Query Frame = 2
Query:  116 LKLLLIISLNFII-VSNALQCSVP-NNNYRLDCFPGSN-ANQNDCLARGCCWSPPETREYSQNNPTIPYCFFPIEYPNYQINSFTPTDRGFKARLTKQQK----SFLRKEILNLNFEVIFETNTRLRIRITDPNVQRFEVPIQLGSPD-PTPPSNIQYKFTMPTNGSFGFEVKRNSDGLSLFKT-FGPLLYSDQFIQISSLMSIQHVYGIGE-QNRPFLHDLSTQWERIGLWARDNGIDTYNNLYGTHPFYMSLPDSGEAFGVYYFNSNAQEFVLQPAPAITYRTIGGILDIFIFSGGTPETTVSQYTELIGRPMLPPFWSLGFHLSKYGYKSIADVSNTLYRNINISIPIEVQWSDIDYMDKYKDFTSDPIRYPNFGSFVAHLN--QSLGIKYIVIIDPGISIQSPGVYSAYDEGLELNIFIKDANTKKDLISNVWP---------------------GETCFPDFTHPNASKYWSHQIQRFHS-------QVPIDGLWIDMNEPSNFYDGSRTGCALNNPYDYPFFVPTI--RDGSLIKKTICSSSLHY----NNVMHYNLHNLYGYTEAVATHSALLNTIPNKRPFILSRSTFSGSGKYTFHWTGDNSANWDQLANSIRQVLNFNMFGIPMTGADICGFNGDSNEELCIRWMQLGAFYPFMRNHNSIGAKAQDPASWSQEAQIIMKKSIIIRYVWLPNFYTLLVKSYLYGGTVMRPLSFQFYSDAETHEIERQFMIGSSMLVNPVVVQGARNVVAYFPAGIWYDATDLSVIYSG----KTGKWISLNAPLERTNVALRGGHALILSSLVNSTEYSRK-VINLVCILSMNQTAAGDLYWDDGESMDSYSGKKFSYFKFTATSSSVLINPEILGYSVLPSL--NSIIILG 2629
            LK+ +I  ++ ++  +  ++ S+   +  ++DC+P  N A+  +C ARGC W        + N+  +P+C+F  +   Y ++       G  A ++ +      +F    +  L  +V +  N  L+ +I DPN  R+EVP+ L  P  P+     Q    +     FG E++R S G  ++ +      +SD FI+IS+ +  +++YG GE ++R +  DL  +W   G+++RD       N YG HP+YM L + G A GV   NSNA +   QP PA+TYRT GG+LD ++F G TPE    QYTELIGRP++ P+WSLGF L +YGY++ +++++     +   IP +VQ+SDIDYM++  DFT  P     F  F A +N  ++ G++ I+I+DP IS      Y A+  G+E ++FIK  N    +   VWP                         FPDF   + +K+W  +I+  ++        +  DG+WIDMNEPS+F +G+ +    +   ++P ++P +  RD  L  KT+C  S       + V HYN+HNLYG+++   T+ A+   +  +R  +++RSTF  SG++  HW GDN+A WDQL  SI  ++ F++FGI  TGADICGF  D+  E+C+RWMQLGAFYPF RNHN+IG + QDP SW      I +  +  RY  LP  YTL+ K++  G TV+RPL  +F SD  T +I+ QF++G + LV+PV+ + ARNV AYFP   WYD       Y+G      G+W +L APL+  N+ +RGG+ L       +T  SRK  + L+  L  N+ A G+L+WDDG++ D+ + K +   +F+ T + + +      Y    +L  N I ILG
Sbjct:  934 LKVAIITDIDLLLGEAYTVEWSIKIRDEEKIDCYPDENGASAENCTARGCIWE-------ASNSSGVPFCYFVNDL--YSVSDVQYNSHGATADISLKSSVYANAFPSTPVNPLRLDVTYHKNEMLQFKIYDPNKNRYEVPVPLNIPSMPSSTPEGQLYDVLIKKNPFGIEIRRKSTGTIIWDSQLLGFTFSDMFIRISTRLPSKYLYGFGETEHRSYRRDL--EWHTWGMFSRDQPPGYKKNSYGVHPYYMGLEEDGSAHGVLLLNSNAMDVTFQPLPALTYRTTGGVLDFYVFLGPTPELVTQQYTELIGRPVMVPYWSLGFQLCRYGYQNDSEIASLYDEMVAAQIPYDVQYSDIDYMERQLDFTLSP----KFAGFPALINRMKADGMRVILILDPAISGNETQPYPAFTRGVEDDVFIKYPNDGDIVWGKVWPDFPDVVVNGSLDWDSQVELYRAYVAFPDFFRNSTAKWWKREIEELYNNPQNPERSLKFDGMWIDMNEPSSFVNGAVSPGCRDASLNHPPYMPHLESRDRGLSSKTLCMESQQILPDGSLVQHYNVHNLYGWSQTRPTYEAV-QEVTGQRGVVITRSTFPSSGRWAGHWLGDNTAAWDQLKKSIIGMMEFSLFGISYTGADICGFFQDAEYEMCVRWMQLGAFYPFSRNHNTIGTRRQDPVSWDAAFVNISRNVLQTRYTLLPYLYTLMQKAHTEGVTVVRPLLHEFVSDQVTWDIDSQFLLGPAFLVSPVLERNARNVTAYFPRARWYD------YYTGVDINARGEWKTLPAPLDHINLHVRGGYILPWQEPALNTHLSRKNPLGLIIALDENKEAKGELFWDDGQTKDTVAKKVYLLCEFSVTQNHLEVTISQSTYKDPNNLAFNEIKILG 1802          

HSP 3 Score: 553.518 bits (1425), Expect = 1.833e-170
Identity = 314/867 (36.22%), Postives = 481/867 (55.48%), Query Frame = 2
Query:  116 LKLLLIISLN-FIIVSNALQCSVP-NNNYRLDCFPGSNANQ-NDCLARGCCWSPPETREYSQNNPTIPYCFFPIEYPNYQINSFTPTDRGFKARLTKQQK----SFLRKEILNLNFEVIFETNTRLRIRITDPNVQRFEVPIQLGSPD-PTPPSNIQYKFTMPTNGSFGFEVKRNSDGLSLFKT-FGPLLYSDQFIQISSLMSIQHVYGIGE-QNRPFLHDLSTQWERIGLWARDNGIDTYNNLYGTHPFYMSLPDSGEAFGVYYFNSNAQEFVLQPAPAITYRTIGGILDIFIFSGGTPETTVSQYTELIGRPMLPPFWSLGFHLSKYGYKSIADVSNTLYRNINISIPIEVQWSDIDYMDKYKDFTSDPIRYPNFGSFVAHLN--QSLGIKYIVIIDPGISIQSPGVYSAYDEGLELNIFIKDANTKKDLISNVWP---------------------GETCFPDFTHPNASKYWSHQIQRFHS-------QVPIDGLWIDMNEPSNFYDGSRTGCALNNPYDYPFFVPTI--RDGSLIKKTICSSSLHY----NNVMHYNLHNLYGYTEAVATHSALLNTIPNKRPFILSRSTFSGSGKYTFHWTGDNSANWDQLANSIRQVLNFNMFGIPMTGADICGFNGDSNEELCIRWMQLGAFYPFMRNHNSIGAKAQDPASWSQEAQIIMKKSIIIRYVWLPNFYTLLVKSYLYGGTVMRPLSFQFYSDAETHEIERQFMIGSSMLVNPVVVQGARNVVAYFPAGIWYDATDLSVIYSG----KTGKWISLNAPLERTNVALRGGHALILSSLVNSTEYSR-KVINLVCILSMNQTAAGDLYWDDGESMDSYSGKKFSYFKFTATSSSV 2563
            LK+ +I  +N F+  +  ++ S+   +  ++DC+P  N +   +C ARGC W        + N+  +P+C+F  +   Y ++       G  A ++ +      +F    +  L  +V +  N  L+ +I DPN  R+EVP+ L  P  P+     Q    +     FG E++R S G  ++ +      ++D FI+IS+ +  +++YG GE ++  +  DL  +W   G+++RD       N YG HP+YM L + G A GV   NSNA +   QP PA+TYRT GG+LD ++F G TPE    QYTELIGRP++ P+WSLGF L +YGY++ +++S+     +   IP +VQ+SDIDYM++  DFT  P     F  F A +N  ++ G++ I+I+DP IS      Y A+  G+E ++FIK  N    +   VWP                         FPDF   + +K+W  +I+  ++        +  DG+WIDMNEPS+F +G+ +    +   ++P ++P +  RD  L  KT+C  S       + V HYN+HNLYG+++   T+ A+   +  +R  +++RSTF  SG++  HW GDN+A WDQL  SI  ++ F++FGI  TGADICGF  D+  E+C+RWMQLGAFYPF RNHN+IG + QDP SW      I +  +  RY  LP  YTL+ K++  G TV+RPL  +F SD  T +I+ QF++G + LV+PV+ + ARNV AYFP   WYD       Y+G      G+W +L APL+  N+ +RGG+ L       +T  SR K +     L    TA G L+WDDG+S+D+Y    +    F+A+ +++
Sbjct: 1830 LKVAIITDINLFLGEAYTVEWSIKIRDEEKIDCYPDENGDSAENCTARGCIWE-------ASNSSGVPFCYFVNDL--YSVSDVQYNSHGATADISLKSSVHANAFPSTPVNPLRLDVTYHKNEMLQFKIYDPNNNRYEVPVPLNIPSVPSSTPEGQLYDVLIKKNPFGIEIRRKSTGTIIWDSQLLGFTFNDMFIRISTRLPSKYLYGFGETEHTSYRRDL--EWHTWGMFSRDQPPGYKKNSYGVHPYYMGLEEDGSAHGVLLLNSNAMDVTFQPLPALTYRTTGGVLDFYVFLGPTPELVTQQYTELIGRPVMVPYWSLGFQLCRYGYQNDSEISSLYDEMVAAQIPYDVQYSDIDYMERQLDFTLSP----KFAGFPALINRMKADGMRVILILDPAISGNETQPYPAFTRGVEDDVFIKYPNDGDIVWGKVWPDFPDVVVNGSLDWDSQVELYRAYVAFPDFFRNSTAKWWKREIEELYNNPQNPERSLKFDGMWIDMNEPSSFVNGAVSPGCRDASLNHPPYMPYLESRDRGLSSKTLCMESQQILPDGSPVQHYNVHNLYGWSQTRPTYEAV-QEVTGQRGVVITRSTFPSSGRWAGHWLGDNTAAWDQLKKSIIGMMEFSLFGISYTGADICGFFQDAEYEMCVRWMQLGAFYPFSRNHNTIGTRRQDPVSWDVAFVNISRTVLQTRYTLLPYLYTLMHKAHTEGVTVVRPLLHEFVSDQVTWDIDSQFLLGPAFLVSPVLERNARNVTAYFPRARWYD------YYTGVDINARGEWKTLPAPLDHINLHVRGGYILPWQEPALNTHLSRQKFMGFKIALDDEGTAGGWLFWDDGQSIDTYGKGLYYLASFSASQNTM 2674          
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Human
Match: MGAM (maltase-glucoamylase [Source:HGNC Symbol;Acc:HGNC:7043])

HSP 1 Score: 631.328 bits (1627), Expect = 0.000e+0
Identity = 346/841 (41.14%), Postives = 500/841 (59.45%), Query Frame = 2
Query:  164 ALQCSVPNNNYRLDCFPGSNANQNDCLARGCCWSPPETREYSQNNPTIPYCFFPIEYPNYQINSFTPTDRGFKARLTKQQKS-FLRKEILNLNFEVIFETNTRLRIRITDPNVQRFEVPIQ-LGSPDPTPPSNIQYKFTMPTNGSFGFEVKRNSDGLSLF-KTFGPLLYSDQFIQISSLMSIQHVYGIGEQ-NRPFLHDLSTQWERIGLWARD---NGIDTYNNLYGTHPFYMSLPD-SGEAFGVYYFNSNAQEFVLQPAPAITYRTIGGILDIFIFSGGTPETTVSQYTELIGRPMLPPFWSLGFHLSKYGYKSIADVSNTLYRNINISIPIEVQWSDIDYMDKYKDFTSDPIRYPNFGSFVAHLNQSLGIKYIVIIDPGISIQSPGV--YSAYDEGLELNIFIKDANTKKDLISNVWPGETCFPDFTHPNASKYWSHQIQRFHSQVPIDGLWIDMNEPSNFYDGSRTGCALNNPYDYPFFVPTIRDGSLIKKTICSSSLHYNNVMHYNLHNLYGYTEAVATHSALLNTIPNKRPFILSRSTFSGSGKYTFHWTGDNSANWDQLANSIRQVLNFNMFGIPMTGADICGFNGDSNEELCIRWMQLGAFYPFMRNHNSIGAKAQDPASWSQEAQII--MKKSIIIRYVWLPNFYTLLVKSYLYGGTVMRPLSFQFYSDAETHEIERQFMIGSSMLVNPVVVQGARNVVAYFPAGIWYDATDLSVIYSGKTGKW----ISLNAPLERTNVALRGGHALILSSLVNSTEYSRK-VINLVCILSMNQTAAGDLYWDDGESMDSYSGKKFSYFKFTATSSSVLINPEILGYSVLPSL--NSIIILG 2629
            + +C V N   R++C P     +  C  RGCCW+P       Q   ++P+C++   +  +   +   T+ GF ARL     S      + N+     ++T+ R   ++TD    RFEVP + + S      +++ Y+  + +   F  +V R S+   LF  + GPLL++DQF+Q+S+ +   +VYG+GE  ++ + HD++  W+   ++ RD   NG  T  NLYG   F++ L D SG +FGV+  NSNA E VLQPAPAITYRTIGGILD ++F G TPE  V +Y ELIGRP LP +W+LGFHLS+Y Y ++ ++   + RN    +P +VQ +DIDYMD+ +DFT D + +  F  FV  L+ + G K ++I+DP IS  S     Y  YD G ++ I++  ++    LI  VWPG+T FPD+T+PN + +W+ + + FH+QV  DG+WIDMNE SNF DGS +GC+ NN  + P F P I DG L  KT+C  ++ +     Y++HNLYGY+ AVAT  A     PNKR FIL+RSTF+GSGK+  HW GDN+A WD L  SI  VL FN+FGIPM G DICGF  D+ EELC RWMQLGAFYPF RNHN  G K QDPAS+  ++ ++   +  + IRY  LP  YTL  +++  G TV RPL  +FY D  T ++ +QF+ G  +L+ PV+ +GA  V+AY P  +WYD        +G   +W    + +  P ++  + LRGG+         +T  SRK  + L+  L  N+ A G+L+WD+GE+ D+ + K +   +F+ T + + +N     Y    +L  N I ILG
Sbjct:   87 SAECPVVNELERINCIPDQPPTKATCDQRGCCWNP-------QGAVSVPWCYYSKNHSYHVEGNLVNTNAGFTARLKNLPSSPVFGSNVDNVLLTAEYQTSNRFHFKLTDQTNNRFEVPHEHVQSFSGNAAASLTYQVEI-SRQPFSIKVTRRSNNRVLFDSSIGPLLFADQFLQLSTRLPSTNVYGLGEHVHQQYRHDMN--WKTWPIFNRDTTPNGNGT--NLYGAQTFFLCLEDASGLSFGVFLMNSNAMEVVLQPAPAITYRTIGGILDFYVFLGNTPEQVVQEYLELIGRPALPSYWALGFHLSRYEYGTLDNMREVVERNRAAQLPYDVQHADIDYMDERRDFTYDSVDFKGFPEFVNELHNN-GQKLVIIVDPAISNNSSSSKPYGPYDRGSDMKIWVNSSDGVTPLIGEVWPGQTVFPDYTNPNCAVWWTKEFELFHNQVEFDGIWIDMNEVSNFVDGSVSGCSTNN-LNNPPFTPRILDGYLFCKTLCMDAVQHWG-KQYDIHNLYGYSMAVATAEAAKTVFPNKRSFILTRSTFAGSGKFAAHWLGDNTATWDDLRWSIPGVLEFNLFGIPMVGPDICGFALDTPEELCRRWMQLGAFYPFSRNHNGQGYKDQDPASFGADSLLLNSSRHYLNIRYTLLPYLYTLFFRAHSRGDTVARPLLHEFYEDNSTWDVHQQFLWGPGLLITPVLDEGAEKVMAYVPDAVWYDYE------TGSQVRWRKQKVEMELPGDKIGLHLRGGYIFPTQQPNTTTLASRKNPLGLIIALDENKEAKGELFWDNGETKDTVANKVYLLCEFSVTQNRLEVNISQSTYKDPNNLAFNEIKILG 906          

HSP 2 Score: 556.214 bits (1432), Expect = 1.978e-174
Identity = 320/898 (35.63%), Postives = 493/898 (54.90%), Query Frame = 2
Query:  116 LKLLLIISLNFII-VSNALQCSVP-NNNYRLDCFPGSN-ANQNDCLARGCCWSPPETREYSQNNPTIPYCFFPIEYPNYQINSFTPTDRGFKARLTKQQK----SFLRKEILNLNFEVIFETNTRLRIRITDPNVQRFEVPIQLGSPD-PTPPSNIQYKFTMPTNGSFGFEVKRNSDGLSLFKT-FGPLLYSDQFIQISSLMSIQHVYGIGE-QNRPFLHDLSTQWERIGLWARDNGIDTYNNLYGTHPFYMSLPDSGEAFGVYYFNSNAQEFVLQPAPAITYRTIGGILDIFIFSGGTPETTVSQYTELIGRPMLPPFWSLGFHLSKYGYKSIADVSNTLYRNINISIPIEVQWSDIDYMDKYKDFTSDPIRYPNFGSFVAHLN--QSLGIKYIVIIDPGISIQSPGVYSAYDEGLELNIFIKDANTKKDLISNVWP---------------------GETCFPDFTHPNASKYWSHQIQRFHS-------QVPIDGLWIDMNEPSNFYDGSRTGCALNNPYDYPFFVPTI--RDGSLIKKTICSSSLHY----NNVMHYNLHNLYGYTEAVATHSALLNTIPNKRPFILSRSTFSGSGKYTFHWTGDNSANWDQLANSIRQVLNFNMFGIPMTGADICGFNGDSNEELCIRWMQLGAFYPFMRNHNSIGAKAQDPASWSQEAQIIMKKSIIIRYVWLPNFYTLLVKSYLYGGTVMRPLSFQFYSDAETHEIERQFMIGSSMLVNPVVVQGARNVVAYFPAGIWYDATDLSVIYSG----KTGKWISLNAPLERTNVALRGGHALILSSLVNSTEYSR-KVINLVCILSMNQTAAGDLYWDDGESMDSYSGKKFSYFKFTATSSSVL-----------INPEILGYSVLPSLNSIII 2623
            LK+ +I  ++ ++  +  ++ S+   +  ++DC+P  N A+  +C ARGC W        + N+  +P+C+F  +   Y ++       G  A ++ +      +F    +  L  +V +  N  L+ +I DPN  R+EVP+ L  P  P+     Q    +     FG E++R S G  ++ +      +SD FI+IS+ +  +++YG GE ++R +  DL  +W   G+++RD       N YG HP+YM L + G A GV   NSNA +   QP PA+TYRT GG+LD ++F G TPE    QYTELIGRP++ P+WSLGF L +YGY++ +++++     +   IP +VQ+SDIDYM++  DFT  P     F  F A +N  ++ G++ I+I+DP IS      Y A+  G+E ++FIK  N    +   VWP                         FPDF   + +K+W  +I+  ++        +  DG+WIDMNEPS+F +G+ +    +   ++P ++P +  RD  L  KT+C  S       + V HYN+HNLYG+++   T+ A+   +  +R  +++RSTF  SG++  HW GDN+A WDQL  SI  ++ F++FGI  TGADICGF  D+  E+C+RWMQLGAFYPF RNHN+IG + QDP SW      I +  +  RY  LP  YTL+ K++  G TV+RPL  +F SD  T +I+ QF++G + LV+PV+ + ARNV AYFP   WYD       Y+G      G+W +L APL+  N+ +RGG+ L       +T  SR K +     L    TA G L+WDDG+S+D+Y    +    F+A+ +++             NP  LGY  +  + S+ +
Sbjct:  934 LKVAIITDIDLLLGEAYTVEWSIKIRDEEKIDCYPDENGASAENCTARGCIWE-------ASNSSGVPFCYFVNDL--YSVSDVQYNSHGATADISLKSSVYANAFPSTPVNPLRLDVTYHKNEMLQFKIYDPNKNRYEVPVPLNIPSMPSSTPEGQLYDVLIKKNPFGIEIRRKSTGTIIWDSQLLGFTFSDMFIRISTRLPSKYLYGFGETEHRSYRRDL--EWHTWGMFSRDQPPGYKKNSYGVHPYYMGLEEDGSAHGVLLLNSNAMDVTFQPLPALTYRTTGGVLDFYVFLGPTPELVTQQYTELIGRPVMVPYWSLGFQLCRYGYQNDSEIASLYDEMVAAQIPYDVQYSDIDYMERQLDFTLSP----KFAGFPALINRMKADGMRVILILDPAISGNETQPYPAFTRGVEDDVFIKYPNDGDIVWGKVWPDFPDVVVNGSLDWDSQVELYRAYVAFPDFFRNSTAKWWKREIEELYNNPQNPERSLKFDGMWIDMNEPSSFVNGAVSPGCRDASLNHPPYMPHLESRDRGLSSKTLCMESQQILPDGSLVQHYNVHNLYGWSQTRPTYEAV-QEVTGQRGVVITRSTFPSSGRWAGHWLGDNTAAWDQLKKSIIGMMEFSLFGISYTGADICGFFQDAEYEMCVRWMQLGAFYPFSRNHNTIGTRRQDPVSWDVAFVNISRTVLQTRYTLLPYLYTLMHKAHTEGVTVVRPLLHEFVSDQVTWDIDSQFLLGPAFLVSPVLERNARNVTAYFPRARWYD------YYTGVDINARGEWKTLPAPLDHINLHVRGGYILPWQEPALNTHLSRQKFMGFKIALDDEGTAGGWLFWDDGQSIDTYGKGLYYLASFSASQNTMQSHIIFNNYITGTNPLKLGYIEIWGVGSVPV 1809          
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Human
Match: MGAM (maltase-glucoamylase [Source:HGNC Symbol;Acc:HGNC:7043])

HSP 1 Score: 631.328 bits (1627), Expect = 0.000e+0
Identity = 346/841 (41.14%), Postives = 500/841 (59.45%), Query Frame = 2
Query:  164 ALQCSVPNNNYRLDCFPGSNANQNDCLARGCCWSPPETREYSQNNPTIPYCFFPIEYPNYQINSFTPTDRGFKARLTKQQKS-FLRKEILNLNFEVIFETNTRLRIRITDPNVQRFEVPIQ-LGSPDPTPPSNIQYKFTMPTNGSFGFEVKRNSDGLSLF-KTFGPLLYSDQFIQISSLMSIQHVYGIGEQ-NRPFLHDLSTQWERIGLWARD---NGIDTYNNLYGTHPFYMSLPD-SGEAFGVYYFNSNAQEFVLQPAPAITYRTIGGILDIFIFSGGTPETTVSQYTELIGRPMLPPFWSLGFHLSKYGYKSIADVSNTLYRNINISIPIEVQWSDIDYMDKYKDFTSDPIRYPNFGSFVAHLNQSLGIKYIVIIDPGISIQSPGV--YSAYDEGLELNIFIKDANTKKDLISNVWPGETCFPDFTHPNASKYWSHQIQRFHSQVPIDGLWIDMNEPSNFYDGSRTGCALNNPYDYPFFVPTIRDGSLIKKTICSSSLHYNNVMHYNLHNLYGYTEAVATHSALLNTIPNKRPFILSRSTFSGSGKYTFHWTGDNSANWDQLANSIRQVLNFNMFGIPMTGADICGFNGDSNEELCIRWMQLGAFYPFMRNHNSIGAKAQDPASWSQEAQII--MKKSIIIRYVWLPNFYTLLVKSYLYGGTVMRPLSFQFYSDAETHEIERQFMIGSSMLVNPVVVQGARNVVAYFPAGIWYDATDLSVIYSGKTGKW----ISLNAPLERTNVALRGGHALILSSLVNSTEYSRK-VINLVCILSMNQTAAGDLYWDDGESMDSYSGKKFSYFKFTATSSSVLINPEILGYSVLPSL--NSIIILG 2629
            + +C V N   R++C P     +  C  RGCCW+P       Q   ++P+C++   +  +   +   T+ GF ARL     S      + N+     ++T+ R   ++TD    RFEVP + + S      +++ Y+  + +   F  +V R S+   LF  + GPLL++DQF+Q+S+ +   +VYG+GE  ++ + HD++  W+   ++ RD   NG  T  NLYG   F++ L D SG +FGV+  NSNA E VLQPAPAITYRTIGGILD ++F G TPE  V +Y ELIGRP LP +W+LGFHLS+Y Y ++ ++   + RN    +P +VQ +DIDYMD+ +DFT D + +  F  FV  L+ + G K ++I+DP IS  S     Y  YD G ++ I++  ++    LI  VWPG+T FPD+T+PN + +W+ + + FH+QV  DG+WIDMNE SNF DGS +GC+ NN  + P F P I DG L  KT+C  ++ +     Y++HNLYGY+ AVAT  A     PNKR FIL+RSTF+GSGK+  HW GDN+A WD L  SI  VL FN+FGIPM G DICGF  D+ EELC RWMQLGAFYPF RNHN  G K QDPAS+  ++ ++   +  + IRY  LP  YTL  +++  G TV RPL  +FY D  T ++ +QF+ G  +L+ PV+ +GA  V+AY P  +WYD        +G   +W    + +  P ++  + LRGG+         +T  SRK  + L+  L  N+ A G+L+WD+GE+ D+ + K +   +F+ T + + +N     Y    +L  N I ILG
Sbjct:   87 SAECPVVNELERINCIPDQPPTKATCDQRGCCWNP-------QGAVSVPWCYYSKNHSYHVEGNLVNTNAGFTARLKNLPSSPVFGSNVDNVLLTAEYQTSNRFHFKLTDQTNNRFEVPHEHVQSFSGNAAASLTYQVEI-SRQPFSIKVTRRSNNRVLFDSSIGPLLFADQFLQLSTRLPSTNVYGLGEHVHQQYRHDMN--WKTWPIFNRDTTPNGNGT--NLYGAQTFFLCLEDASGLSFGVFLMNSNAMEVVLQPAPAITYRTIGGILDFYVFLGNTPEQVVQEYLELIGRPALPSYWALGFHLSRYEYGTLDNMREVVERNRAAQLPYDVQHADIDYMDERRDFTYDSVDFKGFPEFVNELHNN-GQKLVIIVDPAISNNSSSSKPYGPYDRGSDMKIWVNSSDGVTPLIGEVWPGQTVFPDYTNPNCAVWWTKEFELFHNQVEFDGIWIDMNEVSNFVDGSVSGCSTNN-LNNPPFTPRILDGYLFCKTLCMDAVQHWG-KQYDIHNLYGYSMAVATAEAAKTVFPNKRSFILTRSTFAGSGKFAAHWLGDNTATWDDLRWSIPGVLEFNLFGIPMVGPDICGFALDTPEELCRRWMQLGAFYPFSRNHNGQGYKDQDPASFGADSLLLNSSRHYLNIRYTLLPYLYTLFFRAHSRGDTVARPLLHEFYEDNSTWDVHQQFLWGPGLLITPVLDEGAEKVMAYVPDAVWYDYE------TGSQVRWRKQKVEMELPGDKIGLHLRGGYIFPTQQPNTTTLASRKNPLGLIIALDENKEAKGELFWDNGETKDTVANKVYLLCEFSVTQNRLEVNISQSTYKDPNNLAFNEIKILG 906          

HSP 2 Score: 556.214 bits (1432), Expect = 1.978e-174
Identity = 320/898 (35.63%), Postives = 493/898 (54.90%), Query Frame = 2
Query:  116 LKLLLIISLNFII-VSNALQCSVP-NNNYRLDCFPGSN-ANQNDCLARGCCWSPPETREYSQNNPTIPYCFFPIEYPNYQINSFTPTDRGFKARLTKQQK----SFLRKEILNLNFEVIFETNTRLRIRITDPNVQRFEVPIQLGSPD-PTPPSNIQYKFTMPTNGSFGFEVKRNSDGLSLFKT-FGPLLYSDQFIQISSLMSIQHVYGIGE-QNRPFLHDLSTQWERIGLWARDNGIDTYNNLYGTHPFYMSLPDSGEAFGVYYFNSNAQEFVLQPAPAITYRTIGGILDIFIFSGGTPETTVSQYTELIGRPMLPPFWSLGFHLSKYGYKSIADVSNTLYRNINISIPIEVQWSDIDYMDKYKDFTSDPIRYPNFGSFVAHLN--QSLGIKYIVIIDPGISIQSPGVYSAYDEGLELNIFIKDANTKKDLISNVWP---------------------GETCFPDFTHPNASKYWSHQIQRFHS-------QVPIDGLWIDMNEPSNFYDGSRTGCALNNPYDYPFFVPTI--RDGSLIKKTICSSSLHY----NNVMHYNLHNLYGYTEAVATHSALLNTIPNKRPFILSRSTFSGSGKYTFHWTGDNSANWDQLANSIRQVLNFNMFGIPMTGADICGFNGDSNEELCIRWMQLGAFYPFMRNHNSIGAKAQDPASWSQEAQIIMKKSIIIRYVWLPNFYTLLVKSYLYGGTVMRPLSFQFYSDAETHEIERQFMIGSSMLVNPVVVQGARNVVAYFPAGIWYDATDLSVIYSG----KTGKWISLNAPLERTNVALRGGHALILSSLVNSTEYSR-KVINLVCILSMNQTAAGDLYWDDGESMDSYSGKKFSYFKFTATSSSVL-----------INPEILGYSVLPSLNSIII 2623
            LK+ +I  ++ ++  +  ++ S+   +  ++DC+P  N A+  +C ARGC W        + N+  +P+C+F  +   Y ++       G  A ++ +      +F    +  L  +V +  N  L+ +I DPN  R+EVP+ L  P  P+     Q    +     FG E++R S G  ++ +      +SD FI+IS+ +  +++YG GE ++R +  DL  +W   G+++RD       N YG HP+YM L + G A GV   NSNA +   QP PA+TYRT GG+LD ++F G TPE    QYTELIGRP++ P+WSLGF L +YGY++ +++++     +   IP +VQ+SDIDYM++  DFT  P     F  F A +N  ++ G++ I+I+DP IS      Y A+  G+E ++FIK  N    +   VWP                         FPDF   + +K+W  +I+  ++        +  DG+WIDMNEPS+F +G+ +    +   ++P ++P +  RD  L  KT+C  S       + V HYN+HNLYG+++   T+ A+   +  +R  +++RSTF  SG++  HW GDN+A WDQL  SI  ++ F++FGI  TGADICGF  D+  E+C+RWMQLGAFYPF RNHN+IG + QDP SW      I +  +  RY  LP  YTL+ K++  G TV+RPL  +F SD  T +I+ QF++G + LV+PV+ + ARNV AYFP   WYD       Y+G      G+W +L APL+  N+ +RGG+ L       +T  SR K +     L    TA G L+WDDG+S+D+Y    +    F+A+ +++             NP  LGY  +  + S+ +
Sbjct:  934 LKVAIITDIDLLLGEAYTVEWSIKIRDEEKIDCYPDENGASAENCTARGCIWE-------ASNSSGVPFCYFVNDL--YSVSDVQYNSHGATADISLKSSVYANAFPSTPVNPLRLDVTYHKNEMLQFKIYDPNKNRYEVPVPLNIPSMPSSTPEGQLYDVLIKKNPFGIEIRRKSTGTIIWDSQLLGFTFSDMFIRISTRLPSKYLYGFGETEHRSYRRDL--EWHTWGMFSRDQPPGYKKNSYGVHPYYMGLEEDGSAHGVLLLNSNAMDVTFQPLPALTYRTTGGVLDFYVFLGPTPELVTQQYTELIGRPVMVPYWSLGFQLCRYGYQNDSEIASLYDEMVAAQIPYDVQYSDIDYMERQLDFTLSP----KFAGFPALINRMKADGMRVILILDPAISGNETQPYPAFTRGVEDDVFIKYPNDGDIVWGKVWPDFPDVVVNGSLDWDSQVELYRAYVAFPDFFRNSTAKWWKREIEELYNNPQNPERSLKFDGMWIDMNEPSSFVNGAVSPGCRDASLNHPPYMPHLESRDRGLSSKTLCMESQQILPDGSLVQHYNVHNLYGWSQTRPTYEAV-QEVTGQRGVVITRSTFPSSGRWAGHWLGDNTAAWDQLKKSIIGMMEFSLFGISYTGADICGFFQDAEYEMCVRWMQLGAFYPFSRNHNTIGTRRQDPVSWDVAFVNISRTVLQTRYTLLPYLYTLMHKAHTEGVTVVRPLLHEFVSDQVTWDIDSQFLLGPAFLVSPVLERNARNVTAYFPRARWYD------YYTGVDINARGEWKTLPAPLDHINLHVRGGYILPWQEPALNTHLSRQKFMGFKIALDDEGTAGGWLFWDDGQSIDTYGKGLYYLASFSASQNTMQSHIIFNNYITGTNPLKLGYIEIWGVGSVPV 1809          
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Celegans
Match: aagr-1 (Acid Alpha Glucosidase Relate [Source:UniProtKB/TrEMBL;Acc:Q19004])

HSP 1 Score: 484.952 bits (1247), Expect = 3.259e-156
Identity = 329/915 (35.96%), Postives = 474/915 (51.80%), Query Frame = 2
Query:  131 IISLNFIIVSNALQCSVPNNNYRLDCFPGSNANQNDCLARGCCWSPPETREYSQNNPTIPYCFFPIEYPNYQINSFTPTDRGFKA-RLTKQQKSFLRKEILNLNFEVIFETNTRLRIRITDPNVQRFEVPIQLGSPDPTPPSNIQYKFTMPTNGS---FGFEVKRNSDGLSLFKT-FGPLLYSDQFIQISSLMSIQHVYGIGEQ-NRPFLHDLS--TQWERIGLWARDNGIDT-----YNNLYGTHPFYMSLPDSGEAFGVYYFNSNAQEFVLQPAPAITYRTIGGILDIFIFSGGTPETTVSQYTELIGRPMLPPFWSLGFHLSKYGYKSIADVSNTLYRNINISIPIEVQWSDIDYMDKYKDFTSDPIRYPNFGSFVAHLNQ--SLGIKYIVIIDPGISIQSPGVYSAYDEGLELNIF-------------IKD----ANTKKDLISNVWPGE-TCFPDFTHP--NASKYWSHQIQRFHSQVPIDGLWIDMNEPSNFYDG-----------SRTGC-------ALNNPYDYPFFVPTIRDGS-LIKKTICS-SSLHYNNVMHYNLHNLYGYTEAVATHSALLNTIPNKRPFILSRSTFSGSGKYTFHWTGDNSANWDQLANSIRQVLNFNMFGIPMTGADICGFNGDSNEELCIRWMQLGAFYPFMRNHNSIGAKAQDPASWSQEAQIIMKKSIIIRYVWLPNFYTLLVKSYLYGGTVMRPLSFQFYSDAETHEIERQFMIGSSMLVNPVVVQGARNVVAYFPAGIWYD---ATDLSVIYSGKTGKWISLNAPLER-TNVALRGGHALILSSLVNSTEYSR-KVINLVCILSMNQTAAGDLYWDDGESM---DSYSGKKFSYFKFTATSS-------------SVLINP------EILGYSVLPSLNSIIILG 2629
            I+ L  +   N    SV + + R+DC+P   A+Q+ C +RGC W    T   S +    P+C++P E      + FT    G  +  L  + K+     I  LN +      T L   +T  N  R+  P+    P     S    KFT  T GS   F F+V R S G++L+ T  G + ++D+FIQI++ +  +++YG G+  ++   H+L   T W    ++ARD G D+       NLYG HPFYM +   G+A GV+  NSNAQE    P P + YRTIGG +D+  F G TPE  V+QY + IG P LP +W+LG+ L ++GY ++  +   + RN  + IP++V ++DIDYM+ Y+DFT       N+  F A+  Q  + G+  IVI DP + +     Y+++  G+  +               I+D    A   K ++ NVWP   T FPDF  P  N + +W+ +  +FH  +P DG+WIDMNEPSNF  G           ++  C       +L+ P  YP      R+G  L  KT+C      +     Y+  NLYG++EA AT+ A+   +  KR  ++SRSTF  SG+Y  HW GDN+A W  L  S+  V+ FNMFG+P  G+DICGFNG SNEELC+RW Q GAF PF R+HNS G   QDPA W   A    K ++  RY +LP  Y+L   +  YG TV+RPL F+F  D ET  I  QF+ GS++++ P + QG  +V AYFP+  WY     T    ++SG    +  +NAPL   T V +RGG  L   S   +T  SR     L+  +  N  ++GDLY+D G+ +   D        +++F+ TSS             S  + P      EILGY   P+ N   + G
Sbjct:    9 IVVLLLVFYQNTNSQSV-DVSKRVDCYPEPGASQDACQSRGCIW----TEAPSSSPVGTPWCYYPTE------SGFTVQSTGTNSFVLAAKTKNPYGNNISPLNVKYSSNGATLL---LTIGNDDRYVPPVNF--PKKPSTSTESLKFTSGTIGSSDVFSFKVTRASTGVALWDTSIGGMQFADKFIQIATYLPSKNIYGFGDHIHKKIRHNLDRYTTWP---MFARDIGPDSGSALSTQNLYGVHPFYMCIEADGKAHGVFILNSNAQEVETGPGPHLLYRTIGGRIDMAFFPGPTPEQVVNQYLQHIGFPFLPAYWALGYQLCRWGYGNLDAMKTVISRNQALGIPLDVPYADIDYMNHYEDFTEG----DNWSGFPAYTQQIHAQGLHLIVIFDPAVEVD----YASFQRGINADASFIEWARDDQVPHNIQDQYPMAKNTKIMLGNVWPDRNTAFPDFLDPRNNTNAWWAGEFAQFHKTLPFDGMWIDMNEPSNFDTGTYNTVEEQLASAKLSCPITGSDSSLDVP-PYPTQAVYQRNGEYLFSKTLCMLGKTAHRTRDFYDTKNLYGWSEARATYQAIPQ-VTGKRSAVISRSTFPSSGRYGGHWLGDNTARWGDLQTSVIGVMEFNMFGVPYVGSDICGFNGVSNEELCLRWHQFGAFSPFSRDHNSEGMPDQDPAVWPSVAN-AAKIALTFRYYFLPFLYSLHYNAARYGHTVIRPLFFEFPKDEETLNISEQFLWGSALMIAPALYQGQTSVHAYFPSDTWYSLQPETYGQKMFSG----FNDVNAPLSSLTPVFVRGGFVLPRQSPGTTTTASRLSPFELLITVKTNAASSGDLYYDGGDDLIPNDDIEQHPRVHWQFSFTSSIAGGVLTGNCETCSTAVRPPTLDIIEILGYPSSPNFNGFKLDG 889          
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Celegans
Match: aagr-1 (Acid Alpha Glucosidase Relate [Source:UniProtKB/TrEMBL;Acc:Q19004])

HSP 1 Score: 484.952 bits (1247), Expect = 3.259e-156
Identity = 329/915 (35.96%), Postives = 474/915 (51.80%), Query Frame = 2
Query:  131 IISLNFIIVSNALQCSVPNNNYRLDCFPGSNANQNDCLARGCCWSPPETREYSQNNPTIPYCFFPIEYPNYQINSFTPTDRGFKA-RLTKQQKSFLRKEILNLNFEVIFETNTRLRIRITDPNVQRFEVPIQLGSPDPTPPSNIQYKFTMPTNGS---FGFEVKRNSDGLSLFKT-FGPLLYSDQFIQISSLMSIQHVYGIGEQ-NRPFLHDLS--TQWERIGLWARDNGIDT-----YNNLYGTHPFYMSLPDSGEAFGVYYFNSNAQEFVLQPAPAITYRTIGGILDIFIFSGGTPETTVSQYTELIGRPMLPPFWSLGFHLSKYGYKSIADVSNTLYRNINISIPIEVQWSDIDYMDKYKDFTSDPIRYPNFGSFVAHLNQ--SLGIKYIVIIDPGISIQSPGVYSAYDEGLELNIF-------------IKD----ANTKKDLISNVWPGE-TCFPDFTHP--NASKYWSHQIQRFHSQVPIDGLWIDMNEPSNFYDG-----------SRTGC-------ALNNPYDYPFFVPTIRDGS-LIKKTICS-SSLHYNNVMHYNLHNLYGYTEAVATHSALLNTIPNKRPFILSRSTFSGSGKYTFHWTGDNSANWDQLANSIRQVLNFNMFGIPMTGADICGFNGDSNEELCIRWMQLGAFYPFMRNHNSIGAKAQDPASWSQEAQIIMKKSIIIRYVWLPNFYTLLVKSYLYGGTVMRPLSFQFYSDAETHEIERQFMIGSSMLVNPVVVQGARNVVAYFPAGIWYD---ATDLSVIYSGKTGKWISLNAPLER-TNVALRGGHALILSSLVNSTEYSR-KVINLVCILSMNQTAAGDLYWDDGESM---DSYSGKKFSYFKFTATSS-------------SVLINP------EILGYSVLPSLNSIIILG 2629
            I+ L  +   N    SV + + R+DC+P   A+Q+ C +RGC W    T   S +    P+C++P E      + FT    G  +  L  + K+     I  LN +      T L   +T  N  R+  P+    P     S    KFT  T GS   F F+V R S G++L+ T  G + ++D+FIQI++ +  +++YG G+  ++   H+L   T W    ++ARD G D+       NLYG HPFYM +   G+A GV+  NSNAQE    P P + YRTIGG +D+  F G TPE  V+QY + IG P LP +W+LG+ L ++GY ++  +   + RN  + IP++V ++DIDYM+ Y+DFT       N+  F A+  Q  + G+  IVI DP + +     Y+++  G+  +               I+D    A   K ++ NVWP   T FPDF  P  N + +W+ +  +FH  +P DG+WIDMNEPSNF  G           ++  C       +L+ P  YP      R+G  L  KT+C      +     Y+  NLYG++EA AT+ A+   +  KR  ++SRSTF  SG+Y  HW GDN+A W  L  S+  V+ FNMFG+P  G+DICGFNG SNEELC+RW Q GAF PF R+HNS G   QDPA W   A    K ++  RY +LP  Y+L   +  YG TV+RPL F+F  D ET  I  QF+ GS++++ P + QG  +V AYFP+  WY     T    ++SG    +  +NAPL   T V +RGG  L   S   +T  SR     L+  +  N  ++GDLY+D G+ +   D        +++F+ TSS             S  + P      EILGY   P+ N   + G
Sbjct:    9 IVVLLLVFYQNTNSQSV-DVSKRVDCYPEPGASQDACQSRGCIW----TEAPSSSPVGTPWCYYPTE------SGFTVQSTGTNSFVLAAKTKNPYGNNISPLNVKYSSNGATLL---LTIGNDDRYVPPVNF--PKKPSTSTESLKFTSGTIGSSDVFSFKVTRASTGVALWDTSIGGMQFADKFIQIATYLPSKNIYGFGDHIHKKIRHNLDRYTTWP---MFARDIGPDSGSALSTQNLYGVHPFYMCIEADGKAHGVFILNSNAQEVETGPGPHLLYRTIGGRIDMAFFPGPTPEQVVNQYLQHIGFPFLPAYWALGYQLCRWGYGNLDAMKTVISRNQALGIPLDVPYADIDYMNHYEDFTEG----DNWSGFPAYTQQIHAQGLHLIVIFDPAVEVD----YASFQRGINADASFIEWARDDQVPHNIQDQYPMAKNTKIMLGNVWPDRNTAFPDFLDPRNNTNAWWAGEFAQFHKTLPFDGMWIDMNEPSNFDTGTYNTVEEQLASAKLSCPITGSDSSLDVP-PYPTQAVYQRNGEYLFSKTLCMLGKTAHRTRDFYDTKNLYGWSEARATYQAIPQ-VTGKRSAVISRSTFPSSGRYGGHWLGDNTARWGDLQTSVIGVMEFNMFGVPYVGSDICGFNGVSNEELCLRWHQFGAFSPFSRDHNSEGMPDQDPAVWPSVAN-AAKIALTFRYYFLPFLYSLHYNAARYGHTVIRPLFFEFPKDEETLNISEQFLWGSALMIAPALYQGQTSVHAYFPSDTWYSLQPETYGQKMFSG----FNDVNAPLSSLTPVFVRGGFVLPRQSPGTTTTASRLSPFELLITVKTNAASSGDLYYDGGDDLIPNDDIEQHPRVHWQFSFTSSIAGGVLTGNCETCSTAVRPPTLDIIEILGYPSSPNFNGFKLDG 889          
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Celegans
Match: aagr-1 (Acid Alpha Glucosidase Relate [Source:UniProtKB/TrEMBL;Acc:Q19004])

HSP 1 Score: 484.952 bits (1247), Expect = 3.259e-156
Identity = 329/915 (35.96%), Postives = 474/915 (51.80%), Query Frame = 2
Query:  131 IISLNFIIVSNALQCSVPNNNYRLDCFPGSNANQNDCLARGCCWSPPETREYSQNNPTIPYCFFPIEYPNYQINSFTPTDRGFKA-RLTKQQKSFLRKEILNLNFEVIFETNTRLRIRITDPNVQRFEVPIQLGSPDPTPPSNIQYKFTMPTNGS---FGFEVKRNSDGLSLFKT-FGPLLYSDQFIQISSLMSIQHVYGIGEQ-NRPFLHDLS--TQWERIGLWARDNGIDT-----YNNLYGTHPFYMSLPDSGEAFGVYYFNSNAQEFVLQPAPAITYRTIGGILDIFIFSGGTPETTVSQYTELIGRPMLPPFWSLGFHLSKYGYKSIADVSNTLYRNINISIPIEVQWSDIDYMDKYKDFTSDPIRYPNFGSFVAHLNQ--SLGIKYIVIIDPGISIQSPGVYSAYDEGLELNIF-------------IKD----ANTKKDLISNVWPGE-TCFPDFTHP--NASKYWSHQIQRFHSQVPIDGLWIDMNEPSNFYDG-----------SRTGC-------ALNNPYDYPFFVPTIRDGS-LIKKTICS-SSLHYNNVMHYNLHNLYGYTEAVATHSALLNTIPNKRPFILSRSTFSGSGKYTFHWTGDNSANWDQLANSIRQVLNFNMFGIPMTGADICGFNGDSNEELCIRWMQLGAFYPFMRNHNSIGAKAQDPASWSQEAQIIMKKSIIIRYVWLPNFYTLLVKSYLYGGTVMRPLSFQFYSDAETHEIERQFMIGSSMLVNPVVVQGARNVVAYFPAGIWYD---ATDLSVIYSGKTGKWISLNAPLER-TNVALRGGHALILSSLVNSTEYSR-KVINLVCILSMNQTAAGDLYWDDGESM---DSYSGKKFSYFKFTATSS-------------SVLINP------EILGYSVLPSLNSIIILG 2629
            I+ L  +   N    SV + + R+DC+P   A+Q+ C +RGC W    T   S +    P+C++P E      + FT    G  +  L  + K+     I  LN +      T L   +T  N  R+  P+    P     S    KFT  T GS   F F+V R S G++L+ T  G + ++D+FIQI++ +  +++YG G+  ++   H+L   T W    ++ARD G D+       NLYG HPFYM +   G+A GV+  NSNAQE    P P + YRTIGG +D+  F G TPE  V+QY + IG P LP +W+LG+ L ++GY ++  +   + RN  + IP++V ++DIDYM+ Y+DFT       N+  F A+  Q  + G+  IVI DP + +     Y+++  G+  +               I+D    A   K ++ NVWP   T FPDF  P  N + +W+ +  +FH  +P DG+WIDMNEPSNF  G           ++  C       +L+ P  YP      R+G  L  KT+C      +     Y+  NLYG++EA AT+ A+   +  KR  ++SRSTF  SG+Y  HW GDN+A W  L  S+  V+ FNMFG+P  G+DICGFNG SNEELC+RW Q GAF PF R+HNS G   QDPA W   A    K ++  RY +LP  Y+L   +  YG TV+RPL F+F  D ET  I  QF+ GS++++ P + QG  +V AYFP+  WY     T    ++SG    +  +NAPL   T V +RGG  L   S   +T  SR     L+  +  N  ++GDLY+D G+ +   D        +++F+ TSS             S  + P      EILGY   P+ N   + G
Sbjct:    9 IVVLLLVFYQNTNSQSV-DVSKRVDCYPEPGASQDACQSRGCIW----TEAPSSSPVGTPWCYYPTE------SGFTVQSTGTNSFVLAAKTKNPYGNNISPLNVKYSSNGATLL---LTIGNDDRYVPPVNF--PKKPSTSTESLKFTSGTIGSSDVFSFKVTRASTGVALWDTSIGGMQFADKFIQIATYLPSKNIYGFGDHIHKKIRHNLDRYTTWP---MFARDIGPDSGSALSTQNLYGVHPFYMCIEADGKAHGVFILNSNAQEVETGPGPHLLYRTIGGRIDMAFFPGPTPEQVVNQYLQHIGFPFLPAYWALGYQLCRWGYGNLDAMKTVISRNQALGIPLDVPYADIDYMNHYEDFTEG----DNWSGFPAYTQQIHAQGLHLIVIFDPAVEVD----YASFQRGINADASFIEWARDDQVPHNIQDQYPMAKNTKIMLGNVWPDRNTAFPDFLDPRNNTNAWWAGEFAQFHKTLPFDGMWIDMNEPSNFDTGTYNTVEEQLASAKLSCPITGSDSSLDVP-PYPTQAVYQRNGEYLFSKTLCMLGKTAHRTRDFYDTKNLYGWSEARATYQAIPQ-VTGKRSAVISRSTFPSSGRYGGHWLGDNTARWGDLQTSVIGVMEFNMFGVPYVGSDICGFNGVSNEELCLRWHQFGAFSPFSRDHNSEGMPDQDPAVWPSVAN-AAKIALTFRYYFLPFLYSLHYNAARYGHTVIRPLFFEFPKDEETLNISEQFLWGSALMIAPALYQGQTSVHAYFPSDTWYSLQPETYGQKMFSG----FNDVNAPLSSLTPVFVRGGFVLPRQSPGTTTTASRLSPFELLITVKTNAASSGDLYYDGGDDLIPNDDIEQHPRVHWQFSFTSSIAGGVLTGNCETCSTAVRPPTLDIIEILGYPSSPNFNGFKLDG 889          
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Celegans
Match: aagr-2 (Acid Alpha Glucosidase Relate [Source:UniProtKB/TrEMBL;Acc:Q21750])

HSP 1 Score: 459.914 bits (1182), Expect = 2.322e-146
Identity = 316/884 (35.75%), Postives = 445/884 (50.34%), Query Frame = 2
Query:  197 RLDCFPGSNANQNDCLARGCCWSPPETREYSQNNPTIPYCFFPIEYPNYQINSFTPTDRGFKARLTKQQKSF--LRKEILNLNFEVIFETNTRLRIRITDP--NVQ-----RFEVPIQLGSPDPTPPSNIQYKFTMP-TNGSFGFEVKRNSDGLSLFKT-FGPLLYSDQFIQISSLMSIQHVYGIGEQNRPFLHDLSTQWERIGLWARDN-----GIDTYNNLYGTHPFYMSLPDSGEAFGVYYFNSNAQEFVLQPAPAITYRTIGGILDIFIFSGGTPETTVSQYTELIGRPMLPPFWSLGFHLSKYGYKSIADVSNTLYRNINISIPIEVQWSDIDYMDKYKDFTSDPIRYPNFGSFVAHLNQSLGIKYIVIIDPGISIQSPGVYSA---------YDEGLELNIFIKD----ANTKKDLISNVWP-GETCFPDF--THPNASKYWSHQIQRFHSQVPIDGLWIDMNEPSNF---YDGSRTGCALNNPYDYPFFVPTIRDGS------------------------LIKKTICSSSLHYNNVMH-YNLHNLYGYTEAVATHSALLNTIPNKRPFILSRSTFSGSGKYTFHWTGDNSANWDQLANSIRQVLNFNMFGIPMTGADICGFNGDSNEELCIRWMQLGAFYPFMRNHNSIGAKAQDPASWSQEAQIIMKKSIIIRYVWLPNFYTLLVKSYLYGGTVMRPLSFQFYSDAETHEIERQFMIGSSMLVNPVVVQGARNVVAYFPAGIWYDATDL---SVIYSGKTGKWISLNAP-LERTNVALRGGHALILSSLVNSTEYSR----KVINLVCILSMNQTAAGDLYWDDGESM----DSYSGKKFSY-FKFTATSSSVLINPEILGYSV-LPSLNSIIIL 2626
            R DC P  N NQ  C ARGC W   +T +        P+C+F                 G    L  QQ S   LRK     N      T  +L  +      NV+     R+E P+    P  T  S      +   +NG F F V R S    LF T  G L++SDQFIQI++ +  +++YG GE     L    T++    ++ARD       +DT N LYG HP+YM L   G+A GV   NSNAQE    P P++ YRTIGG LD++ F G TPE    QY + IG+P LP +W+LG+ LS+YGYK +A++   +    +  IPI++  +DIDYM +YKDFT+    +  F  +V  ++   G+K I+I DP I    P    A         ++   ++   I++    A   K ++  VWP     FPDF  +  N   +W ++   + SQV  DG+WIDMNEPSNF    D      + ++P D P F PT  +GS                        L   T+C  +         YN+ NLYG TEA+ T  AL      KR  ++SRST+  +G+Y  HW GDN+A W+ L  S+     FN+FGIP  G+D+CGF G + EELC+RW Q+GAF+ F RNHN+IGA AQDPA W   A    KK+ + RY +LP  ++L   + L G TV+RP+ F++ +DAET  +  +FM GS +LV PV+ QG  +V AY P   WY   D    S++  G    + ++ AP   R  V +RG   +   +   +T  +R    +++   C L M +   G LYWDDGE++    +SY   +F + +  TAT  SV I        + LP+L+ I I 
Sbjct:   21 RFDCLPEPNGNQGACEARGCIWKEDDTGK------NAPWCYF---------------KDGVGYNLDSQQGSTYNLRKNGGPSNPWGADSTEIKLTTKSIGSVLNVKIGIDGRYEPPVDF--PRETQSSTESLSLSTSFSNGVFSFSVVRQSTNRKLFDTSIGGLIFSDQFIQIATYLPSENMYGWGENTHQSLRHDFTKYLTWAMFARDQPPNSGSLDTVN-LYGVHPYYMILEPDGKAHGVLIINSNAQEVTTAPGPSLIYRTIGGNLDMYFFPGPTPEMVTQQYLKFIGKPFLPAYWALGYQLSRYGYKGLAEMKTRIQAVRDAGIPIDIGVADIDYMQRYKDFTTGD-DWAGFSDYVKTMHD-WGMKLILIFDPAIEATYPSFQRAIAANAKFIEWETKAQVQTAIQNLYPMAKDTKIMLGVVWPDNHVAFPDFLDSTNNTQNWWINEFVNYQSQVAFDGIWIDMNEPSNFGTNQDHPWYFDSDDHPNDAPLFCPT--NGSSPWEMPPYKTRAVWRFGDANSGAFLSSNTLCMLAQQDGGKQRFYNVKNLYGLTEAINTQKALFKAT-GKRGAVVSRSTYPSAGRYAGHWLGDNTARWEDLRTSVIGAQEFNLFGIPYVGSDVCGFIGTTTEELCLRWQQMGAFHSFFRNHNTIGAPAQDPAVWPSVAAAT-KKANLFRYQYLPYLFSLHFTASLSGATVIRPVFFEYPTDAETFNLGYEFMWGSRILVAPVIYQGTTSVNAYLPTDRWYSLFDYRYGSIMSPG----YATVPAPTTSRIPVFVRGYSVIPRQTPSITTTATRSNPFELLIAPCPLGMGE---GTLYWDDGETIVNDFNSYDYHQFDFMYNSTATGGSVTITHSKKSSKISLPTLDIIEIF 867          
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Celegans
Match: aagr-3 (Acid Alpha Glucosidase Relate [Source:UniProtKB/TrEMBL;Acc:J7SA48])

HSP 1 Score: 263.077 bits (671), Expect = 5.248e-76
Identity = 172/575 (29.91%), Postives = 282/575 (49.04%), Query Frame = 2
Query:  947 GILDIFIFSGGTPETTVSQYTELIGRPMLPPFWSLGFHLSKYGYKSIADVSNTLYRNINISIPIEVQWSDIDYMDKYKDFTSDPIRYPNFGSFVAHLNQSLGIKYIVIIDPGISIQSPGVYSAYDEGLELNIFIKDANTKKDLISNVWPGETCFPDFTHPNASKYWSHQI--QRFHSQVPIDGLWIDMNEPSNFYDGSRTGCALNNPYDYPFFVPTIRDGSLIKKTICSSSLHYNNVMHYNLHNLYGYTEAVATHSALL-NTIPNKRPFILSRSTFSGSGKYTFHWTGDNSANWDQLANSIRQVLNFNMFGIPMTGADICGFNGDSNEELCIRWMQLGAFYPFMRNHNSIGAKAQDPASWSQEAQIIMKKSIIIRYVWLPNFYTLLVKSYLYGGTVMRPLSFQFYSDAETHEIERQFMIGSSMLVNPVVVQGARNVVAYFPAG-----IWYDATDLSVIYSGKTGKWISLNAPLERTNVALRGGHALILSSLV--NSTEYSRKVINLVCILSMNQTAAGDLYWDDGESMDSYSGK--KFSYFKFTATSSSVLINPEILG--YSVLPSLNSIIILG 2629
            G++D+F F G T +    Q ++L G   LPP +S+G+H  ++ Y    DV+       +  +P++V W DI++ D  K FT D  ++P     V  +  + G K + I+DP   I+    Y  Y +  +  +F+K  +   D   + WPG + + DF HP+   YW  Q    R+        +W DMNEPS F                    P I        T+   S+HY  + H  +HN+YG     AT   ++  T   +RPF+LSR+ F G+ +    WTGDN+A+W  L  +    L+ ++ G+P  GAD+ GF G+ +E+L  RW Q  AF PF R H  I  + ++P  +S++ Q I+++++  RY  LP +YTL  +    G   MRPL ++F +D    E ++Q+M+GS +L  PVV +   NV    P G      W++    + +     G+ I ++AP+  T +  RGG  +     +  ++T      I L   L  N+ + G++Y DDG + D  SG+  K S+   T + +S ++  E L   Y+    +  +++ G
Sbjct:   69 GLVDVFFFVGPTVKDVQRQNSKLTGVTPLPPLFSIGYHQCRWNYNDEQDVATVNQGFDDHDMPMDVIWLDIEHTDGKKYFTWDKHKFPTPNDMVDKV-AAKGRKMVTIVDP--HIKKDDGYYVYKDAKDKGLFVKRVD-GSDFEGHCWPGSSEYLDFWHPDTRSYWKDQFAFDRYTGSSSNLHIWNDMNEPSVFSG------------------PEI--------TMDKESIHYGGIEHREIHNMYGMMYTSATFDGMIARTGGKERPFLLSRAGFIGTQRTAAIWTGDNTADWGHLEIAAPMTLSLSIAGVPFVGADVGGFFGNPDEQLLSRWYQTAAFQPFFRAHAHIDTRRREPWLFSEQTQQIIREALRTRYALLPYWYTLFQQHTENGVPPMRPLFYEFENDDLLLEEQKQWMVGSGILARPVVEKDTFNVQVKLPRGEHKTERWFEWVSGNEV----RGESIYVDAPITFTPIYQRGGTIIPTWQRIRRSATLMKDDPITLFVALDSNENSNGEIYLDDGNTHDYQSGQFVKASFKYTTLSKNSAMLEGEHLDGKYAAKNWIERVVVRG 609          
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Fly
Match: GCS2alpha (gene:FBgn0027588 transcript:FBtr0070058)

HSP 1 Score: 269.626 bits (688), Expect = 3.441e-76
Identity = 177/591 (29.95%), Postives = 278/591 (47.04%), Query Frame = 2
Query:  914 PAPAITYRTIGGILDIFIFSGGTPETTVSQYTELIGRPMLPPFWSLGFHLSKYGYKSIADVSNTLYRNINISIPIEVQWSDIDYMDKYKDFTSDPIRYPNFGSFVAHLNQSLGIKYIVIIDPGISIQSPGVYSAYDEGLELNIFIKDANTKKDLISNVWPGETCFPDFTHPNASKYWSHQ--IQRFHSQVPIDGLWIDMNEPSNFYDGSRTGCALNNPYDYPFFVPTIRDGSLIKKTICSSSLHYNNVMHYNLHNLYGYTEAVATHSALLNTIPNKRPFILSRSTFSGSGKYTFHWTGDNSANWDQLANSIRQVLNFNMFGIPMTGADICGFNGDSNEELCIRWMQLGAFYPFMRNHNSIGAKAQDPASWSQEAQIIMKKSIIIRYVWLPNFYTLLVKSYLYGGTVMRPLSFQFYSDAETHEIERQFMIGSSMLVNPVVVQGARNVVAYFPA------GIWYDATDLSVIYSGKTGKWISLNAPLERTNVALRGGHALILSSLVNSTEYSRKV--------INLVCILSMNQTAAGDLYWDDGESMDSYSGKKFSY---FKFTATSSSVLINPEILGYSVLPSLNSIIILG 2629
            P PA  + +  GI+D FI  G  P  T  QY  L G   LP  ++L +H S++ Y    DV++   +    +IP++  W DI++ D  + FT D  ++P+  + + +L + LG   +VI+DP   I+    Y  + +  +   ++K      D     WPG   +PDF +P   +Y++ Q  + +F +      LW DMNEPS F      G  +  P D                      +HY N  H ++HNLYG+   + + + L    PN+RPFIL+R+ F+GS +Y   WTGDN A+W  L +S++  L   + G    GAD+  F G+ + EL  RW Q GAF PF R H  I  K ++P  + +  + +++ ++I RY +LP +YT   +  L G  V+RPL  Q+  D E   ++ Q ++   +LV PV+ QG   V  YFPA      G W+   D+      +   ++S+     +  V  RGG      S+V   E  R+           L+  L     A+G LY DD +S     G++      F      +S +  P+   Y  L  +  I+I G
Sbjct:  327 PPPAAHFMSESGIVDAFIMLGPKPMDTFKQYAALTGTHELPQLFALAYHQSRWNYNDERDVTSVSAKFDEYNIPMDTMWLDIEHTDGKRYFTWDKFKFPHPLAMIKNLTE-LGRHLVVIVDP--HIKRDNNYFFHRDCTDRGYYVK-TREGNDYEGWCWPGAASYPDFFNPVVREYYASQYALDKFQTVTADVMLWNDMNEPSVF-----NGPEITAPKDL---------------------IHYGNWEHRDVHNLYGHMHLMGSFAGLQQRDPNQRPFILTRAHFAGSQRYAAIWTGDNFADWSHLQHSVKMCLTEAVAGFSFCGADVGAFFGNPDTELLERWYQTGAFLPFFRAHAHIDTKRREPWLFPERTRQVIQNAVIKRYSYLPLWYTAFYELELTGEPVIRPLLAQYPLDKEAFGVDNQLLVQDRLLVRPVMQQGVSKVDVYFPAIDDKKNGDWW--YDVDTYQRQERSGYVSVPVDDFKIPVWQRGG------SIVPKKERQRRASTLMLHDPYTLIICLDRQGKASGSLYLDDEKSYAYRQGQRIHVNYEFAHDQLVNSFVGKPK---YKTLAWIERIVIAG 876          
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Fly
Match: GCS2alpha (gene:FBgn0027588 transcript:FBtr0070062)

HSP 1 Score: 269.626 bits (688), Expect = 3.441e-76
Identity = 177/591 (29.95%), Postives = 278/591 (47.04%), Query Frame = 2
Query:  914 PAPAITYRTIGGILDIFIFSGGTPETTVSQYTELIGRPMLPPFWSLGFHLSKYGYKSIADVSNTLYRNINISIPIEVQWSDIDYMDKYKDFTSDPIRYPNFGSFVAHLNQSLGIKYIVIIDPGISIQSPGVYSAYDEGLELNIFIKDANTKKDLISNVWPGETCFPDFTHPNASKYWSHQ--IQRFHSQVPIDGLWIDMNEPSNFYDGSRTGCALNNPYDYPFFVPTIRDGSLIKKTICSSSLHYNNVMHYNLHNLYGYTEAVATHSALLNTIPNKRPFILSRSTFSGSGKYTFHWTGDNSANWDQLANSIRQVLNFNMFGIPMTGADICGFNGDSNEELCIRWMQLGAFYPFMRNHNSIGAKAQDPASWSQEAQIIMKKSIIIRYVWLPNFYTLLVKSYLYGGTVMRPLSFQFYSDAETHEIERQFMIGSSMLVNPVVVQGARNVVAYFPA------GIWYDATDLSVIYSGKTGKWISLNAPLERTNVALRGGHALILSSLVNSTEYSRKV--------INLVCILSMNQTAAGDLYWDDGESMDSYSGKKFSY---FKFTATSSSVLINPEILGYSVLPSLNSIIILG 2629
            P PA  + +  GI+D FI  G  P  T  QY  L G   LP  ++L +H S++ Y    DV++   +    +IP++  W DI++ D  + FT D  ++P+  + + +L + LG   +VI+DP   I+    Y  + +  +   ++K      D     WPG   +PDF +P   +Y++ Q  + +F +      LW DMNEPS F      G  +  P D                      +HY N  H ++HNLYG+   + + + L    PN+RPFIL+R+ F+GS +Y   WTGDN A+W  L +S++  L   + G    GAD+  F G+ + EL  RW Q GAF PF R H  I  K ++P  + +  + +++ ++I RY +LP +YT   +  L G  V+RPL  Q+  D E   ++ Q ++   +LV PV+ QG   V  YFPA      G W+   D+      +   ++S+     +  V  RGG      S+V   E  R+           L+  L     A+G LY DD +S     G++      F      +S +  P+   Y  L  +  I+I G
Sbjct:  327 PPPAAHFMSESGIVDAFIMLGPKPMDTFKQYAALTGTHELPQLFALAYHQSRWNYNDERDVTSVSAKFDEYNIPMDTMWLDIEHTDGKRYFTWDKFKFPHPLAMIKNLTE-LGRHLVVIVDP--HIKRDNNYFFHRDCTDRGYYVK-TREGNDYEGWCWPGAASYPDFFNPVVREYYASQYALDKFQTVTADVMLWNDMNEPSVF-----NGPEITAPKDL---------------------IHYGNWEHRDVHNLYGHMHLMGSFAGLQQRDPNQRPFILTRAHFAGSQRYAAIWTGDNFADWSHLQHSVKMCLTEAVAGFSFCGADVGAFFGNPDTELLERWYQTGAFLPFFRAHAHIDTKRREPWLFPERTRQVIQNAVIKRYSYLPLWYTAFYELELTGEPVIRPLLAQYPLDKEAFGVDNQLLVQDRLLVRPVMQQGVSKVDVYFPAIDDKKNGDWW--YDVDTYQRQERSGYVSVPVDDFKIPVWQRGG------SIVPKKERQRRASTLMLHDPYTLIICLDRQGKASGSLYLDDEKSYAYRQGQRIHVNYEFAHDQLVNSFVGKPK---YKTLAWIERIVIAG 876          
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Fly
Match: GCS2alpha (gene:FBgn0027588 transcript:FBtr0070061)

HSP 1 Score: 269.626 bits (688), Expect = 3.441e-76
Identity = 177/591 (29.95%), Postives = 278/591 (47.04%), Query Frame = 2
Query:  914 PAPAITYRTIGGILDIFIFSGGTPETTVSQYTELIGRPMLPPFWSLGFHLSKYGYKSIADVSNTLYRNINISIPIEVQWSDIDYMDKYKDFTSDPIRYPNFGSFVAHLNQSLGIKYIVIIDPGISIQSPGVYSAYDEGLELNIFIKDANTKKDLISNVWPGETCFPDFTHPNASKYWSHQ--IQRFHSQVPIDGLWIDMNEPSNFYDGSRTGCALNNPYDYPFFVPTIRDGSLIKKTICSSSLHYNNVMHYNLHNLYGYTEAVATHSALLNTIPNKRPFILSRSTFSGSGKYTFHWTGDNSANWDQLANSIRQVLNFNMFGIPMTGADICGFNGDSNEELCIRWMQLGAFYPFMRNHNSIGAKAQDPASWSQEAQIIMKKSIIIRYVWLPNFYTLLVKSYLYGGTVMRPLSFQFYSDAETHEIERQFMIGSSMLVNPVVVQGARNVVAYFPA------GIWYDATDLSVIYSGKTGKWISLNAPLERTNVALRGGHALILSSLVNSTEYSRKV--------INLVCILSMNQTAAGDLYWDDGESMDSYSGKKFSY---FKFTATSSSVLINPEILGYSVLPSLNSIIILG 2629
            P PA  + +  GI+D FI  G  P  T  QY  L G   LP  ++L +H S++ Y    DV++   +    +IP++  W DI++ D  + FT D  ++P+  + + +L + LG   +VI+DP   I+    Y  + +  +   ++K      D     WPG   +PDF +P   +Y++ Q  + +F +      LW DMNEPS F      G  +  P D                      +HY N  H ++HNLYG+   + + + L    PN+RPFIL+R+ F+GS +Y   WTGDN A+W  L +S++  L   + G    GAD+  F G+ + EL  RW Q GAF PF R H  I  K ++P  + +  + +++ ++I RY +LP +YT   +  L G  V+RPL  Q+  D E   ++ Q ++   +LV PV+ QG   V  YFPA      G W+   D+      +   ++S+     +  V  RGG      S+V   E  R+           L+  L     A+G LY DD +S     G++      F      +S +  P+   Y  L  +  I+I G
Sbjct:  327 PPPAAHFMSESGIVDAFIMLGPKPMDTFKQYAALTGTHELPQLFALAYHQSRWNYNDERDVTSVSAKFDEYNIPMDTMWLDIEHTDGKRYFTWDKFKFPHPLAMIKNLTE-LGRHLVVIVDP--HIKRDNNYFFHRDCTDRGYYVK-TREGNDYEGWCWPGAASYPDFFNPVVREYYASQYALDKFQTVTADVMLWNDMNEPSVF-----NGPEITAPKDL---------------------IHYGNWEHRDVHNLYGHMHLMGSFAGLQQRDPNQRPFILTRAHFAGSQRYAAIWTGDNFADWSHLQHSVKMCLTEAVAGFSFCGADVGAFFGNPDTELLERWYQTGAFLPFFRAHAHIDTKRREPWLFPERTRQVIQNAVIKRYSYLPLWYTAFYELELTGEPVIRPLLAQYPLDKEAFGVDNQLLVQDRLLVRPVMQQGVSKVDVYFPAIDDKKNGDWW--YDVDTYQRQERSGYVSVPVDDFKIPVWQRGG------SIVPKKERQRRASTLMLHDPYTLIICLDRQGKASGSLYLDDEKSYAYRQGQRIHVNYEFAHDQLVNSFVGKPK---YKTLAWIERIVIAG 876          
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Fly
Match: GCS2alpha (gene:FBgn0027588 transcript:FBtr0070060)

HSP 1 Score: 269.626 bits (688), Expect = 3.441e-76
Identity = 177/591 (29.95%), Postives = 278/591 (47.04%), Query Frame = 2
Query:  914 PAPAITYRTIGGILDIFIFSGGTPETTVSQYTELIGRPMLPPFWSLGFHLSKYGYKSIADVSNTLYRNINISIPIEVQWSDIDYMDKYKDFTSDPIRYPNFGSFVAHLNQSLGIKYIVIIDPGISIQSPGVYSAYDEGLELNIFIKDANTKKDLISNVWPGETCFPDFTHPNASKYWSHQ--IQRFHSQVPIDGLWIDMNEPSNFYDGSRTGCALNNPYDYPFFVPTIRDGSLIKKTICSSSLHYNNVMHYNLHNLYGYTEAVATHSALLNTIPNKRPFILSRSTFSGSGKYTFHWTGDNSANWDQLANSIRQVLNFNMFGIPMTGADICGFNGDSNEELCIRWMQLGAFYPFMRNHNSIGAKAQDPASWSQEAQIIMKKSIIIRYVWLPNFYTLLVKSYLYGGTVMRPLSFQFYSDAETHEIERQFMIGSSMLVNPVVVQGARNVVAYFPA------GIWYDATDLSVIYSGKTGKWISLNAPLERTNVALRGGHALILSSLVNSTEYSRKV--------INLVCILSMNQTAAGDLYWDDGESMDSYSGKKFSY---FKFTATSSSVLINPEILGYSVLPSLNSIIILG 2629
            P PA  + +  GI+D FI  G  P  T  QY  L G   LP  ++L +H S++ Y    DV++   +    +IP++  W DI++ D  + FT D  ++P+  + + +L + LG   +VI+DP   I+    Y  + +  +   ++K      D     WPG   +PDF +P   +Y++ Q  + +F +      LW DMNEPS F      G  +  P D                      +HY N  H ++HNLYG+   + + + L    PN+RPFIL+R+ F+GS +Y   WTGDN A+W  L +S++  L   + G    GAD+  F G+ + EL  RW Q GAF PF R H  I  K ++P  + +  + +++ ++I RY +LP +YT   +  L G  V+RPL  Q+  D E   ++ Q ++   +LV PV+ QG   V  YFPA      G W+   D+      +   ++S+     +  V  RGG      S+V   E  R+           L+  L     A+G LY DD +S     G++      F      +S +  P+   Y  L  +  I+I G
Sbjct:  327 PPPAAHFMSESGIVDAFIMLGPKPMDTFKQYAALTGTHELPQLFALAYHQSRWNYNDERDVTSVSAKFDEYNIPMDTMWLDIEHTDGKRYFTWDKFKFPHPLAMIKNLTE-LGRHLVVIVDP--HIKRDNNYFFHRDCTDRGYYVK-TREGNDYEGWCWPGAASYPDFFNPVVREYYASQYALDKFQTVTADVMLWNDMNEPSVF-----NGPEITAPKDL---------------------IHYGNWEHRDVHNLYGHMHLMGSFAGLQQRDPNQRPFILTRAHFAGSQRYAAIWTGDNFADWSHLQHSVKMCLTEAVAGFSFCGADVGAFFGNPDTELLERWYQTGAFLPFFRAHAHIDTKRREPWLFPERTRQVIQNAVIKRYSYLPLWYTAFYELELTGEPVIRPLLAQYPLDKEAFGVDNQLLVQDRLLVRPVMQQGVSKVDVYFPAIDDKKNGDWW--YDVDTYQRQERSGYVSVPVDDFKIPVWQRGG------SIVPKKERQRRASTLMLHDPYTLIICLDRQGKASGSLYLDDEKSYAYRQGQRIHVNYEFAHDQLVNSFVGKPK---YKTLAWIERIVIAG 876          
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Fly
Match: GCS2alpha (gene:FBgn0027588 transcript:FBtr0070059)

HSP 1 Score: 269.626 bits (688), Expect = 3.441e-76
Identity = 177/591 (29.95%), Postives = 278/591 (47.04%), Query Frame = 2
Query:  914 PAPAITYRTIGGILDIFIFSGGTPETTVSQYTELIGRPMLPPFWSLGFHLSKYGYKSIADVSNTLYRNINISIPIEVQWSDIDYMDKYKDFTSDPIRYPNFGSFVAHLNQSLGIKYIVIIDPGISIQSPGVYSAYDEGLELNIFIKDANTKKDLISNVWPGETCFPDFTHPNASKYWSHQ--IQRFHSQVPIDGLWIDMNEPSNFYDGSRTGCALNNPYDYPFFVPTIRDGSLIKKTICSSSLHYNNVMHYNLHNLYGYTEAVATHSALLNTIPNKRPFILSRSTFSGSGKYTFHWTGDNSANWDQLANSIRQVLNFNMFGIPMTGADICGFNGDSNEELCIRWMQLGAFYPFMRNHNSIGAKAQDPASWSQEAQIIMKKSIIIRYVWLPNFYTLLVKSYLYGGTVMRPLSFQFYSDAETHEIERQFMIGSSMLVNPVVVQGARNVVAYFPA------GIWYDATDLSVIYSGKTGKWISLNAPLERTNVALRGGHALILSSLVNSTEYSRKV--------INLVCILSMNQTAAGDLYWDDGESMDSYSGKKFSY---FKFTATSSSVLINPEILGYSVLPSLNSIIILG 2629
            P PA  + +  GI+D FI  G  P  T  QY  L G   LP  ++L +H S++ Y    DV++   +    +IP++  W DI++ D  + FT D  ++P+  + + +L + LG   +VI+DP   I+    Y  + +  +   ++K      D     WPG   +PDF +P   +Y++ Q  + +F +      LW DMNEPS F      G  +  P D                      +HY N  H ++HNLYG+   + + + L    PN+RPFIL+R+ F+GS +Y   WTGDN A+W  L +S++  L   + G    GAD+  F G+ + EL  RW Q GAF PF R H  I  K ++P  + +  + +++ ++I RY +LP +YT   +  L G  V+RPL  Q+  D E   ++ Q ++   +LV PV+ QG   V  YFPA      G W+   D+      +   ++S+     +  V  RGG      S+V   E  R+           L+  L     A+G LY DD +S     G++      F      +S +  P+   Y  L  +  I+I G
Sbjct:  327 PPPAAHFMSESGIVDAFIMLGPKPMDTFKQYAALTGTHELPQLFALAYHQSRWNYNDERDVTSVSAKFDEYNIPMDTMWLDIEHTDGKRYFTWDKFKFPHPLAMIKNLTE-LGRHLVVIVDP--HIKRDNNYFFHRDCTDRGYYVK-TREGNDYEGWCWPGAASYPDFFNPVVREYYASQYALDKFQTVTADVMLWNDMNEPSVF-----NGPEITAPKDL---------------------IHYGNWEHRDVHNLYGHMHLMGSFAGLQQRDPNQRPFILTRAHFAGSQRYAAIWTGDNFADWSHLQHSVKMCLTEAVAGFSFCGADVGAFFGNPDTELLERWYQTGAFLPFFRAHAHIDTKRREPWLFPERTRQVIQNAVIKRYSYLPLWYTAFYELELTGEPVIRPLLAQYPLDKEAFGVDNQLLVQDRLLVRPVMQQGVSKVDVYFPAIDDKKNGDWW--YDVDTYQRQERSGYVSVPVDDFKIPVWQRGG------SIVPKKERQRRASTLMLHDPYTLIICLDRQGKASGSLYLDDEKSYAYRQGQRIHVNYEFAHDQLVNSFVGKPK---YKTLAWIERIVIAG 876          
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Zebrafish
Match: si:ch73-12o23.1 (si:ch73-12o23.1 [Source:ZFIN;Acc:ZDB-GENE-130530-749])

HSP 1 Score: 694.115 bits (1790), Expect = 0.000e+0
Identity = 362/805 (44.97%), Postives = 504/805 (62.61%), Query Frame = 2
Query:  173 CSVPNNNYRLDCFPGSNA--NQNDCLARGCCWSPPETREYSQNNPTIPYCFFPIEYPNYQINSFTPTDRGFKARLTKQQKSFLRKEILNLNFEVIFETNTRLRIRITDPNVQRFEVPIQLGSPDPTPPSNIQYKFTMPTNGSFGFEVKRNSDGLSLFKT-FGPLLYSDQFIQISSLMSIQHVYGIGEQNRPFLHDLSTQWERIGLWARDNGIDTYNNLYGTHPFYMSLPDSGEAFGVYYFNSNAQEFVLQPAPAITYRTIGGILDIFIFSGGTPETTVSQYTELIGRPMLPPFWSLGFHLSKYGYKSIADVSNTLYRNINISIPIEVQWSDIDYMDKYKDFTSDPIRYPNFGSFVAHLNQSLGIKYIVIIDPGIS-IQSPGVYSAYDEGLELNIFIKDANTKKDLISNVWPGETCFPDFTHPNASKYWSHQIQRFHSQVPIDGLWIDMNEPSNFYDGSRTGCALNNPYDYPFFVPTIRDGSLIKKTICSSSLHYNNVMHYNLHNLYGYTEAVATHSALLNTIPNKRPFILSRSTFSGSGKYTFHWTGDNSANWDQLANSIRQVLNFNMFGIPMTGADICGFNGDSNEELCIRWMQLGAFYPFMRNHNSIGAKAQDPASWSQEAQIIMKKSIIIRYVWLPNFYTLLVKSYLYGGTVMRPLSFQFYSDAETHEIERQFMIGSSMLVNPVVVQGARNVVAYFPAGIWYD-ATDLSVIYSGKTGKWISLNAPLERTNVALRGGHALILSSLVNSTEY--SRKVINLVCILSMNQTAAGDLYWDDGESMDSYSGKKFSYFKFTATSSSVL 2566
            CS     +R DC+P  N    ++ C AR CC+        S  N  +P+CF+  +YP+Y++ S   T+ G   +L + +K++  K+I  L  EV+FE + RLR++ITDP  +R+EVPI +        SN  Y         FG  VKR   G  L  T   PL Y+DQF+Q+SS +  + +YG+GE    FLHD+  QW  + +WARD       NLYG HPFY+S+   G A G +  NSNA + VLQPAPA+T+R IGGILD +IF G  P + + QY +++G+P +P +W+LG+HL ++GYK+     + +    N  IP +VQW+DIDYMD+  DFT DP  +      V  L Q     Y++I+DPGIS  Q PG Y  +DEG +  IFI D+N    LI  VWPG T FPDF++P+  ++W   +QRFH++VP DG+WIDMNEPSNF+DGS  GC  +N  + P + P I  G+L  KT+C+S+    +V HYN+H+LYG  EA AT SAL   I  KRPFI+SRSTF   GKY+ HW GDN + W  LA SI  +L FN+ GIP+ GADICGF G + EELC+RW QLGAFYPF RNHNSI  + Q+P ++S  A+  MK++I++RY   P+ YTL   +++ G TV  PL FQF +D +T+ I++QF+ G S+LV PV+  G   VV YFP G+WYD  T  S+I SG+    I L AP ++ N+ LR G ++I +   N+T +  S + ++L+  LS +  A GDLYWDDGE++DSY   +++Y  FT   ++++
Sbjct:  101 CSQVPEGWRFDCYPERNVVVTEDMCHARNCCFIQSSRGNVSAQN-GVPWCFYTPDYPSYELMSIVDTEMGKVGKLLRNKKTYYPKDIDALQLEVLFEEDHRLRVKITDPTEKRYEVPIDVPVVHKRA-SNPSYTVDF-IKEPFGLIVKRTQTGAVLLNTSIAPLFYADQFLQMSSSLPTRFIYGLGEHRSNFLHDV--QWNTLTMWARDVPPMELTNLYGVHPFYLSMESDGNAHGFFMLNSNAMDVVLQPAPAVTWRMIGGILDFYIFLGPDPSSVIGQYLDVVGKPAMPIYWALGYHLCRWGYKTSNKTWSVVKEMRNYGIPQDVQWNDIDYMDRSLDFTYDPSGFSTLPDLVKDL-QRHDQHYVMILDPGISNSQPPGSYWPFDEGKKKGIFINDSNGDI-LIGKVWPGLTAFPDFSNPDTHEWWYQNLQRFHNKVPFDGVWIDMNEPSNFFDGSLNGCP-DNELENPPYTPGILGGTLKGKTVCASARQKISV-HYNIHSLYGLMEAQATESAL-RRITKKRPFIISRSTFPSQGKYSGHWLGDNRSQWKDLATSIPGMLTFNILGIPLIGADICGFGGSTTEELCVRWTQLGAFYPFTRNHNSIDEQDQEPTAFSPAARTAMKEAILLRYSLFPHLYTLFHHAHVSGHTVATPLLFQFPTDEKTYGIDKQFLWGKSLLVTPVLDAGRDYVVGYFPKGLWYDFHTGNSLISSGEE---IKLEAPADKINLHLREG-SVIPTQRPNTTLWVSSGQPLHLIVSLSEDGRAKGDLYWDDGETIDSYESNQYAYIYFTVEQNTMM 891          
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Zebrafish
Match: CABZ01079192.1 (sucrase-isomaltase (alpha-glucosidase) [Source:NCBI gene;Acc:100148922])

HSP 1 Score: 485.723 bits (1249), Expect = 2.822e-152
Identity = 300/856 (35.05%), Postives = 473/856 (55.26%), Query Frame = 2
Query:  197 RLDCFPGSNANQNDCLARGCCWSPPETREYSQNNP-TIPYCFFPIEYPNYQINSFTPTDRGFKARLT-----KQQKSFLRKEILNLNFEVIFETNTRLRIRITDPNVQRFEVPIQLGSPDPTPPSNIQYKFTMPTNGSFGFEVKRNSDGLSLFKTFGP-LLYSDQFIQISSLMSIQHVYGIGEQNRP-FLHDLSTQWERIGLWARDNGIDTYNNLYGTHPFYMSLPDSGEAFGVYYFNSNAQE-FVLQPAPAITYRTIGGILDIFIFSGGTPETTVSQYTE-LIGRPMLPPFWSLGFHLSKYGYKSIADVSNTLYRNINIS-IPIEVQWSDIDYMDKYKDFTSDPIRYPNFGSFVAHLNQSLGIKYIVIIDPGISI-QSPGVYSAYDEGLELNIFIK--DANTKKDLISNVWPGE---------------------TCFPDFTHPNASKYWSHQIQRFHSQV-PIDGLWIDMNEPSNFYDGSRTGCALNNPY-DYPFFVPTI--RDGSLIKKTICSSSLHY----NNVMHYNLHNLYGYTEAVATHSALLNTIPNKRPFILSRSTFSGSGKYTFHWTGDNSANWDQLANSIRQVLNFNMFGIPMTGADICGFNGDSNEELCIRWMQLGAFYPFMRNHNSIGAKAQDPASWSQEAQIIMKKSIIIRYVWLPNFYTLLVKSYLYGGTVMRPLSFQFYSDAETHEIERQFMIGSSMLVNPVVVQGARNVVAYFPAGIWYDATDLSVIYSGKTGKWISLNAPLERTNVALRGGHALILSSLVNSTEYSRK-VINLVCILSMNQTAAGDLYWDDGESMDSYSGKKFSYFKFTATSSSVL-INPEILGYSVLPSLNSIIILG 2629
            R+DC+P   A + +C  RGC W      E+S+  P  +P C++  E   Y+ ++      G  A L        Q+S    +I  L  E+ F     LR +I DP   R+EVP+ L  P+P P    Q          FG  V R      +F +  P  ++SDQFIQIS+ +  ++VYG GE   P + HDL+  +   GL+A+D       N YG HPFYM +  S +A G+   NSNA   F + P   + +R +  +L +++F   T    +  Y + LIGRP+LP +WSLGF L +YGY + +++++ LYR++  + IP +VQ++DIDYM++  DFT D   +    + V  + +  G+++I I+DP I+  ++ G Y+A+D G+E ++FIK   A +   +   VWP                         FPDF     +++W+ QI+ ++  V   DGLWIDMNEP++F  G+  G  L +P  + P ++P +  ++  L  KT+C +S         V HY++HNLYG +    T+ AL +T   KR  I++RST+  SG++  HW GDN + WDQL  SI  ++ F++FG+  TGADICGF   + +E+C+RWMQLGAFYPF RNHN+I    QDP +W  E   + +  + IRY  LP  YTL+ +++  G TV+RP+  +F +D +T +I+RQF+ GS++L+ P + +G   V  Y P   WYD     V+     G+++ ++ PL++ N+ +RG + +   +   +T+ SRK  +NL+  L  +  A G+L+WDDGE +D+   +K+ Y +F+A+  S+  +    L  +  P L  + +LG
Sbjct:  437 RIDCYPEEGATKAECEGRGCIW------EHSKGIPLAVPMCYYS-ENHGYKASNVVENMYGITADLEINTAFPSQRS-QSPDINKLRVEITFHDEICLRWKIYDPEKARYEVPVPLNLPNPPPLWGEQTYKVEINEEPFGIRVIRKDTSEVIFDSVLPGFIFSDQFIQISTRLPTEYVYGFGETEHPSYKHDLN--FHTYGLFAKDQPPGYKLNSYGIHPFYMGMEKSKKAHGILLLNSNAMGIFTVLPFTFLFWRNVFLLLLMYVFINNTESLFMKTYNDMLIGRPVLPAYWSLGFQLCRYGYANDSEIAD-LYRDMRAAEIPYDVQYADIDYMERQMDFTLDKTNFLGLPALVDRM-RGEGMRFIFILDPAIAANETTGSYAAFDSGIEKDVFIKWPPALSNDIVWGKVWPDYPNITVDNSLDWDTQVELFRSFVAFPDFFKNGTAEWWADQIKDYYDNVMKFDGLWIDMNEPASFVHGTVGGKCLGDPLLENPPYMPPLESKEKGLNHKTLCMNSEQILADGTRVRHYDVHNLYGLSHTKPTYDALHSTT-GKRGVIITRSTYPTSGRWAGHWLGDNYSAWDQLLKSIIGMMEFSIFGVSYTGADICGFFNPAQKEMCLRWMQLGAFYPFSRNHNTINMPRQDPVAWGPEFANMSRDVLNIRYTLLPYLYTLMYEAHTKGTTVVRPMLHEFVNDEKTWDIDRQFLWGSALLITPALEEGVTVVKGYLPKTRWYDYHTNEVVEG--QGQFVDMDTPLDKINLHVRGRYIIPYQNPERNTQLSRKNPMNLLVALDGSGYATGNLFWDDGEGIDTLKNRKYIYKQFSASRGSLSGVRETGLEEADRPLLGEVKVLG 1277          

HSP 2 Score: 279.256 bits (713), Expect = 7.523e-78
Identity = 158/385 (41.04%), Postives = 228/385 (59.22%), Query Frame = 2
Query: 1499 DMNEPSNFYDGSRTGCALNNPYDYPFFVPTIRDGSLIKKTIC-SSSLHYNNVMHYNLHNLYGYTEAVATHSALLNTIPNKRPFILSRSTFSGSGKYTFHWTGDNSANWDQLANSIRQVLNFNMFGIPMTGADICGFNGDSNEELCIRWMQLGAFYPFMRNHNSIGAKAQDPASWSQEAQII--MKKSIIIRYVWLPNFYTLLVKSYLYGGTVMRPLSFQFYSDAETHEIERQFMIGSSMLVNPVVVQGARNVVAYFPAGIWYDATDLSVIYSGKTGKWISLNAPLERTNVALRGGHALILSSL---VNSTEYSRKVINLVCILSMNQTAAGDLYWDDGESMDSYSGKKFSYFKFTATSSSVLINPEILGYSVLPSLN--SIIILG 2629
            DMNE SNF  GS  GCA +N  +YP F P I D  +  KT+C  +   + N  HY++H+LYGY+  +AT  A        R  + +RS+F G GKY+ HW GDN ANW+ +  +I  +L FN+FGIP  GADICGF  +S EELC RWMQ+GAFYPF RNHN+ G + QDPAS+  ++ ++   +  + IRY  LP  YTL  K+++ G TV+RPL  +FYSD++T +I +QFM G+ +L+ PV+  G   V AY P  IWYD  +L    + K  K  ++N  +    +  +  H     S    V  +   R  + L+  L  N++A+G+L+WDDG+S D+ S     +++F+ T  S+ ++    GYS   +L   +I ILG
Sbjct:    1 DMNEISNFIKGSNKGCA-DNKLNYPPFTPRILDDLMYSKTLCMDAKQKWGN--HYDVHSLYGYSMVLATERASKEVFGTNRSMVFTRSSFPGVGKYSGHWLGDNGANWNDIKWAIPGMLEFNLFGIPYIGADICGFFDNSTEELCRRWMQVGAFYPFSRNHNAQGYEDQDPASYGLDSLLVNTSRHYLNIRYKLLPYLYTLFYKAHVNGETVVRPLMHEFYSDSQTWDIHKQFMWGAHLLITPVLDPGVHYVEAYIPDAIWYDFENLKSKVNFKKFK-SNVNLNVNNIKMNKKNKHLNYFPSQRMKVVCSPSRRHPMGLIIALDDNKSASGELFWDDGDSRDTVSSGNHIHYQFSVTDGSLTMHVTKNGYSDPNNLKFENITILG 381          
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Zebrafish
Match: GAA (glucosidase alpha, acid [Source:HGNC Symbol;Acc:HGNC:4065])

HSP 1 Score: 354.369 bits (908), Expect = 2.352e-110
Identity = 186/454 (40.97%), Postives = 271/454 (59.69%), Query Frame = 2
Query:  170 QCSVPNNNYRLDCFPGSNANQNDCLARGCCWSPPETREYSQNNPTIPYCFFPIEYPNYQINSFTPTDRGFKARLTKQQKSFLRKEILNLNFEVIFETNTRLRIRITDPNVQRFEVP-IQLGSPDPTPPSNIQYKFTMPTNGSFGFEVKRNSDGLSLF-KTFGPLLYSDQFIQISSLMSIQHVYGIGEQNRPFLHDLSTQWERIGLWARDNGIDTYNNLYGTHPFYMSLPDSGEAFGVYYFNSNAQEFVLQPAPAITYRTIGGILDIFIFSGGTPETTVSQYTELIGRPMLPPFWSLGFHLSKYGYKSIADVSNTLYRNINISIPIEVQWSDIDYMDKYKDFTSDPIRYPNFGSFVAHLNQSLGIKYIVIIDPGISIQS-PGVYSAYDEGLELNIFIKDANTKKDLISNVWPGETCFPDFTHPNASKYWSHQIQRFHSQVPIDGLWIDMNEPSNF 1522
            QC +     R+DC    + ++ +C +RGCC+ P    +     P  P+CF+ + YP Y++    PT+RG +A LT+   S+L ++I  L  +V+ ET  RL + + DP   R+EVP ++  S       N  Y         FGF V+R S+G  L   T GPLL++DQ++Q+S+ ++   V G+GE   P   DL   W  + LW RD       NLYG+HPF++     G+A GV+  NSNA E  +QPAPA+T+ TIGGILD FIF G +P++ + QY E+IG PM+PP+WSLGFHL ++GY S       +       IP++VQW+D+DY D+ + FT DP R+ +    V   +Q LG+KY++I+DPGIS  S PG Y  +D+GL+  +FI ++ T + LI  VWPG T FPDFT+P    +W   I+ F+++VP+DGLWI     S+F
Sbjct:   64 QCGIAVER-RIDCARDRSLSRAECESRGCCYLP--LPQSGLRGP--PWCFYTVFYPGYKMGPMLPTERGHRAILTRSAPSYLPRDIHTLQLDVMAETQDRLHLTLKDPTSPRYEVPFVKSQSKGHKSMENPLYDVDFQPE-PFGFSVRRKSNGRVLLNTTIGPLLFADQYLQLSTSLASSTVSGLGEHYTPITLDLD--WSSVSLWNRDMAPHRSANLYGSHPFFLVQEGDGQAHGVFLLNSNAMEVFMQPAPALTWVTIGGILDFFIFLGPSPQSVIQQYQEVIGYPMMPPYWSLGFHLCRWGYTSTNITRTVVQLMRQAKIPLDVQWNDLDYADQRRVFTFDPQRFGDLPQMVEDFHQ-LGMKYVLILDPGISSASPPGSYKPFDDGLKKGVFINNS-TGQILIGKVWPGPTAFPDFTNPTTQDWWMDWIKDFYNKVPVDGLWIVSIHSSSF 507          
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Zebrafish
Match: gaa (glucosidase, alpha; acid (Pompe disease, glycogen storage disease type II) [Source:ZFIN;Acc:ZDB-GENE-070212-2])

HSP 1 Score: 315.464 bits (807), Expect = 6.951e-98
Identity = 178/422 (42.18%), Postives = 244/422 (57.82%), Query Frame = 2
Query: 1502 MNEPSNFYDGSRTGCALNNPYDYPFFVPTIRDGSLIKKTICSSSLHYNNVMHYNLHNLYGYTEAVATHSALLNTIPNKRPFILSRSTFSGSGKYTFHWTGDNSANWDQLANSIRQVLNFNMFGIPMTGADICGFNGDSNEELCIRWMQLGAFYPFMRNHNSIGAKAQDPASWSQEAQIIMKKSIIIRYVWLPNFYTLLVKSYLYGGTVMRPLSFQFYSDAETHEIERQFMIGSSMLVNPVVVQGARNVVAYFPAGIWYDATDLSVIYSGKTGKWISLNAPLERTNVALRGGHALILSSLVNSTEYSRK-VINLVCILSMNQTAAGDLYWDDGESMDSYSGKKFSYFKFTATSSSVLINPEILGYSVLP-SLNSIIILGXXXXXXXXXXXXDKPIQF-YKKSNLLDALLGGLFPIGQKLILKW 2758
            MNEPSNF  GS  GC  ++  + P + P +  G L   T+C S+  Y +  HYNLHNLYG TEA+ATH ALL  +   RPF+LSRS+F G G+++ HWTGD  ++W+QL  SI  VL F ++GIP+ GAD+CGF GD+NEELC+RW QLGAFYPFMRNHN      Q+P  +SQ AQ  M+  I +RY  LP  YTL   ++    TV RPL  QF +D +   I+RQF+ GSS+L++PV+ QGA  V+AY P G WY   +    YS   G++I   A L+   V +R    +   +   +T  SRK    L   LS+   A G+L+WDDGES+D++    +SY  F A  S V+  P  L  S+    L  + + G+ T          K   F Y+    +  + G   P+  K+ ++W
Sbjct:    1 MNEPSNFVQGSVDGCP-DSELEKPPYTPGVIGGQLNSGTLCVSAQQYLS-NHYNLHNLYGLTEAIATHRALLK-VKKTRPFVLSRSSFPGLGRFSAHWTGDVRSDWEQLRFSIPAVLLFGLYGIPLVGADVCGFGGDTNEELCVRWTQLGAFYPFMRNHNDRPNAPQEPYVFSQRAQDAMRMVINLRYSLLPFLYTLFHHAHTSASTVARPLFLQFPTDPDCRSIDRQFLWGSSLLISPVLEQGAVEVMAYLPPGTWYSLHNGQTYYS--KGQYIVFPASLDTIIVHVRERSIIPQQAPALTTAISRKNPFTLTVGLSVGNLAKGELFWDDGESLDTFERGDYSYLLFFAEESYVVSKPIKLNGSLDGLVLGEVRVFGVQTPPTAVWANGQKVPDFSYRLDTKVLTVAGLELPMTAKITIQW 417          
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Zebrafish
Match: CABZ01088484.1 (pep chromosome:GRCz11:18:1768804:1791127:1 gene:ENSDARG00000104569.2 transcript:ENSDART00000167477.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CABZ01088484.1)

HSP 1 Score: 283.493 bits (724), Expect = 1.328e-85
Identity = 158/446 (35.43%), Postives = 241/446 (54.04%), Query Frame = 2
Query:  197 RLDCFPGSNANQNDCLARGCCWSPPETREYSQNNPTIPYCFFPIEYPNYQINSFTPTDRGFKARLTKQQK-SFLRKEILNLNFEVIFETNTRLRIRITDPNVQRFEVPIQ-LGSPDPTPPSNIQYKFTMPTNGSFGFEVKRNSDGLSLFKT-FGPLLYSDQFIQISSLMSIQHVYGIGEQ-NRPFLHDLSTQWERIGLWARD---NGIDTYNNLYGTHPFYMSLPDSGEAFGVYYFNSNAQEFVLQPAPAITYRTIGGILDIFIFSGGTPETTVSQYTELIGRPMLPPFWSLGFHLSKYGYKSIADVSNTLYRNINISIPIEVQWSDIDYMDKYKDFTSDPIRYPNFGSFVAHLNQSLGIKYIVIIDPGISI--QSPGVYSAYDEGLELNIFIKDANTKKDLISNVWPGETCFPDFTHPNASKYWSHQIQRFHSQVPIDGLWIDMN 1507
            R+DCFP   A+Q  CL R CCWSP        +   +P+CFF   +         P     +A+LT+    S    +I +L F    +T  R R +ITD    RFEVP + + +P   P   ++YK  +     FG ++ R +    LF T  GPL+++DQ++Q+S+ +   ++YG+GE  ++ F HD  T W    ++ RD   NGI                                   ++QPAPA+T+RTIGG+LD ++  G TPE  V ++T+LIGRP +PP+WSLGF +S++ Y S+  V   + RN N S+P +VQ++DIDYM++ K FT D +++ +  +F  +++   G KYIVI+DP +S   +  G Y   D G    +++ +++ +  L+  VWPGET FPDFT+    K+W  +I RFH +V  D LWI  N
Sbjct:   46 RVDCFPDGGASQQKCLERACCWSP-------LDETNVPWCFFSKNHGYTADRVSNPDSTHIEAKLTRMNAPSLFGADIKDLTFHGEMQTENRFRFKITDAKQARFEVPHENVKAPANPPTGPLKYKVEI-VQKPFGVKIWRTTPEKLLFDTTIGPLVFADQYLQLSAKLPSHNIYGLGEHVHQTFRHD--TNWRTWPIFTRDSFPNGIS----------------------------------LIQPAPAVTFRTIGGVLDFYVLVGDTPEAVVDEFTKLIGRPFIPPYWSLGFQISRWDYGSLDAVKEVVERNRNASLPYDVQYTDIDYMEEKKIFTYDLVKFADLPNFADYMHDK-GQKYIVILDPAVSTGRRLNGPYDTVDRGHAAKVWVTESDGETPLVGEVWPGETVFPDFTNEACIKWWVDEISRFHKEVKHDALWIVSN 446          
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Xenopus
Match: GAA (glucosidase, alpha; acid [Source:NCBI gene;Acc:100495955])

HSP 1 Score: 710.679 bits (1833), Expect = 0.000e+0
Identity = 374/836 (44.74%), Postives = 531/836 (63.52%), Query Frame = 2
Query:  113 MLKLLLIISLNFIIVSNA-----LQCSVPNNNYRLDCFPGSNANQNDCLARGCCWSPPETREYSQNNPTIPYCFFPIEYPNYQINSFTPTDRGFKARLTKQQKSFLRKEILNLNFEVIFETNTRLRIRITDPNVQRFEVPIQLGSPDPTPPSNIQYKFTMP----TNGSFGFEVKRNSDGLSLFKT-FGPLLYSDQFIQISSLMSIQHVYGIGEQNRPFLHDLSTQWERIGLWARDNGIDTYNNLYGTHPFYMSLPDSGEAFGVYYFNSNAQEFVLQPAPAITYRTIGGILDIFIFSGGTPETTVSQYTELIGRPMLPPFWSLGFHLSKYGYKSIADVSNTLYRNI-NISIPIEVQWSDIDYMDKYKDFTSDPIRYPNFGSFVAHLNQSLGIKYIVIIDPGISIQ-SPGVYSAYDEGLELNIFIKDANTKKDLISNVWPGETCFPDFTHPNASKYWSHQIQRFHSQVPIDGLWIDMNEPSNFYDGSRTGCALNNPYDYPFFVPTIRDGSLIKKTICSSSLHYNNVMHYNLHNLYGYTEAVATHSALLNTIPNKRPFILSRSTFSGSGKYTFHWTGDNSANWDQLANSIRQVLNFNMFGIPMTGADICGFNGDSNEELCIRWMQLGAFYPFMRNHNSIGAKAQDPASWSQEAQIIMKKSIIIRYVWLPNFYTLLVKSYLYGGTVMRPLSFQFYSDAETHEIERQFMIGSSMLVNPVVVQGARNVVAYFPAGIWYDATDLSVIYSGKTGKWISLNAPLERTNVALRGGHALILSSLVNSTEYSRK-VINLVCILSMNQTAAGDLYWDDGESMDSYSGKKFSYFKFTATSSSVLINPEI 2581
            +L L+LI ++  +  S       LQCSV + N R DC P    ++ +C ARGCC+SP   +     N   P+CFFP  YP+Y++ + T TDRG+ A L +   +F+  +I+ L  EV+FET +RL   I DP  +R+EVPI      PTP  + +   T+     +   FG  ++R S GL L  T   PL+++DQF+QIS+ +   ++YG+GE       +LS QW R+  W RD      +NLYG+HPFY+S+ + G++ GV+  NSNA + +LQ APA+T+RT GGILD ++F G  P++ + QY ++IG P +PP+WSLGFHL ++GY S ++ +  + +N+ +  IP++VQW+DIDYMD  +DFT D  R+ +F   V   +Q  G+KYI+I+DP IS   +PG Y  YD+GL+  +FI D +  K L+  VWPG T FPDFT P    +W   ++ FH QVP DG+WIDMNEPSNF  GS  GC  NN  + P +VP +  GSL   TIC+SS  + +  HYNLHNLYG +EAVATH AL+  +  KRPFI+SRSTF+  G Y  HWTGD  ++W+Q+  S+  +L FNMFG+PM GADICGF G++ EELC+RW QLGAFYPFMRNHN   + +Q+P  +S EAQ  +K +++IRY  LP  YTL  K++  G TV R L  +F +D  T  I+RQ++ G ++L+ PV+ QG   V AYFP G WY     + I S   G+W+ L APL++ NV +RGG+ L       +TE SRK  + LV  L+ +  A GDL+WDDG S+ ++  + +++  F A ++++L+N  I
Sbjct:   19 LLMLILISAVCPVAPSQETGPSPLQCSV-SPNRRFDCVPEKCVSKEECEARGCCYSPAGDK----GNIGQPWCFFPPSYPSYKMFNLTQTDRGYNATLKRSVGTFMPHDIMTLQLEVLFETESRLHFTIKDPAKKRYEVPI------PTPQVSGKASSTLFDVQFSCDPFGLIIRRKSSGLILLNTTVAPLIFADQFLQISTSLPSGYLYGLGEHLTAL--NLSLQWNRLTFWNRDLRPSKDSNLYGSHPFYLSMEEGGQSHGVFLLNSNAMDVLLQEAPALTWRTTGGILDFYVFLGPEPKSVIRQYQDIIGYPFMPPYWSLGFHLCRWGY-STSNCTRQVVKNMRDAKIPLDVQWNDIDYMDAMRDFTYDQNRFGDFPEMVKEFHQQ-GVKYIMILDPAISSSNTPGSYPPYDDGLKRGVFITD-DEGKPLVGKVWPGLTVFPDFTMPETFSWWYDMVKLFHDQVPFDGIWIDMNEPSNFVQGSVDGCP-NNELENPPYVPGVVGGSLRSTTICASSQQHLS-SHYNLHNLYGLSEAVATHYALVKIL-KKRPFIISRSTFASHGHYAGHWTGDVVSSWEQIYYSVPAILLFNMFGVPMVGADICGFGGNTTEELCVRWSQLGAFYPFMRNHNDHDSVSQEPYVFSSEAQKAIKSALLIRYTLLPYLYTLFHKAHSSGETVARALFIEFPTDPNTWTIDRQYLWGEALLITPVLEQGKTTVNAYFPTGTWYAPESGTGIQS--KGQWLMLPAPLDKINVHIRGGYILPAQVPGMNTEESRKNKLLLVVALTPDGVARGDLFWDDGVSLGTFERQDYTHVVFLA-ANNILLNELI 832          
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Xenopus
Match: GAA (glucosidase, alpha; acid [Source:NCBI gene;Acc:100495955])

HSP 1 Score: 706.827 bits (1823), Expect = 0.000e+0
Identity = 373/841 (44.35%), Postives = 531/841 (63.14%), Query Frame = 2
Query:  113 MLKLLLIISLNFIIVSNA-----LQCSVPNNNYRLDCFPGSNANQNDCLARGCCWSPPETREYSQNNPTIPYCFFPIEYPNYQINSFTPTDRGFKARLTKQQKSFLRKEILNLNFEVIFETNTRLRIRITDPNVQRFEVPIQLGSPDPTPPSNIQYKFTMP----TNGSFGFEVKRNSDGLSLFKTFGPLLYSDQFIQISSLMSIQHVYGIGEQNRPFLHDLSTQWERIGLWARDNGIDTYNNLYGTHPFYMSLPDSGEAFGVYYFNSNAQEFVLQPAPAITYRTIGGILDIFIFSGGTPETTVSQYTELIGRPMLPPFWSLGFHLSKYGYKSIADVSNTLYRNI-NISIPIEVQWSDIDYMDKYKDFTSDPIRYPNFGSFVAHLNQSLGIKYIVIIDPGISIQ-SPGVYSAYDEGLELNIFIKDANTKKDLISNVWPGETCFPDFTHPNASKYWSHQIQRFHSQVPIDGLWIDMNEPSNFYDGSRTGCALNNPYDYPFFVPTIRDGSLIKKTICSSSLHYNNVMHYNLHNLYGYTEAVATHSALLNTIPNKRPFILSRSTFSGSGKYTFHWTGDNSANWDQLANSIRQVLNFNMFGIPMTGADICGFNGDSNEELCIRWMQLGAFYPFMRNHNSIGAKAQDPASWSQEAQIIMKKSIIIRYVWLPNFYTLLVKSYLYGGTVMRPLSFQFYSDAETHEIERQFMIGSSMLVNPVVVQGARNVVAYFPAGIWYDATDLSVIYSGK------TGKWISLNAPLERTNVALRGGHALILSSLVNSTEYSRK-VINLVCILSMNQTAAGDLYWDDGESMDSYSGKKFSYFKFTATSSSVLINPEI 2581
            +L L+LI ++  +  S       LQCSV + N R DC P    ++ +C ARGCC+SP   +     N   P+CFFP  YP+Y++ + T TDRG+ A L +   +F+  +I+ L  EV+FET +RL   I DP  +R+EVPI      PTP  + +   T+     +   FG  ++R S GL+   T  PL+++DQF+QIS+ +   ++YG+GE       +LS QW R+  W RD      +NLYG+HPFY+S+ + G++ GV+  NSNA + +LQ APA+T+RT GGILD ++F G  P++ + QY ++IG P +PP+WSLGFHL ++GY S ++ +  + +N+ +  IP++VQW+DIDYMD  +DFT D  R+ +F   V   +Q  G+KYI+I+DP IS   +PG Y  YD+GL+  +FI D +  K L+  VWPG T FPDFT P    +W   ++ FH QVP DG+WIDMNEPSNF  GS  GC  NN  + P +VP +  GSL   TIC+SS  + +  HYNLHNLYG +EAVATH AL+  +  KRPFI+SRSTF+  G Y  HWTGD  ++W+Q+  S+  +L FNMFG+PM GADICGF G++ EELC+RW QLGAFYPFMRNHN   + +Q+P  +S EAQ  +K +++IRY  LP  YTL  K++  G TV R L  +F +D  T  I+RQ++ G ++L+ PV+ QG   V AYFP G WY    +S     K       G+W+ L APL++ NV +RGG+ L       +TE SRK  + LV  L+ +  A GDL+WDDG S+ ++  + +++  F A ++++L+N  I
Sbjct:   19 LLMLILISAVCPVAPSQETGPSPLQCSV-SPNRRFDCVPEKCVSKEECEARGCCYSPAGDK----GNIGQPWCFFPPSYPSYKMFNLTQTDRGYNATLKRSVGTFMPHDIMTLQLEVLFETESRLHFTIKDPAKKRYEVPI------PTPQVSGKASSTLFDVQFSCDPFGLIIRRKSSGLN--TTVAPLIFADQFLQISTSLPSGYLYGLGEHLTAL--NLSLQWNRLTFWNRDLRPSVNSNLYGSHPFYLSMEEGGQSHGVFLLNSNAMDVLLQEAPALTWRTTGGILDFYVFLGPEPKSVIRQYQDIIGYPFMPPYWSLGFHLCRWGY-STSNCTRQVVKNMRDAKIPLDVQWNDIDYMDAMRDFTYDQNRFGDFPEMVKEFHQQ-GVKYIMILDPAISSSNTPGSYPPYDDGLKRGVFITD-DEGKPLVGKVWPGLTVFPDFTMPETFSWWYDMVKLFHDQVPFDGIWIDMNEPSNFVQGSVDGCP-NNELENPPYVPGVVGGSLRSTTICASSQQHLS-SHYNLHNLYGLSEAVATHYALVKIL-KKRPFIISRSTFASHGHYAGHWTGDVVSSWEQIYYSVPAILLFNMFGVPMVGADICGFGGNTTEELCVRWSQLGAFYPFMRNHNDHDSVSQEPYVFSSEAQKAIKSALLIRYTLLPYLYTLFHKAHSSGETVARALFIEFPTDPNTWTIDRQYLWGEALLITPVLEQGKTTVNAYFPTGTWYAPESVSTPNPPKKSEKKHKGQWLMLPAPLDKINVHIRGGYILPAQVPGMNTEESRKNKLLLVVALTPDGVARGDLFWDDGVSLGTFERQDYTHVVFLA-ANNILLNELI 837          
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Xenopus
Match: GAA (glucosidase, alpha; acid [Source:NCBI gene;Acc:100495955])

HSP 1 Score: 704.131 bits (1816), Expect = 0.000e+0
Identity = 367/820 (44.76%), Postives = 520/820 (63.41%), Query Frame = 2
Query:  167 LQCSVPNNNYRLDCFPGSNANQNDCLARGCCWSPPETREYSQNNPTIPYCFFPIEYPNYQINSFTPTDRGFKARLTKQQKSFLRKEILNLNFEVIFETNTRLRIRITDPNVQRFEVPIQLGSPDPTPPSNIQYKFTMP----TNGSFGFEVKRNSDGLSLFKTFGPLLYSDQFIQISSLMSIQHVYGIGEQNRPFLHDLSTQWERIGLWARDNGIDTYNNLYGTHPFYMSLPDSGEAFGVYYFNSNAQEFVLQPAPAITYRTIGGILDIFIFSGGTPETTVSQYTELIGRPMLPPFWSLGFHLSKYGYKSIADVSNTLYRNI-NISIPIEVQWSDIDYMDKYKDFTSDPIRYPNFGSFVAHLNQSLGIKYIVIIDPGISIQ-SPGVYSAYDEGLELNIFIKDANTKKDLISNVWPGETCFPDFTHPNASKYWSHQIQRFHSQVPIDGLWIDMNEPSNFYDGSRTGCALNNPYDYPFFVPTIRDGSLIKKTICSSSLHYNNVMHYNLHNLYGYTEAVATHSALLNTIPNKRPFILSRSTFSGSGKYTFHWTGDNSANWDQLANSIRQVLNFNMFGIPMTGADICGFNGDSNEELCIRWMQLGAFYPFMRNHNSIGAKAQDPASWSQEAQIIMKKSIIIRYVWLPNFYTLLVKSYLYGGTVMRPLSFQFYSDAETHEIERQFMIGSSMLVNPVVVQGARNVVAYFPAGIWYDATDLSVIYSG--------KTGKWISLNAPLERTNVALRGGHALILSSLVNSTEYSRK-VINLVCILSMNQTAAGDLYWDDGESMDSYSGKKFSYFKFTATSSSVLINPEI 2581
            LQCSV + N R DC P    ++ +C ARGCC+SP   +     N   P+CFFP  YP+Y++ + T TDRG+ A L +   +F+  +I+ L  EV+FET +RL   I DP  +R+EVPI      PTP  + +   T+     +   FG  ++R S GL+   T  PL+++DQF+QIS+ +   ++YG+GE       +LS QW R+  W RD      +NLYG+HPFY+S+ + G++ GV+  NSNA + +LQ APA+T+RT GGILD ++F G  P++ + QY ++IG P +PP+WSLGFHL ++GY S ++ +  + +N+ +  IP++VQW+DIDYMD  +DFT D  R+ +F   V   +Q  G+KYI+I+DP IS   +PG Y  YD+GL+  +FI D +  K L+  VWPG T FPDFT P    +W   ++ FH QVP DG+WIDMNEPSNF  GS  GC  NN  + P +VP +  GSL   TIC+SS  + +  HYNLHNLYG +EAVATH AL+  +  KRPFI+SRSTF+  G Y  HWTGD  ++W+Q+  S+  +L FNMFG+PM GADICGF G++ EELC+RW QLGAFYPFMRNHN   + +Q+P  +S EAQ  +K +++IRY  LP  YTL  K++  G TV R L  +F +D  T  I+RQ++ G ++L+ PV+ QG   V AYFP G WY    +     G          G+W+ L APL++ NV +RGG+ L       +TE SRK  + LV  L+ +  A GDL+WDDG S+ ++  + +++  F A ++++L+N  I
Sbjct:   32 LQCSV-SPNRRFDCVPEKCVSKEECEARGCCYSPAGDK----GNIGQPWCFFPPSYPSYKMFNLTQTDRGYNATLKRSVGTFMPHDIMTLQLEVLFETESRLHFTIKDPAKKRYEVPI------PTPQVSGKASSTLFDVQFSCDPFGLIIRRKSSGLN--TTVAPLIFADQFLQISTSLPSGYLYGLGEHLTAL--NLSLQWNRLTFWNRDLRPSVNSNLYGSHPFYLSMEEGGQSHGVFLLNSNAMDVLLQEAPALTWRTTGGILDFYVFLGPEPKSVIRQYQDIIGYPFMPPYWSLGFHLCRWGY-STSNCTRQVVKNMRDAKIPLDVQWNDIDYMDAMRDFTYDQNRFGDFPEMVKEFHQQ-GVKYIMILDPAISSSNTPGSYPPYDDGLKRGVFITD-DEGKPLVGKVWPGLTVFPDFTMPETFSWWYDMVKLFHDQVPFDGIWIDMNEPSNFVQGSVDGCP-NNELENPPYVPGVVGGSLRSTTICASSQQHLS-SHYNLHNLYGLSEAVATHYALVKIL-KKRPFIISRSTFASHGHYAGHWTGDVVSSWEQIYYSVPAILLFNMFGVPMVGADICGFGGNTTEELCVRWSQLGAFYPFMRNHNDHDSVSQEPYVFSSEAQKAIKSALLIRYTLLPYLYTLFHKAHSSGETVARALFIEFPTDPNTWTIDRQYLWGEALLITPVLEQGKTTVNAYFPTGTWYAPESVPFWIMGSIPGTGIQSKGQWLMLPAPLDKINVHIRGGYILPAQVPGMNTEESRKNKLLLVVALTPDGVARGDLFWDDGVSLGTFERQDYTHVVFLA-ANNILLNELI 829          
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Xenopus
Match: GAA (glucosidase, alpha; acid [Source:NCBI gene;Acc:100495955])

HSP 1 Score: 703.36 bits (1814), Expect = 0.000e+0
Identity = 377/868 (43.43%), Postives = 541/868 (62.33%), Query Frame = 2
Query:   29 MMDRENE*PKYKI*RYLSNKIEFRT*IEMLKLLLIISLNFIIVSNA-----LQCSVPNNNYRLDCFPGSNANQNDCLARGCCWSPPETREYSQNNPTIPYCFFPIEYPNYQINSFTPTDRGFKARLTKQQKSFLRKEILNLNFEVIFETNTRLRIRITDPNVQRFEVPIQLGSPDPTPPSNIQYKFTMP----TNGSFGFEVKRNSDGLSLFKTFGPLLYSDQFIQISSLMSIQHVYGIGEQNRPFLHDLSTQWERIGLWARDNGIDTYNNLYGTHPFYMSLPDSGEAFGVYYFNSNAQEFVLQPAPAITYRTIGGILDIFIFSGGTPETTVSQYTELIGRPMLPPFWSLGFHLSKYGYKSIADVSNTLYRNI-NISIPIEVQWSDIDYMDKYKDFTSDPIRYPNFGSFVAHLNQSLGIKYIVIIDPGISIQ-SPGVYSAYDEGLELNIFIKDANTKKDLISNVWPGETCFPDFTHPNASKYWSHQIQRFHSQVPIDGLWIDMNEPSNFYDGSRTGCALNNPYDYPFFVPTIRDGSLIKKTICSSSLHYNNVMHYNLHNLYGYTEAVATHSALLNTIPNKRPFILSRSTFSGSGKYTFHWTGDNSANWDQLANSI--RQVLNFNMFGIPMTGADICGFNGDSNEELCIRWMQLGAFYPFMRNHNSIGAKAQDPASWSQEAQIIMKKSIIIRYVWLPNFYTLLVKSYLYGGTVMRPLSFQFYSDAETHEIERQFMIGSSMLVNPVVVQGARNVVAYFPAGIWYDATDLSVIYSGKTGKWISLNAPLERTNVALRGGHALILSSLVNSTEYSRK-VINLVCILSMNQTAAGDLYWDDGESMDSYSGKKFSYFKFTATSSSVL-INPEILG 2587
            + D+ +  P Y   R  ++ +       +L L+LI ++  +  S       LQCSV + N R DC P    ++ +C ARGCC+SP   +     N   P+CFFP  YP+Y++ + T TDRG+ A L +   +F+  +I+ L  EV+FET +RL   I DP  +R+EVPI      PTP  + +   T+     +   FG  ++R S GL+   T  PL+++DQF+QIS+ +   ++YG+GE       +LS QW R+  W RD      +NLYG+HPFY+S+ + G++ GV+  NSNA + +LQ APA+T+RT GGILD ++F G  P++ + QY ++IG P +PP+WSLGFHL ++GY S ++ +  + +N+ +  IP++VQW+DIDYMD  +DFT D  R+ +F   V   +Q  G+KYI+I+DP IS   +PG Y  YD+GL+  +FI D +  K L+  VWPG T FPDFT P    +W   ++ FH QVP DG+WIDMNEPSNF  GS  GC  NN  + P +VP +  GSL   TIC+SS  + +  HYNLHNLYG +EAVATH AL+  +  KRPFI+SRSTF+  G Y  HWTGD  ++W+Q+  S+    +L FNMFG+PM GADICGF G++ EELC+RW QLGAFYPFMRNHN   + +Q+P  +S EAQ  +K +++IRY  LP  YTL  K++  G TV R L  +F +D  T  I+RQ++ G ++L+ PV+ QG   V AYFP G WY     + I S   G+W+ L APL++ NV +RGG+ L       +TE SRK  + LV  L+ +  A GDL+WDDG S+ ++  + +++  F A + +++ I  + LG
Sbjct:   21 LQDQHDNLPGYPRGRSSADSV-----CSLLMLILISAVCPVAPSQETGPSPLQCSV-SPNRRFDCVPEKCVSKEECEARGCCYSPAGDK----GNIGQPWCFFPPSYPSYKMFNLTQTDRGYNATLKRSVGTFMPHDIMTLQLEVLFETESRLHFTIKDPAKKRYEVPI------PTPQVSGKASSTLFDVQFSCDPFGLIIRRKSSGLN--TTVAPLIFADQFLQISTSLPSGYLYGLGEHLTAL--NLSLQWNRLTFWNRDLRPSKDSNLYGSHPFYLSMEEGGQSHGVFLLNSNAMDVLLQEAPALTWRTTGGILDFYVFLGPEPKSVIRQYQDIIGYPFMPPYWSLGFHLCRWGY-STSNCTRQVVKNMRDAKIPLDVQWNDIDYMDAMRDFTYDQNRFGDFPEMVKEFHQQ-GVKYIMILDPAISSSNTPGSYPPYDDGLKRGVFITD-DEGKPLVGKVWPGLTVFPDFTMPETFSWWYDMVKLFHDQVPFDGIWIDMNEPSNFVQGSVDGCP-NNELENPPYVPGVVGGSLRSTTICASSQQHLS-SHYNLHNLYGLSEAVATHYALVKIL-KKRPFIISRSTFASHGHYAGHWTGDVVSSWEQIYYSVPGMSILLFNMFGVPMVGADICGFGGNTTEELCVRWSQLGAFYPFMRNHNDHDSVSQEPYVFSSEAQKAIKSALLIRYTLLPYLYTLFHKAHSSGETVARALFIEFPTDPNTWTIDRQYLWGEALLITPVLEQGKTTVNAYFPTGTWYAPESGTGIQS--KGQWLMLPAPLDKINVHIRGGYILPAQVPGMNTEESRKNKLLLVVALTPDGVARGDLFWDDGVSLGTFERQDYTHVVFLAANVNLMSITIQTLG 860          
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Xenopus
Match: GAA (glucosidase, alpha; acid [Source:NCBI gene;Acc:100495955])

HSP 1 Score: 702.59 bits (1812), Expect = 0.000e+0
Identity = 371/840 (44.17%), Postives = 530/840 (63.10%), Query Frame = 2
Query:  113 MLKLLLIISLNFIIVSNA-----LQCSVPNNNYRLDCFPGSNANQNDCLARGCCWSPPETREYSQNNPTIPYCFFPIEYPNYQINSFTPTDRGFKARLTKQQKSFLRKEILNLNFEVIFETNTRLRIRITDPNVQRFEVPIQLGSPDPTPPSNIQYKFTMP----TNGSFGFEVKRNSDGLSLFKTFGPLLYSDQFIQISSLMSIQHVYGIGEQNRPFLHDLSTQWERIGLWARDNGIDTYNNLYGTHPFYMSLPDSGEAFGVYYFNSNAQEFVLQPAPAITYRTIGGILDIFIFSGGTPETTVSQYTELIGRPMLPPFWSLGFHLSKYGYKSIADVSNTLYRNI-NISIPIEVQWSDIDYMDKYKDFTSDPIRYPNFGSFVAHLNQSLGIKYIVIIDPGISIQ-SPGVYSAYDEGLELNIFIKDANTKKDLISNVWPGETCFPDFTHPNASKYWSHQIQRFHSQVPIDGLWIDMNEPSNFYDGSRTGCALNNPYDYPFFVPTIRDGSLIKKTICSSSLHYNNVMHYNLHNLYGYTEAVATHSALLNTIPNKRPFILSRSTFSGSGKYTFHWTGDNSANWDQLANSI--RQVLNFNMFGIPMTGADICGFNGDSNEELCIRWMQLGAFYPFMRNHNSIGAKAQDPASWSQEAQIIMKKSIIIRYVWLPNFYTLLVKSYLYGGTVMRPLSFQFYSDAETHEIERQFMIGSSMLVNPVVVQGARNVVAYFPAGIWYDATDLSVIYSGKTGKWISLNAPLERTNVALRGGHALILSSLVNSTEYSRK-VINLVCILSMNQTAAGDLYWDDGESMDSYSGKKFSYFKFTATSSSVL-INPEILG 2587
            +L L+LI ++  +  S       LQCSV + N R DC P    ++ +C ARGCC+SP   +     N   P+CFFP  YP+Y++ + T TDRG+ A L +   +F+  +I+ L  EV+FET +RL   I DP  +R+EVPI      PTP  + +   T+     +   FG  ++R S GL+   T  PL+++DQF+QIS+ +   ++YG+GE       +LS QW R+  W RD      +NLYG+HPFY+S+ + G++ GV+  NSNA + +LQ APA+T+RT GGILD ++F G  P++ + QY ++IG P +PP+WSLGFHL ++GY S ++ +  + +N+ +  IP++VQW+DIDYMD  +DFT D  R+ +F   V   +Q  G+KYI+I+DP IS   +PG Y  YD+GL+  +FI D +  K L+  VWPG T FPDFT P    +W   ++ FH QVP DG+WIDMNEPSNF  GS  GC  NN  + P +VP +  GSL   TIC+SS  + +  HYNLHNLYG +EAVATH AL+  +  KRPFI+SRSTF+  G Y  HWTGD  ++W+Q+  S+    +L FNMFG+PM GADICGF G++ EELC+RW QLGAFYPFMRNHN   + +Q+P  +S EAQ  +K +++IRY  LP  YTL  K++  G TV R L  +F +D  T  I+RQ++ G ++L+ PV+ QG   V AYFP G WY    + +      G+W+ L APL++ NV +RGG+ L       +TE SRK  + LV  L+ +  A GDL+WDDG S+ ++  + +++  F A + +++ I  + LG
Sbjct:   22 LLMLILISAVCPVAPSQETGPSPLQCSV-SPNRRFDCVPEKCVSKEECEARGCCYSPAGDK----GNIGQPWCFFPPSYPSYKMFNLTQTDRGYNATLKRSVGTFMPHDIMTLQLEVLFETESRLHFTIKDPAKKRYEVPI------PTPQVSGKASSTLFDVQFSCDPFGLIIRRKSSGLN--TTVAPLIFADQFLQISTSLPSGYLYGLGEHLTAL--NLSLQWNRLTFWNRDLRPSKDSNLYGSHPFYLSMEEGGQSHGVFLLNSNAMDVLLQEAPALTWRTTGGILDFYVFLGPEPKSVIRQYQDIIGYPFMPPYWSLGFHLCRWGY-STSNCTRQVVKNMRDAKIPLDVQWNDIDYMDAMRDFTYDQNRFGDFPEMVKEFHQQ-GVKYIMILDPAISSSNTPGSYPPYDDGLKRGVFITD-DEGKPLVGKVWPGLTVFPDFTMPETFSWWYDMVKLFHDQVPFDGIWIDMNEPSNFVQGSVDGCP-NNELENPPYVPGVVGGSLRSTTICASSQQHLS-SHYNLHNLYGLSEAVATHYALVKIL-KKRPFIISRSTFASHGHYAGHWTGDVVSSWEQIYYSVPGMSILLFNMFGVPMVGADICGFGGNTTEELCVRWSQLGAFYPFMRNHNDHDSVSQEPYVFSSEAQKAIKSALLIRYTLLPYLYTLFHKAHSSGETVARALFIEFPTDPNTWTIDRQYLWGEALLITPVLEQGKTTVNAYFPTGTWYAPESVRI---QSKGQWLMLPAPLDKINVHIRGGYILPAQVPGMNTEESRKNKLLLVVALTPDGVARGDLFWDDGVSLGTFERQDYTHVVFLAANVNLMSITIQTLG 837          
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Mouse
Match: Gaa (glucosidase, alpha, acid [Source:MGI Symbol;Acc:MGI:95609])

HSP 1 Score: 702.59 bits (1812), Expect = 0.000e+0
Identity = 347/821 (42.27%), Postives = 505/821 (61.51%), Query Frame = 2
Query:  170 QCSVPNNNYRLDCFPGSNANQNDCLARGCCWSPPETREYSQNNPTIPYCFFPIEYPNYQINSFTPTDRGFKARLTKQQKSFLRKEILNLNFEVIFETNTRLRIRITDPNVQRFEVPIQ---LGSPDPTPPSNIQYKFTMPTNGSFGFEVKRNSDGLSLFKT-FGPLLYSDQFIQISSLMSIQHVYGIGEQNRPFLHDLSTQWERIGLWARDNGIDTYNNLYGTHPFYMSLPDSGEAFGVYYFNSNAQEFVLQPAPAITYRTIGGILDIFIFSGGTPETTVSQYTELIGRPMLPPFWSLGFHLSKYGYKSIADVSNTLYRNINISIPIEVQWSDIDYMDKYKDFTSDPIRYPNFGSFVAHLNQSLGIKYIVIIDPGISIQSP-GVYSAYDEGLELNIFIKDANTKKDLISNVWPGETCFPDFTHPNASKYWSHQIQRFHSQVPIDGLWIDMNEPSNFYDGSRTGCALNNPYDYPFFVPTIRDGSLIKKTICSSSLHYNNVMHYNLHNLYGYTEAVATHSALLNTIPNKRPFILSRSTFSGSGKYTFHWTGDNSANWDQLANSIRQVLNFNMFGIPMTGADICGFNGDSNEELCIRWMQLGAFYPFMRNHNSIGAKAQDPASWSQEAQIIMKKSIIIRYVWLPNFYTLLVKSYLYGGTVMRPLSFQFYSDAETHEIERQFMIGSSMLVNPVVVQGARNVVAYFPAGIWYDATDLSVIYSG----------------KTGKWISLNAPLERTNVALRGGHALILSS-LVNSTEYSRKVINLVCILSMNQTAAGDLYWDDGESMDSYSGKKFSYFKFTATSSSVL 2566
            QC VP ++ R DC P    +Q  C ARGCC+ P   +   +     P+CFFP  YP+Y++ + + T+ G+ A LT+   +F  K++L L  EV+ ET++RL  +I DP  +R+EVP++   + S  P+P  ++++     +   FG  V+R   G  L  T   PL ++DQF+Q+S+ +  QH+ G+GE   P +  LST W RI LW RD       NLYG+HPFY++L D G A GV+  NSNA + +LQP+PA+T+R+ GGILD+++F G  P++ V QY +++G P +PP+W LGFHL ++GY S A V   +        P++VQW+D+DYMD  +DFT +   + +F   V  L+Q  G +Y++I+DP IS   P G Y  YDEGL   +FI +  T + LI  VWPG T FPDFT+P    +W   +  FH+QVP DG+W+DMNEPSNF  GS+ GC  NN  + P +VP +  G L   TIC+SS  + +  HYNLHNLYG TEA+A+  AL+ T    RPF++SRSTFSG G+Y  HWTGD  ++W+ LA S+  +L FN+ G+P+ GADICGF GD++EELC+RW QLGAFYPFMRNHN + +  Q+P  +S+ AQ  M+K+  +RY  LP  YTL  ++++ G TV RPL  +F  D  T  ++RQ + G ++L+ PV+  G   V  YFP G WY+   +SV   G                  G+W++L APL+  NV LR G+ + L    + +TE  ++ + L   L+ +  A G+L+WDDGES+       ++   F+A +++++
Sbjct:   81 QCDVPPSS-RFDCAPDKGISQEQCEARGCCYVP-AGQVLKEPQIGQPWCFFPPSYPSYRLENLSSTESGYTATLTRTSPTFFPKDVLTLQLEVLMETDSRLHFKIKDPASKRYEVPLETPRVLSQAPSPLYSVEF-----SEEPFGVIVRRKLGGRVLLNTTVAPLFFADQFLQLSTSLPSQHITGLGEHLSPLM--LSTDWARITLWNRDTPPSQGTNLYGSHPFYLALEDGGLAHGVFLLNSNAMDVILQPSPALTWRSTGGILDVYVFLGPEPKSVVQQYLDVVGYPFMPPYWGLGFHLCRWGYSSTAIVRQVVENMTRTHFPLDVQWNDLDYMDARRDFTFNQDSFADFPDMVRELHQD-GRRYMMIVDPAISSAGPAGSYRPYDEGLRRGVFITN-ETGQPLIGKVWPGTTAFPDFTNPETLDWWQDMVSEFHAQVPFDGMWLDMNEPSNFVRGSQQGCP-NNELENPPYVPGVVGGILQAATICASSHQFLST-HYNLHNLYGLTEAIASSRALVKTR-GTRPFVISRSTFSGHGRYAGHWTGDVRSSWEHLAYSVPDILQFNLLGVPLVGADICGFIGDTSEELCVRWTQLGAFYPFMRNHNDLNSVPQEPYRFSETAQQAMRKAFALRYALLPYLYTLFHRAHVRGDTVARPLFLEFPEDPSTWSVDRQLLWGPALLITPVLEPGKTEVTGYFPKGTWYNMQMVSVDSLGTLPSPSSASSFRSAVQSKGQWLTLEAPLDTINVHLREGYIIPLQGPSLTTTESRKQPMALAVALTASGEADGELFWDDGESLAVLERGAYTLVTFSAKNNTIV 887          
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Mouse
Match: Gaa (glucosidase, alpha, acid [Source:MGI Symbol;Acc:MGI:95609])

HSP 1 Score: 702.59 bits (1812), Expect = 0.000e+0
Identity = 347/821 (42.27%), Postives = 505/821 (61.51%), Query Frame = 2
Query:  170 QCSVPNNNYRLDCFPGSNANQNDCLARGCCWSPPETREYSQNNPTIPYCFFPIEYPNYQINSFTPTDRGFKARLTKQQKSFLRKEILNLNFEVIFETNTRLRIRITDPNVQRFEVPIQ---LGSPDPTPPSNIQYKFTMPTNGSFGFEVKRNSDGLSLFKT-FGPLLYSDQFIQISSLMSIQHVYGIGEQNRPFLHDLSTQWERIGLWARDNGIDTYNNLYGTHPFYMSLPDSGEAFGVYYFNSNAQEFVLQPAPAITYRTIGGILDIFIFSGGTPETTVSQYTELIGRPMLPPFWSLGFHLSKYGYKSIADVSNTLYRNINISIPIEVQWSDIDYMDKYKDFTSDPIRYPNFGSFVAHLNQSLGIKYIVIIDPGISIQSP-GVYSAYDEGLELNIFIKDANTKKDLISNVWPGETCFPDFTHPNASKYWSHQIQRFHSQVPIDGLWIDMNEPSNFYDGSRTGCALNNPYDYPFFVPTIRDGSLIKKTICSSSLHYNNVMHYNLHNLYGYTEAVATHSALLNTIPNKRPFILSRSTFSGSGKYTFHWTGDNSANWDQLANSIRQVLNFNMFGIPMTGADICGFNGDSNEELCIRWMQLGAFYPFMRNHNSIGAKAQDPASWSQEAQIIMKKSIIIRYVWLPNFYTLLVKSYLYGGTVMRPLSFQFYSDAETHEIERQFMIGSSMLVNPVVVQGARNVVAYFPAGIWYDATDLSVIYSG----------------KTGKWISLNAPLERTNVALRGGHALILSS-LVNSTEYSRKVINLVCILSMNQTAAGDLYWDDGESMDSYSGKKFSYFKFTATSSSVL 2566
            QC VP ++ R DC P    +Q  C ARGCC+ P   +   +     P+CFFP  YP+Y++ + + T+ G+ A LT+   +F  K++L L  EV+ ET++RL  +I DP  +R+EVP++   + S  P+P  ++++     +   FG  V+R   G  L  T   PL ++DQF+Q+S+ +  QH+ G+GE   P +  LST W RI LW RD       NLYG+HPFY++L D G A GV+  NSNA + +LQP+PA+T+R+ GGILD+++F G  P++ V QY +++G P +PP+W LGFHL ++GY S A V   +        P++VQW+D+DYMD  +DFT +   + +F   V  L+Q  G +Y++I+DP IS   P G Y  YDEGL   +FI +  T + LI  VWPG T FPDFT+P    +W   +  FH+QVP DG+W+DMNEPSNF  GS+ GC  NN  + P +VP +  G L   TIC+SS  + +  HYNLHNLYG TEA+A+  AL+ T    RPF++SRSTFSG G+Y  HWTGD  ++W+ LA S+  +L FN+ G+P+ GADICGF GD++EELC+RW QLGAFYPFMRNHN + +  Q+P  +S+ AQ  M+K+  +RY  LP  YTL  ++++ G TV RPL  +F  D  T  ++RQ + G ++L+ PV+  G   V  YFP G WY+   +SV   G                  G+W++L APL+  NV LR G+ + L    + +TE  ++ + L   L+ +  A G+L+WDDGES+       ++   F+A +++++
Sbjct:   81 QCDVPPSS-RFDCAPDKGISQEQCEARGCCYVP-AGQVLKEPQIGQPWCFFPPSYPSYRLENLSSTESGYTATLTRTSPTFFPKDVLTLQLEVLMETDSRLHFKIKDPASKRYEVPLETPRVLSQAPSPLYSVEF-----SEEPFGVIVRRKLGGRVLLNTTVAPLFFADQFLQLSTSLPSQHITGLGEHLSPLM--LSTDWARITLWNRDTPPSQGTNLYGSHPFYLALEDGGLAHGVFLLNSNAMDVILQPSPALTWRSTGGILDVYVFLGPEPKSVVQQYLDVVGYPFMPPYWGLGFHLCRWGYSSTAIVRQVVENMTRTHFPLDVQWNDLDYMDARRDFTFNQDSFADFPDMVRELHQD-GRRYMMIVDPAISSAGPAGSYRPYDEGLRRGVFITN-ETGQPLIGKVWPGTTAFPDFTNPETLDWWQDMVSEFHAQVPFDGMWLDMNEPSNFVRGSQQGCP-NNELENPPYVPGVVGGILQAATICASSHQFLST-HYNLHNLYGLTEAIASSRALVKTR-GTRPFVISRSTFSGHGRYAGHWTGDVRSSWEHLAYSVPDILQFNLLGVPLVGADICGFIGDTSEELCVRWTQLGAFYPFMRNHNDLNSVPQEPYRFSETAQQAMRKAFALRYALLPYLYTLFHRAHVRGDTVARPLFLEFPEDPSTWSVDRQLLWGPALLITPVLEPGKTEVTGYFPKGTWYNMQMVSVDSLGTLPSPSSASSFRSAVQSKGQWLTLEAPLDTINVHLREGYIIPLQGPSLTTTESRKQPMALAVALTASGEADGELFWDDGESLAVLERGAYTLVTFSAKNNTIV 887          
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Mouse
Match: Mgam (maltase-glucoamylase [Source:MGI Symbol;Acc:MGI:1203495])

HSP 1 Score: 624.78 bits (1610), Expect = 0.000e+0
Identity = 336/812 (41.38%), Postives = 483/812 (59.48%), Query Frame = 2
Query:  161 NALQCSVPNNNYRLDCFPGSNANQNDCLARGCCWSPPETREYSQNNPTIPYCFFPIEYPNYQINSFTPTDRGFKARLTKQQKS-FLRKEILNLNFEVIFETNTRLRIRITDPNVQRFEVPIQLGSP-DPTPPSNIQYKFTMPTNGSFGFEVKRNSDGLSLF-KTFGPLLYSDQFIQISSLMSIQHVYGIGEQ-NRPFLHDLSTQWERIGLWARDNGI-DTYNNLYGTHPFYMSLPD-SGEAFGVYYFNSNAQEFVLQPAPAITYRTIGGILDIFIFSGGTPETTVSQYTELIGRPMLPPFWSLGFHLSKYGYKSIADVSNTLYRNINISIPIEVQWSDIDYMDKYKDFTSDPIRYPNFGSFVAHLNQSLGIKYIVIIDPGISIQS--PGVYSAYDEGLELNIFIKDANTKKDLISNVWPGETCFPDFTHPNASKYWSHQIQRFHSQVPIDGLWIDMNEPSNFYDGSRTGCALNNPYDYPFFVPTIRDGSLIKKTICSSSLHYNNVMHYNLHNLYGYTEAVATHSALLNTIPNKRPFILSRSTFSGSGKYTFHWTGDNSANWDQLANSIRQVLNFNMFGIPMTGADICGFNGDSNEELCIRWMQLGAFYPFMRNHNSIGAKAQDPASWSQEAQII--MKKSIIIRYVWLPNFYTLLVKSYLYGGTVMRPLSFQFYSDAETHEIERQFMIGSSMLVNPVVVQGARNVVAYFPAGIWYDATDLSVIYSGKTGKWISLNAPLERTNVALRGGHALILSSLVNSTEYSRK-VINLVCILSMNQTAAGDLYWDDGESMDSYSGKKFSYFKFTATSSSV 2563
            N+  C V +   R++C P  ++N+  C  RGCCW P       Q + ++P C++   +     +    T+ GF A L     +      I N+     ++T+ R   ++TD   +R+EVP +   P     PS++ YK  + +   F  +V R S+   LF  + GPLL+SDQF+Q S+ +   +VYG+GE  ++ + H+++  W+   +++RD    +   NLYG   F++ L D SG +FGV+  NSNA E  LQP PAITYRT GGILD ++F G TPE  V +Y ELIGRP LP +W+LGF LS+Y YKS+ ++   + RN    +P +VQ +DIDYMD+ KDFT DP+ +  F  FV  L+ + G K ++I+DP IS  S     Y  YD G  + I++  ++    +I  VWPG T FPD+T PN + +W+ + + FH +V  DG+WIDMNE SNF DGS +GC+ NN  +YP F P + DG L  KT+C  ++ +     Y++HNLYGY+ A+AT  A+ +  P+KR FI++RSTF+GSGK+  HW GDN+A W  L  SI  +L FN+FGIPM GADICGF  D+ EELC RWMQLGAFYPF RNHN  G K QDPAS+   + ++   +  + IRY  LP  YTL  +++  G TV RPL  +FY D  T  I+RQF+ G  +L+ PV+ QGA  V AY P   WYD      +  G   + I +  P ++  + LRGG+         +TE SRK  + L+  L  N+ A G+L+WDDGES D+ +   + + +F+ T + +
Sbjct:   61 NSPNCPVLSELERINCIPDQSSNKGTCDERGCCWDP-------QGSISVP-CYYSRNHGYKMESDVVNTNAGFTATLKNLPSAPVFGNSIENILLTAEYQTSNRFHFKLTDQTKKRYEVPHEHVQPFSGNAPSSLNYKVEV-SKEPFSIKVTRKSNNRVLFDSSIGPLLFSDQFLQFSTHLPSANVYGLGEHVHQQYRHNMN--WKTWPMFSRDTTPNEDGTNLYGVQTFFLCLEDNSGLSFGVFLMNSNAMEVTLQPTPAITYRTTGGILDFYVFLGNTPEQVVQEYLELIGRPALPSYWTLGFQLSRYDYKSLDNMKAVVERNRAAQLPYDVQHADIDYMDQKKDFTYDPVNFKGFPEFVKELHNN-GQKLVIILDPAISNNSFSSNPYGPYDRGSAMKIWVNSSDGISPVIGKVWPGTTVFPDYTSPNCAVWWTKEFELFHKEVEFDGIWIDMNEVSNFIDGSFSGCSQNN-LNYPPFTPKVLDGYLFSKTLCMDAVQHWG-KQYDVHNLYGYSMAIATAKAVKDVFPDKRSFIITRSTFAGSGKFAAHWLGDNTATWKDLQWSIPGMLEFNLFGIPMVGADICGFAQDTYEELCRRWMQLGAFYPFSRNHNGQGYKDQDPASFGNNSLLLNSSRHYLNIRYTLLPYLYTLFYRAHSRGDTVARPLLHEFYDDNNTWGIDRQFLWGPGLLITPVLDQGAEKVKAYVPNATWYDYETGEEL--GWRKQSIEMQLPGDKIGLHLRGGYIFPTQQPATTTEASRKNPLGLIVALDENKEARGELFWDDGESKDTVAQNIYLFSEFSVTQNHL 856          

HSP 2 Score: 546.969 bits (1408), Expect = 2.000e-171
Identity = 316/849 (37.22%), Postives = 472/849 (55.59%), Query Frame = 2
Query:  197 RLDCFPGSN-ANQNDCLARGCCWSPPETREYSQNNPTIPYCFFPIEY---PNYQINSFTPT-DRGFKARLTKQQKSFLRKEILNLNFEVIFETNTRLRIRITDPNVQRFEVPIQLGSPDP--TPPSNIQYKFTMPTNGSFGFEVKRNSDGLSLFKT-FGPLLYSDQFIQISSLMSIQHVYGIGE-QNRPFLHDLSTQWERIGLWARDNGIDTYNNLYGTHPFYMSLPDSGEAFGVYYFNSNAQEFVLQPAPAITYRTIGGILDIFIFSGGTPETTVSQYTELIGRPMLPPFWSLGFHLSKYGYKSIADVSNTLYRNINISIPIEVQWSDIDYMDKYKDFTSDPIRYPNFGSFVAHLN--QSLGIKYIVIIDPGISIQSPGVYSAYDEGLELNIFIKDANTKKDLISNVWP---------------------GETCFPDFTHPNASKYWSHQIQRFHS-------QVPIDGLWIDMNEPSNFYDGSR-TGCA---LNNPYDYPFFVPTIRDGSLIKKTICSSSLHY----NNVMHYNLHNLYGYTEAVATHSALLNTIPNKRPFILSRSTFSGSGKYTFHWTGDNSANWDQLANSIRQVLNFNMFGIPMTGADICGFNGDSNEELCIRWMQLGAFYPFMRNHNSIGAKAQDPASWSQEAQIIMKKSIIIRYVWLPNFYTLLVKSYLYGGTVMRPLSFQFYSDAETHEIERQFMIGSSMLVNPVVVQGARNVVAYFPAGIWYD---ATDLSVIYSGKTGKWISLNAPLERTNVALRGGHALILSSLVNSTEYSR-KVINLVCILSMNQTAAGDLYWDDGESMDSYSGKKFSYFKFTATSSSVLINPEILGY 2590
            R+DC+P  + A++ +C ARGC W        + N    P C+F  E     N Q +S   T D   KA  +    +F    +  L  +V +  N  L+ +I DPN  R+EVP+ L  P    + P    Y   +  N  FG +++R + G  ++ +      ++D FI+IS+ +   ++YG GE ++  F  D++  W   G+++RD       N YG HP+YM L + G A GV   NSNA +   QP PA+TYRTIGGILD ++F G TPE    QYTELIGRP++ P+WSLGF L +YGY++  +++N     +   IP +VQ+SDIDYM++  DF   P     F  F A +N  ++ G++ I+I+DP IS      Y A+  G+E ++FI+  N    +   VWP                         FPDF   + + +W  +I+  HS        +  DGLWIDMNEPS+F +G+  +GC+   LN+P   P+     RD  L  KT+C  S       + V HY++HNLYG+++   T+ A+   +  +R  +++RSTF  SG++  HW GDN+A WDQL  SI  +++F++FGI  TG+DICGF  D+  E+C+RWMQLGAFYPF RNHN+IG + QDP SW++  + I +  +  RY  LP  YTL+ K++  G TV+RPL  +F SD ET  I++QF++G + LV+PV+   AR V AYFP   WYD     D++      TG+W +L APLE  N+ +RGG+ L       +T  SR K + L   L+    A G L+WDDG+ +++    ++   +F+   +++L + +   Y
Sbjct:  937 RIDCYPDEHGASEANCSARGCIWE-------ASNTTRGPPCYFAHELYSVSNVQYDSHGATADISLKA--STYSNAFPSTPVNKLKLQVTYHKNEMLQFKIYDPNHSRYEVPVPLNIPSAPLSTPEGRLYDVLIKEN-PFGIQIRRKTTGTVIWDSQLLGFTFNDMFIRISTRLPSTYIYGFGETEHTTFKIDMN--WHTWGMFSRDEPPGYKKNSYGVHPYYMGLEEDGNAHGVLLMNSNAMDVTFQPMPALTYRTIGGILDFYVFLGPTPEIVTQQYTELIGRPVMVPYWSLGFQLCRYGYENDTEIANLYDEMVAKQIPYDVQYSDIDYMERQLDFKLSP----KFSGFPALINRMKANGMRVILILDPAISGNETEPYPAFTRGVENDVFIRYPNNGSIVWGKVWPDYPNITVDPSLGWDHQVEQYRAYVAFPDFFRNSTATWWKKEIKELHSNTQDPAKSLKFDGLWIDMNEPSSFVNGAVPSGCSDATLNHPPYMPYL--EARDRGLSSKTLCMESEQILPDGSRVRHYDVHNLYGWSQTRPTYEAV-QEVTGERGIVITRSTFPSSGRWGGHWLGDNTAAWDQLGKSIIGMMDFSLFGISYTGSDICGFFQDAEYEMCVRWMQLGAFYPFSRNHNTIGTRRQDPVSWNKTFEDISRSVLETRYTLLPYLYTLMYKAHTEGSTVVRPLLHEFVSDRETWNIDKQFLLGPAFLVSPVLEPNARKVEAYFPRARWYDYYKGVDINA-----TGEWKTLEAPLEYINLHIRGGYILPWQEPAMNTHLSRQKFMGLRAALNAEGRAEGWLFWDDGKRINT---DQYYLARFSVNQTTLLTHEKFNNY 1758          
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Mouse
Match: Mgam (maltase-glucoamylase [Source:MGI Symbol;Acc:MGI:1203495])

HSP 1 Score: 624.78 bits (1610), Expect = 0.000e+0
Identity = 336/812 (41.38%), Postives = 483/812 (59.48%), Query Frame = 2
Query:  161 NALQCSVPNNNYRLDCFPGSNANQNDCLARGCCWSPPETREYSQNNPTIPYCFFPIEYPNYQINSFTPTDRGFKARLTKQQKS-FLRKEILNLNFEVIFETNTRLRIRITDPNVQRFEVPIQLGSP-DPTPPSNIQYKFTMPTNGSFGFEVKRNSDGLSLF-KTFGPLLYSDQFIQISSLMSIQHVYGIGEQ-NRPFLHDLSTQWERIGLWARDNGI-DTYNNLYGTHPFYMSLPD-SGEAFGVYYFNSNAQEFVLQPAPAITYRTIGGILDIFIFSGGTPETTVSQYTELIGRPMLPPFWSLGFHLSKYGYKSIADVSNTLYRNINISIPIEVQWSDIDYMDKYKDFTSDPIRYPNFGSFVAHLNQSLGIKYIVIIDPGISIQS--PGVYSAYDEGLELNIFIKDANTKKDLISNVWPGETCFPDFTHPNASKYWSHQIQRFHSQVPIDGLWIDMNEPSNFYDGSRTGCALNNPYDYPFFVPTIRDGSLIKKTICSSSLHYNNVMHYNLHNLYGYTEAVATHSALLNTIPNKRPFILSRSTFSGSGKYTFHWTGDNSANWDQLANSIRQVLNFNMFGIPMTGADICGFNGDSNEELCIRWMQLGAFYPFMRNHNSIGAKAQDPASWSQEAQII--MKKSIIIRYVWLPNFYTLLVKSYLYGGTVMRPLSFQFYSDAETHEIERQFMIGSSMLVNPVVVQGARNVVAYFPAGIWYDATDLSVIYSGKTGKWISLNAPLERTNVALRGGHALILSSLVNSTEYSRK-VINLVCILSMNQTAAGDLYWDDGESMDSYSGKKFSYFKFTATSSSV 2563
            N+  C V +   R++C P  ++N+  C  RGCCW P       Q + ++P C++   +     +    T+ GF A L     +      I N+     ++T+ R   ++TD   +R+EVP +   P     PS++ YK  + +   F  +V R S+   LF  + GPLL+SDQF+Q S+ +   +VYG+GE  ++ + H+++  W+   +++RD    +   NLYG   F++ L D SG +FGV+  NSNA E  LQP PAITYRT GGILD ++F G TPE  V +Y ELIGRP LP +W+LGF LS+Y YKS+ ++   + RN    +P +VQ +DIDYMD+ KDFT DP+ +  F  FV  L+ + G K ++I+DP IS  S     Y  YD G  + I++  ++    +I  VWPG T FPD+T PN + +W+ + + FH +V  DG+WIDMNE SNF DGS +GC+ NN  +YP F P + DG L  KT+C  ++ +     Y++HNLYGY+ A+AT  A+ +  P+KR FI++RSTF+GSGK+  HW GDN+A W  L  SI  +L FN+FGIPM GADICGF  D+ EELC RWMQLGAFYPF RNHN  G K QDPAS+   + ++   +  + IRY  LP  YTL  +++  G TV RPL  +FY D  T  I+RQF+ G  +L+ PV+ QGA  V AY P   WYD      +  G   + I +  P ++  + LRGG+         +TE SRK  + L+  L  N+ A G+L+WDDGES D+ +   + + +F+ T + +
Sbjct:   61 NSPNCPVLSELERINCIPDQSSNKGTCDERGCCWDP-------QGSISVP-CYYSRNHGYKMESDVVNTNAGFTATLKNLPSAPVFGNSIENILLTAEYQTSNRFHFKLTDQTKKRYEVPHEHVQPFSGNAPSSLNYKVEV-SKEPFSIKVTRKSNNRVLFDSSIGPLLFSDQFLQFSTHLPSANVYGLGEHVHQQYRHNMN--WKTWPMFSRDTTPNEDGTNLYGVQTFFLCLEDNSGLSFGVFLMNSNAMEVTLQPTPAITYRTTGGILDFYVFLGNTPEQVVQEYLELIGRPALPSYWTLGFQLSRYDYKSLDNMKAVVERNRAAQLPYDVQHADIDYMDQKKDFTYDPVNFKGFPEFVKELHNN-GQKLVIILDPAISNNSFSSNPYGPYDRGSAMKIWVNSSDGISPVIGKVWPGTTVFPDYTSPNCAVWWTKEFELFHKEVEFDGIWIDMNEVSNFIDGSFSGCSQNN-LNYPPFTPKVLDGYLFSKTLCMDAVQHWG-KQYDVHNLYGYSMAIATAKAVKDVFPDKRSFIITRSTFAGSGKFAAHWLGDNTATWKDLQWSIPGMLEFNLFGIPMVGADICGFAQDTYEELCRRWMQLGAFYPFSRNHNGQGYKDQDPASFGNNSLLLNSSRHYLNIRYTLLPYLYTLFYRAHSRGDTVARPLLHEFYDDNNTWGIDRQFLWGPGLLITPVLDQGAEKVKAYVPNATWYDYETGEEL--GWRKQSIEMQLPGDKIGLHLRGGYIFPTQQPATTTEASRKNPLGLIVALDENKEARGELFWDDGESKDTVAQNIYLFSEFSVTQNHL 856          

HSP 2 Score: 557.37 bits (1435), Expect = 1.311e-171
Identity = 315/849 (37.10%), Postives = 476/849 (56.07%), Query Frame = 2
Query:  197 RLDCFPGSN-ANQNDCLARGCCWSPPETREYSQNNPTIPYCFFPIEY---PNYQINSFTPT-DRGFKARLTKQQKSFLRKEILNLNFEVIFETNTRLRIRITDPNVQRFEVPIQLGSPD-PTPPSNIQYKFTMPTNGSFGFEVKRNSDGLSLFKT-FGPLLYSDQFIQISSLMSIQHVYGIGE-QNRPFLHDLSTQWERIGLWARDNGIDTYNNLYGTHPFYMSLPDSGEAFGVYYFNSNAQEFVLQPAPAITYRTIGGILDIFIFSGGTPETTVSQYTELIGRPMLPPFWSLGFHLSKYGYKSIADVSNTLYRNINISIPIEVQWSDIDYMDKYKDFTSDPIRYPNFGSFVAHLN--QSLGIKYIVIIDPGISIQSPGVYSAYDEGLELNIFIKDANTKKDLISNVWP---------------------GETCFPDFTHPNASKYWSHQIQRFHS-------QVPIDGLWIDMNEPSNFYDGSRTGCALNNPYDYPFFVPTI--RDGSLIKKTICSSSLHY----NNVMHYNLHNLYGYTEAVATHSALLNTIPNKRPFILSRSTFSGSGKYTFHWTGDNSANWDQLANSIRQVLNFNMFGIPMTGADICGFNGDSNEELCIRWMQLGAFYPFMRNHNSIGAKAQDPASWSQEAQIIMKKSIIIRYVWLPNFYTLLVKSYLYGGTVMRPLSFQFYSDAETHEIERQFMIGSSMLVNPVVVQGARNVVAYFPAGIWYDATDLSVIYSGKTGKWISLNAPLERTNVALRGGHALILSSLVNSTEYSRK-VINLVCILSMNQTAAGDLYWDDGESMDSYSGKKFSYFKFT------ATSSSVLINPEILGY 2590
            R+DC+P  + A++ +C ARGC W          N   +P C+F  E     N Q +S   T D   KA  +    +F    +  L  +V +  N  L+ +I DPN  R+EVP+ L  P  P+  +  +    +     FG +V+R S G  ++ +      ++D FI+IS+ +   ++YG GE ++  F  D++  W   G+++RD       N YG HP+YM L + G A GV   NSNA +   QP PA+TYRT GGILD ++  G TPE    QYTELIGRP++ P+WSLGF L +YGY++ +++++     ++  IP +VQ+SDIDYM++  DF   P     F  F A +N  ++ G++ I+I+DP IS      Y A+  G+E ++FI+  N    +   VWP                         FPDF   + + +W  +I+  ++        +  DGLWIDMNEPS+F +G+      +   ++P ++P +  RD  L  KT+C  S H     + V HY++H+LYG+++   T+ A+   +  +R  +++RSTF  SG++  HW GDN+A WDQL  SI  +++F++FGI  TG+DICGF  D+  E+C+RWMQLGAFYPF RNHN+IG K QDP SW++  + I +  +  RY  LP  YTL+ K+++ G TV+RPL  +F SD +T  I++QF++G + LV+PV+   ARN+ AYFP  +WYD    + I S  TG+W +L APLE  N+ +RGG+ L       +T  SRK  + L+  L  N+ A G+L+WDDG+S D  +      F  T      +T  S  +NP+ L +
Sbjct: 1832 RIDCYPDEHGASEANCSARGCIWE-------ESNTIGVPTCYFAHELYSVSNVQYDSHGATADISLKA--STYSNAFPSTPVNKLKLQVTYHKNEMLQFKIYDPNNSRYEVPVPLNIPSAPSSTNEGRLYDVLIKENPFGIQVRRKSTGTVIWDSQLLGFTFNDMFIRISTRLPSTYIYGFGETEHTTFKIDMN--WHTWGMFSRDEPPGYKKNSYGVHPYYMGLEEDGNAHGVLLMNSNAMDVTFQPMPALTYRTTGGILDFYVLLGPTPEIVTQQYTELIGRPVMVPYWSLGFQLCRYGYENDSEIASLYDEMVDKQIPYDVQYSDIDYMERQLDFKLSP----KFSGFPALINRMKANGMRVILILDPAISGNETQPYPAFTRGVENDVFIRYPNNGSIVWGKVWPDYPNITVDPSLGWDHQVEQYRAYVAFPDFFRNSTATWWKKEIEELYTNTEEPEKSLKFDGLWIDMNEPSSFVNGAVPSGCSDATLNHPPYMPHVEGRDRGLSSKTLCMESEHILPDGSRVQHYDVHSLYGWSQTRPTYEAV-QEVTGERGIVITRSTFPSSGRWGGHWLGDNTAAWDQLGKSIIGMMDFSLFGISYTGSDICGFFQDAEYEMCVRWMQLGAFYPFSRNHNTIGTKRQDPVSWNKTFEDISRSVLETRYTLLPYLYTLMYKAHMEGSTVVRPLLHEFVSDRKTWNIDKQFLLGPAFLVSPVLEPNARNISAYFPTALWYDYYTGANINS--TGEWKTLPAPLEHINLHVRGGYILPWQRPALNTHLSRKNPLGLLIALDENKEARGELFWDDGQSKDLTTNNILCKFSVTQNRLDVSTLQSTYMNPDNLAF 2662          

HSP 3 Score: 555.444 bits (1430), Expect = 5.274e-171
Identity = 315/835 (37.72%), Postives = 470/835 (56.29%), Query Frame = 2
Query:  197 RLDCFPGSN-ANQNDCLARGCCWSPPETREYSQNNPTIPYCFFPIEY---PNYQINSFTPT-DRGFKARLTKQQKSFLRKEILNLNFEVIFETNTRLRIRITDPNVQRFEVPIQLGSPDP--TPPSNIQYKFTMPTNGSFGFEVKRNSDGLSLFKT-FGPLLYSDQFIQISSLMSIQHVYGIGE-QNRPFLHDLSTQWERIGLWARDNGIDTYNNLYGTHPFYMSLPDSGEAFGVYYFNSNAQEFVLQPAPAITYRTIGGILDIFIFSGGTPETTVSQYTELIGRPMLPPFWSLGFHLSKYGYKSIADVSNTLYRNINISIPIEVQWSDIDYMDKYKDFTSDPIRYPNFGSFVAHLN--QSLGIKYIVIIDPGISIQSPGVYSAYDEGLELNIFIKDANTKKDLISNVWP---------------------GETCFPDFTHPNASKYWSHQIQRFHS-------QVPIDGLWIDMNEPSNFYDGSRTGCALNNPYDYPFFVPTI--RDGSLIKKTICSSSLHY----NNVMHYNLHNLYGYTEAVATHSALLNTIPNKRPFILSRSTFSGSGKYTFHWTGDNSANWDQLANSIRQVLNFNMFGIPMTGADICGFNGDSNEELCIRWMQLGAFYPFMRNHNSIGAKAQDPASWSQEAQIIMKKSIIIRYVWLPNFYTLLVKSYLYGGTVMRPLSFQFYSDAETHEIERQFMIGSSMLVNPVVVQGARNVVAYFPAGIWYDATDLSVIYSGKTGKWISLNAPLERTNVALRGGHALILSSLVNSTEYSRKV-INLVCILSMNQTAAGDLYWDDGESMDSYSGKKFSYFKFTATSSSV 2563
            R+DC+P  + A++ +C ARGC W        + N    P C+F  E     N Q +S   T D   KA  +    +F    +  L  +V +  N  L+ +I DPN  R+EVP+ L  P    + P    Y   +  N  FG +++R + G  ++ +      ++D FI+IS+ +   ++YG GE ++  F  D++  W   G+++RD       N YG HP+YM L + G A GV   NSNA +   QP PA+TYRTIGGILD ++F G TPE    QYTELIGRP++ P+WSLGF L +YGY++  +++N     +   IP +VQ+SDIDYM++  DF   P     F  F A +N  ++ G++ I+I+DP IS      Y A+ +G+E ++FI+  N    +   VWP                         FPDF   + + +W  +I+  HS        +  DGLWIDMNEPS+F +G+      +   ++P ++P +  RD  L  KT+C  S H     + V HY++H+LYG+++   T+ A+   +  +R  +++RSTF  SG++  HW GDN+A WDQL  SI  +++F++FGI  TG+DICGF  D+  E+C+RWMQLGAFYPF RNHN+IG K QDP SW +  + I +  +  RY  LP  YTL+ K++  G TV+RPL  +F +D ET  I++QF++G + LV+PV+   ARNV AYFP   WYD    + I S  TG W +L APLE  N+ +RGG+ L       +T  SRK  + L+  L   + A G+L+WDDG+S D+ +   + + +F+ T + +
Sbjct:  937 RIDCYPDEHGASEANCSARGCIWE-------ASNTTRGPPCYFAHELYSVSNVQYDSHGATADISLKA--STYSNAFPSTPVNKLKLQVTYHKNEMLQFKIYDPNHSRYEVPVPLNIPSAPLSTPEGRLYDVLIKEN-PFGIQIRRKTTGTVIWDSQLLGFTFNDMFIRISTRLPSTYIYGFGETEHTTFKIDMN--WHTWGMFSRDEPPGYKKNSYGVHPYYMGLEEDGNAHGVLLMNSNAMDVTFQPMPALTYRTIGGILDFYVFLGPTPEIVTQQYTELIGRPVMVPYWSLGFQLCRYGYENDTEIANLYDEMVAKQIPYDVQYSDIDYMERQLDFKLSP----KFSGFPALINRMKANGMRVILILDPAISGNETQPYPAFTQGVENDVFIRYPNNGGIVWGKVWPDYPNITVDSSLDWDIQVERYRAYVAFPDFFRDSTALWWKKEIKELHSNSQDQAKSLKFDGLWIDMNEPSSFVNGAVPSGCSDATLNHPPYMPHVEGRDRGLSSKTLCMESEHILPDGSRVRHYDVHSLYGWSQTRPTYEAM-QEVTGERGIVITRSTFPSSGRWGGHWLGDNTAAWDQLGKSIIGMMDFSLFGISYTGSDICGFFQDAEYEMCVRWMQLGAFYPFSRNHNTIGTKRQDPVSWDKTFEDISRSVLETRYTLLPYLYTLMYKAHKEGSTVVRPLLHEFLADRETWNIDKQFLLGPAFLVSPVLEPNARNVTAYFPKAQWYDYYTGADINS--TG-WTTLPAPLEHINLHVRGGYILPWQQPALNTNLSRKKPLGLLIALDEKKEARGELFWDDGQSKDTVAKNIYLFSEFSVTQNHL 1751          

HSP 4 Score: 552.362 bits (1422), Expect = 6.915e-170
Identity = 313/850 (36.82%), Postives = 477/850 (56.12%), Query Frame = 2
Query:  197 RLDCFPGSN-ANQNDCLARGCCWSPPETREYSQNNPTIPYCFFPIEYPNYQINSFTPTDRGFKARLTKQQK----SFLRKEILNLNFEVIFETNTRLRIRITDPNVQRFEVPIQL---GSPDPTPPSNIQYKFTMPTNGSFGFEVKRNSDGLSLFKT-FGPLLYSDQFIQISSLMSIQHVYGIGE-QNRPFLHDLSTQWERIGLWARDNGIDTYNNLYGTHPFYMSLPDSGEAFGVYYFNSNAQEFVLQPAPAITYRTIGGILDIFIFSGGTPETTVSQYTELIGRPMLPPFWSLGFHLSKYGYKSIADVSNTLYRNINISIPIEVQWSDIDYMDKYKDFTSDPIRYPNFGSFVAHLN--QSLGIKYIVIIDPGISIQSPGVYSAYDEGLELNIFIKDANTKKDLISNVWP---------------------GETCFPDFTHPNASKYWSHQIQRFHS-------QVPIDGLWIDMNEPSNFYDGSR-TGCA---LNNPYDYPFFVPTIRDGSLIKKTICSSSLHY----NNVMHYNLHNLYGYTEAVATHSALLNTIPNKRPFILSRSTFSGSGKYTFHWTGDNSANWDQLANSIRQVLNFNMFGIPMTGADICGFNGDSNEELCIRWMQLGAFYPFMRNHNSIGAKAQDPASWSQEAQIIMKKSIIIRYVWLPNFYTLLVKSYLYGGTVMRPLSFQFYSDAETHEIERQFMIGSSMLVNPVVVQGARNVVAYFPAGIWYD---ATDLSVIYSGKTGKWISLNAPLERTNVALRGGHALILSSLVNSTEYSR-KVINLVCILSMNQTAAGDLYWDDGESMDSYSGKKFSYFKFTATSSSVLINPEILGY 2590
            ++DC+P  + A++  C ARGC W          N+  +P+C+F  E   Y +++      G  A ++ +      +F    +  L  +V +  N  L+ +I DPN  R+EVP+ L    +P  TP S + Y   +  N  FG E++R   G  ++ +      +SD FI+IS+ +   ++YG GE ++  F  D++  W + G+++RD       N YG HP+YM L + G A GV   NSNA +   QP PA+TYRT GGILD ++F G TPE    QYTELIGRP++ P+WSLGF L +YGY++ +++++     ++  IP +VQ+SDIDYM++  DF   P     F  F A +N  ++ G++ I+I+DP IS      Y A+  G+E ++FI+  N    +   VWP                         FPDF   + + +W  +I+  HS        +  DGLWIDMNEPS+F +G+  +GC+   LN+P   P+     RD  L  KT+C  S       + V HY++HNLYG+++   T+ A+   +  +R  +++RSTF  SG++  HW GDN+A WDQL  SI  +++F++FGI  TG+DICGF  D+  E+C+RWMQLGAFYPF RNHN+IG + QDP SW++  + I +  +  RY  LP  YTL+ K++  G TV+RPL  +F SD ET  I++QF++G + LV+PV+   AR V AYFP   WYD     D++      TG+W +L APLE  N+ +RGG+ L       +T  SR K + L   L+    A G L+WDDG+ +++    ++   +F+   +++L + +   Y
Sbjct: 2726 KIDCYPDQHGASETSCTARGCVWE-------ESNSDVVPFCYFVNEL--YSVSNVQYGSHGATANISLKASPYSGAFPSTPVKELQLQVTYHKNEMLQFKIYDPNHSRYEVPVPLNIPSAPSSTPESRL-YDVLIKEN-PFGIEIRRKGTGTVVWDSQLLGFTFSDMFIRISTRLPSTYIYGFGETEHTTFKIDMN--WNKWGMFSRDEPPGYRKNSYGVHPYYMGLEEDGNAHGVLLMNSNAMDVTFQPMPALTYRTTGGILDFYVFLGPTPEFVTQQYTELIGRPVMVPYWSLGFQLCRYGYENDSEIASLYDEMVDKKIPYDVQYSDIDYMERQLDFKLSP----KFSGFPALINRMKANGMRVILILDPAISGNETEPYPAFTRGVENDVFIRYPNNGSIVWGKVWPDYPNITVDPSLGWDHQVEQYRAYVAFPDFFRNSTATWWKKEIKELHSNTQDPAKSLKFDGLWIDMNEPSSFVNGAVPSGCSDATLNHPPYMPYL--EARDRGLSSKTLCMESEQILPDGSRVRHYDVHNLYGWSQTRPTYEAV-QEVTGERGIVITRSTFPSSGRWGGHWLGDNTAAWDQLGKSIIGMMDFSLFGISYTGSDICGFFQDAEYEMCVRWMQLGAFYPFSRNHNTIGTRRQDPVSWNKTFEDISRSVLETRYTLLPYLYTLMYKAHTEGSTVVRPLLHEFVSDRETWNIDKQFLLGPAFLVSPVLEPNARKVEAYFPRARWYDYYKGVDINA-----TGEWKTLEAPLEYINLHIRGGYILPWQEPAMNTHLSRQKFMGLRAALNAEGRAEGWLFWDDGKRINT---DQYYLARFSVNQTTLLTHEKFNNY 3547          
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Mouse
Match: Mgam (maltase-glucoamylase [Source:MGI Symbol;Acc:MGI:1203495])

HSP 1 Score: 624.78 bits (1610), Expect = 0.000e+0
Identity = 336/812 (41.38%), Postives = 483/812 (59.48%), Query Frame = 2
Query:  161 NALQCSVPNNNYRLDCFPGSNANQNDCLARGCCWSPPETREYSQNNPTIPYCFFPIEYPNYQINSFTPTDRGFKARLTKQQKS-FLRKEILNLNFEVIFETNTRLRIRITDPNVQRFEVPIQLGSP-DPTPPSNIQYKFTMPTNGSFGFEVKRNSDGLSLF-KTFGPLLYSDQFIQISSLMSIQHVYGIGEQ-NRPFLHDLSTQWERIGLWARDNGI-DTYNNLYGTHPFYMSLPD-SGEAFGVYYFNSNAQEFVLQPAPAITYRTIGGILDIFIFSGGTPETTVSQYTELIGRPMLPPFWSLGFHLSKYGYKSIADVSNTLYRNINISIPIEVQWSDIDYMDKYKDFTSDPIRYPNFGSFVAHLNQSLGIKYIVIIDPGISIQS--PGVYSAYDEGLELNIFIKDANTKKDLISNVWPGETCFPDFTHPNASKYWSHQIQRFHSQVPIDGLWIDMNEPSNFYDGSRTGCALNNPYDYPFFVPTIRDGSLIKKTICSSSLHYNNVMHYNLHNLYGYTEAVATHSALLNTIPNKRPFILSRSTFSGSGKYTFHWTGDNSANWDQLANSIRQVLNFNMFGIPMTGADICGFNGDSNEELCIRWMQLGAFYPFMRNHNSIGAKAQDPASWSQEAQII--MKKSIIIRYVWLPNFYTLLVKSYLYGGTVMRPLSFQFYSDAETHEIERQFMIGSSMLVNPVVVQGARNVVAYFPAGIWYDATDLSVIYSGKTGKWISLNAPLERTNVALRGGHALILSSLVNSTEYSRK-VINLVCILSMNQTAAGDLYWDDGESMDSYSGKKFSYFKFTATSSSV 2563
            N+  C V +   R++C P  ++N+  C  RGCCW P       Q + ++P C++   +     +    T+ GF A L     +      I N+     ++T+ R   ++TD   +R+EVP +   P     PS++ YK  + +   F  +V R S+   LF  + GPLL+SDQF+Q S+ +   +VYG+GE  ++ + H+++  W+   +++RD    +   NLYG   F++ L D SG +FGV+  NSNA E  LQP PAITYRT GGILD ++F G TPE  V +Y ELIGRP LP +W+LGF LS+Y YKS+ ++   + RN    +P +VQ +DIDYMD+ KDFT DP+ +  F  FV  L+ + G K ++I+DP IS  S     Y  YD G  + I++  ++    +I  VWPG T FPD+T PN + +W+ + + FH +V  DG+WIDMNE SNF DGS +GC+ NN  +YP F P + DG L  KT+C  ++ +     Y++HNLYGY+ A+AT  A+ +  P+KR FI++RSTF+GSGK+  HW GDN+A W  L  SI  +L FN+FGIPM GADICGF  D+ EELC RWMQLGAFYPF RNHN  G K QDPAS+   + ++   +  + IRY  LP  YTL  +++  G TV RPL  +FY D  T  I+RQF+ G  +L+ PV+ QGA  V AY P   WYD      +  G   + I +  P ++  + LRGG+         +TE SRK  + L+  L  N+ A G+L+WDDGES D+ +   + + +F+ T + +
Sbjct:   61 NSPNCPVLSELERINCIPDQSSNKGTCDERGCCWDP-------QGSISVP-CYYSRNHGYKMESDVVNTNAGFTATLKNLPSAPVFGNSIENILLTAEYQTSNRFHFKLTDQTKKRYEVPHEHVQPFSGNAPSSLNYKVEV-SKEPFSIKVTRKSNNRVLFDSSIGPLLFSDQFLQFSTHLPSANVYGLGEHVHQQYRHNMN--WKTWPMFSRDTTPNEDGTNLYGVQTFFLCLEDNSGLSFGVFLMNSNAMEVTLQPTPAITYRTTGGILDFYVFLGNTPEQVVQEYLELIGRPALPSYWTLGFQLSRYDYKSLDNMKAVVERNRAAQLPYDVQHADIDYMDQKKDFTYDPVNFKGFPEFVKELHNN-GQKLVIILDPAISNNSFSSNPYGPYDRGSAMKIWVNSSDGISPVIGKVWPGTTVFPDYTSPNCAVWWTKEFELFHKEVEFDGIWIDMNEVSNFIDGSFSGCSQNN-LNYPPFTPKVLDGYLFSKTLCMDAVQHWG-KQYDVHNLYGYSMAIATAKAVKDVFPDKRSFIITRSTFAGSGKFAAHWLGDNTATWKDLQWSIPGMLEFNLFGIPMVGADICGFAQDTYEELCRRWMQLGAFYPFSRNHNGQGYKDQDPASFGNNSLLLNSSRHYLNIRYTLLPYLYTLFYRAHSRGDTVARPLLHEFYDDNNTWGIDRQFLWGPGLLITPVLDQGAEKVKAYVPNATWYDYETGEEL--GWRKQSIEMQLPGDKIGLHLRGGYIFPTQQPATTTEASRKNPLGLIVALDENKEARGELFWDDGESKDTVAQNIYLFSEFSVTQNHL 856          

HSP 2 Score: 546.969 bits (1408), Expect = 2.000e-171
Identity = 316/849 (37.22%), Postives = 472/849 (55.59%), Query Frame = 2
Query:  197 RLDCFPGSN-ANQNDCLARGCCWSPPETREYSQNNPTIPYCFFPIEY---PNYQINSFTPT-DRGFKARLTKQQKSFLRKEILNLNFEVIFETNTRLRIRITDPNVQRFEVPIQLGSPDP--TPPSNIQYKFTMPTNGSFGFEVKRNSDGLSLFKT-FGPLLYSDQFIQISSLMSIQHVYGIGE-QNRPFLHDLSTQWERIGLWARDNGIDTYNNLYGTHPFYMSLPDSGEAFGVYYFNSNAQEFVLQPAPAITYRTIGGILDIFIFSGGTPETTVSQYTELIGRPMLPPFWSLGFHLSKYGYKSIADVSNTLYRNINISIPIEVQWSDIDYMDKYKDFTSDPIRYPNFGSFVAHLN--QSLGIKYIVIIDPGISIQSPGVYSAYDEGLELNIFIKDANTKKDLISNVWP---------------------GETCFPDFTHPNASKYWSHQIQRFHS-------QVPIDGLWIDMNEPSNFYDGSR-TGCA---LNNPYDYPFFVPTIRDGSLIKKTICSSSLHY----NNVMHYNLHNLYGYTEAVATHSALLNTIPNKRPFILSRSTFSGSGKYTFHWTGDNSANWDQLANSIRQVLNFNMFGIPMTGADICGFNGDSNEELCIRWMQLGAFYPFMRNHNSIGAKAQDPASWSQEAQIIMKKSIIIRYVWLPNFYTLLVKSYLYGGTVMRPLSFQFYSDAETHEIERQFMIGSSMLVNPVVVQGARNVVAYFPAGIWYD---ATDLSVIYSGKTGKWISLNAPLERTNVALRGGHALILSSLVNSTEYSR-KVINLVCILSMNQTAAGDLYWDDGESMDSYSGKKFSYFKFTATSSSVLINPEILGY 2590
            R+DC+P  + A++ +C ARGC W        + N    P C+F  E     N Q +S   T D   KA  +    +F    +  L  +V +  N  L+ +I DPN  R+EVP+ L  P    + P    Y   +  N  FG +++R + G  ++ +      ++D FI+IS+ +   ++YG GE ++  F  D++  W   G+++RD       N YG HP+YM L + G A GV   NSNA +   QP PA+TYRTIGGILD ++F G TPE    QYTELIGRP++ P+WSLGF L +YGY++  +++N     +   IP +VQ+SDIDYM++  DF   P     F  F A +N  ++ G++ I+I+DP IS      Y A+  G+E ++FI+  N    +   VWP                         FPDF   + + +W  +I+  HS        +  DGLWIDMNEPS+F +G+  +GC+   LN+P   P+     RD  L  KT+C  S       + V HY++HNLYG+++   T+ A+   +  +R  +++RSTF  SG++  HW GDN+A WDQL  SI  +++F++FGI  TG+DICGF  D+  E+C+RWMQLGAFYPF RNHN+IG + QDP SW++  + I +  +  RY  LP  YTL+ K++  G TV+RPL  +F SD ET  I++QF++G + LV+PV+   AR V AYFP   WYD     D++      TG+W +L APLE  N+ +RGG+ L       +T  SR K + L   L+    A G L+WDDG+ +++    ++   +F+   +++L + +   Y
Sbjct:  937 RIDCYPDEHGASEANCSARGCIWE-------ASNTTRGPPCYFAHELYSVSNVQYDSHGATADISLKA--STYSNAFPSTPVNKLKLQVTYHKNEMLQFKIYDPNHSRYEVPVPLNIPSAPLSTPEGRLYDVLIKEN-PFGIQIRRKTTGTVIWDSQLLGFTFNDMFIRISTRLPSTYIYGFGETEHTTFKIDMN--WHTWGMFSRDEPPGYKKNSYGVHPYYMGLEEDGNAHGVLLMNSNAMDVTFQPMPALTYRTIGGILDFYVFLGPTPEIVTQQYTELIGRPVMVPYWSLGFQLCRYGYENDTEIANLYDEMVAKQIPYDVQYSDIDYMERQLDFKLSP----KFSGFPALINRMKANGMRVILILDPAISGNETEPYPAFTRGVENDVFIRYPNNGSIVWGKVWPDYPNITVDPSLGWDHQVEQYRAYVAFPDFFRNSTATWWKKEIKELHSNTQDPAKSLKFDGLWIDMNEPSSFVNGAVPSGCSDATLNHPPYMPYL--EARDRGLSSKTLCMESEQILPDGSRVRHYDVHNLYGWSQTRPTYEAV-QEVTGERGIVITRSTFPSSGRWGGHWLGDNTAAWDQLGKSIIGMMDFSLFGISYTGSDICGFFQDAEYEMCVRWMQLGAFYPFSRNHNTIGTRRQDPVSWNKTFEDISRSVLETRYTLLPYLYTLMYKAHTEGSTVVRPLLHEFVSDRETWNIDKQFLLGPAFLVSPVLEPNARKVEAYFPRARWYDYYKGVDINA-----TGEWKTLEAPLEYINLHIRGGYILPWQEPAMNTHLSRQKFMGLRAALNAEGRAEGWLFWDDGKRINT---DQYYLARFSVNQTTLLTHEKFNNY 1758          
BLAST of Lysosomal alpha-glucosidase vs. UniProt/SwissProt
Match: sp|Q6P7A9|LYAG_RAT (Lysosomal alpha-glucosidase OS=Rattus norvegicus OX=10116 GN=Gaa PE=2 SV=1)

HSP 1 Score: 703.36 bits (1814), Expect = 0.000e+0
Identity = 348/823 (42.28%), Postives = 506/823 (61.48%), Query Frame = 2
Query:  170 QCSVPNNNYRLDCFPGSNANQNDCLARGCCWSPPETREYSQNNPTI--PYCFFPIEYPNYQINSFTPTDRGFKARLTKQQKSFLRKEILNLNFEVIFETNTRLRIRITDPNVQRFEVPIQ---LGSPDPTPPSNIQYKFTMPTNGSFGFEVKRNSDGLSLF-KTFGPLLYSDQFIQISSLMSIQHVYGIGEQNRPFLHDLSTQWERIGLWARDNGIDTYNNLYGTHPFYMSLPDSGEAFGVYYFNSNAQEFVLQPAPAITYRTIGGILDIFIFSGGTPETTVSQYTELIGRPMLPPFWSLGFHLSKYGYKSIADVSNTLYRNINISIPIEVQWSDIDYMDKYKDFTSDPIRYPNFGSFVAHLNQSLGIKYIVIIDPGISIQSP-GVYSAYDEGLELNIFIKDANTKKDLISNVWPGETCFPDFTHPNASKYWSHQIQRFHSQVPIDGLWIDMNEPSNFYDGSRTGCALNNPYDYPFFVPTIRDGSLIKKTICSSSLHYNNVMHYNLHNLYGYTEAVATHSALLNTIPNKRPFILSRSTFSGSGKYTFHWTGDNSANWDQLANSIRQVLNFNMFGIPMTGADICGFNGDSNEELCIRWMQLGAFYPFMRNHNSIGAKAQDPASWSQEAQIIMKKSIIIRYVWLPNFYTLLVKSYLYGGTVMRPLSFQFYSDAETHEIERQFMIGSSMLVNPVVVQGARNVVAYFPAGIWYDATDLSVIYSG----------------KTGKWISLNAPLERTNVALRGGHALILSS-LVNSTEYSRKVINLVCILSMNQTAAGDLYWDDGESMDSYSGKKFSYFKFTATSSSVL 2566
            QC V  N+ R DC P     Q  C ARGCCW P        N P +  P+CFFP  YP+Y++ + + T+ G+ A LT+   +F  K++L L  EV+ ET++RL   I DP  +R+EVP++   + S  P+P  ++++     +   FG  V+R   G  L   T  PL ++DQF+Q+S+ +  QH+ G+GE   P +  LST+W RI LW RD       NLYG+HPFY++L D G A GV+  NSNA + VLQP+PA+T+R+ GGILD+++F G  P++ V QY +++G P +PP+W LGFHL ++GY S A V   +        P++VQW+D+DYMD  +DFT +   + +F   V  L+Q  G +Y++I+DP IS   P G Y  YDEGL   +FI +  T + LI  VWPG T FPDFT+P    +W   +  FH+QVP DG+WIDMNEPSNF  GS+ GC  +N  + P +VP +  G+L   TIC+SS  + +  HYNLHNLYG TEA+A+  AL+ T    RPF++SRSTF+G G+Y  HWTGD  ++W+ LA S+ ++L FN+ G+P+ GADICGF G++ EELC+RW QLGAFYPFMRNHN + +  Q+P  +S+ AQ  M+K+  +RY  LP  YTL   +++ G TV RPL  +F  D  T  ++RQ + G ++L+ PV+  G  +V  YFP G+WY+   + V   G                  G+W++L APL+  NV LR G+ + L    + +TE  ++ + L   L+ +  A+G+L+WDDGES+       ++   F+A +++++
Sbjct:   81 QCDVTPNS-RFDCAPDKGITQEQCEARGCCWVPAGQ---VLNGPVMGQPWCFFPPSYPSYRLENLSSTESGYTATLTRTSPTFFPKDVLTLQLEVLMETDSRLHFMIKDPTSKRYEVPLETPRVLSQAPSPLYSVEF-----SEEPFGVIVRRKLGGRVLLNTTVAPLFFADQFLQLSTSLPSQHIAGLGEHLSPLM--LSTEWTRITLWNRDVAPSQGVNLYGSHPFYLALEDGGLAHGVFLLNSNAMDVVLQPSPALTWRSTGGILDVYVFLGPEPKSVVQQYLDVVGYPFMPPYWGLGFHLCRWGYSSTAIVRQVVENMTRTHFPLDVQWNDLDYMDARRDFTFNQDGFADFPDMVHELHQG-GRRYMMIVDPAISSSGPAGSYRPYDEGLRRGVFITN-ETGQPLIGKVWPGSTAFPDFTNPETLDWWQDMVSEFHAQVPFDGMWIDMNEPSNFIRGSQQGCP-DNELENPPYVPGVVGGALQAATICASSHQFLST-HYNLHNLYGLTEAIASSRALVKTR-GTRPFVISRSTFAGHGRYAGHWTGDVWSSWEHLAYSVPEILQFNLLGVPLVGADICGFQGNTTEELCVRWTQLGAFYPFMRNHNDLNSLPQEPYRFSETAQQAMRKAFTLRYALLPYLYTLFHGAHVKGDTVARPLFLEFPEDPSTWSVDRQLLWGPALLITPVLEPGKTDVTGYFPKGMWYNLQMVPVETLGSLPSSSPASSFRSIVHSKGQWLTLEAPLDTINVHLRAGYIIPLQGPSLTTTESRKQPMALAVALTESGEASGELFWDDGESLGVLERGAYTLVTFSAKNNTIV 887          
BLAST of Lysosomal alpha-glucosidase vs. UniProt/SwissProt
Match: sp|P70699|LYAG_MOUSE (Lysosomal alpha-glucosidase OS=Mus musculus OX=10090 GN=Gaa PE=1 SV=2)

HSP 1 Score: 702.59 bits (1812), Expect = 0.000e+0
Identity = 347/821 (42.27%), Postives = 505/821 (61.51%), Query Frame = 2
Query:  170 QCSVPNNNYRLDCFPGSNANQNDCLARGCCWSPPETREYSQNNPTIPYCFFPIEYPNYQINSFTPTDRGFKARLTKQQKSFLRKEILNLNFEVIFETNTRLRIRITDPNVQRFEVPIQ---LGSPDPTPPSNIQYKFTMPTNGSFGFEVKRNSDGLSLFKT-FGPLLYSDQFIQISSLMSIQHVYGIGEQNRPFLHDLSTQWERIGLWARDNGIDTYNNLYGTHPFYMSLPDSGEAFGVYYFNSNAQEFVLQPAPAITYRTIGGILDIFIFSGGTPETTVSQYTELIGRPMLPPFWSLGFHLSKYGYKSIADVSNTLYRNINISIPIEVQWSDIDYMDKYKDFTSDPIRYPNFGSFVAHLNQSLGIKYIVIIDPGISIQSP-GVYSAYDEGLELNIFIKDANTKKDLISNVWPGETCFPDFTHPNASKYWSHQIQRFHSQVPIDGLWIDMNEPSNFYDGSRTGCALNNPYDYPFFVPTIRDGSLIKKTICSSSLHYNNVMHYNLHNLYGYTEAVATHSALLNTIPNKRPFILSRSTFSGSGKYTFHWTGDNSANWDQLANSIRQVLNFNMFGIPMTGADICGFNGDSNEELCIRWMQLGAFYPFMRNHNSIGAKAQDPASWSQEAQIIMKKSIIIRYVWLPNFYTLLVKSYLYGGTVMRPLSFQFYSDAETHEIERQFMIGSSMLVNPVVVQGARNVVAYFPAGIWYDATDLSVIYSG----------------KTGKWISLNAPLERTNVALRGGHALILSS-LVNSTEYSRKVINLVCILSMNQTAAGDLYWDDGESMDSYSGKKFSYFKFTATSSSVL 2566
            QC VP ++ R DC P    +Q  C ARGCC+ P   +   +     P+CFFP  YP+Y++ + + T+ G+ A LT+   +F  K++L L  EV+ ET++RL  +I DP  +R+EVP++   + S  P+P  ++++     +   FG  V+R   G  L  T   PL ++DQF+Q+S+ +  QH+ G+GE   P +  LST W RI LW RD       NLYG+HPFY++L D G A GV+  NSNA + +LQP+PA+T+R+ GGILD+++F G  P++ V QY +++G P +PP+W LGFHL ++GY S A V   +        P++VQW+D+DYMD  +DFT +   + +F   V  L+Q  G +Y++I+DP IS   P G Y  YDEGL   +FI +  T + LI  VWPG T FPDFT+P    +W   +  FH+QVP DG+W+DMNEPSNF  GS+ GC  NN  + P +VP +  G L   TIC+SS  + +  HYNLHNLYG TEA+A+  AL+ T    RPF++SRSTFSG G+Y  HWTGD  ++W+ LA S+  +L FN+ G+P+ GADICGF GD++EELC+RW QLGAFYPFMRNHN + +  Q+P  +S+ AQ  M+K+  +RY  LP  YTL  ++++ G TV RPL  +F  D  T  ++RQ + G ++L+ PV+  G   V  YFP G WY+   +SV   G                  G+W++L APL+  NV LR G+ + L    + +TE  ++ + L   L+ +  A G+L+WDDGES+       ++   F+A +++++
Sbjct:   81 QCDVPPSS-RFDCAPDKGISQEQCEARGCCYVP-AGQVLKEPQIGQPWCFFPPSYPSYRLENLSSTESGYTATLTRTSPTFFPKDVLTLQLEVLMETDSRLHFKIKDPASKRYEVPLETPRVLSQAPSPLYSVEF-----SEEPFGVIVRRKLGGRVLLNTTVAPLFFADQFLQLSTSLPSQHITGLGEHLSPLM--LSTDWARITLWNRDTPPSQGTNLYGSHPFYLALEDGGLAHGVFLLNSNAMDVILQPSPALTWRSTGGILDVYVFLGPEPKSVVQQYLDVVGYPFMPPYWGLGFHLCRWGYSSTAIVRQVVENMTRTHFPLDVQWNDLDYMDARRDFTFNQDSFADFPDMVRELHQD-GRRYMMIVDPAISSAGPAGSYRPYDEGLRRGVFITN-ETGQPLIGKVWPGTTAFPDFTNPETLDWWQDMVSEFHAQVPFDGMWLDMNEPSNFVRGSQQGCP-NNELENPPYVPGVVGGILQAATICASSHQFLST-HYNLHNLYGLTEAIASSRALVKTR-GTRPFVISRSTFSGHGRYAGHWTGDVRSSWEHLAYSVPDILQFNLLGVPLVGADICGFIGDTSEELCVRWTQLGAFYPFMRNHNDLNSVPQEPYRFSETAQQAMRKAFALRYALLPYLYTLFHRAHVRGDTVARPLFLEFPEDPSTWSVDRQLLWGPALLITPVLEPGKTEVTGYFPKGTWYNMQMVSVDSLGTLPSPSSASSFRSAVQSKGQWLTLEAPLDTINVHLREGYIIPLQGPSLTTTESRKQPMALAVALTASGEADGELFWDDGESLAVLERGAYTLVTFSAKNNTIV 887          
BLAST of Lysosomal alpha-glucosidase vs. UniProt/SwissProt
Match: sp|P10253|LYAG_HUMAN (Lysosomal alpha-glucosidase OS=Homo sapiens OX=9606 GN=GAA PE=1 SV=4)

HSP 1 Score: 693.345 bits (1788), Expect = 0.000e+0
Identity = 347/820 (42.32%), Postives = 506/820 (61.71%), Query Frame = 2
Query:  170 QCSVPNNNYRLDCFPGSNANQNDCLARGCCWSPPETREYSQNNPTIPYCFFPIEYPNYQINSFTPTDRGFKARLTKQQKSFLRKEILNLNFEVIFETNTRLRIRITDPNVQRFEVPIQ---LGSPDPTPPSNIQYKFTMPTNGSFGFEVKRNSDGLSLFKT-FGPLLYSDQFIQISSLMSIQHVYGIGEQNRPFLHDLSTQWERIGLWARDNGIDTYNNLYGTHPFYMSLPDSGEAFGVYYFNSNAQEFVLQPAPAITYRTIGGILDIFIFSGGTPETTVSQYTELIGRPMLPPFWSLGFHLSKYGYKSIADVSNTLYRNINISIPIEVQWSDIDYMDKYKDFTSDPIRYPNFGSFVAHLNQSLGIKYIVIIDPGISIQSP-GVYSAYDEGLELNIFIKDANTKKDLISNVWPGETCFPDFTHPNASKYWSHQIQRFHSQVPIDGLWIDMNEPSNFYDGSRTGCALNNPYDYPFFVPTIRDGSLIKKTICSSSLHYNNVMHYNLHNLYGYTEAVATHSALLNTIPNKRPFILSRSTFSGSGKYTFHWTGDNSANWDQLANSIRQVLNFNMFGIPMTGADICGFNGDSNEELCIRWMQLGAFYPFMRNHNSIGAKAQDPASWSQEAQIIMKKSIIIRYVWLPNFYTLLVKSYLYGGTVMRPLSFQFYSDAETHEIERQFMIGSSMLVNPVVVQGARNVVAYFPAGIWYDATDLSVIYSG---------------KTGKWISLNAPLERTNVALRGGHALILSSL-VNSTEYSRKVINLVCILSMNQTAAGDLYWDDGESMDSYSGKKFSYFKFTATSSSVL 2566
            QC VP N+ R DC P     Q  C ARGCC+ P + +         P+CFFP  YP+Y++ + + ++ G+ A LT+   +F  K+IL L  +V+ ET  RL   I DP  +R+EVP++   + S  P+P  ++++     +   FG  V+R  DG  L  T   PL ++DQF+Q+S+ +  Q++ G+ E   P +  LST W RI LW RD       NLYG+HPFY++L D G A GV+  NSNA + VLQP+PA+++R+ GGILD++IF G  P++ V QY +++G P +PP+W LGFHL ++GY S A     +        P++VQW+D+DYMD  +DFT +   + +F + V  L+Q  G +Y++I+DP IS   P G Y  YDEGL   +FI +  T + LI  VWPG T FPDFT+P A  +W   +  FH QVP DG+WIDMNEPSNF  GS  GC  NN  + P +VP +  G+L   TIC+SS  + +  HYNLHNLYG TEA+A+H AL+      RPF++SRSTF+G G+Y  HWTGD  ++W+QLA+S+ ++L FN+ G+P+ GAD+CGF G+++EELC+RW QLGAFYPFMRNHNS+ +  Q+P S+S+ AQ  M+K++ +RY  LP+ YTL  ++++ G TV RPL  +F  D+ T  ++ Q + G ++L+ PV+  G   V  YFP G WYD   + V   G                 G+W++L APL+  NV LR G+ + L    + +TE  ++ + L   L+    A G+L+WDDGES++      ++   F A +++++
Sbjct:   81 QCDVPPNS-RFDCAPDKAITQEQCEARGCCYIPAK-QGLQGAQMGQPWCFFPPSYPSYKLENLSSSEMGYTATLTRTTPTFFPKDILTLRLDVMMETENRLHFTIKDPANRRYEVPLETPHVHSRAPSPLYSVEF-----SEEPFGVIVRRQLDGRVLLNTTVAPLFFADQFLQLSTSLPSQYITGLAEHLSPLM--LSTSWTRITLWNRDLAPTPGANLYGSHPFYLALEDGGSAHGVFLLNSNAMDVVLQPSPALSWRSTGGILDVYIFLGPEPKSVVQQYLDVVGYPFMPPYWGLGFHLCRWGYSSTAITRQVVENMTRAHFPLDVQWNDLDYMDSRRDFTFNKDGFRDFPAMVQELHQG-GRRYMMIVDPAISSSGPAGSYRPYDEGLRRGVFITN-ETGQPLIGKVWPGSTAFPDFTNPTALAWWEDMVAEFHDQVPFDGMWIDMNEPSNFIRGSEDGCP-NNELENPPYVPGVVGGTLQAATICASSHQFLST-HYNLHNLYGLTEAIASHRALVKAR-GTRPFVISRSTFAGHGRYAGHWTGDVWSSWEQLASSVPEILQFNLLGVPLVGADVCGFLGNTSEELCVRWTQLGAFYPFMRNHNSLLSLPQEPYSFSEPAQQAMRKALTLRYALLPHLYTLFHQAHVAGETVARPLFLEFPKDSSTWTVDHQLLWGEALLITPVLQAGKAEVTGYFPLGTWYDLQTVPVEALGSLPPPPAAPREPAIHSEGQWVTLPAPLDTINVHLRAGYIIPLQGPGLTTTESRQQPMALAVALTKGGEARGELFWDDGESLEVLERGAYTQVIFLARNNTIV 886          
BLAST of Lysosomal alpha-glucosidase vs. UniProt/SwissProt
Match: sp|Q5R7A9|LYAG_PONAB (Lysosomal alpha-glucosidase OS=Pongo abelii OX=9601 GN=GAA PE=2 SV=1)

HSP 1 Score: 689.108 bits (1777), Expect = 0.000e+0
Identity = 344/820 (41.95%), Postives = 506/820 (61.71%), Query Frame = 2
Query:  170 QCSVPNNNYRLDCFPGSNANQNDCLARGCCWSPPETREYSQNNPTIPYCFFPIEYPNYQINSFTPTDRGFKARLTKQQKSFLRKEILNLNFEVIFETNTRLRIRITDPNVQRFEVPIQ---LGSPDPTPPSNIQYKFTMPTNGSFGFEVKRNSDGLSLF-KTFGPLLYSDQFIQISSLMSIQHVYGIGEQNRPFLHDLSTQWERIGLWARDNGIDTYNNLYGTHPFYMSLPDSGEAFGVYYFNSNAQEFVLQPAPAITYRTIGGILDIFIFSGGTPETTVSQYTELIGRPMLPPFWSLGFHLSKYGYKSIADVSNTLYRNINISIPIEVQWSDIDYMDKYKDFTSDPIRYPNFGSFVAHLNQSLGIKYIVIIDPGISIQSP-GVYSAYDEGLELNIFIKDANTKKDLISNVWPGETCFPDFTHPNASKYWSHQIQRFHSQVPIDGLWIDMNEPSNFYDGSRTGCALNNPYDYPFFVPTIRDGSLIKKTICSSSLHYNNVMHYNLHNLYGYTEAVATHSALLNTIPNKRPFILSRSTFSGSGKYTFHWTGDNSANWDQLANSIRQVLNFNMFGIPMTGADICGFNGDSNEELCIRWMQLGAFYPFMRNHNSIGAKAQDPASWSQEAQIIMKKSIIIRYVWLPNFYTLLVKSYLYGGTVMRPLSFQFYSDAETHEIERQFMIGSSMLVNPVVVQGARNVVAYFPAGIWYDATDLSVIYSG---------------KTGKWISLNAPLERTNVALRGGHALILSSL-VNSTEYSRKVINLVCILSMNQTAAGDLYWDDGESMDSYSGKKFSYFKFTATSSSVL 2566
            QC VP N+ R DC P     +  C ARGCC+ P + +         P+CFFP  YP+Y++ + + ++ G+ A LT+   +F  K+IL L  +V+ ET  RL   I DP  +R+EVP++   + S  P+P  ++++     +   FG  V+R  DG  L   T  PL ++DQF+Q+S+ +  Q++ G+ E   P +  LST W R+ LW RD       NLYG+HPFY++L D G A GV+  NSNA + VLQP+PA+++R+ GGILD++IF G  P++ V QY +++G P +PP+W LGFHL ++GY S A  S  +        P++VQW+D+DYMD  +DFT +   + +F + V  L+Q  G +Y++I+DP IS   P G Y  YDEGL   +FI +  T + LI  VWPG T FPDFT+P A  +W   +  FH QVP DG+WIDMNEPSNF  GS  GC  +N  + P +VP +  G+L   TIC+SS  + +  HYNLHNLYG TEA+A+H AL+      RPF++SRSTF+G G+Y  HWTGD  ++W+QLA+S+ ++L FN+ G+P+ GAD+CGF G+++EELC+RW QLGAFYPFMRNHN +    Q+P S+S+ AQ  M+K++ +RY  LP+ YTL  ++++ G TV RPL  +F  D+ T  ++ Q + G ++L+ PV+  G   V  YFP GIWYD   + +   G                 G+W++L APL+  NV LR G+ + L    + +TE  ++ + L   L+    A G+L+WDDGES++      ++   F A +++++
Sbjct:   81 QCDVPPNS-RFDCAPDKAITREQCDARGCCYIPAK-QGLRGAQMGQPWCFFPPSYPSYKLENLSSSEMGYTATLTRTTPTFFPKDILTLRLDVMMETENRLHFTIKDPANRRYEVPLETPRVHSRAPSPLYSVEF-----SEEPFGVIVRRQLDGRVLLNTTVAPLFFADQFLQLSTSLPSQYITGLAEHLSPLM--LSTSWTRVTLWNRDLAPTPGANLYGSHPFYLALEDGGSAHGVFLLNSNAMDVVLQPSPALSWRSTGGILDVYIFLGPEPKSVVRQYLDVVGYPFMPPYWGLGFHLCRWGYSSTAITSQVVENMTRAHFPLDVQWNDLDYMDARRDFTFNKDGFRDFPAMVRELHQG-GRRYMMIVDPAISSSGPAGSYRPYDEGLRRGVFITN-ETSQPLIGKVWPGSTAFPDFTNPAALAWWEDMVAEFHDQVPFDGMWIDMNEPSNFIRGSEDGCP-DNELENPPYVPGVVGGTLQAATICASSHQFLST-HYNLHNLYGLTEAIASHRALVKAR-GTRPFVISRSTFAGHGRYAGHWTGDVWSSWEQLASSVPEILQFNLLGVPLVGADVCGFLGNTSEELCVRWTQLGAFYPFMRNHNGLLNLPQEPYSFSEPAQQAMRKALTLRYALLPHLYTLFHQAHVAGETVARPLFLEFPKDSSTWTVDHQLLWGEALLITPVLQAGKAEVTGYFPLGIWYDLQTVPIEALGSLPPPPAAPREPAIHSEGQWVTLPAPLDTINVHLRAGYIIPLQGPGLTTTESRQQPMALAVALTKGGEARGELFWDDGESLEVLERGAYTQVLFLARNNTIV 886          
BLAST of Lysosomal alpha-glucosidase vs. UniProt/SwissProt
Match: sp|Q9MYM4|LYAG_BOVIN (Lysosomal alpha-glucosidase OS=Bos taurus OX=9913 GN=GAA PE=2 SV=1)

HSP 1 Score: 680.248 bits (1754), Expect = 0.000e+0
Identity = 356/845 (42.13%), Postives = 515/845 (60.95%), Query Frame = 2
Query:  170 QCSVPNNNYRLDCFPGSNANQNDCLARGCCWSPPETREYSQNNPTIPYCFFPIEYPNYQINSFTPTDRGFKARLTKQQKSFLRKEILNLNFEVIFETNTRLRIRITDPNVQRFEVPIQLGSPDPTPPSNIQYKFTMPT----NGSFGFEVKRNSDGLSLF-KTFGPLLYSDQFIQISSLMSIQHVYGIGEQNRPFLHDLSTQWERIGLWARDNGIDTYNNLYGTHPFYMSLPDSGEAFGVYYFNSNAQEFVLQPAPAITYRTIGGILDIFIFSGGTPETTVSQYTELIGRPMLPPFWSLGFHLSKYGYKSIADVSNTLYRNINISIPIEVQWSDIDYMDKYKDFTSDPIRYPNFGSFVAHLNQSLGIKYIVIIDPGISIQSP-GVYSAYDEGLELNIFIKDANTKKDLISNVWPGETCFPDFTHPNASKYWSHQIQRFHSQVPIDGLWIDMNEPSNFYDGSRTGCALNNPYDYPFFVPTIRDGSLIKKTICSSSLHYNNVMHYNLHNLYGYTEAVATHSALLNTIPNKRPFILSRSTFSGSGKYTFHWTGDNSANWDQLANSIRQVLNFNMFGIPMTGADICGFNGDSNEELCIRWMQLGAFYPFMRNHNSIGAKAQDPASWSQEAQIIMKKSIIIRYVWLPNFYTLLVKSYLYGGTVMRPLSFQFYSDAETHEIERQFMIGSSMLVNPVVVQGARNVVAYFPAGIWYD---------------ATDLSVIYSGKTGKWISLNAPLERTNVALRGGHALILSSLVNSTEYSRKV-INLVCILSMNQTAAGDLYWDDGESMDSYSGKKFSYFKFTATSSSV---LINPEILGYSVLPSLNSIIILG 2629
            QC +P N+ R DC P        C ARGCC+ P E    +Q     P+CFFP  YP+Y++ + T T+ G+ A LT+   +F  K+I+ L  +++ ET +RL   I DP  +R+EVP++      TP    Q  FT+ +       FG  V+R  DG  L   T  PL ++DQF+Q+S+ +  QH+ G+ E     +  LST W +I LW RD   +   NLYG+HPFY+ L D G A GV+  NSNA + VLQP+PA+++R+ GGILD++IF G  P++ V QY +++G P +PP+W LGFHL ++GY + A     +        P++VQW+D+DYMD  +DFT +   + +F + V  L+Q  G +YI+I+DP IS   P G Y  YDEGL   +FI +  T + LI  VWPG T FPDFT+P    +W   +  FH+QVP DG+WIDMNEPSNF  GS  GC  +N  + P ++P +  G+L   TIC+SS  + +  HY+LHNLYG TEA+A+H AL+      RPF++SRSTF+G G+Y+ HWTGD  +NW+QL+ S+ ++L FN+ G+P+ GADICGF G+++EELC+RW QLGAFYPFMRNHN++ ++ Q+P  +S+ AQ  M+K+  +RYV LP  YTL  ++++ G TV RPL  +F  D  T  ++RQ + G ++L+ PV+      V  YFP G WYD               A   SVI+S   G+W++L+APL+  NV LR GH + +     +T  SRK  + L   L+ +  A G+L+WDDGES+    G  ++   F A +++    L++    G S+   L ++ +LG
Sbjct:   69 QCDLPPNS-RFDCAPDKGITPQQCEARGCCYMPAEWPPDAQMGQ--PWCFFPPSYPSYRLENLTTTETGYTATLTRAVPTFFPKDIMTLRLDMLMETESRLHFTIKDPANRRYEVPLE------TPRVYSQAPFTLYSVEFSEEPFGVVVRRKLDGRVLLNTTVAPLFFADQFLQLSTSLPSQHITGLAEHLGSLM--LSTNWTKITLWNRDIAPEPNVNLYGSHPFYLVLEDGGLAHGVFLLNSNAMDVVLQPSPALSWRSTGGILDVYIFLGPEPKSVVQQYLDVVGYPFMPPYWGLGFHLCRWGYSTSAITRQVVENMTRAYFPLDVQWNDLDYMDARRDFTFNKDHFGDFPAMVQELHQG-GRRYIMIVDPAISSSGPAGTYRPYDEGLRRGVFITN-ETGQPLIGQVWPGLTAFPDFTNPETLDWWQDMVTEFHAQVPFDGMWIDMNEPSNFVRGSVDGCP-DNSLENPPYLPGVVGGTLRAATICASSHQFLST-HYDLHNLYGLTEALASHRALVKAR-GMRPFVISRSTFAGHGRYSGHWTGDVWSNWEQLSYSVPEILLFNLLGVPLVGADICGFLGNTSEELCVRWTQLGAFYPFMRNHNALNSQPQEPYRFSETAQQAMRKAFTLRYVLLPYLYTLFHRAHVRGETVARPLFLEFPEDPSTWTVDRQLLWGEALLITPVLEAEKVEVTGYFPQGTWYDLQTVPMEAFGSLPPPAPLTSVIHS--KGQWVTLSAPLDTINVHLRAGHIIPMQGPALTTTESRKQHMALAVALTASGEAQGELFWDDGESLGVLDGGDYTQLIFLAKNNTFVNKLVHVSSEGASL--QLRNVTVLG 893          
BLAST of Lysosomal alpha-glucosidase vs. TrEMBL
Match: A0A5J4NLU2 (Lysosomal alpha-glucosidase OS=Paragonimus westermani OX=34504 GN=DEA37_0007412 PE=3 SV=1)

HSP 1 Score: 741.11 bits (1912), Expect = 0.000e+0
Identity = 389/865 (44.97%), Postives = 526/865 (60.81%), Query Frame = 2
Query:  113 MLKLLLIISLNFIIVSNALQCSVPNNNYRLDCFPGSNANQNDCLARGCCWSPPETREYSQNNPTIPYCFFPIEYPNYQINSFTPTDRGFKARLTKQQKSFLRKEILNLNFEVIFETNTRLRIRITDP-NVQRFEVPIQLGSPDPTPPSNIQYKFTMPTNGSFGFEVKRNSDGLS-LFKTFGPL----LYSDQFIQISSLMSIQHVYGIGEQNRPFLHDLSTQWERIGLWARDNGIDTYNNLYGTHPFYMSLPDSGEAFGVYYFNSNAQEFVLQPAPAITYRTIGGILDIFIFSGGTPETTVSQYTELIGRPMLPPFWSLGFHLSKYGYKSIADVSNTLYRNINISIPIEVQWSDIDYMDKYKDFTSDPIRYPNFGSFVAH-LNQSLGIKYIVIIDPGISIQSPGVYSAYDEGLELNIFIKDANTKKDLISNVWPGETCFPDFTHPNASKYWSHQIQRFHSQVPIDGLWIDMNEPSNFYDGSRTGCALNNPYDYPFFVPTIRDGSLIKKTICSSSLHYNNVMHYNLHNLYGYTEAVATHSALLNTIPNKRPFILSRSTFSGSGKYTFHWTGDNSANWDQLANSIRQVLNFNMFGIPMTGADICGFNGDSNEELCIRWMQLGAFYPFMRNHNSIGAKAQDPASWSQEAQIIMKKSIIIRYVWLPNFYTLLVKSYLYGGTVMRPLSFQFYSDAETHEIERQFMIGSSMLVNPVVVQGARNVVAYFPAGIWYD-ATDLSVIYSGKTGKWISLNAPLERTNVALRGGHALILSSLVNSTEYSRKV-INLVCILSMNQ----------TAAGDLYWDDGESMDSYSGKKFSYFKFTATSSSVLINPEILGYSVLPS-------LNSIIILG 2629
            +  L  ++SL  + V    QC     + RLDC P   AN+  C+A+GCCW+P +      N+P IP C+FP  YP Y + S TPT RGF A L+K +  F   E  +   E+  ET  RLRIR T P +  R+E PI LG P+  PP+  +Y   +     FG +V RN++    L  + G +    + +DQF+Q+S  +  Q  +G GE    F   LS QW R GLWARD     + NLYG H F+M L   G AFG++  NSNAQE  L P PAITYRT+GGILD FIF+G  P+  ++QY +LIG P LPP+WSLGFHL +YGY+++ +V+ T+ RN++  IPIE QW DIDYMD++K ++ DP+ + + G+F+   L++  GIK ++I+DP +S Q    Y+ +  GL+  IFI D+ T K ++  VWPGET FPDF+HPNA ++W   + RFH  VP DGLWIDMNEP+NF  GS TGC   +  + P FVP I D SL  KTIC S+LHYN   HYN HNLYGY  A  T  AL    P KR F+LSRSTF+GSG+YT HWTGDN ++W  +  SI Q+ NFNMF +P+ GADICGF  D+ EELCIRW QLGAFYPF RNHN +G+  QDPA WS++    ++ ++ +RY  LP FY+L  +++L+G T++R L+F+F  +  TH I +QFM+GS +LV PV+ +    V  Y PAG W + +T L +   G+        APL    V +RGG  L   +    T  SRK  ++L  +LS              AAG+L+WDDGES        + + +FT  S  ++I+P+    + + S       L SIII G
Sbjct:   16 VFTLASVLSLT-VSVEGQAQCMPIPVSARLDCHPEEGANEEKCIAKGCCWTPRDA-----NDPGIPMCYFPTNYPKYFVTSVTPTSRGFLADLSKIRTGFGMNESKHARVEIRHETKNRLRIRFTIPSDSNRWEPPIPLGEPENPPPAQPEYVVQL-MKSPFGLQVARNNEAHDILLDSSGFMSASTIIADQFLQVSFRLFAQRGFGPGELRTSFPQPLS-QWSRDGLWARDTAPMAHENLYGVHNFFMGLSYDGTAFGIFLLNSNAQEVALTPLPAITYRTVGGILDFFIFTGPKPKDVIAQYYDLIGHPPLPPYWSLGFHLCRYGYRNLEEVAQTVKRNMDAGIPIEAQWVDIDYMDQHKIWSVDPVNFADLGNFIRDTLHKRYGIKSVLIVDPAVSTQGGPDYATFSTGLKSGIFINDSRTGKPILGTVWPGETVFPDFSHPNAEQWWYELVSRFHENVPFDGLWIDMNEPANFDAGSTTGCDNWDSLNNPPFVPEILDRSLYAKTICPSALHYNTT-HYNRHNLYGYDHARVTRHALERLFPGKRSFLLSRSTFAGSGRYTIHWTGDNLSSWADMRASILQLFNFNMFAMPIVGADICGFRDDTTEELCIRWSQLGAFYPFARNHNGLGSIPQDPAVWSKKGTEAIRDALQLRYTLLPYFYSLFFRAHLHGETIIRALAFEFPDELATHTINKQFMLGSCVLVTPVLEESRTWVEGYVPAGEWINLSTGLRLTSHGEVKY---FKAPLNVIPVLIRGGCILPTQNSWEITSISRKKGLSLFVVLSSVDDGSPVAGRIAKAAGELFWDDGES----DPLNYVHVRFTVNSRVLIIHPDPSHLAAVASLEPQETDLKSIIICG 864          
BLAST of Lysosomal alpha-glucosidase vs. TrEMBL
Match: V8PHZ8 (Lysosomal alpha-glucosidase (Fragment) OS=Ophiophagus hannah OX=8665 GN=GAA PE=4 SV=1)

HSP 1 Score: 734.561 bits (1895), Expect = 0.000e+0
Identity = 359/808 (44.43%), Postives = 507/808 (62.75%), Query Frame = 2
Query:  170 QCSVPNNNYRLDCFPGSNANQNDCLARGCCWSPPETREYSQNNPTIPYCFFPIEYPNYQINSFTPTDRGFKARLTKQQKSFLRKEILNLNFEVIFETNTRLRIRITDPNVQRFEVPIQLGSPDPTPPSNIQYKFTMPTNGSFGFEVKRNSDGLSLFKT-FGPLLYSDQFIQISSLMSIQHVYGIGEQNRPFLHDLSTQWERIGLWARDNGIDTYNNLYGTHPFYMSLPDSGEAFGVYYFNSNAQEFVLQPAPAITYRTIGGILDIFIFSGGTPETTVSQYTELIGRPMLPPFWSLGFHLSKYGYKSIADVSNTLYRNINISI-PIEVQWSDIDYMDKYKDFTSDPIRYPNFGSFVAHLNQSLGIKYIVIIDPGISIQSP-GVYSAYDEGLELNIFIKDANTKKDLISNVWPGETCFPDFTHPNASKYWSHQIQRFHSQVPIDGLWIDMNEPSNFYDGSRTGCALNNPYDYPFFVPTIRDGSLIKKTICSSSLHYNNVMHYNLHNLYGYTEAVATHSALLNTIPNKRPFILSRSTFSGSGKYTFHWTGDNSANWDQLANSIRQVLNFNMFGIPMTGADICGFNGDSNEELCIRWMQLGAFYPFMRNHNSIGAKAQDPASWSQEAQIIMKKSIIIRYVWLPNFYTLLVKSYLYGGTVMRPLSFQFYSDAETHEIERQFMIGSSMLVNPVVVQGARNVVAYFPAGIWYDATDLSVIYSGKTGKWISLNAPLERTNVALRGGHALILSS-LVNSTEYSRKVINLVCILSMNQTAAGDLYWDDGESMDSYSGKKFSYFKFTATSSS---VLIN 2572
            QC++P ++ R DC P    +Q++C ARGCC+ P  ++E        P+CFFP  Y +Y+I + T T  G+ A L ++  SF+  +I+N+  +VIFET  RL   + DP  +R+EVP++  +P  T   +        +   FG  V R S+G  L  T   PL Y+DQF+QIS+ +    + G+GE   P    L+  W +I LW RD       NLYG+HPFY++L   G A GV+  NSNA + +LQP+PA+T+RT GGILD ++F G  P + V QY ++IG P +PP+W+LGFHL ++GY S A ++  + +N+  ++ P++VQW+D+DYMD  +DFT +   + +    V   +   G +Y++I+DPGIS  SP G Y  YDEGL+  +FI +A T + LI  VWPG T FPDFT+P    +W   ++ FH +VP DG+WIDMNEPSNF DGS   C  NN  + P +VP +  G+L  KT+C+SS  Y +  HYNLH+LYG TEA+ATH AL+  +  KRPF++SRSTF+  G+Y  HWTGD  + W+ L  SI  +L FN++G+P+ GADICGF   + EELC+RW QLGAFYPFMRNHN  G+K+Q+P ++S EAQ  M+K+  +RY  LP  YTL  K++  G TV RPL F+F  D  T  I+RQFM G+ +L+ PV+ +G R +  YFP G WYD    SV +S   G+WI L APL+  NV +RGGH L L    + +TE     + L+  L++   A GDL+WDDGE + ++    ++   F A + S   VL+N
Sbjct: 1203 QCNIPPDS-RFDCAPEKLLSQDECQARGCCYVPVSSKE--------PWCFFPTSYSSYKITNLTATQTGYTAHLIRRAPSFMPDDIMNVQLDVIFETKGRLHFTLKDPARKRYEVPLE--TPKTTSKESSALYSVQFSADPFGLIVFRKSNGQVLLNTTVAPLFYADQFLQISTTLPSSFISGLGEHLTPL--TLNVNWTKITLWNRDISPMPSANLYGSHPFYVALEKGGLAHGVFLLNSNAMDVLLQPSPALTWRTTGGILDFYVFLGPDPSSVVRQYMDVIGYPFMPPYWALGFHLCRWGYTSTA-ITREVVKNMTAALFPLDVQWNDLDYMDAKRDFTFNKDGFRDMPDMVNDFHHD-GRRYVMIVDPGISSASPPGSYKPYDEGLKRGVFIVNA-TGQPLIGRVWPGPTAFPDFTNPETHLWWYDMVKDFHDKVPFDGMWIDMNEPSNFVDGSSEDCP-NNKLENPPYVPGMLGGTLKAKTVCASSRQYLS-SHYNLHSLYGLTEAIATHDALVK-VRGKRPFVISRSTFASHGRYAGHWTGDVISVWEHLYYSIPAMLLFNLYGVPLVGADICGFLNSTTEELCVRWTQLGAFYPFMRNHNDRGSKSQEPYAFSPEAQQAMRKAFSLRYSLLPYLYTLFHKAHSTGETVARPLYFEFPQDTYTWTIDRQFMWGAGLLITPVLEEGIRKMPGYFPLGTWYDILTGSVFHS--KGQWILLPAPLDTINVHIRGGHILPLQEPALTTTESRSNGMTLIVALTLEGVARGDLFWDDGEGLLTFEKGDYTQIFFLARNVSLEGVLVN 1989          
BLAST of Lysosomal alpha-glucosidase vs. TrEMBL
Match: A0A1D1VXK3 (P-type domain-containing protein OS=Ramazzottius varieornatus OX=947166 GN=RvY_16194-1 PE=3 SV=1)

HSP 1 Score: 723.005 bits (1865), Expect = 0.000e+0
Identity = 364/840 (43.33%), Postives = 526/840 (62.62%), Query Frame = 2
Query:  152 IVSNALQCSVPNNNYRLDCFPGSNANQNDCLARGCCWSPPETREYSQNNPTI--PYCFFPIEYPNYQINSFTPTDRGFKARL--TKQQKSFLRKEILNLNFEVIFETNTRLRIRITDPNVQRFEVPIQL--GSPDPTPPSNIQYKFTMPTNGSFGFEVKRNSDGLSLFKTF-GPLLYSDQFIQISSLMSIQHVYGIGEQ-NRPFLHDLSTQWERIGLWARDNGIDTYNNLYGTHPFYMSLPDSGEAFGVYYFNSNAQEFVLQPAPAITYRTIGGILDIFIFSGGTPETTVSQYTELIGRPMLPPFWSLGFHLSKYGYKSIADVSNTLYRNINISIPIEVQWSDIDYMDKYKDFTSDPIRYPNFGSFVAHLNQSLGIKYIVIIDPGIS-IQSPGVYSAYDEGLELNIFIKDANTKKDLISNVWPGE-TCFPDFTHPNASKYWSHQIQRFHSQVPIDGLWIDMNEPSNFYDGSRTGCALNNPYDYPFFVPTIRDGSLIKKTICSSSLHYNNVMHYNLHNLYGYTEAVATHSALLNTIPNKRPFILSRSTFSGSGKYTFHWTGDNSANWDQLANSIRQVLNFNMFGIPMTGADICGFNGDSNEELCIRWMQLGAFYPFMRNHNSIGAKAQDPASWSQEAQIIMKKSIIIRYVWLPNFYTLLVKSYLYGGTVMRPLSFQFYSDAETHEIERQFMIGSSMLVNPVVVQGARNVVAYFPAGIWYDATDLSVIYSGKTGKWISLNAPLERTNVALR-GGHALILSSLVNSTEYSRKVINLVCILSMNQTAAGDLYWDDGESMDSYSGKKFSYFKFTATS---SSVLINPEILGYSVLPSLNSIIILG 2629
            + SNA+ CS   ++ R DC P  + ++  C+ARGCCW+   + +       +  P CF+P +YP Y++ ++  T  GF+  L  +K  K      I +L  +VIF+T  RL ++ITD    R+EVP+ +  G+P   P + + Y F + T   F F+VKR S G  L  T      + DQFIQISSL+  +++YG+GE  +  FLH  S  W++  +W  D   +    LYG HPFY S+ + G+A GV  FNSNA + +LQP PAITYRTIGG+LD + F G +P+   SQY EL+G+P +PP+W+LG+HL ++GY S+ +    + RN+   IP++ QW+DIDYMDK KDFT D  ++     FV  ++   G++Y+VI+DPGIS  ++PG Y AY +GL +N+F+++A+ +  +   VW G    +PDFTHPN S+YW  QI  F   VP+DGLWIDMNEPSNF DGS  GC  ++  + P ++P I   +L  +T+C ++ H+   +HYNLH+ YG  +A AT +ALL   PNKRPF++SRSTF G G+Y+ HWTGD S++W  L  SI  +LNFNMFGIP  GADICGF  ++ EELC+RW QLGAFYPF RNHN++  + QDPA+WS  A   ++  ++ RY  LP + TLL ++ + G TV+RPL F+F  D  T+ I+ QF+IGSS++++PV       ++AY P G W+D   L  I S K G+WI L+APL++ NV LR GG   +    V + +  +  I+LV +L     A G++YWDDGE MD      FS  +F   +    S ++N +   Y  +P++ S+ ++G
Sbjct:  184 VESNAV-CSTMADDDRFDCLPQGDISEASCMARGCCWNQRSSVQMVNGTVKLGLPACFYPYKYPTYRLENYKETANGFEGTLQRSKDAKDIYPNPINSLRLQVIFDTAQRLHVKITDATKDRYEVPLPVLPGAPFSKPDTTL-YDFVV-TKEPFSFQVKRKSTGGVLVDTATNTFAFYDQFIQISSLLPSKYIYGLGEHTDAHFLH--SVNWKQFTMWTTDIYPNLETPLYGVHPFYFSMEEDGDANGVLLFNSNAMDVILQPTPAITYRTIGGVLDFYFFLGPSPQDVTSQYMELLGKPQMPPYWALGYHLCRWGYGSVENTRKVMERNLAAGIPLDAQWNDIDYMDKNKDFTIDGSKFNGITEFVNEVHAK-GLRYVVIVDPGISSAEAPGSYQAYTDGLAMNVFVQNASDQV-IEGRVWTGNPQAYPDFTHPNISQYWLKQITDFRKVVPVDGLWIDMNEPSNFVDGSMVGCPKDSSLENPPYLPNIAGKTLNTRTLCMTAKHHAG-LHYNLHSTYGIYQAKATQAALLQVFPNKRPFVVSRSTFVGQGQYSAHWTGDESSSWSDLQTSIGDILNFNMFGIPFVGADICGFGDNATEELCLRWHQLGAFYPFSRNHNAVSNRDQDPAAWSPAATEAIRTVLLTRYSLLPYYSTLLFRASISGHTVVRPLFFEFAHDKRTYSIDAQFLIGSSVMLSPVTTPNTTKILAYLPEGRWFDFYSLKKI-SDKGGEWIELDAPLDKVNVHLREGGIVPMQKPEVTTGKTRQNPIDLVVMLDKTGKACGEVYWDDGEQMDVLQKGDFSLVQFEMKNGKLKSTVVNDK---YKDVPAMGSVRVVG 1011          
BLAST of Lysosomal alpha-glucosidase vs. TrEMBL
Match: R7V9X3 (P-type domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_167453 PE=3 SV=1)

HSP 1 Score: 719.153 bits (1855), Expect = 0.000e+0
Identity = 378/804 (47.01%), Postives = 504/804 (62.69%), Query Frame = 2
Query:  170 QCSVPNNNYRLDCFPGSNANQNDCLARGCCWSPPETREYSQNNPTIPYCFFPIEYPNYQINSFTPTDRGFKARLTKQQKSFL--RKEILNLNFEVIFETNTRLRIRITDPNVQRFEVPIQLGSPDPTP-PSNIQYKFTMPTNGSFGFEVKRNSDGLSLFKTF-GPLLYSDQFIQISSLMSIQHVYGIGEQNRPFLHDLSTQWERIGLWARDNGIDTYNNLYGTHPFYMSLPDSGEAFGVYYFNSNAQEFVLQPAPAITYRTIGGILDIFIFSGGTPETTVSQYTELIGRPMLPPFWSLGFHLSKYGYKSIADVSNTLYRNINISIPIEVQWSDIDYMDKYKDFTSDPIRYPNFGSFVAHLNQSLGIKYIVIIDPGISIQSPGVYSAYDEGLELNIFIKDANTKKDLISNVWPGETCFPDFTHPNASKYWSHQIQRFHSQVPIDGLWIDMNEPSNFYDGSRTGCALNNPYDYPFFVPTIR-DGSLIKKTICSSSLHYNNVMHYNLHNLYGYTEAVATHSALLNTIPNKRPFILSRSTFSGSGKYTFHWTGDNSANWDQLANSIRQVLNFNMFGIPMTGADICGFNGDSNEELCIRWMQLGAFYPFMRNHNSIGAKAQDPASWSQEAQIIMKKSIIIRYVWLPNFYTLLVKSYLYGGTVMRPLSFQFYSDAETHEIERQFMIGSSMLVNPVVVQGARNVVAYFPAGIWYDATDLSVIYSGKTGKWISLNAPLERTNVALRGGHALILSSLVNSTEYSRK-VINLVCILSMNQTAAGDLYWDDGESMDSYSGKKFSYFKFTATSSSV 2563
            QCS   +N R DC P  NAN   C+ARGCCW         + +  +P+CFFP +Y  Y  +    T  G+ A LT   +  L     I  L FE+   T   +R +  DP  +R+EVPI           +N    FT      F  ++ R S G  LF +   PL+++DQF+ IS+L+S  ++YG+GEQ  P        W R  LWARD       N+YG+HPF+++L   G+A GV+  NSNA +  + P PA+T+RTIGGILD F+F G + +  +SQYT++IG+P +PP+WSLGFHL +YGY   A V   + RN  I IP +VQW+DIDYMD   D+T DP RY +  S V  L++  G KYI+IIDPGI+   PG Y+AYDEG++  +FI+D+     LI  VWPG   FPDF HPNA+K+W+ Q Q +H++V  DG+WIDMNEPSNF  GS  GC  N+  D P +VP I  +GSL   T+C S+LHY+   HYNLHNLYG +E +AT SA+ + I  KR  I+SRSTF   G +  HWTGD  + W+ L  SI  +L F M+GIP+ GADICGFN D+ EELC RWMQLGAFYPFMRNHN++GA  QDPA++S+ AQ IMK  + +RY  LP  YTL+V S++ G    RPL F F +D  T +I++QFM GSS++++PV+ QGA +V AY P GIWYD     +I  G TGK I L APLE+  V +RGG  L L +   +T  SRK    L+    +N +A+G+L+WDDG+S+DSYS  KF +  F+A   ++
Sbjct:   17 QCSKSADNDRFDCHPEPNANPQKCVARGCCWKSASANFDPEASYNVPWCFFPSDYAGYSTDEIVVTSTGYAATLTATGQWQLPYGTRIGLLRFELFMPTVDSIRFKFYDPANKRYEVPISTPEIQKKAFKTNYHIDFT---KNPFSVKITRKSTGAVLFDSSPSPLIFTDQFLLISTLLSSSNLYGLGEQKAPLQK--GGAWARYSLWARDQSPTFNTNIYGSHPFFLNLEPDGKAHGVFLLNSNAMDVDISPKPAVTFRTIGGILDFFVFLGPSADAVISQYTDVIGKPFMPPYWSLGFHLCRYGYSDTAYVKKIIERNRAIGIPYDVQWTDIDYMDAKFDWTYDPKRYGDLPSVVEDLHEH-GQKYIMIIDPGIANTQPGKYAAYDEGVKDGVFIQDSKGNL-LIGKVWPGTVTFPDFYHPNATKWWTKQAQDWHTKVSYDGIWIDMNEPSNFVFGSTVGCPGNH-LDNPPYVPQISGNGSLADNTVCPSALHYS-TSHYNLHNLYGLSETMATASAVTSVI-KKRSIIISRSTFPSQGHFGGHWTGDVFSTWEDLHYSIPAMLEFGMYGIPLVGADICGFNHDTTEELCTRWMQLGAFYPFMRNHNTLGAPDQDPAAFSKRAQSIMKAILEVRYTLLPFLYTLMVNSHMTGVPAARPLFFSFPTDVNTFDIDKQFMWGSSLIISPVLTQGAESVEAYLPKGIWYDLYTSQMI--GSTGKMIGLPAPLEKIPVHIRGGSILPLQAPAVTTTLSRKNPFGLIAAYDVNGSASGELFWDDGDSLDSYSADKFCHVAFSAAQGTL 808          
BLAST of Lysosomal alpha-glucosidase vs. TrEMBL
Match: H2KPA9 (Lysosomal alpha-glucosidase OS=Clonorchis sinensis OX=79923 GN=CLF_101613 PE=3 SV=1)

HSP 1 Score: 717.613 bits (1851), Expect = 0.000e+0
Identity = 378/854 (44.26%), Postives = 506/854 (59.25%), Query Frame = 2
Query:  122 LLLIISLNFIIVSNAL-----QCSVPNNNYRLDCFPGSNANQNDCLARGCCWSPPETREYSQNNPTIPYCFFPIEYPNYQINSFTPTDRGFKARLTKQQKSFLRKEILNLNFEVIFETNTRLRIRIT---DPNVQRFEVPIQLGSPDPTPPSNIQYKFTMPTNGSFGFEVKRNSD-GLSLFKTFGPL----LYSDQFIQISSLMSIQHVYGIGEQNRPFLHDLSTQWERIGLWARDNGIDTYNNLYGTHPFYMSLPDSGEAFGVYYFNSNAQEFVLQPAPAITYRTIGGILDIFIFSGGTPETTVSQYTELIGRPMLPPFWSLGFHLSKYGYKSIADVSNTLYRNINISIPIEVQWSDIDYMDKYKDFTSDPIRYPNFGSFVAH-LNQSLGIKYIVIIDPGISIQSPGVYSAYDEGLELNIFIKDANTKKDLISNVWPGETCFPDFTHPNASKYWSHQIQRFHSQVPIDGLWIDMNEPSNFYDGSRTGCALNNPYDYPFFVPTIRDGSLIKKTICSSSLHYNNVMHYNLHNLYGYTEAVATHSALLNTIPNKRPFILSRSTFSGSGKYTFHWTGDNSANWDQLANSIRQVLNFNMFGIPMTGADICGFNGDSNEELCIRWMQLGAFYPFMRNHNSIGAKAQDPASWSQEAQIIMKKSIIIRYVWLPNFYTLLVKSYLYGGTVMRPLSFQFYSDAETHEIERQFMIGSSMLVNPVVVQGARNVVAYFPAGIWYDATDLSVIYSGKTGKWISLNAPLERTNVALRGGHALILSSLVNSTEYSRKV-INLVCILSMNQ---------TAAGDLYWDDGESMDSYSGKKFSYFKFTATSSSVLINPEILGYSVLPSLN 2611
            LLL++  +  + SNA+     QC     + RLDC+P + AN++ C+ +GCCWS       +   P IP C+FP +Y  Y + + T   RGF A + K    +   E  N+  EV+ ET TRLR+R T   DPN  R+E PI LG PD   P    Y   +     FG  V RN      L  + G +    ++SDQF+Q S  +  +H +G GE    F H L   W R+GLW RDN      NLYG H F+M L   G AFGV+  NSNAQE VL P PAITYRTIGGILD FIF+G  P    +QY  LIG P+LPP+WSLGFHL ++GY+   +V+NT+ RNI   IP++ QW DIDYMD Y+ +T DP ++    S +   L+   GI+ ++I+DP +S +    Y+ + +G +  IFI D+ T   +   VWPG+T FPDF+HP A  +  +    FH  VP DGLWIDMNEP++F  GS+T C   NP D P FVP I D SL  KT+C S+LH+++  HYN HNLYGY  A  TH+ L      KRPF+LSRSTFSGSG YT HWTGDN ++W  +  SI Q++NFN+FGIPM GADICGF G++ EELC+RW QLGAFYPF RNHN + +  QDPA WS+ A   ++ +I +RY+ LP  Y+L  +++L G TV R LSF+F  D  TH ++ QFM+GS +LV PV+ +G  +V  Y PAG W + +     YS  TG+     APL    + +RGG  +   +    T+ SRK  I L+ +LS            TA G+L+WDDGE+        + Y  FT  +  + I P+ L    + S++
Sbjct:    7 LLLLVFGSSGLASNAVNSLPPQCGPFPISERLDCYPEAGANKDACINKGCCWS-----GITFTEPHIPMCYFPKDYRTYTVRNVTQNPRGFVADMEKITSPYGVNEFQNVRVEVLHETKTRLRVRFTIPSDPN--RWEPPIPLGKPDVNAPEPTDYAVEL-EKSPFGIRVVRNDPIRQMLLDSTGDMSVSTIFSDQFLQTSFRLGAEHGFGPGEVRADFPHWLRRTWLRMGLWTRDNAPMKEANLYGVHNFFMGLSPDGSAFGVFLINSNAQEVVLTPLPAITYRTIGGILDFFIFTGPDPMDVTAQYLSLIGHPLLPPYWSLGFHLCRFGYRDSEEVANTVERNIKAGIPVDAQWIDIDYMDAYRVWTVDPTKFGGLPSLIQDTLHSKYGIRNVLIVDPAVSAKDDPTYAPFLDGFKRGIFINDSRTGSPIEGVVWPGDTVFPDFSHPEAEAWLYNLASEFHKSVPFDGLWIDMNEPASFAAGSKTNCDQTNPLDNPPFVPPILDRSLYAKTVCPSALHHDST-HYNRHNLYGYDHARVTHNVLKQLFAGKRPFLLSRSTFSGSGLYTIHWTGDNLSSWPDMRASIAQIINFNLFGIPMVGADICGFRGNTTEELCVRWSQLGAFYPFARNHNDLASIPQDPAVWSKAATEAIRDAIKLRYLLLPYMYSLFYRAHLNGTTVARALSFEFPRDTNTHTVKEQFMLGSCILVTPVLDEGRTDVTGYVPAGYWINLSTGRRDYS--TGQVKYFQAPLNVIPILVRGGCVVPFQTSFEVTKISRKKGIALLVVLSTTDDGTLIPQTGTAKGELFWDDGEA----DPLNYVYVNFTVANRELHIVPKPLNADTIRSID 845          
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Cavefish
Match: si:ch73-12o23.1 (lysosomal alpha-glucosidase [Source:NCBI gene;Acc:103033787])

HSP 1 Score: 678.322 bits (1749), Expect = 0.000e+0
Identity = 347/802 (43.27%), Postives = 502/802 (62.59%), Query Frame = 2
Query:  173 CSVPNNNYRLDCFP--GSNANQNDCLARGCCW-SPPETREYSQNNPTIPYCFFPIEYPNYQINSFTPTDRGFKARLTKQQKSFLRKEILNLNFEVIFETNTRLRIRITDPNVQRFEVPIQLGSPDPTPPSNIQYKFTMPTNGSFGFEVKRNSDGLSLFKT-FGPLLYSDQFIQISSLMSIQHVYGIGEQNRPFLHDLSTQWERIGLWARDNGIDTYNNLYGTHPFYMSLPDSGEAFGVYYFNSNAQEFVLQPAPAITYRTIGGILDIFIFSGGTPETTVSQYTELIGRPMLPPFWSLGFHLSKYGYKSIADVSNTLYRNINISIPIEVQWSDIDYMDKYKDFTSDPIRYPNFGSFVAHLNQSLGIKYIVIIDPGISIQSP-GVYSAYDEGLELNIFIKDANTKKDL-ISNVWPGETCFPDFTHPNASKYWSHQIQRFHSQVPIDGLWIDMNEPSNFYDGSRTGCALNNPYDYPFFVPTIRDGSLIKKTICSSSLHYNNVMHYNLHNLYGYTEAVATHSALLNTIPNKRPFILSRSTFSGSGKYTFHWTGDNSANWDQLANSIRQVLNFNMFGIPMTGADICGFNGDSNEELCIRWMQLGAFYPFMRNHNSIGAKAQDPASWSQEAQIIMKKSIIIRYVWLPNFYTLLVKSYLYGGTVMRPLSFQFYSDAETHEIERQFMIGSSMLVNPVVVQGARNVVAYFPAGIWYDATDLSVIYSGKT----GKWISLNAPLERTNVALRGGHALILSSLVNSTEY--SRKVINLVCILSMNQTAAGDLYWDDGESMDSYSGKKFSYFKF 2542
            C++    +R DC+P  G   N+  C  R CC+    E +   QN   +P+CF+P ++P+Y++ +   T+ G++ +L ++QK++   +I  L  +V++E+++RLRIR+TDP   R+EVPI +        SN  Y     T   FG  VKR  +G  L  T   PL Y+DQF+Q+S+ ++ + VYG+GE    FLHD+  QW  + +W RD       NLYG HPFY+ +   G A G +  NSNA + VLQPAPA+T+RTIGGILD+++F G  P + V +Y E++G+P +P +W+LG+HL ++GY S  +  + + +  N  IP +VQW+DIDYMD+  DFT DP+ +      V  L+      Y++I+DPGIS   P G Y  + EG++  +FI   N+  DL I  VWPG T FPDF++P+  ++W   ++ FH QVP DGLWIDMNEPSNF DGS  GC  N+  + P + P +  GSL  KT+C+S+    N  HYNLHNLYG  EA A+ SAL   +  KRPF++SRSTFS  G Y+ HW GDN + W  L  SI  +L FN+ GIP+ GADICGF+  + EELC+RW QLGAFYPF RNHN+  ++AQDP  +S  A+  M + +++RY   P  YTL   ++L G TV RPL F+F  D +T++I++QF+ G S+LV PV+  G   VV Y P GIWYD       Y+G +    G+ I L+APL++ N+ LR G ++  +   N+T +  S + ++L+  L+ +  A GDL+WDDGE++D+Y   +++YF F
Sbjct:  103 CTLIPEGWRFDCYPERGVVVNEEMCHKRNCCFIQVAEEKSPGQNG--VPWCFYPPDFPSYELVTNNETEMGYRGKLVRRQKTYYPNDIETLQLDVLYESDSRLRIRVTDPAKDRYEVPIDVPVVKKKA-SNPLYTVEF-TEQPFGLIVKRKQNGAVLLNTTVAPLFYADQFLQMSTSLASEFVYGLGEHRSNFLHDV--QWNTLTMWTRDAAPVELTNLYGVHPFYLLMESDGLAHGSFLLNSNAMDVVLQPAPALTWRTIGGILDLYVFVGPDPSSVVGEYLEVVGKPAMPIYWALGYHLCRWGYDSSNNTWDVVKKMRNNQIPQDVQWNDIDYMDRALDFTHDPVNFATLPDLVKDLHIH-DQHYVMILDPGISSTQPAGSYLPFQEGIKQGVFI--TNSSGDLLIGKVWPGLTAFPDFSNPDTHEWWYQNLKTFHDQVPFDGLWIDMNEPSNFLDGSVDGCPSND-LENPPYTPAVLGGSLRAKTVCASARQKLN-SHYNLHNLYGLMEAKASASALKKLL-KKRPFVISRSTFSSHGVYSGHWLGDNRSQWKDLYMSIPGMLTFNILGIPLVGADICGFSATTTEELCVRWTQLGAFYPFTRNHNTKDSQAQDPTVFSPAARKAMTEVLLLRYSLFPFLYTLFHHAHLSGHTVARPLFFEFPRDLKTYKIDKQFLWGKSLLVTPVLAPGVDYVVGYLPQGIWYD------FYTGDSLVSKGEEIKLHAPLDKINLHLREG-SITPTQRPNTTLWVSSSQPLHLIACLTEDGLAEGDLFWDDGETIDTYETDQYAYFIF 885          
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Cavefish
Match: gaa (glucosidase alpha, acid [Source:NCBI gene;Acc:103044115])

HSP 1 Score: 662.529 bits (1708), Expect = 0.000e+0
Identity = 343/801 (42.82%), Postives = 484/801 (60.42%), Query Frame = 2
Query:  197 RLDCFPGSNANQNDCLARGCCWSPPETREYSQNNPTIPYCFFPIEYPNYQINSFTPTDRGFKARLTKQQKSFLRKEILNLNFEVIFETNTRLRIRITDPNVQRFEVPIQLGSPDPTPPSNIQYKFTMPTN-GSFGFEVKRNSDGLSLFKT-FGPLLYSDQFIQISSLMSIQHVYGIGEQNRPFLHDLSTQWERIGLWARDNGIDTYNNLYGTHPFYMSLPDSGEAFGVYYFNSNAQEFVLQPAPAITYRTIGGILDIFIFSGGTPETTVSQYTELIGRPMLPPFWSLGFHLSKYGYKSIADVSNTLYRNINISIPIEVQWSDIDYMDKYKDFTSDPIRYPNFGSFVAHLNQSLGIKYIVIIDPGISIQSP-GVYSAYDEGLELNIFIKDANTKKDLISNVWPGETCFPDFTHPNASKYWSHQIQRFHSQVPIDGLWIDMNEPSNFYDGSRTGCALNNPYDYPFFVPTIRDGSLIKKTICSSSLHYNNVMHYNLHNLYGYTEAVATHSALLNTIPNKRPFILSRSTFSGSGKYTFHWTGDNSANWDQLANSIRQVLNFNMFGIPMTGADICGFNGDSNEELCIRWMQLGAFYPFMRNHNSIGAKAQDPASWSQEAQIIMKKSIIIRYVWLPNFYTLLVKSYLYGGTVMRPLSFQFYSDAETHEIERQFMIGSSMLVNPVVVQGARNVVAYFPAGIWYDATDLSVIYSGK----TGKWISLNAPLERTNVALRGGHALILSSLVNSTEYSRKVINLVCI-LSMNQTAAGDLYWDDGESMDSYSGKKFSYFKFTATSSSVLINP 2575
            R DC       Q+ C  RGCC+ P     +S      P+CF+P+ YP Y++    PT RG +A LT+   S+L +++  L  EV+ E   RL I + DP+  R+EVP  +  P  TP     + + +      FGF V+R S+G  L  T   PLL++DQ++Q+S+ ++   V G GE       DL+  W  + LW RD       NLYG+HPF +     G+A+G++  NSNA E V QPAPA+T+ T GGI+D +IF G  P++   QY ++IG PM+PP+WSLGFHL ++GY S       +      + P++VQW+D+DY DK + FT DP R+ +    V   + S G+KY++I+DPGIS  SP G Y  +DEG    +FI++  T + LI  VWPG T FPDFT+P+A  +W   I  F+++VP+DGLWIDMNEP+NF  GS  GC  +   + PF+VP +  G L   T+C SS   +   HYNLHNLYG TEA+ATHSALL      RPF+LSRS+F G G+Y+ HWTGD  ++W+QL  SI  VL F ++G+P+ GADICGF GD++EELC+RW QLGAFYPFMRNHN      Q+P  + Q+AQ  M+  +++RY  LP  YTL  ++     TV RPL  +F  D     I++QF+ GSS+L++PV+ QGA  + AY P G+WY       +Y G+     G+++ L+APL+  NV +RGG  +       +T  SR    L+ + LS +  A G+L+WDDGES+ ++    +S+  FTA  S ++  P
Sbjct:   88 RFDCARDRALTQSQCEQRGCCYVPLPKSAFSGP----PWCFYPVSYPGYRMGPLVPTSRGQEANLTRSTSSYLPRDVQTLTLEVMAEEAGRLHIALKDPSQDRYEVPF-VAVPPTTPTDTQSFLYDVEFQPDPFGFVVRRASNGRVLLNTTVAPLLFADQYLQLSTTLASSLVSGFGEHYTGLTLDLN--WTSVTLWNRDMAPHRDTNLYGSHPFCLVQEGDGQAYGIFLLNSNAMEVVSQPAPALTWVTTGGIMDFYIFLGPDPQSVAQQYHQVIGYPMMPPYWSLGFHLCRWGYTSTNATRAVVQHMHQANFPLDVQWNDLDYADKRRVFTFDPQRFGDLPEMVKEFH-SEGMKYVLILDPGISSTSPPGSYKPFDEGERRGVFIRNL-TGQTLIGKVWPGPTAFPDFTNPDAVSWWEECIADFYAKVPVDGLWIDMNEPANFVQGSLLGCP-DTDLENPFYVPDMIGGQLNAGTLCMSS-QQSLSAHYNLHNLYGLTEAMATHSALLKAR-GSRPFVLSRSSFPGLGRYSGHWTGDVHSDWEQLRYSIPAVLLFGLYGVPLVGADICGFEGDTSEELCVRWTQLGAFYPFMRNHNDRSNAPQEPYVFGQQAQAAMRSVMMLRYSLLPFLYTLFHQAQTSASTVARPLFLEFPFDPNCQTIDQQFLWGSSLLISPVLEQGAVELTAYLPPGMWYS------LYDGQPYNSRGQYLLLSAPLDTINVHVRGGRIIPQQMPALTTTASRSNPFLLTVALSSDGWAVGELFWDDGESLGTFERGDYSFIIFTAEQSQLVSEP 870          
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Cavefish
Match: gaa (glucosidase alpha, acid [Source:NCBI gene;Acc:103044115])

HSP 1 Score: 659.448 bits (1700), Expect = 0.000e+0
Identity = 341/792 (43.06%), Postives = 480/792 (60.61%), Query Frame = 2
Query:  197 RLDCFPGSNANQNDCLARGCCWSPPETREYSQNNPTIPYCFFPIEYPNYQINSFTPTDRGFKARLTKQQKSFLRKEILNLNFEVIFETNTRLRIRITDPNVQRFEVPIQLGSPDPTPPSNIQYKFTMPTN-GSFGFEVKRNSDGLSLF-KTFGPLLYSDQFIQISSLMSIQHVYGIGEQNRPFLHDLSTQWERIGLWARDNGIDTYNNLYGTHPFYMSLPDSGEAFGVYYFNSNAQEFVLQPAPAITYRTIGGILDIFIFSGGTPETTVSQYTELIGRPMLPPFWSLGFHLSKYGYKSIADVSNTLYRNINISIPIEVQWSDIDYMDKYKDFTSDPIRYPNFGSFVAHLNQSLGIKYIVIIDPGISIQSP-GVYSAYDEGLELNIFIKDANTKKDLISNVWPGETCFPDFTHPNASKYWSHQIQRFHSQVPIDGLWIDMNEPSNFYDGSRTGCALNNPYDYPFFVPTIRDGSLIKKTICSSSLHYNNVMHYNLHNLYGYTEAVATHSALLNTIPNKRPFILSRSTFSGSGKYTFHWTGDNSANWDQLANSIRQVLNFNMFGIPMTGADICGFNGDSNEELCIRWMQLGAFYPFMRNHNSIGAKAQDPASWSQEAQIIMKKSIIIRYVWLPNFYTLLVKSYLYGGTVMRPLSFQFYSDAETHEIERQFMIGSSMLVNPVVVQGARNVVAYFPAGIWYDATDLSVIYSGK----TGKWISLNAPLERTNVALRGGHALILSSLVNSTEYSRKVINLVCI-LSMNQTAAGDLYWDDGESMDSYSGKKFSYFKFTA 2548
            R DC       Q+ C  RGCC+ P     +S      P+CF+P+ YP Y++    PT RG +A LT+   S+L +++  L  EV+ E   RL I + DP+  R+EVP  +  P  TP     + + +      FGF V+R S+G  L   T  PLL++DQ++Q+S+ ++   V G GE       DL+  W  + LW RD       NLYG+HPF +     G+A+G++  NSNA E V QPAPA+T+ T GGI+D +IF G  P++   QY ++IG PM+PP+WSLGFHL ++GY S       +      + P++VQW+D+DY DK + FT DP R+ +    V   + S G+KY++I+DPGIS  SP G Y  +DEG    +FI++  T + LI  VWPG T FPDFT+P+A  +W   I  F+++VP+DGLWIDMNEP+NF  GS  GC  +   + PF+VP +  G L   T+C SS   +   HYNLHNLYG TEA+ATHSALL      RPF+LSRS+F G G+Y+ HWTGD  ++W+QL  SI  VL F ++G+P+ GADICGF GD++EELC+RW QLGAFYPFMRNHN      Q+P  + Q+AQ  M+  +++RY  LP  YTL  ++     TV RPL  +F  D     I++QF+ GSS+L++PV+ QGA  + AY P G+WY       +Y G+     G+++ L+APL+  NV +RGG  +       +T  SR    L+ + LS +  A G+L+WDDGES+ ++    +S+  FTA
Sbjct:   88 RFDCARDRALTQSQCEQRGCCYVPLPKSAFSGP----PWCFYPVSYPGYRMGPLVPTSRGQEANLTRSTSSYLPRDVQTLTLEVMAEEAGRLHIALKDPSQDRYEVPF-VAVPPTTPTDTQSFLYDVEFQPDPFGFVVRRASNGRVLLNTTVAPLLFADQYLQLSTTLASSLVSGFGEHYTGLTLDLN--WTSVTLWNRDMAPHRDTNLYGSHPFCLVQEGDGQAYGIFLLNSNAMEVVSQPAPALTWVTTGGIMDFYIFLGPDPQSVAQQYHQVIGYPMMPPYWSLGFHLCRWGYTSTNATRAVVQHMHQANFPLDVQWNDLDYADKRRVFTFDPQRFGDLPEMVKEFH-SEGMKYVLILDPGISSTSPPGSYKPFDEGERRGVFIRNL-TGQTLIGKVWPGPTAFPDFTNPDAVSWWEECIADFYAKVPVDGLWIDMNEPANFVQGSLLGCP-DTDLENPFYVPDMIGGQLNAGTLCMSS-QQSLSAHYNLHNLYGLTEAMATHSALLKAR-GSRPFVLSRSSFPGLGRYSGHWTGDVHSDWEQLRYSIPAVLLFGLYGVPLVGADICGFEGDTSEELCVRWTQLGAFYPFMRNHNDRSNAPQEPYVFGQQAQAAMRSVMMLRYSLLPFLYTLFHQAQTSASTVARPLFLEFPFDPNCQTIDQQFLWGSSLLISPVLEQGAVELTAYLPPGMWYS------LYDGQPYNSRGQYLLLSAPLDTINVHVRGGRIIPQQMPALTTTASRSNPFLLTVALSSDGWAVGELFWDDGESLGTFERGDYSFIIFTA 861          
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Cavefish
Match: ganab (glucosidase, alpha; neutral AB [Source:ZFIN;Acc:ZDB-GENE-110930-9])

HSP 1 Score: 248.054 bits (632), Expect = 8.065e-69
Identity = 213/772 (27.59%), Postives = 329/772 (42.62%), Query Frame = 2
Query:  464 TRLRIRITDPNVQRFEVPIQLGSPDPTPPSNIQYKFTMPTNGSFGFEVKR----------------------NSDGLSLFK------------------TF---------GPLLYSDQFIQISSLMSIQHVYGIGEQNRPFLHDLSTQWERIGLWARDN-GIDTYN--NLYGTHPFYMSLPDSGEAFGVYYFNSNAQ------------------EFVL----QPAPAITYRTIGGILDIFIFSGGTPETTVSQYTELIGRPMLPPFWSLGFHLSKYGYKSIADVSNTLYRNINISIPIEVQWSDIDYMDKYKDFTSDPIRYPNFGSFVAHLNQSLGIKYIVIIDPGISIQSPGVYSAYDEGLELNIFIKDANTKKDLISNVWPGETCFPDFTHPNASKYWSHQIQRFHSQVPIDGL--WIDMNEPSNFYDGSRTGCALNNPYDYPFFVPTIRDGSLIKKTICSSSLHYNNVMHYNLHNLYG-YTEAVAT-HSALLNTIPNKRPFILSRSTFSGSGKYTFHWTGDNSANWDQLANSIRQVLNFNMFGIPMTGADICGFNGDSNEELCIRWMQLGAFYPFMRNHNSIGAKAQDPASWSQEAQIIMKKSIIIRYVWLPNFYTLLVKSYLYGGTVMRPLSFQFYSDAETHEIERQFMIGSSMLVNPVVVQGARNVVAYFP--AGIWYDATDLSVIYSGKTGKWISLNAPLERTNVALRGGHALILSSLVNSTEYSRKVIN----LVCILSMNQTAAGDLYWDDGESMDSYSGKKF 2527
            TR++I    P   RFEVP  L    PT P ++  +       S G E +R                      NS GL  F+                  TF         GP   S  F    SL  ++HVYGI E         +   E   L+  D    + YN   LYG  P  ++  ++    G+++ N+                     +FV      P   + + +  GI+D+FI  G  P    +QY  L G    PP   L +H  ++ Y    DV           IP +  W DI++ D  + FT DP ++P     +  +      K + I+DP I + S   Y  ++E  + N ++K+ +   D     WPG + +PDFT+P    +W+        +  ++ L  W DMNEPS F          N P                + T+   ++H  +  H ++HNLYG Y +  AT    +  +   +RPF+L+R+ F+GS +Y   WTGDN+A WD L  S+   L+  + GI + GAD+ GF    + EL +RW Q GA+ PF R H  +    ++P  +  E   +++++I  RY  LP +Y    +++  G  VMR L  ++  D  T  I+ +F+IG  +LV+ V  +GAR V AY P    +WYD       ++G    +I +   +    V  RGG   I+   V     S  + N    L   LS  + A G+LY DDG + +  + K+F
Sbjct:   93 TRVKINELKPLKPRFEVPDVLIGEPPTEPLSVLSRDDNGLVLSLGVESQRLIVSARPFRLDIMEGPEVLLSLNSRGLLAFEHLRLRGGKDKEEDGLWEETFKSHTDSKPNGPTAVSLDF----SLPGVEHVYGIPEHADNLKLKTTDGGEPYRLYNLDVFQYELYNPMALYGAVPVMLA-HNTQRTMGIFWLNAAETWVDISSNTAGKTVFGKMLDFVQGSSETPQTDVRWISESGIIDVFIMLGPKPSDVFTQYASLTGTQSFPPLTGLAYHQCRWNYNDQDDVKAVDEGFDQHDIPCDFIWLDIEHTDGKRYFTWDPHKFPQPKDMLQGIKDKRR-KMVAIVDPHIKVDSG--YKIHNEIRDKNFYVKNKDGG-DYEGWCWPGNSGYPDFTNPEMRAWWASMFAYDQYEGSMENLYTWNDMNEPSVF----------NGP----------------EVTMHKDAMH-GHWEHRDVHNLYGLYVQHRATAEGQIQRSGGTERPFVLTRAFFAGSQRYGAVWTGDNAAEWDHLKISVPMCLSLGLVGISLCGADVGGFFKSPSAELLVRWYQTGAYQPFFRAHAHLDTPRREPWLFGPENTALIREAIRQRYALLPYWYQQFYQAHKTGQPVMRALWVEYPKDTATFTIDDEFLIGRDLLVHTVTEEGARGVTAYLPGLGEVWYDVHTFQK-HNGAQNLYIPVT--MSSIPVFQRGGS--IIPRKVRVRRSSECMENDPYTLFVALSPQRVAEGELYIDDGHTFNFQTKKEF 823          
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Cavefish
Match: ENSAMXT00000016120.2 (neutral alpha-glucosidase AB-like [Source:NCBI gene;Acc:103032339])

HSP 1 Score: 243.432 bits (620), Expect = 4.005e-67
Identity = 182/651 (27.96%), Postives = 287/651 (44.09%), Query Frame = 2
Query:  686 SLMSIQHVYGIGEQNRPFLHDLSTQWERIGLWARDNGIDTYNNL---YGTHPFYMSLPDSGEAFGVYYFNS------------------NAQEFVL--QPAPAITYRTIG--GILDIFIFSGGTPETTVSQYTELIGRPMLPPFWSLGFHLSKYGYKSIADVSNTLYRNINISIPIEVQWSDIDYMDKYKDFTSDPIRYPNFGSFVAHLNQSLGIKYIVIIDPGISIQSPGVYSAYDEGLELNIFIKDANTKKDLISNVWPGETCFPDFTHPNASKYWSHQIQRFHSQVPIDGL--WIDMNEPSNFYDGSRTGCALNNPYDYPFFVPTIRDGSLIKKTICSSSLHYNNVMHYNLHNLYG-YTEAVATHSALLNTIPNKRPFILSRSTFSGSGKYTFHWTGDNSANWDQLANSIRQVLNFNMFGIPMTGADICGFNGDSNEELCIRWMQLGAFYPFMRNHNSIGAKAQDPASWSQEAQIIMKKSIIIRYVWLPNFYTLLVKSYLYGGTVMRPLSFQFYSDAETHEIERQFMIGSSMLVNPVVVQGARNVVAYFPAG--IWYDATDLSVIYSGKTGKWISLNAPLERTNVALRGGHALILSSLV--NSTEYSRKVINLVCILSMNQTAAGDLYWDDGESMDSYSGKKFSYFKF 2542
            S   ++H+YGI E         +   E   L+  D      NNL   YG  P  +S  ++    GV++ N+                     +FV     AP    R I   GI+D+F  SG  P    +QY  L G    P   +LG+H  ++ Y    DV           IP +  W DI++ D  + FT DP ++      +  L      K + I+DP I + S   YS ++E      ++K+ +   D     WPG + +PDFT+P    +W+ +         ++ L  W DMNEPS F          N P                + T+   ++H  N  H ++HN+YG Y +       +  +   +RPF+L+R+ F+GS +Y   WTGDN+A W  L  SI   L+  + GI   GAD+ GF    + EL +RW Q GA+ PF R H  +    ++P  +  +   +++++I  RY  LP +Y L   +Y  G  VMRPL  ++  D +T  IE ++++G  +LV+PV  +GA+ V A+ P    +WY   D+      K  + + +   +    V  RGG  +     V  +S         L   LS   TA G++Y DD  +    + K+F + + 
Sbjct:  221 SFPGVEHLYGIPEHADTLKLKNTDGGEPYRLYNLDVFQYELNNLMALYGAVPVIIS-HNTERTMGVFWLNAAESWVDISSSTSGKTVFGKMMDFVQGSNEAPQTDVRWISESGIIDVFFMSGPRPNDVFAQYASLTGTQAFPALATLGYHQCRWNYNDQEDVKAVDEGFDEHDIPYDFIWLDIEHTDGKRYFTWDPNKFSQPKEMLQGLMDKRR-KMVAIVDPHIKVDSG--YSIHNEIRSKGFYVKNKD-GGDYEGWCWPGNSGYPDFTNPEMRAWWASKFAYDQYTGSMENLFTWNDMNEPSVF----------NGP----------------EVTMHKDAMH-GNWEHRDVHNIYGIYVQRATAEGQIQRSGGTERPFVLTRAFFAGSQRYGAVWTGDNAAEWGHLKISIPMCLSLGLVGISFCGADVGGFFKHPSTELLVRWYQAGAYQPFFRAHAHLDTPRREPWLFGPDNTALIREAIRQRYTLLPYWYQLFYNAYRTGQPVMRPLWVEYTEDPDTFAIEDEYLLGKDLLVHPVTEEGAKGVTAFLPGKGEVWY---DVHTFQKHKGAQNLYIPVTMSSIPVFQRGGSIISRKDRVRRSSACMENDPYTLYVALSPQGTAEGEIYIDDFHTFKFETDKQFIHRRL 836          
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005523.1 (pep scaffold:Pmarinus_7.0:GL480123:76219:97698:-1 gene:ENSPMAG00000005011.1 transcript:ENSPMAT00000005523.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 456.833 bits (1174), Expect = 8.939e-149
Identity = 259/708 (36.58%), Postives = 381/708 (53.81%), Query Frame = 2
Query:  593 FGFEVKRNSDGLSLFKTFGP-LLYSDQFIQISSLMSIQHVYGIGEQNRPFLHDLSTQWERIGLWARDNGIDTYN-NLYGTHPFYMSLPDSGEAFGVYYFNSNAQEFVLQPAPAITYRTIGGILDIFIFSGGTPETTVSQYTELIGRPMLPPFWSLGFHLSKYGYKSIADVSNTLYRNINIS-IPIEVQWSDIDYMDKYKDFTSDPIRYPNFGSFVAHLNQSLGIKYIVIIDPGISIQSPGVYSAYDEGLELNIFIKDANTKKDLISNVWPGETCFPDFTHPNASKYWSHQIQRFH-------SQVPIDGLWIDMNEPSNFYDGSRTG-------------------------CALNNPYDYPFFVPTIR-------------------------------DGSLIKKTICSSSLHY----NNVMHYNLHNLYGYTEAVATHSALLNTIPNKRPFILSRSTFSGSGKYTFHWTGDNSANWDQLANSIRQVLNFNMFGIPMTGADICGFNGDSNEELCIRWMQLGAFYPFMRNHNSIGAKAQDPASWSQEAQIIMKKSIIIRYVWLPNFYTLLVKSYLYGGTVMRPLSFQFYSDAETHEIERQFMIGSSMLVNPVVVQGARNVVAYFPAGIWYDATDLSVIYSGKTGKWISLNAPLERTNVALRGGHALILSSLVNSTEYSR-KVINLVCILSMNQTAAGDLYWDDGESM 2503
            FG  V R S G  ++ +  P   ++D+FIQ+S L+  +++YG GE      HD   Q   + +         Y  N YG HP+YMS+ D   A  V  FNSNA + VLQP PA+TYRT GGILD +   G +PE    QYT LIGRP +PP+WSLGF L +YGY +  ++ N LY ++  + +P + Q+ DIDYM +  DFT +  ++ NF + + H++   G++ I+I+DP I+      Y AY  G+E ++++K  + +  +    +      PDF     +++W  +I+ F+         +  DGLWIDMNEP++F  GS +G                         C  + P D      T R                               D +   KT+C  +LH     + V HYN+H+LYG+++   T  AL N +  KR  +++RSTF GSG+++ HW GDNSA WD L  SI  ++ F++FGI  TGADICGF GDSN +LC RWMQLGAFYP+ RNHN  G   QDP +W      + K+ + IRY  LP  YTL+ +++ +G TV+RPL  +F SD ET  I +QF+ G ++L+ PV+ +    V  Y P   WYD   +      +  ++  +NAP +  N+ +RGG+ L      N+T+YSR K ++L+     + TA G L+WDDG+ +
Sbjct:    7 FGIRVIRKSTGKVIWNSQAPGFTFTDRFIQMSVLLPSENIYGFGETE----HDTFKQPWYVHILGVCAVYPQYRANAYGVHPYYMSVEDGANAHSVLLFNSNAMDIVLQPNPAVTYRTTGGILDFYFTLGPSPEEVTQQYTALIGRPAMPPYWSLGFQLCRYGYANDTEILN-LYNDMKAAGVPYDTQYGDIDYMVRQLDFTLNKEKFGNFPNLIRHMHDE-GMRIIIILDPAIAANETEPYPAYTRGVENDVYMKRPDGQI-MFGKHYRAYAAMPDFFRERTARWWQREIEEFYRNPTTPTDSMEFDGLWIDMNEPASFVHGSTSGCEDKELNEPPYMPRAFELYFSSLANCHTSIPLDSQHRYTTTRSSQQVTTHSHMCGDNNQTYIQKILHRKSVQADETSHHKTMCMEALHELPDGSKVQHYNVHSLYGWSQTKPTLDALHN-VTGKRGIVVTRSTFPGSGQWSGHWLGDNSARWDNLDKSIIGMMEFSLFGITYTGADICGFFGDSNYDLCARWMQLGAFYPYSRNHNGKGNIRQDPVAWDTAFAEMSKRVLEIRYSLLPYLYTLMHEAHAHGSTVVRPLLHEFLSDNETWAISKQFLWGPALLITPVLEEEKVTVRGYVPDARWYDYQTMKGAQLTERKEYKEMNAPWDTINLHVRGGYILPTQQPANTTKYSRQKPMSLLVAPDSSGTATGSLFWDDGDGI 706          
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008911.1 (pep scaffold:Pmarinus_7.0:GL496136:1712:3787:1 gene:ENSPMAG00000008065.1 transcript:ENSPMAT00000008911.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 282.337 bits (721), Expect = 3.240e-86
Identity = 166/424 (39.15%), Postives = 238/424 (56.13%), Query Frame = 2
Query:  776 LWARDN------GIDTYNNLYGTHPFYMSLPDSGEAFGVYYFNSNAQEFVL---QPAPAITYRTI--GGILDIFIFSGGTPETTVSQYTELIGRPMLPPFWSLGFHLSKYGYKSIADVSNTLYRNINISIPIEVQWSDIDYMDKYKDFTSDPIRYPNFGSFVAHLNQSLGIKYIVIIDPGISIQSPGVYSAYDEGLELNIFIKDANTKKDLISNVWPGETCFPDFTHPNASKYWSHQIQRFHSQVPIDGLWIDMNEPSNFYDGSRTGCALNNPYDYPF-----FVPTIRDGSLIKKTICSSSLHYNNVMHYNLHNLYGYTEAVATHSALLNTIPNKRPFILSRSTFSGSGKYTFHWTGDNSANWDQLANSIRQVLNFNMFGIPMTGADICGFNGDSNEELCIRWMQLGAFYPFMRNHNSIGAKA 1999
            +W+RD       G    +N+YGTHPF+M     G   GV Y  ++AQ++ +   Q   +I   TI  GG+ DI++    +P+  V+ Y  LIGRP++ P W+LG++  ++GY    D  + L    +  +P++VQWSDID+M+KY+ F  D + + +  SFV  L++S G KY+ I+D GI+ +    Y A+ E    N+F          I+ VWP +  FPD+T+P+        ++  H+QV  DGLW DMNE SNF  G+   C  N   D P      + PT RD  L  K++   +LH N V+  + H+ YG  E  ATHS       N R FI+ RS+F+G GK+   W GDN +    +  SI  V+  N+FGIP+ GADICGF GD+N ELC RW  +GA+YPF RNHN+ G  A
Sbjct:   39 MWSRDQPTPEETGTLPGSNMYGTHPFFMYKHKVGAWTGVLYKLAHAQDWWVKNNQAKGSIDISTIATGGVADIYVIQAQSPDDIVNNYFRLIGRPVMVPQWALGWNQCRWGY----DTLDKLKGYDDNKLPLDVQWSDIDWMNKYRSFEFDQVNFKDLPSFVDDLHKS-GRKYVPIVDAGIAYRPDSDYKAFQE----NLFTT--------INEVWPNDASFPDYTNPDTG-----HLEDVHTQVAFDGLWEDMNEASNFCQGA---CYRNQQVDKPVKQNLPYTPTGRD--LEIKSMPLDTLHSNGVLQLDAHSYYGTQEVKATHSK------NMRTFIIERSSFAGMGKFASRWLGDNFSEDKYMGYSISGVMMMNIFGIPLAGADICGFIGDTNPELCARWHHVGAYYPFSRNHNNWGQVA 429          
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008912.1 (pep scaffold:Pmarinus_7.0:GL496136:2540:3769:1 gene:ENSPMAG00000008065.1 transcript:ENSPMAT00000008912.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 275.404 bits (703), Expect = 3.614e-84
Identity = 161/419 (38.42%), Postives = 233/419 (55.61%), Query Frame = 2
Query:  776 LWARDN------GIDTYNNLYGTHPFYMSLPDSGEAFGVYYFNSNAQEFVL---QPAPAITYRTI--GGILDIFIFSGGTPETTVSQYTELIGRPMLPPFWSLGFHLSKYGYKSIADVSNTLYRNINISIPIEVQWSDIDYMDKYKDFTSDPIRYPNFGSFVAHLNQSLGIKYIVIIDPGISIQSPGVYSAYDEGLELNIFIKDANTKKDLISNVWPGETCFPDFTHPNASKYWSHQIQRFHSQVPIDGLWIDMNEPSNFYDGSRTGCALNNPYDYPF-----FVPTIRDGSLIKKTICSSSLHYNNVMHYNLHNLYGYTEAVATHSALLNTIPNKRPFILSRSTFSGSGKYTFHWTGDNSANWDQLANSIRQVLNFNMFGIPMTGADICGFNGDSNEELCIRWMQLGAFYPFMRNHNS 1984
            +W+RD       G    +N+YGTHPF+M     G   GV Y  ++AQ++ +   Q   +I   TI  GG+ DI++    +P+  V+ Y  LIGRP++ P W+LG++  ++GY    D  + L    +  +P++VQWSDID+M+KY+ F  D + + +  SFV  L++S G KY+ I+D GI+ +    Y A+ E                  ++VWP +  FPD+T+P+        ++  H+QV  DGLW DMNE SNF  G+   C  N   D P      + PT RD  L  K++   +LH N V+  + H+ YG  E  ATHS       N R FI+ RS+F+G GK+   W GDN +    +  SI  V+  N+FGIP+ GADICGF GD+N ELC RW  +GA+YPF RNHN+
Sbjct:    2 MWSRDQPTPEETGTLPGSNMYGTHPFFMYKHKVGAWTGVLYKLAHAQDWWVKNNQAKGSIDISTIATGGVADIYVIQAQSPDDIVNNYFRLIGRPVMVPQWALGWNQCRWGY----DTLDKLKGYDDNKLPLDVQWSDIDWMNKYRSFEFDQVNFKDLPSFVDDLHKS-GRKYVPIVDAGIAYRPDSDYKAFQE------------------AHVWPNDASFPDYTNPDTG-----HLEDVHTQVAFDGLWEDMNEASNFCQGA---CYRNQQVDKPVKQNLPYTPTGRD--LEIKSMPLDTLHSNGVLQLDAHSYYGTQEVKATHSK------NMRTFIIERSSFAGMGKFASRWLGDNFSEDKYMGYSISGVMMMNIFGIPLAGADICGFIGDTNPELCARWHHVGAYYPFSRNHNN 381          
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008215.1 (pep scaffold:Pmarinus_7.0:GL476974:10756:37747:1 gene:ENSPMAG00000007408.1 transcript:ENSPMAT00000008215.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 223.787 bits (569), Expect = 3.434e-61
Identity = 179/671 (26.68%), Postives = 310/671 (46.20%), Query Frame = 2
Query:  686 SLMSIQHVYGIGEQNRPFLHDLSTQWERIGLWARDN-GIDTYN--NLYGTHPFYMSLPDSGEAFGVYYFNSNAQEFVLQ-------PAP-----------------AITYRTIGGILDIFIFSGGTPETTVSQYTELI----GRPMLPPFWSLGFHLSKYGYKSIADVSNTLYRNINISIPIEVQWSDIDYMDKYKDFTSDPIRYPNFGSFVAHLNQSLGIKYIVIIDPGISIQSPGVYSAYDEGLELNIFIKDANTKKDLISNVWP-GETCFPDFTHPNASKYWSHQIQRFHSQVPIDGL--WIDMNEPSNFYDGSRTGCALNNPYDYPFFVPTIRDGSLIKKTICSSSLHYNNVMHYNLHNLYGYTEAVATHSALLNTIPN-KRPFILSRSTFSGSGKYTFHWTGDNSANWDQLANSIRQVLNFNMFGIPMTGADICGFNGD-SNEELCIRWMQLGAFYPFMRNHNSIGAKAQDPASWSQEAQIIMKKSIIIRYVWLPNFYTLLVKSYLYGGTVMRPLSFQFYSDAETHEIERQFMIGSSMLVNPVVVQGARNVVAYFPA--GIWYDATDLSVIYSGKTGKWISLNAPLERTNVA-----LRGGHALILS-SLVNSTEYSRK-VINLVCILSMNQTAAGDLYWDDGESMDSYSGKKFSYFKFTATSSSV 2563
            +L    HVYGI E+   F    +T+     ++  D  G + +N   LYG  P  ++   +     +++ NS+     +        P P                  + + +  G +D+F+  G TP     QY  L     G   LPP ++LG+H S++  ++ AD            I  +V W DI++ D  + FT D  R+P+       L  + G K + I+DP I + +   Y  Y EG     FI++ +   +     WP G + + D T+P+   +++ +    + +     L  W DMNEP+ F+                           I+KT+  + LH+    H + HNLYG+ + +A+ + L+      +RPF+L+RS F+GS +Y   WTGD+ A WD L  S   +L+ ++ GI + GAD+ GF  +  ++ + +RW Q G+  PF R H++     ++P       + ++++++ +RY  LP +YT   +++  G  VMRPL  +F SD ET  +E Q+MIG+++L  PV       V  Y P     WYD      I+S K  ++ +     +R N++      R G  +    +L +STE  ++    L+  +     A G+L+ DDG S    + ++F +  F+ + S++
Sbjct:  208 ALPDCGHVYGIPERATSFRLKPTTEGSPYRMFNLDTFGYELHNPQGLYGAVPLLLAH-SAQRTSAIFWLNSSETWVDVSTTQQQQPPVPSEPSASQSSSVRDRVDTGVRWMSESGTIDVFVLPGPTPCDVFRQYAGLTVGSAGTQALPPLFALGYHHSRWAEQTEADTREVDGGFRRSRIACDVLWLDIEHTDGKRYFTWDADRFPDPVGLQNDL-AAKGRKVVTIVDPHIKVDNE--YFVYSEGKARGYFIRNPD-GSNYEGRCWPEGLSSYLDLTNPDVRDWYASKFDYCNYKNSTAALFTWNDMNEPAVFHS--------------------------IEKTVPRNCLHWGGWEHRDNHNLYGFYQQMASAAGLVRRSGGLERPFVLTRSFFAGSQRYGAVWTGDSLATWDYLRMSTPMLLSLSVCGISLCGADVGGFFEEPQSQAMVLRWFQAGSLQPFFRVHSA--KVRREPWLMGASGEKLIRRAVALRYALLPYWYTQFYRAHRTGQPVMRPLWVEFPSDEETFVLEDQYMIGNALLARPVTEDNVNTVQVYLPGRNEAWYD------IHSRK--RYPAPGKFAQRVNMSSIPLYQRAGTIIPQKLNLRDSTELMKEDPYTLLVAVDPGGCAEGELFIDDGHSFLYKTQQRFLHRGFSYSDSTL 837          
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008908.1 (pep scaffold:Pmarinus_7.0:GL496136:110:3787:1 gene:ENSPMAG00000008065.1 transcript:ENSPMAT00000008908.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 174.096 bits (440), Expect = 3.135e-48
Identity = 118/340 (34.71%), Postives = 170/340 (50.00%), Query Frame = 2
Query: 1130 IPIEVQWSDIDYMDKYKDFTSDPIRYPNFGSFVAHLNQSLGIKYIVIIDPGISIQSPGVYSAYDEG-LELNIFIKDANTK-----KDLISNVWPGETCFPDFTHPNASKYWSHQIQRFHSQVPIDGLWIDMNEPSNFYDG--------------------SRTGCALNNPYDY-----------PFF---------VPTIRDGSLIKKTIC-SSSLHYNNVMHYNLHNLYGYTEAVATH---SALLNTIPNKRPFILSRSTFSGSGKYTFHWTGDNSANWDQLANSIRQVLNFNMFGIPMTGADICGFNGDSNEELCIRWMQLGAFYPFMRNHNSIGAKA 1999
            +P+E  + DI YM  YKDF+ D   +      +   NQ L    +VI+D  IS         Y +G  EL+IFIK +  K      ++IS VWP +  F D+ +P +  +W++ +      V  DG+WIDMNEP+ F  G                    S  G  ++  Y++           PF           P   +G+    T+  +S++       YN+H+LYG   A  T    + +    P++RP+IL+RSTF+ SG+Y  HW GDN   W+ +  SI  V+  N+FGIP+ GADICGF GD+N ELC RW  +GA+YPF RNHN+ G  A
Sbjct:   21 MPLETMYLDIPYMKSYKDFSVDTKAF-GLAKRLHDANQKL----VVILDAAISADDVND-DVYQKGSTELDIFIKSSMYKSKTYNNNIISKVWPDKAVFIDWFNPKSLDFWTYDL------VDYDGIWIDMNEPTTFGHGEIKPDDAEPVTPTLAKKRLMSDDGETVDWYYEFKDQSVGSTFTLPFIPGYVQSDDGKPGPYNGNFDYMTLSLNSTIPSLGETSYNVHSLYGLMMAKRTFEHVTKMEAKRPDERPYILTRSTFASSGRYASHWLGDNWRKWEYMRYSIAGVMMMNIFGIPLAGADICGFIGDTNPELCARWHHVGAYYPFSRNHNNWGQVA 348          
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Yeast
Match: ROT2 (Glucosidase II catalytic subunit; required to trim the final glucose in N-linked glycans; required for normal cell wall synthesis; mutations in rot2 suppress tor2 mutations, and are synthetically lethal with rot1 mutations [Source:SGD;Acc:S000000433])

HSP 1 Score: 249.595 bits (636), Expect = 6.821e-70
Identity = 194/632 (30.70%), Postives = 297/632 (46.99%), Query Frame = 2
Query:  686 SLMSIQHVYGIGEQNRPF-LHDLSTQWERIGLWARD---NGIDTYNNLYGTHPFYMSLPDSGEAFGVYYFNSNAQEFVLQPAPAITYRTI------GGILDIFIFSGGTPETTVSQYTELIGRPMLPPFWSLGFHLSKYGYKSIADVSNTLYRNINISIPIEVQWSDIDYMDKYKDFTSDPIRYPNFGSFVAHLNQSLGIKYIVIIDPGISIQSPGVYSAYDEGLELNIFIKDANTKKDLISNVWPGETCFPDFTHPNASKYWSHQIQRFHSQVPID----GLWIDMNEPSNFYDGSRTGCALNNPYDYPFFVPTIRDGSLIKKTICSSSLHYNNVMHYNLHNLYGYTEAVATHSAL--LNTIPNKRPFILSRSTFSGSGKYTFHWTGDNSANWDQLANSIRQVLNFNMFGIPMTGADICGFNGDSNEELCIRWMQLGAFYPFMRNHNSIGAKAQDPASWSQEAQIIMKKSIIIRYVWLPNFYTLLVKSYLYGGTVMRPLSFQFYSDAETHEIERQFMIGSS-MLVNPVVVQGARNVVAYFPAGIWYDATDL-SVIYSGKTGKWISLNAPLERTNVALRGGHALILSSLVNSTEYSRKVINLVCILSMNQT--AAGDLYWDDGESMDSYSGK 2521
            S M   +VYGI E      L D S   E   L+  D     I T   +YG+ PF  S      +  +++ N+ A  +V         +T+       G++D+ +  G    T + ++T+L GRP LPP  S+G+H  ++ Y    DV     +     IP +  W D++Y +  K FT     +PN    +    + LG   +V+IDP +       Y   D  +  N+ +KD N   D + + WPG + + D       K W    +RF   +P D     +W DMNEPS  +DG  T      P D                      +H N +   ++HN+YG +   AT+ A+  + +  +KRPF+L+R+ F+GS +    WTGDN ANWD L  SI  VL+ N+ G+P  GADI GF  D   EL  RW Q G +YPF R H  I  K ++P  +++  + I++  I +RY  LP  YT+  KS + G  +M P+  +    AE + I+ QF   +S +LV PV   G       FP GI+Y+   L S I +G      +++APL++  + + GGH + +      +    K    V +++ +    A GDLY DDGE+     G+
Sbjct:  264 SFMGSTNVYGIPEHATSLRLMDTSGGKEPYRLFNVDVFEYNIGTSQPMYGSIPFMFS----SSSTSIFWVNA-ADTWVDIKYDTSKNKTMTHWISENGVIDVVMSLGPDIPTIIDKFTDLTGRPFLPPISSIGYHQCRWNYNDEMDVLTVDSQMDAHMIPYDFIWLDLEYTNDKKYFTWKQHSFPN-PKRLLSKLKKLGRNLVVLIDPHLKKD----YEISDRVINENVAVKDHN-GNDYVGHCWPGNSIWIDTISKYGQKIWKSFFERF-MDLPADLTNLFIWNDMNEPS-IFDGPETTA----PKDL---------------------IHDNYIEERSVHNIYGLSVHEATYDAIKSIYSPSDKRPFLLTRAFFAGSQRTAATWTGDNVANWDYLKISIPMVLSNNIAGMPFIGADIAGFAEDPTPELIARWYQAGLWYPFFRAHAHIDTKRREPYLFNEPLKSIVRDIIQLRYFLLPTLYTMFHKSSVTGFPIMNPMFIEHPEFAELYHIDNQFYWSNSGLLVKPVTEPGQSETEMVFPPGIFYEFASLHSFINNGTDLIEKNISAPLDKIPLFIEGGHIITMKDKYRRSSMLMKNDPYVIVIAPDTEGRAVGDLYVDDGETFGYQRGE 857          
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Nematostella
Match: EDO41811 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S392])

HSP 1 Score: 618.616 bits (1594), Expect = 0.000e+0
Identity = 351/809 (43.39%), Postives = 466/809 (57.60%), Query Frame = 2
Query:  197 RLDCFPGSNANQNDCLARGCCWSPPETRE---YSQNNPT-------IPYCFFPIEYPNYQINSFTPTDRGFKARLT------KQQKSFLRKEILNLNFEVIFETNTRLRIRITDPNVQRFEVPIQLGSPDPTPPSNIQYKFTMPTNGSFGFEVKRNSDGLSLF-KTFGPLLYSDQFIQISSLMSIQHVYGIGEQNRPFLHDLSTQWERIGLWARDNGI--DTYNNLYGTHPFYMSLPDSGEAFGVYYFNSNAQEFVLQPAPAITYRTIGGILDIFIFSGGTPETTVSQYTELIGRPMLPPFWSLGFHLSKYGYKSIADVSNTLYRNINI---SIPIEVQWSDIDYMDKYKDFTSDPIRYPNFGSFVAHLNQSLGIKYIVIIDPGISIQSP-GVYSAYDEGLELNIFIKDANTKKDLISNVWPGETCFPDFTHPNASKYWSHQIQRFHSQVPIDGLWIDMNEPSNFYDGSRTGCALNNPYDYPFFVPTIRDGSLIKKTICSSSLHYNNVMHYNLHNLYGYTEAVATHSALLNTIPNKRPFILSRSTFSGSGKYTFHWTGDNSANWDQLANSIRQVLNFNMFGIPMTGADICGFNGDSNEELCIRWMQLGAFYPFMRNHNSIGAKAQDPASWSQEAQIIMKKSIIIRYVWLPNFYTLLVKSYLYGGTVMRPLSFQFYSDAETHEIERQFMIGSSMLVNPVVVQGARNVVAYFPAGIWYDATDL-----------SVIYSGKTGKWISLNAP-LERTNVALRGGHALILSSLVNSTEYSRKVINLVCILSM---NQTAAGDLYWDDGESMDS 2509
            R DCFP + A +  C ARGCCW P E R       + PT       IPYCF+P+ Y  Y + S   T  G+K  L       K Q S  + ++ NL          +L   I DP  +R+EVPI   +P  T  SN Q      T+  FG  V R S G  LF  T G +++ DQF+QISSL+   ++YG+GE    F   L+  W R  ++ARD         NLYG HPFY+++ + G A G++  NSNA E +LQP PAITYR++GG+LD ++F G TPE    QY  LIG+P LPP+W LG+HL ++GY    +VS T+  N N+    IP +VQW+DI+YM  + DFT D   +   G FV  L+      YI I+DPGIS   P G Y  Y +GL + +F+ +A+    ++  VWPG T +PDF +P+   YW+ QI +FH  VP DGLWIDMNEPSNF  GS +GC  N  +D P + P I    LI KT+C S+ HY    HY++H+LYGYTE VAT SAL  +I  KR  ++SRSTF  SG++  HW GDN A W+ +  S+  +LN NMFGIP+ GADICGF G++N ELC RW QLGAFYPF RNHN+ GA  QDPAS+  +   + +  ++ RY  LP  YTL   +Y  G TV RPL F+F  DA+T  I+RQFM GSS+LV PV+ QGA +V  YFP   WY+  D+            +   G  G++  L  P L  T + +RGG  +       +T  SRK    + +       + A G L+ DDGES+ +
Sbjct:    6 RFDCFPEAGATEELCQARGCCWVPAENRPPRPEPTSKPTGVNAPLDIPYCFYPLNY-GYSLTSKVATKTGYKKTLCPTKLPIKHQTSERKIKMTNL---------FKLHGDIYDPANKRYEVPIP--TPMITQKSNSQDYDVSFTSFPFGISVTRKSTGTVLFNSTVGGMIFEDQFLQISSLLPSSNIYGLGEHADAF--KLNVTWRRDTMFARDVATPEGMQYNLYGVHPFYLNVENDGNANGLFLLNSNALEVILQPTPAITYRSLGGVLDFYMFLGPTPEAVAQQYITLIGKPRLPPYWGLGYHLCRWGY---GNVSRTITVNDNMRRYKIPQDVQWNDIEYMKDHLDFTVDSTNWGGLGDFVKKLHTQYDQHYIPIVDPGISNTQPSGSYPPYSDGLAMGVFV-NASNGGPIVGQVWPGNTVYPDFFNPSTQSYWTKQISQFHDVVPFDGLWIDMNEPSNFVQGSTSGCP-NTKWDNPPYTPHIIGDKLIDKTLCMSARHYG-YRHYDVHSLYGYTETVATMSAL-ESIRGKRSMVISRSTFPNSGQHGGHWLGDNQATWESMYLSVPGILNMNMFGIPLVGADICGFLGNTNYELCARWTQLGAFYPFSRNHNTKGATPQDPASFGDKFASMARGVLLTRYRMLPYLYTLFFDAYNMGSTVARPLFFEFPKDAKTLAIDRQFMWGSSLLVTPVLQQGASDVTGYFPDATWYNVYDVRLRAPCAPPGSELQREGSGGQYHKLGCPVLCDTPLHIRGGSIIATQKPDITTAASRKNPFELIVAKTGKDGEPANGRLFLDDGESLGT 793          
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Nematostella
Match: EDO48632 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJ81])

HSP 1 Score: 225.328 bits (573), Expect = 2.210e-61
Identity = 155/514 (30.16%), Postives = 244/514 (47.47%), Query Frame = 2
Query: 1040 FWSLGFHLSKYGYKSIADVSNTLYRNINISIPIEVQWSDIDYMDKYKDFTSDPIRYPNFGSFVAHLNQSLGIKYIVIIDPGISIQSPGVYSAYDEGLELNIFIKDANTKKDLISNVWPGETCFPDFTHPNASKYWSHQIQRFHSQVPIDGL--WIDMNEPSNFYDGSRTGCALNNPYDYPFFVPTIRDGSLIKKTICSSSLHYNNVMHYNLHNLYGYTEAVATHSALLNTIPNK-RPFILSRSTFSGSGKYTFHWTGDNSANWDQLANSIRQVLNFNMFGIPMTGADICGFNGDSNEELCIRWMQLGAFYPFMRNHNSIGAKAQDPASWSQEAQIIMKKSIIIRYVWLPNFYTLLVKSYLYGGTVMRPLSFQFYSDAETHEIERQFMIGSSMLVNPVVVQGARNVVAYFPAG--IWYDATDLSVIYSGKTGKWISLNAPLERTNVALRGGHALIL-------SSLVNSTEYSRKVINLVCILSMNQTAAGDLYWDDGESMDSYSGKKFSYFKFT 2545
             + + +H  ++ Y    DV +         IP +V W DI++ D  +  T D +++PN  +   ++  S G K + I+DP +   S   Y  ++E   L  +IK+ +   +  +  W G + +PDFT+P   ++W+ +I     +     L  W DMNEPS F+                   P I        T+   ++HY +  H ++HN+YG     AT+  L+     K RPF+LSR+ F+G+ +Y   WTGDN A W  L  SI  +L+  + G+P  GAD+ GF  +   EL  RW Q G F PF+R H  +  K ++P  +    + +++ ++  RY  LP +YTL   +   G  ++RPL  ++  D  T ++E +F++G  +LV PV   G      Y P     WY   D   IY G  G  + + +PL++  +  RGG  +         SSL +   Y+     L   L     A GDLY DD  S D  +G  F+Y KFT
Sbjct:  332 LFGIAYHQCRWNYNDEEDVKSVDDSFDKHDIPYDVLWLDIEHTDGKRYMTWDKVKFPNPEAMQENI-ASKGRKMVTIVDPHMKRTSD--YHVHEEATSLGHYIKNKDGG-EYENWCWSGSSSWPDFTNPKIREWWASKISHDQYKGSTTNLFIWNDMNEPSVFHG------------------PEI--------TMHKDTIHYGDWEHRDVHNIYGMYFHKATNLGLIQRSGGKDRPFVLSRAFFAGTQRYGPIWTGDNMAEWSHLKASIPMILSLGVTGLPFAGADVGGFFKNPEPELLARWYQTGVFTPFLRAHAHLDTKRREPWLFDDVYKNVIRDALRTRYALLPLWYTLFFHASQDGTPIIRPLWVEYPEDKSTFKMEDEFLVGDQLLVKPVTEPGQVTSDVYLPGKEQYWYHLDDHK-IYRG--GNNVKVASPLDKIPLFQRGGSIIPRKNRIRRSSSLSHDDPYT-----LTLALDPKGEAEGDLYIDDFHSFDYKTG-AFAYMKFT 806          
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Nematostella
Match: EDO45756 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RS68])

HSP 1 Score: 54.299 bits (129), Expect = 2.034e-7
Identity = 54/210 (25.71%), Postives = 82/210 (39.05%), Query Frame = 2
Query: 1802 DNSANWDQ---LANSIRQVLNFNMFGIPMTGADICGFNG-------DS----NEELCIRWMQLGAFYPFMR----------NHNSIGAKAQDPASWSQEAQIIMKKSIIIRYVWLPNFYTLLVKSYLYGGTVMRPLSFQFYSDAETHEIERQFMIGSSMLVNPVVVQGARNV---VAYFPAGIWYDA-TDLSVIYSGKTGKWISLNAPLE 2347
            D ++ WD+   L + I   L   + G P    D+ G NG       DS    + EL +RWMQ   F P M+          N  +I  +  D  +   E  I+  + +        N  T           ++RPL +   +D     ++ +F++G   LV PV+   + N      Y P G W +   D  VI   K G+WI     LE
Sbjct:  343 DRTSKWDEKDGLRSVIPATLTLGILGYPFVLPDMIGGNGAQLNSNSDSFNKPDNELYVRWMQAAVFLPTMQFSFPPWLYGSNTINIAKRLLDLRAKISETLILFARQV--------NQST---------APIIRPLWWVAPNDDIALTLDSEFLVGDRFLVAPVLRPYSENKGKHKVYLPQGKWKEEFGDFKVITVPKPGQWIEYTVTLE 535          
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Medaka
Match: si:ch73-12o23.1 (lysosomal alpha-glucosidase [Source:NCBI gene;Acc:101169174])

HSP 1 Score: 672.929 bits (1735), Expect = 0.000e+0
Identity = 348/806 (43.18%), Postives = 498/806 (61.79%), Query Frame = 2
Query:  173 CSVPNNNYRLDCFP--GSNANQNDCLARGCCWSPPETRE---YSQNNPTIPYCFFPIEYPNYQINSFTPTDRGFKARLTKQQKSFLRKEILNLNFEVIFETNTRLRIRITDPNVQRFEVPIQLGSPDPTPPSNIQYKFTMPTNGSFGFEVKRNSDGLSLFKT-FGPLLYSDQFIQISSLMSIQHVYGIGEQNRPFLHDLSTQWERIGLWARDNGIDTYNNLYGTHPFYMSLPDSGEAFGVYYFNSNAQEFVLQPAPAITYRTIGGILDIFIFSGGTPETTVSQYTELIGRPMLPPFWSLGFHLSKYGYKSIADVSNTLYRNINISIPIEVQWSDIDYMDKYKDFTSDPIRYPNFGSFVAHLNQSLGIKYIVIIDPGISIQSP-GVYSAYDEGLELNIFIKDANTKKDLISNVWPGETCFPDFTHPNASKYWSHQIQRFHSQVPIDGLWIDMNEPSNFYDGSRTGCALNNPYDYPFFVPTIRDGSLIKKTICSSSLHYNNVMHYNLHNLYGYTEAVATHSALLNTIPNKRPFILSRSTFSGSGKYTFHWTGDNSANWDQLANSIRQVLNFNMFGIPMTGADICGFNGDSNEELCIRWMQLGAFYPFMRNHNSIGAKAQDPASWSQEAQIIMKKSIIIRYVWLPNFYTLLVKSYLYGGTVMRPLSFQFYSDAETHEIERQFMIGSSMLVNPVVVQGARNVVAYFPAGIWYDATDLSVIYSGKTGKWISLNAPLERTNVALRGGHALILSSLVNSTEY--SRKVINLVCILSMNQTAAGDLYWDDGESMDSYSGKKFSYFKFTATSSSV 2563
            CS  +  +R DC+P  G    ++ C AR CC+ P  +      S+ N  +P+CF+P ++P+Y + S   T  G K  L K+ K++   +IL +  E   ET+TRL +R+TDP+  RFEVPI +  P+PT  +         +   FG  VKR S G+ L  T   PL Y+DQF+Q S+++  Q +YG+GE    FLHD++  W  + +WARD       NLYG HPFY+++ + G A G +  NSNA + VLQP PA+T+RTIGGILD ++F G  P + VSQY E+IG P +P +W+LG+HL ++GY S       +    N  IP + QW+DIDYMD+  DFT D  ++      V  L+ +    Y++++DPGIS   P G Y  +DEGL+  +FIKDA  K  LI  VWPG T +PDF+      +W   +Q+FH++VP DGLWIDMNEPSNF DGS  GC  +N  + P + P +  G L  KT+C+++      MHYNLH+LYG  EA A+ SAL   +  KRPF++SRSTF   G Y+ HW GDN + W  L  SI  +L FN+ GIP+ GADICGF+ +  EELC+RW QLGAFYPF RNHNSI  K QDP ++S  A+  MK+++++RY   P  YTL   ++ +G +V RP+ F+F  D +T+ I++QF+ G S+LV PV+  G   VV YFPAG+WYD      ++S   G+ + L APL++ N+ LR G ++I +   N T +  + + ++L+  LS   +A GDL+WDDGES+D++   ++SY  F+   +++
Sbjct:  113 CSAISEPWRFDCYPERGVVVTKDMCEARNCCFIPASSSSNAGQSRKN-GVPWCFYPPDFPSYSLVSTDDTLMGQKGTLVKEVKTYYPGDILTVEVETRQETDTRLHVRMTDPSNPRFEVPISV--PNPTKKAENPAYIVELSKQPFGITVKRRSTGVLLLNTTVAPLFYADQFLQFSTVLPTQFIYGLGEHRSTFLHDMN--WNTLTMWARDVPPMEKTNLYGVHPFYLAMEEDGNAHGFFLLNSNAMDVVLQPTPALTWRTIGGILDFYVFLGPDPGSVVSQYLEVIGNPAMPIYWALGYHLCRWGYNSSNSTWEVVKSLRNYGIPQDTQWNDIDYMDQSMDFTYDSKKFETLPDLVRDLH-AHNQTYVIMLDPGISSTQPEGSYWPFDEGLKRGVFIKDAEGKT-LIGKVWPGLTAYPDFSDEVTHDWWFDNLQKFHNKVPFDGLWIDMNEPSNFLDGSTNGCP-SNSLENPPYTPGVLGGLLRAKTVCATA-QQKLSMHYNLHSLYGLMEAKASASALKKLL-TKRPFVISRSTFPSQGLYSGHWLGDNRSQWKDLYTSIAGILTFNLLGIPLVGADICGFSEEPQEELCVRWTQLGAFYPFTRNHNSIDMKPQDPTAFSPLARTAMKEALLLRYSLFPFLYTLFHHAHAHGHSVARPVMFEFPKDVKTYGIDKQFLWGRSLLVTPVLDPGVDYVVGYFPAGLWYDFYTGDSLHS--KGEEVRLQAPLDKINLHLREG-SVIPTQTPNLTLWISTGQPLHLISALSDEGSAHGDLFWDDGESIDTFETNQYSYIVFSVAQNTM 905          
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Medaka
Match: si:ch73-12o23.1 (lysosomal alpha-glucosidase [Source:NCBI gene;Acc:101169174])

HSP 1 Score: 672.929 bits (1735), Expect = 0.000e+0
Identity = 348/806 (43.18%), Postives = 498/806 (61.79%), Query Frame = 2
Query:  173 CSVPNNNYRLDCFP--GSNANQNDCLARGCCWSPPETRE---YSQNNPTIPYCFFPIEYPNYQINSFTPTDRGFKARLTKQQKSFLRKEILNLNFEVIFETNTRLRIRITDPNVQRFEVPIQLGSPDPTPPSNIQYKFTMPTNGSFGFEVKRNSDGLSLFKT-FGPLLYSDQFIQISSLMSIQHVYGIGEQNRPFLHDLSTQWERIGLWARDNGIDTYNNLYGTHPFYMSLPDSGEAFGVYYFNSNAQEFVLQPAPAITYRTIGGILDIFIFSGGTPETTVSQYTELIGRPMLPPFWSLGFHLSKYGYKSIADVSNTLYRNINISIPIEVQWSDIDYMDKYKDFTSDPIRYPNFGSFVAHLNQSLGIKYIVIIDPGISIQSP-GVYSAYDEGLELNIFIKDANTKKDLISNVWPGETCFPDFTHPNASKYWSHQIQRFHSQVPIDGLWIDMNEPSNFYDGSRTGCALNNPYDYPFFVPTIRDGSLIKKTICSSSLHYNNVMHYNLHNLYGYTEAVATHSALLNTIPNKRPFILSRSTFSGSGKYTFHWTGDNSANWDQLANSIRQVLNFNMFGIPMTGADICGFNGDSNEELCIRWMQLGAFYPFMRNHNSIGAKAQDPASWSQEAQIIMKKSIIIRYVWLPNFYTLLVKSYLYGGTVMRPLSFQFYSDAETHEIERQFMIGSSMLVNPVVVQGARNVVAYFPAGIWYDATDLSVIYSGKTGKWISLNAPLERTNVALRGGHALILSSLVNSTEY--SRKVINLVCILSMNQTAAGDLYWDDGESMDSYSGKKFSYFKFTATSSSV 2563
            CS  +  +R DC+P  G    ++ C AR CC+ P  +      S+ N  +P+CF+P ++P+Y + S   T  G K  L K+ K++   +IL +  E   ET+TRL +R+TDP+  RFEVPI +  P+PT  +         +   FG  VKR S G+ L  T   PL Y+DQF+Q S+++  Q +YG+GE    FLHD++  W  + +WARD       NLYG HPFY+++ + G A G +  NSNA + VLQP PA+T+RTIGGILD ++F G  P + VSQY E+IG P +P +W+LG+HL ++GY S       +    N  IP + QW+DIDYMD+  DFT D  ++      V  L+ +    Y++++DPGIS   P G Y  +DEGL+  +FIKDA  K  LI  VWPG T +PDF+      +W   +Q+FH++VP DGLWIDMNEPSNF DGS  GC  +N  + P + P +  G L  KT+C+++      MHYNLH+LYG  EA A+ SAL   +  KRPF++SRSTF   G Y+ HW GDN + W  L  SI  +L FN+ GIP+ GADICGF+ +  EELC+RW QLGAFYPF RNHNSI  K QDP ++S  A+  MK+++++RY   P  YTL   ++ +G +V RP+ F+F  D +T+ I++QF+ G S+LV PV+  G   VV YFPAG+WYD      ++S   G+ + L APL++ N+ LR G ++I +   N T +  + + ++L+  LS   +A GDL+WDDGES+D++   ++SY  F+   +++
Sbjct:  113 CSAISEPWRFDCYPERGVVVTKDMCEARNCCFIPASSSSNAGQSRKN-GVPWCFYPPDFPSYSLVSTDDTLMGQKGTLVKEVKTYYPGDILTVEVETRQETDTRLHVRMTDPSNPRFEVPISV--PNPTKKAENPAYIVELSKQPFGITVKRRSTGVLLLNTTVAPLFYADQFLQFSTVLPTQFIYGLGEHRSTFLHDMN--WNTLTMWARDVPPMEKTNLYGVHPFYLAMEEDGNAHGFFLLNSNAMDVVLQPTPALTWRTIGGILDFYVFLGPDPGSVVSQYLEVIGNPAMPIYWALGYHLCRWGYNSSNSTWEVVKSLRNYGIPQDTQWNDIDYMDQSMDFTYDSKKFETLPDLVRDLH-AHNQTYVIMLDPGISSTQPEGSYWPFDEGLKRGVFIKDAEGKT-LIGKVWPGLTAYPDFSDEVTHDWWFDNLQKFHNKVPFDGLWIDMNEPSNFLDGSTNGCP-SNSLENPPYTPGVLGGLLRAKTVCATA-QQKLSMHYNLHSLYGLMEAKASASALKKLL-TKRPFVISRSTFPSQGLYSGHWLGDNRSQWKDLYTSIAGILTFNLLGIPLVGADICGFSEEPQEELCVRWTQLGAFYPFTRNHNSIDMKPQDPTAFSPLARTAMKEALLLRYSLFPFLYTLFHHAHAHGHSVARPVMFEFPKDVKTYGIDKQFLWGRSLLVTPVLDPGVDYVVGYFPAGLWYDFYTGDSLHS--KGEEVRLQAPLDKINLHLREG-SVIPTQTPNLTLWISTGQPLHLISALSDEGSAHGDLFWDDGESIDTFETNQYSYIVFSVAQNTM 905          
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Medaka
Match: gaa (glucosidase alpha, acid [Source:NCBI gene;Acc:101161640])

HSP 1 Score: 650.203 bits (1676), Expect = 0.000e+0
Identity = 342/806 (42.43%), Postives = 495/806 (61.41%), Query Frame = 2
Query:  170 QCSVPNNNYRLDCFPGSNANQNDCLARGCCWSPPETREYSQNNPTIPYCFFPIEYPNYQINSFTPTDRGFKARLTKQQKSFLRKEILNLNFEVIFETNTRLRIRITDPNVQRFEVPIQLGSPDPTPPSNIQYKFTMPTNGS-FGFEVKRNSDGLSLFKT-FGPLLYSDQFIQISSLMSIQHVYGIGEQNRPFLHDLSTQWERIGLWARDNGIDTYNNLYGTHPFYMSLPDSGEAFGVYYFNSNAQEFVLQPAPAITYRTIGGILDIFIFSGGTPETTVSQYTELIGRPMLPPFWSLGFHLSKYGYKSIADVSNTLYRNINISIPIEVQWSDIDYMDKYKDFTSDPIRYPNFGSFVAHLNQSLGIKYIVIIDPGISIQSP-GVYSAYDEGLELNIFIKDANTKKDLISNVWPGETCFPDFTHPNASKYWSHQIQRFHSQVPIDGLWIDMNEPSNFYDGSRTGCALNNPYDYPFFVPTIRDGSLIKKTICSSSLHYNNVMHYNLHNLYGYTEAVATHSALLNTIPNKRPFILSRSTFSGSGKYTFHWTGDNSANWDQLANSIRQVLNFNMFGIPMTGADICGFNGDSNEELCIRWMQLGAFYPFMRNHNSIGAKAQDPASWSQEAQIIMKKSIIIRYVWLPNFYTLLVKSYLYGGTVMRPLSFQFYSDAETHEIERQFMIGSSMLVNPVVVQGARNVVAYFPAGIWYDATDLSVIYSGKTGKWISLNAPLERTNVALRGGHALILSSLVNSTEYS-RKVINLVCILSMNQTAAGDLYWDDGESMDSYSGKKFSYFKFTATSSSVLINP 2575
            +C++ +   R DC      +Q +C  RGCC+SP      S   P  P+CF+P  YP Y++  F+P+  G  A LT+ + S+L KEI  L  EV+ E+   L + I DP  QR+EVP+  G    T        FT+  +   FGF V+R ++G  +  T   PLL++DQ++Q+S+ ++   V G+GE     + DL+  W  + LW RD       NLYG+HPFYM   + G A GV+  NSNA E +LQP PA+T+ + GGILD+++F G  P++ + QY ++IG PM+PP+WSLGFHL ++GY S     +      + + P++VQW+D+DY  + K FT DP+R+ +    V   ++  G+KYI+I+DPGIS  SP   Y  +++G++ ++F+K+A   + LI  VWPG T FPDFT+    ++W   I+ F+S+VP+DGLWIDMNEP++F  GS  GC  +N  + P + P +  G L   T+C S+    +  HYNLHNLYG TEA ATHSAL   I  KRPF+LSRS+F G G+++  WTGD  ++W+QL  SI  VL F++FG+P+ GADICGF G++ EELC+RWMQLGAFYPFMRNHN      Q+P  + Q+AQ  M++++ +RY  LP  YTL   ++    TV RPL  +F SD     I++QF+ G S+L++PV+ QGA  V AY P G WY   +    +S   G++  L APL+  N+ +R GH +       +T  S RK   L+  LS + +A GDL+WDDGES+D++  + +SY  FTA    ++  P
Sbjct:   71 ECTI-DPESRFDCGRDRLLSQGECEDRGCCFSPLP----SPVGP--PWCFYPRWYPGYKMGPFSPSTHGKTASLTRAKPSYLFKEISPLTLEVMEESADCLHLTIKDPFTQRYEVPLPEGVSH-TKADAQDVLFTVEFHSEPFGFIVRRATNGRVIMNTTVAPLLFADQYLQMSTTLASSFVSGLGEHYTSLVLDLN--WTSLTLWNRDMAPHADANLYGSHPFYMVQEEGGLAHGVFLLNSNAIEVILQPTPALTWISTGGILDLYVFMGPDPQSVIRQYLQVIGYPMMPPYWSLGFHLCRWGYTSSNATRSVAQHMHSANFPMDVQWNDLDYAHERKVFTFDPMRFGDLPEMVEEFHER-GMKYILILDPGISSTSPPRTYPPFEDGVKRDVFVKNA-MGEILIGKVWPGPTAFPDFTNVETRQWWEDCIRNFYSEVPVDGLWIDMNEPASFVQGSVEGCP-DNDLERPPYTPRMVGGQLNSGTLCMSAQQKLST-HYNLHNLYGLTEAYATHSAL-KKIQRKRPFVLSRSSFPGIGRFSAVWTGDVQSDWEQLGFSIPAVLQFSLFGVPLVGADICGFGGNTTEELCVRWMQLGAFYPFMRNHNDKPNAPQEPFVFGQKAQAAMRRAVNLRYSLLPFLYTLFHHAHTSAATVARPLFMEFPSDPNCKSIDQQFLWGGSLLISPVLKQGAVKVKAYLPLGTWYSLYNGQAFHS--KGQFFLLPAPLDTINIHVRQGHIIPQQEPALTTAASRRKPFFLIAALSGDGSARGDLFWDDGESLDTFEMQNYSYIIFTAVQFQIVSEP 859          
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Medaka
Match: ENSORLT00000015393.2 (sucrase-isomaltase [Source:NCBI gene;Acc:101164831])

HSP 1 Score: 624.394 bits (1609), Expect = 0.000e+0
Identity = 336/830 (40.48%), Postives = 495/830 (59.64%), Query Frame = 2
Query:  197 RLDCFPGSNANQNDCLARGCCWSPPETREYSQNNPTIPYCFFPIEYPNYQINSFTPTDRGFKARLTKQ-QKSFLRKEILNLNFEVIFETNTRLRIRITDPNVQRFEVP---IQLGSPDPTPPSNIQYKFTMPTNGSFGFEVKRNSDGLSLFKT-FGPLLYSDQFIQISSLMSIQHVYGIGEQ-NRPFLHDLSTQWERIGLWARD---NGIDTYNNLYGTHPFYMSLPD-SGEAFGVYYFNSNAQEFVLQPAPAITYRTIGGILDIFIFSGGTPETTVSQYTELIGRPMLPPFWSLGFHLSKYGYKSIADVSNTLYRNINISIPIEVQWSDIDYMDKYKDFTSDPIRYPNFGSFVAHLNQSLGIKYIVIIDPGISIQS---PGVYSAYDEGLELNIFIKDANTKKDLISNVWPGETCFPDFTHPNASKYWSHQIQRFHSQVPIDGLWIDMNEPSNFYDGSRTGCALNNPYDYPFFVPTIRDGSLIKKTICSSSLH-YNNVMHYNLHNLYGYTEAVATHSALLNTIPNKRPFILSRSTFSGSGKYTFHWTGDNSANWDQLANSIRQVLNFNMFGIPMTGADICGFNGDSNEELCIRWMQLGAFYPFMRNHNSIGAKAQDPASWSQEAQIIM--KKSIIIRYVWLPNFYTLLVKSYLYGGTVMRPLSFQFYSDAETHEIERQFMIGSSMLVNPVVVQGARNVVAYFPAGIWYDATDLSVIYSGKTGKWISLNAPLERTNVALRGGHALILSSLVNSTEYSR-KVINLVCILSMNQTAAGDLYWDDGESMDSYSGKKFSYFKFTATSSSVLINPEILGYSVLPSLN--SIIILG 2629
            R+DCFP + A+Q  C  RGCCWSP +T       P +P+CFF   +     +   P      A L++    S    +I  L+F    +T+ RLR +I D   +RFEVP   I   + +P+ P +   + T   N  FG  V+R  +   LF T F PL+++DQF+Q+S+ +   ++YG+GE  ++ + HD  T W    +++RD   NG    +NLYG +PF++ L D SG +FGV+  NSNA E  LQPAPA+TYRTIGGILD FIF G TPE  V ++ ELIGRP++PP+WSLGF LS++ Y S+++V  T+ RN  + +P ++Q++DIDYM++ KDFT D + + +  +F  +L++  G KYI+I+DP I+         Y +YD G   N ++ +++ K  L+  VWPGET FPD+T  N   +W  +  R + +V  D LWIDMNE +NF  GS  GC++N   +YP + P I D  +  KT+C  +   + N  HY++H+LYGY+  +AT  AL       R  +L+RS+F G GKY+ HW GDN ANW+ +  +I  +L F +FG+P  GADICGF  DS+EELC RWMQ+GAFYPF RNHN+ G K QDPAS+   + ++   K  + IRY  LP  YTL  K++  G TV+RPL  +FYSD++T  ++RQF+ G  +L+ PV+  G  +V  YFP  +WYD      +   KT   + L  P ++  + +RGG  L       +T +SR + + L+  L  N  A G+L+WDDG+S  +    K+ ++ F+   + + ++    GYS   +L   +I +LG
Sbjct:   59 RVDCFPETGASQLTCEQRGCCWSPLDT-------PNVPWCFFSSNHGYTAHSVKHPNPHEITAELSRMPSPSLFGADIQQLSFHAEMQTSNRLRFKIFDAQQKRFEVPHEHINTVTSNPSTPISDALEIT---NEPFGLIVRRKENKKVLFDTTFAPLVFADQFLQLSAKLPSHNIYGLGEHVHQNYRHD--TNWRTWPIFSRDAFPNG--GTHNLYGHYPFFLCLEDNSGNSFGVFLLNSNAMEVTLQPAPAVTYRTIGGILDFFIFFGETPEQVVQEFEELIGRPVIPPYWSLGFQLSRWNYGSLSEVKKTVERNRAVGLPYDIQYTDIDYMEEKKDFTYDKVNFKDLPTFADYLHEK-GQKYILILDPAIATSKLIGDVAYGSYDRGTAKNAWVTESDGKTHLVGEVWPGETVFPDYTSQNCIDWWVDEYDRLYKEVKHDALWIDMNEVANFKQGSSKGCSVNK-LNYPPYTPRILDDLMYSKTLCMDAKQAWGN--HYDVHSLYGYSMVLATEQALQRVFGGNRTLMLTRSSFPGVGKYSGHWLGDNGANWNDIKWAIPGMLEFGLFGVPYIGADICGFFDDSSEELCRRWMQVGAFYPFSRNHNAEGYKPQDPASYGASSLLVATSKHYLSIRYTLLPYLYTLFYKAHTSGDTVVRPLLHEFYSDSDTWAVDRQFLWGKYLLITPVLDPGVESVQGYFPDAVWYDYETRERLGQRKTH--VELFLPADKLGLHIRGGAILPTQEPDVTTTHSRLRPMGLIIALDDNNQATGELFWDDGDSRATVENGKYIHYDFSVVDNVLAMDVTNAGYSDPNNLKFETITVLG 868          

HSP 2 Score: 561.607 bits (1446), Expect = 5.735e-177
Identity = 318/840 (37.86%), Postives = 479/840 (57.02%), Query Frame = 2
Query:  176 SVPNNNYRLDCFPGSNANQNDCLARGCCWSPPETREYSQNNPTIPYCFFPIEYPNYQINSFTPTDRGFKARLTK--QQKSFLRKE---ILNLNFEVIFETNTRLRIRITDPNVQRFEVPIQLGSPDPTPPSNIQYKF--TMPTNGSFGFEVKRNSDGLSLFKTFGP-LLYSDQFIQISSLMSIQHVYGIGE-QNRPFLHDLSTQWERIGLWARDNGIDTYNNLYGTHPFYMSLPDSGEAFGVYYFNSNAQEFVLQPAPAITYRTIGGILDIFIFSGGTPETTVSQYTELIGRPMLPPFWSLGFHLSKYGYKSIADVSNTLYRNINISIPIEVQWSDIDYMDKYKDFTSDPIRYPNFGSFVAHLNQSLGIKYIVIIDPGISIQSPGVYSAYDEGLELNIFIKDANTKKDLI--SNVWPG------------ET---------CFPDFTHPNASKYWSHQIQRFHSQV-PIDGLWIDMNEPSNFYDGSRTG-CALNNPYDYPFFVPTI--RDGSLIKKTICSSSLHY----NNVMHYNLHNLYGYTEAVATHSALLNTIPNKRPFILSRSTFSGSGKYTFHWTGDNSANWDQLANSIRQVLNFNMFGIPMTGADICGFNGDSNEELCIRWMQLGAFYPFMRNHNSIGAKAQDPASWSQEAQIIMKKSIIIRYVWLPNFYTLLVKSYLYGGTVMRPLSFQFYSDAETHEIERQFMIGSSMLVNPVVVQGARNVVAYFPAGIWYDATDLSVIYSGKTGKWISLNAPLERTNVALRGGHALILSSLVNSTEYSRK-VINLVCILSMNQTAAGDLYWDDGESMDSYSGKKFSYFKFTATSSSVLIN 2572
            SV  +  R+DC P  N+N+ +C  RGC W              +P+CF+P +Y  Y + ++  T  G +  + +  + +S  R +   I +L  E+ + T   L+ +I DP+ +RFEVP+ L  P  TP S+   +      T   FG +V R S G +++ +  P  ++S+ FIQIS+ +S + VYG GE ++  F HDL   +   G++A+D       N YG HPFYM L ++G+A GV   NSNA +   QP P++TYRTIGGILD ++  G TPE  V +YT L+GRP+LP +WSLGF L +YGY + +++ N         IP +VQ++DIDYM++  DF  D   +    + V  + ++ G+++I I+DP IS      Y A++ G+  ++FIK      D I    VWP             ET          FPDF     + +W  +IQ F++ V   DGLWIDMNEP++F  G+  G C   N  ++P ++P +  ++  L  KT+C +S         V HY++HNLYG++    T+ ALL+ +  KR  +++RST+  SGK+  HW GDN+++WDQL  SI  ++ F++FGIP TGADICGF  +++ E+C+RWMQLGAFYP+ RNHN  G   QDP +W      I K  + IRY  LP  YTL+ +++  G TV+RP+  +F +D  T +I RQF+ G ++L++P +  G   V  Y P   WYD      +  G  GKW+++  PLER N+ +RGG+ L      ++T+ SRK  + L+  LS + TA G  +WDDGE +D+   KK+ +  F +T+S+ L N
Sbjct:  925 SVTLDYQRVDCHPEENSNEAECKKRGCLWEVSAAE-------NVPWCFYPDDY-GYNVLNYAETTTGIRVDINRNTRYRSSGRPDSPDIDSLRVEINYHTGDMLQFKIWDPSTERFEVPVPLTVPS-TPESDEDKRLYRVSVTESPFGIQVVRKSTGTTVWDSSMPGFIFSNMFIQISTKLSSKFVYGFGETEHTSFKHDLD--YHTWGMFAKDQPPGYKMNCYGVHPFYMGLENTGDAHGVLLLNSNAMDVTFQPTPSLTYRTIGGILDFYMVLGPTPEMVVQEYTSLVGRPVLPAYWSLGFQLCRYGYANDSEIENLYTDMKKAGIPYDVQYADIDYMERQLDFVLDS-EFQGLPALVDQM-RAEGMRFIFILDPAISGNETN-YPAFERGVAQDVFIKWPKELGDGIVWGKVWPDFPNVTVDEDLDWETQVQIYRSYAAFPDFFRSQTAAWWHQEIQDFYTNVMKFDGLWIDMNEPASFVHGTVGGTCLGENLLEFPPYMPPLESKEEGLKHKTLCMNSEQILSDGKRVKHYDVHNLYGWSHTKPTYDALLD-VTGKRGIVVTRSTYPSSGKWAGHWLGDNNSSWDQLYKSIIGMMEFSLFGIPYTGADICGFFNEADYEMCLRWMQLGAFYPYSRNHNGKGNPRQDPVAWDDRFATISKDVLNIRYTLLPYLYTLMFEAHTQGSTVVRPVLHEFTNDKTTWDIHRQFLWGPALLISPALDAGQTVVNGYLPVARWYDYHSAQDV--GVRGKWLTMQTPLERINLHVRGGYILPWQKPESNTKLSRKNPLGLIVALSDSGTAEGSFFWDDGEGIDTVEQKKYLHATF-STASNTLTN 1746          
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Medaka
Match: ENSORLT00000015395.2 (sucrase-isomaltase [Source:NCBI gene;Acc:101164831])

HSP 1 Score: 624.394 bits (1609), Expect = 0.000e+0
Identity = 336/830 (40.48%), Postives = 495/830 (59.64%), Query Frame = 2
Query:  197 RLDCFPGSNANQNDCLARGCCWSPPETREYSQNNPTIPYCFFPIEYPNYQINSFTPTDRGFKARLTKQ-QKSFLRKEILNLNFEVIFETNTRLRIRITDPNVQRFEVP---IQLGSPDPTPPSNIQYKFTMPTNGSFGFEVKRNSDGLSLFKT-FGPLLYSDQFIQISSLMSIQHVYGIGEQ-NRPFLHDLSTQWERIGLWARD---NGIDTYNNLYGTHPFYMSLPD-SGEAFGVYYFNSNAQEFVLQPAPAITYRTIGGILDIFIFSGGTPETTVSQYTELIGRPMLPPFWSLGFHLSKYGYKSIADVSNTLYRNINISIPIEVQWSDIDYMDKYKDFTSDPIRYPNFGSFVAHLNQSLGIKYIVIIDPGISIQS---PGVYSAYDEGLELNIFIKDANTKKDLISNVWPGETCFPDFTHPNASKYWSHQIQRFHSQVPIDGLWIDMNEPSNFYDGSRTGCALNNPYDYPFFVPTIRDGSLIKKTICSSSLH-YNNVMHYNLHNLYGYTEAVATHSALLNTIPNKRPFILSRSTFSGSGKYTFHWTGDNSANWDQLANSIRQVLNFNMFGIPMTGADICGFNGDSNEELCIRWMQLGAFYPFMRNHNSIGAKAQDPASWSQEAQIIM--KKSIIIRYVWLPNFYTLLVKSYLYGGTVMRPLSFQFYSDAETHEIERQFMIGSSMLVNPVVVQGARNVVAYFPAGIWYDATDLSVIYSGKTGKWISLNAPLERTNVALRGGHALILSSLVNSTEYSR-KVINLVCILSMNQTAAGDLYWDDGESMDSYSGKKFSYFKFTATSSSVLINPEILGYSVLPSLN--SIIILG 2629
            R+DCFP + A+Q  C  RGCCWSP +T       P +P+CFF   +     +   P      A L++    S    +I  L+F    +T+ RLR +I D   +RFEVP   I   + +P+ P +   + T   N  FG  V+R  +   LF T F PL+++DQF+Q+S+ +   ++YG+GE  ++ + HD  T W    +++RD   NG    +NLYG +PF++ L D SG +FGV+  NSNA E  LQPAPA+TYRTIGGILD FIF G TPE  V ++ ELIGRP++PP+WSLGF LS++ Y S+++V  T+ RN  + +P ++Q++DIDYM++ KDFT D + + +  +F  +L++  G KYI+I+DP I+         Y +YD G   N ++ +++ K  L+  VWPGET FPD+T  N   +W  +  R + +V  D LWIDMNE +NF  GS  GC++N   +YP + P I D  +  KT+C  +   + N  HY++H+LYGY+  +AT  AL       R  +L+RS+F G GKY+ HW GDN ANW+ +  +I  +L F +FG+P  GADICGF  DS+EELC RWMQ+GAFYPF RNHN+ G K QDPAS+   + ++   K  + IRY  LP  YTL  K++  G TV+RPL  +FYSD++T  ++RQF+ G  +L+ PV+  G  +V  YFP  +WYD      +   KT   + L  P ++  + +RGG  L       +T +SR + + L+  L  N  A G+L+WDDG+S  +    K+ ++ F+   + + ++    GYS   +L   +I +LG
Sbjct:   59 RVDCFPETGASQLTCEQRGCCWSPLDT-------PNVPWCFFSSNHGYTAHSVKHPNPHEITAELSRMPSPSLFGADIQQLSFHAEMQTSNRLRFKIFDAQQKRFEVPHEHINTVTSNPSTPISDALEIT---NEPFGLIVRRKENKKVLFDTTFAPLVFADQFLQLSAKLPSHNIYGLGEHVHQNYRHD--TNWRTWPIFSRDAFPNG--GTHNLYGHYPFFLCLEDNSGNSFGVFLLNSNAMEVTLQPAPAVTYRTIGGILDFFIFFGETPEQVVQEFEELIGRPVIPPYWSLGFQLSRWNYGSLSEVKKTVERNRAVGLPYDIQYTDIDYMEEKKDFTYDKVNFKDLPTFADYLHEK-GQKYILILDPAIATSKLIGDVAYGSYDRGTAKNAWVTESDGKTHLVGEVWPGETVFPDYTSQNCIDWWVDEYDRLYKEVKHDALWIDMNEVANFKQGSSKGCSVNK-LNYPPYTPRILDDLMYSKTLCMDAKQAWGN--HYDVHSLYGYSMVLATEQALQRVFGGNRTLMLTRSSFPGVGKYSGHWLGDNGANWNDIKWAIPGMLEFGLFGVPYIGADICGFFDDSSEELCRRWMQVGAFYPFSRNHNAEGYKPQDPASYGASSLLVATSKHYLSIRYTLLPYLYTLFYKAHTSGDTVVRPLLHEFYSDSDTWAVDRQFLWGKYLLITPVLDPGVESVQGYFPDAVWYDYETRERLGQRKTH--VELFLPADKLGLHIRGGAILPTQEPDVTTTHSRLRPMGLIIALDDNNQATGELFWDDGDSRATVENGKYIHYDFSVVDNVLAMDVTNAGYSDPNNLKFETITVLG 868          

HSP 2 Score: 561.607 bits (1446), Expect = 4.087e-177
Identity = 318/840 (37.86%), Postives = 479/840 (57.02%), Query Frame = 2
Query:  176 SVPNNNYRLDCFPGSNANQNDCLARGCCWSPPETREYSQNNPTIPYCFFPIEYPNYQINSFTPTDRGFKARLTK--QQKSFLRKE---ILNLNFEVIFETNTRLRIRITDPNVQRFEVPIQLGSPDPTPPSNIQYKF--TMPTNGSFGFEVKRNSDGLSLFKTFGP-LLYSDQFIQISSLMSIQHVYGIGE-QNRPFLHDLSTQWERIGLWARDNGIDTYNNLYGTHPFYMSLPDSGEAFGVYYFNSNAQEFVLQPAPAITYRTIGGILDIFIFSGGTPETTVSQYTELIGRPMLPPFWSLGFHLSKYGYKSIADVSNTLYRNINISIPIEVQWSDIDYMDKYKDFTSDPIRYPNFGSFVAHLNQSLGIKYIVIIDPGISIQSPGVYSAYDEGLELNIFIKDANTKKDLI--SNVWPG------------ET---------CFPDFTHPNASKYWSHQIQRFHSQV-PIDGLWIDMNEPSNFYDGSRTG-CALNNPYDYPFFVPTI--RDGSLIKKTICSSSLHY----NNVMHYNLHNLYGYTEAVATHSALLNTIPNKRPFILSRSTFSGSGKYTFHWTGDNSANWDQLANSIRQVLNFNMFGIPMTGADICGFNGDSNEELCIRWMQLGAFYPFMRNHNSIGAKAQDPASWSQEAQIIMKKSIIIRYVWLPNFYTLLVKSYLYGGTVMRPLSFQFYSDAETHEIERQFMIGSSMLVNPVVVQGARNVVAYFPAGIWYDATDLSVIYSGKTGKWISLNAPLERTNVALRGGHALILSSLVNSTEYSRK-VINLVCILSMNQTAAGDLYWDDGESMDSYSGKKFSYFKFTATSSSVLIN 2572
            SV  +  R+DC P  N+N+ +C  RGC W              +P+CF+P +Y  Y + ++  T  G +  + +  + +S  R +   I +L  E+ + T   L+ +I DP+ +RFEVP+ L  P  TP S+   +      T   FG +V R S G +++ +  P  ++S+ FIQIS+ +S + VYG GE ++  F HDL   +   G++A+D       N YG HPFYM L ++G+A GV   NSNA +   QP P++TYRTIGGILD ++  G TPE  V +YT L+GRP+LP +WSLGF L +YGY + +++ N         IP +VQ++DIDYM++  DF  D   +    + V  + ++ G+++I I+DP IS      Y A++ G+  ++FIK      D I    VWP             ET          FPDF     + +W  +IQ F++ V   DGLWIDMNEP++F  G+  G C   N  ++P ++P +  ++  L  KT+C +S         V HY++HNLYG++    T+ ALL+ +  KR  +++RST+  SGK+  HW GDN+++WDQL  SI  ++ F++FGIP TGADICGF  +++ E+C+RWMQLGAFYP+ RNHN  G   QDP +W      I K  + IRY  LP  YTL+ +++  G TV+RP+  +F +D  T +I RQF+ G ++L++P +  G   V  Y P   WYD      +  G  GKW+++  PLER N+ +RGG+ L      ++T+ SRK  + L+  LS + TA G  +WDDGE +D+   KK+ +  F +T+S+ L N
Sbjct:  925 SVTLDYQRVDCHPEENSNEAECKKRGCLWEVSAAE-------NVPWCFYPDDY-GYNVLNYAETTTGIRVDINRNTRYRSSGRPDSPDIDSLRVEINYHTGDMLQFKIWDPSTERFEVPVPLTVPS-TPESDEDKRLYRVSVTESPFGIQVVRKSTGTTVWDSSMPGFIFSNMFIQISTKLSSKFVYGFGETEHTSFKHDLD--YHTWGMFAKDQPPGYKMNCYGVHPFYMGLENTGDAHGVLLLNSNAMDVTFQPTPSLTYRTIGGILDFYMVLGPTPEMVVQEYTSLVGRPVLPAYWSLGFQLCRYGYANDSEIENLYTDMKKAGIPYDVQYADIDYMERQLDFVLDS-EFQGLPALVDQM-RAEGMRFIFILDPAISGNETN-YPAFERGVAQDVFIKWPKELGDGIVWGKVWPDFPNVTVDEDLDWETQVQIYRSYAAFPDFFRSQTAAWWHQEIQDFYTNVMKFDGLWIDMNEPASFVHGTVGGTCLGENLLEFPPYMPPLESKEEGLKHKTLCMNSEQILSDGKRVKHYDVHNLYGWSHTKPTYDALLD-VTGKRGIVVTRSTYPSSGKWAGHWLGDNNSSWDQLYKSIIGMMEFSLFGIPYTGADICGFFNEADYEMCLRWMQLGAFYPYSRNHNGKGNPRQDPVAWDDRFATISKDVLNIRYTLLPYLYTLMFEAHTQGSTVVRPVLHEFTNDKTTWDIHRQFLWGPALLISPALDAGQTVVNGYLPVARWYDYHSAQDV--GVRGKWLTMQTPLERINLHVRGGYILPWQKPESNTKLSRKNPLGLIVALSDSGTAEGSFFWDDGEGIDTVEQKKYLHATF-STASNTLTN 1746          
BLAST of Lysosomal alpha-glucosidase vs. Planmine SMEST
Match: SMESG000005054.1 (SMESG000005054.1)

HSP 1 Score: 1672.91 bits (4331), Expect = 0.000e+0
Identity = 821/881 (93.19%), Postives = 850/881 (96.48%), Query Frame = 2
Query:  122 LLLIISL-NFIIVSNALQCSVPNNNYRLDCFPGSNANQNDCLARGCCWSPPETREYSQNNPTIPYCFFPIEYPNYQINSFTPTDRGFKARLTKQQKSFLRKEILNLNFEVIFETNTRLRIRITDPNVQRFEVPIQLGSPDPTPPSNIQYKFTMPTNGSFGFEVKRNSDGLSLFKTFGPLLYSDQFIQISSLMSIQHVYGIGEQNRPFLHDLSTQWERIGLWARDNGIDTYNNLYGTHPFYMSLPDSGEAFGVYYFNSNAQEFVLQPAPAITYRTIGGILDIFIFSGGTPETTVSQYTELIGRPMLPPFWSLGFHLSKYGYKSIADVSNTLYRNINISIPIEVQWSDIDYMDKYKDFTSDPIRYPNFGSFVAHLNQSLGIKYIVIIDPGISIQSPGVYSAYDEGLELNIFIKDANTKKDLISNVWPGETCFPDFTHPNASKYWSHQIQRFHSQVPIDGLWIDMNEPSNFYDGSRTGCALNNPYDYPFFVPTIRDGSLIKKTICSSSLHYNNVMHYNLHNLYGYTEAVATHSALLNTIPNKRPFILSRSTFSGSGKYTFHWTGDNSANWDQLANSIRQVLNFNMFGIPMTGADICGFNGDSNEELCIRWMQLGAFYPFMRNHNSIGAKAQDPASWSQEAQIIMKKSIIIRYVWLPNFYTLLVKSYLYGGTVMRPLSFQFYSDAETHEIERQFMIGSSMLVNPVVVQGARNVVAYFPAGIWYDATDLSVIYSGKTGKWISLNAPLERTNVALRGGHALILSSLVNSTEYSRKVINLVCILSMNQTAAGDLYWDDGESMDSYSGKKFSYFKFTATSSSVLINPEILGYSVLPSLNSIIILGXXXXXXXXXXXXDKPIQFYKKSNLLDALLGGLFPIGQKLILKWK 2761
            L++I +L NFIIVSNALQCSVPNNNYRLDCFPGSNANQNDCLARGCCWSPPETREYSQNNPTIPYCFFPIEYPNYQINSFTPT RGFKARLTKQQKSFLRKEILNLNFEVIFETNTRLRIRITDPNVQRFEVPIQLGSPDPTPPSN+QYKFTMP NGSFGFEVKRNSDGLSLFKTFGPLLYSDQFIQISSLMSIQHVYGIGEQNRPFLHDLSTQWERIGLWARDN +DTYNNLYGTHPFYMSLPDSGEAFGVYYFNSNAQEFVLQPAPAITYRTIGGILDIFIFSGGTPETTVSQYTELIGRPMLPP+WSLGFHLSKYGYKSIADVSNTLYRNINISIPIEVQWSDIDYMDKYKDFTSDPI+Y NFGSFVA+LN +LGI+YIVIIDPGISIQSPG YS YDEGLE+N++IKDANTKK LI+ VWPGETCFPDFTHPNASKYWS+QIQRFHSQVPIDGLWIDMNEPSNFY GS+TGC  N+PYD P+F P IRD SLIK TIC SSLHYNNVMHYNLHNLYGYTEAVATHSALLNTIPNKRPFILSRSTFSGSGKYTFHWTGDNSANWDQLANSIRQVLNFNMFGIPMTGADICGF GDSNEELCIRWMQLGAFYPFMRNHN++G + QDPA+WS+ AQ IM++SI IRY  LPN YTLLVKS+LYGGTVMRPLSF+FY DAET EIERQFMIGS++LVNPVVVQGARNVVAYFPAGIWYDATDLSVIYSGKTGKWISLNAPLERTNVALRGGHALILSSLVNSTEYSRKVINLVCILSMNQTAAGDLYWDDGESMDSYSGKKFSYFKFTATSSSVLINPEILGYSVLPSLNSIIILGINTSSITTVTINDKPIQFYKKSNLLDALLGGLFPIGQKLILKWK
Sbjct:    2 LIIIYTLFNFIIVSNALQCSVPNNNYRLDCFPGSNANQNDCLARGCCWSPPETREYSQNNPTIPYCFFPIEYPNYQINSFTPTVRGFKARLTKQQKSFLRKEILNLNFEVIFETNTRLRIRITDPNVQRFEVPIQLGSPDPTPPSNVQYKFTMPRNGSFGFEVKRNSDGLSLFKTFGPLLYSDQFIQISSLMSIQHVYGIGEQNRPFLHDLSTQWERIGLWARDNPVDTYNNLYGTHPFYMSLPDSGEAFGVYYFNSNAQEFVLQPAPAITYRTIGGILDIFIFSGGTPETTVSQYTELIGRPMLPPYWSLGFHLSKYGYKSIADVSNTLYRNINISIPIEVQWSDIDYMDKYKDFTSDPIKYANFGSFVAYLNITLGIRYIVIIDPGISIQSPGAYSPYDEGLEMNLYIKDANTKKPLIAKVWPGETCFPDFTHPNASKYWSNQIQRFHSQVPIDGLWIDMNEPSNFYYGSKTGCPGNSPYDQPYFTPLIRDNSLIKSTICLSSLHYNNVMHYNLHNLYGYTEAVATHSALLNTIPNKRPFILSRSTFSGSGKYTFHWTGDNSANWDQLANSIRQVLNFNMFGIPMTGADICGFLGDSNEELCIRWMQLGAFYPFMRNHNTLGVRDQDPAAWSKGAQDIMRQSINIRYALLPNLYTLLVKSHLYGGTVMRPLSFEFYGDAETLEIERQFMIGSAILVNPVVVQGARNVVAYFPAGIWYDATDLSVIYSGKTGKWISLNAPLERTNVALRGGHALILSSLVNSTEYSRKVINLVCILSMNQTAAGDLYWDDGESMDSYSGKKFSYFKFTATSSSVLINPEILGYSVLPSLNSIIILGINTSSITTVTINDKPIQFYKKSNLLDALLGGLFPIGQKLILKWK 882          
BLAST of Lysosomal alpha-glucosidase vs. Planmine SMEST
Match: SMESG000005050.1 (SMESG000005050.1)

HSP 1 Score: 1580.84 bits (4092), Expect = 0.000e+0
Identity = 769/865 (88.90%), Postives = 801/865 (92.60%), Query Frame = 2
Query:  113 MLKLLLIISLNFIIVSNALQCSVPNNNYRLDCFPGSNANQNDCLARGCCWSPPETREYSQNNPTIPYCFFPIEYPNYQINSFTPTDRGFKARLTKQQKSFLRKEILNLNFEVIFETNTRLRIRITDPNVQRFEVPIQLGSPDPTPPSNIQYKFTMPTNGSFGFEVKRNSDGLSLFKTFGPLLYSDQFIQISSLMSIQHVYGIGEQNRPFLHDLSTQWERIGLWARDNGIDTYNNLYGTHPFYMSLPDSGEAFGVYYFNSNAQEFVLQPAPAITYRTIGGILDIFIFSGGTPETTVSQYTELIGRPMLPPFWSLGFHLSKYGYKSIADVSNTLYRNINISIPIEVQWSDIDYMDKYKDFTSDPIRYPNFGSFVAHLNQSLGIKYIVIIDPGISIQSPGVYSAYDEGLELNIFIKDANTKKDLISNVWPGETCFPDFTHPNASKYWSHQIQRFHSQVPIDGLWIDMNEPSNFYDGSRTGCALNNPYDYPFFVPTIRDGSLIKKTICSSSLHYNNVMHYNLHNLYGYTEAVATHSALLNTIPNKRPFILSRSTFSGSGKYTFHWTGDNSANWDQLANSIRQVLNFNMFGIPMTGADICGFNGDSNEELCIRWMQLGAFYPFMRNHNSIGAKAQDPASWSQEAQIIMKKSIIIRYVWLPNFYTLLVKSYLYGGTVMRPLSFQFYSDAETHEIERQFMIGSSMLVNPVVVQGARNVVAYFPAGIWYDATDLSVIYSGKTGKWISLNAPLERTNVALRGGHALI-LSSLVNSTEYSRKVINLVCILSMNQTAAGDLYWDDGESMDSYSGKKFSYFKFTATSSSVLINPEILGYSVLPSLNSIIILGXXXXXXXXXXXXDKPIQFYKKSNLL 2704
            MLKLLLIISLNFIIVSNALQCSVPNNNYRLDCFPGSNANQNDCLARGCCWSPPETREYSQNNPTIPYCFFPIEYPNYQINSFTPTDRGFKARLTKQQKSFLRKEILNLNFEVIFETNTRLRIRITDPNVQRFEVPIQLGSPDPTPPSNIQYKFTMPTNGSFGFEVKRNSDGLSLFKTFGPLLYSDQFIQISSLMSIQHVYGIGEQNRPFLHDLSTQWERIGLWARDNGIDTYNNLYGTHPFYMSLPDSGEAFGVYYFNSNAQEFVLQPAPAITYRTIGGILDIFIFSGGTPETTVSQYTELIGRPMLPPFWSLGFHLSKYGYKSIADVSNTLYRNINISIPIEVQWSDIDYMDKYKDFT DPI Y    SFV +LNQSLGI+YIVIIDPGISIQSPG YSAYDEGLE+NIFIKDANTKK LI  VWPGETC+PDFTHPNASKYWSHQIQRFHSQVPIDGLWIDMNEPSNFYDGSRTGCALNNPYDYPFFVPTIRDGSLIKKTICSSSLHYNNVMHYNLHNLYGYTEAVATHSALLNTIPNKRPFILSRSTFSGSGKYTFHWTGDNSANWDQLANSIRQVLNFNMFGIPMTGADICGFNGDSNEELCIRWMQLGAFYPFMRNHNSIGAKAQDPASWSQEAQIIMKKSIIIRYVWLPNFYTLLVKSYLYGGTVMRPLSFQFYSDAETHEIERQFMIGSSMLVNPVVVQGARNVVAYFPAG+WYD     V++SG  GKWISL+AP+++ N A+RGG  L  L   + +T        L C LS+N+TA+G+LYWDDGES DSYSG K+SY  FTA S  + + P+ +G+  +P L SI ++G+   SIT V++N K + F   +N L
Sbjct:    1 MLKLLLIISLNFIIVSNALQCSVPNNNYRLDCFPGSNANQNDCLARGCCWSPPETREYSQNNPTIPYCFFPIEYPNYQINSFTPTDRGFKARLTKQQKSFLRKEILNLNFEVIFETNTRLRIRITDPNVQRFEVPIQLGSPDPTPPSNIQYKFTMPTNGSFGFEVKRNSDGLSLFKTFGPLLYSDQFIQISSLMSIQHVYGIGEQNRPFLHDLSTQWERIGLWARDNGIDTYNNLYGTHPFYMSLPDSGEAFGVYYFNSNAQEFVLQPAPAITYRTIGGILDIFIFSGGTPETTVSQYTELIGRPMLPPFWSLGFHLSKYGYKSIADVSNTLYRNINISIPIEVQWSDIDYMDKYKDFTLDPINYSKLSSFVKYLNQSLGIRYIVIIDPGISIQSPGAYSAYDEGLEMNIFIKDANTKKPLIGQVWPGETCYPDFTHPNASKYWSHQIQRFHSQVPIDGLWIDMNEPSNFYDGSRTGCALNNPYDYPFFVPTIRDGSLIKKTICSSSLHYNNVMHYNLHNLYGYTEAVATHSALLNTIPNKRPFILSRSTFSGSGKYTFHWTGDNSANWDQLANSIRQVLNFNMFGIPMTGADICGFNGDSNEELCIRWMQLGAFYPFMRNHNSIGAKAQDPASWSQEAQIIMKKSIIIRYVWLPNFYTLLVKSYLYGGTVMRPLSFQFYSDAETHEIERQFMIGSSMLVNPVVVQGARNVVAYFPAGVWYDGYTNQVVHSGPIGKWISLDAPIDKLNYAIRGGSILTGLFPAMTTTSSRNGPCFLYCALSLNRTASGELYWDDGESFDSYSGNKYSYITFTADSRGLRVTPQFVGFRSIPLLASISVVGLENLSITKVSLNGKEVPFIVLNNCL 865          
BLAST of Lysosomal alpha-glucosidase vs. Planmine SMEST
Match: SMESG000005053.1 (SMESG000005053.1)

HSP 1 Score: 1524.22 bits (3945), Expect = 0.000e+0
Identity = 738/865 (85.32%), Postives = 787/865 (90.98%), Query Frame = 2
Query:  113 MLKLLLIISLNFIIVSNALQCSVPNNNYRLDCFPGSNANQNDCLARGCCWSPPETREYSQNNPTIPYCFFPIEYPNYQINSFTPTDRGFKARLTKQQKSFLRKEILNLNFEVIFETNTRLRIRITDPNVQRFEVPIQLGSPDPTPPSNIQYKFTMPTNGSFGFEVKRNSDGLSLFKTFGPLLYSDQFIQISSLMSIQHVYGIGEQNRPFLHDLSTQWERIGLWARDNGIDTYNNLYGTHPFYMSLPDSGEAFGVYYFNSNAQEFVLQPAPAITYRTIGGILDIFIFSGGTPETTVSQYTELIGRPMLPPFWSLGFHLSKYGYKSIADVSNTLYRNINISIPIEVQWSDIDYMDKYKDFTSDPIRYPNFGSFVAHLNQSLGIKYIVIIDPGISIQSPGVYSAYDEGLELNIFIKDANTKKDLISNVWPGETCFPDFTHPNASKYWSHQIQRFHSQVPIDGLWIDMNEPSNFYDGSRTGCALNNPYDYPFFVPTIRDGSLIKKTICSSSLHYNNVMHYNLHNLYGYTEAVATHSALLNTIPNKRPFILSRSTFSGSGKYTFHWTGDNSANWDQLANSIRQVLNFNMFGIPMTGADICGFNGDSNEELCIRWMQLGAFYPFMRNHNSIGAKAQDPASWSQEAQIIMKKSIIIRYVWLPNFYTLLVKSYLYGGTVMRPLSFQFYSDAETHEIERQFMIGSSMLVNPVVVQGARNVVAYFPAGIWYDATDLSVIYSGKTGKWISLNAPLERTNVALRGGHALI-LSSLVNSTEYSRKVINLVCILSMNQTAAGDLYWDDGESMDSYSGKKFSYFKFTATSSSVLINPEILGYSVLPSLNSIIILGXXXXXXXXXXXXDKPIQFYKKSNLL 2704
            MLK+LL+IS+N +IVSNALQCSV NNNYRLDCFPG+N+NQNDCLARGCCWSPPETREYSQNNPTIPYCFFPIEYPNYQINSFTPTDRGFKARLTKQQKSFLRKEILNLNFEVIFETNTRLRIRITDPNVQRFEVPIQLGSPDPTPPSNIQYKFTMPTNGSFGFEVKRNSDGLSLFKTFGPLLYSDQFIQISSLMSIQHVYGIGEQNRPFLHDLSTQWERIGLW+RD GIDTYNNLYGTHPFYMSLPDSGEAFGVYYFNSNAQEFVLQPAPAITYRTIGGILDIFIFSGGTPETTVSQYTELIGRPMLPPFWSLGFHLSKYG  +IADVSNTLYRNINISIPIEVQWSDIDYMDKYKDFTSDPIRYPNFGSFVAHLNQSLGIKYIVIIDPGISIQSPGVYSAYDEGLELNIFIKDANTKKDLISNVWPGETCFPDFTHPNASKYWSHQIQRFHSQVPIDGLWIDMNEP++FY GS  GC  NNPYDYPFFVPTIRD SLI KTICSSSLHYNNVMHYNLHNLYGYTEAVATHSALLNTIPNKRPFILSRSTFSGSGKYTFHWTGDN ++WDQLANSIRQ+LNFNMFG+PM G DICGFN + NEELCIRWMQLGAFYPFMRNHN+ G + QDPASWS+EAQ IM+KSI +RYVWLPNFYTLLVKSYLYGGTVMRPLSFQFY D ET EIERQFMIGSSMLVNPVVVQGARNVVAYFP+G+WYD     V++SG  GKWISL+AP+++ N A+RGG  L  L   + +T        L C LS+N+TA+G+LYWDDGES DSYSG K+SY  FTA S  + + P+ +G+  +P L SI ++G+   SIT V++N K + F   +N L
Sbjct:    1 MLKVLLLISINLVIVSNALQCSVLNNNYRLDCFPGTNSNQNDCLARGCCWSPPETREYSQNNPTIPYCFFPIEYPNYQINSFTPTDRGFKARLTKQQKSFLRKEILNLNFEVIFETNTRLRIRITDPNVQRFEVPIQLGSPDPTPPSNIQYKFTMPTNGSFGFEVKRNSDGLSLFKTFGPLLYSDQFIQISSLMSIQHVYGIGEQNRPFLHDLSTQWERIGLWSRDYGIDTYNNLYGTHPFYMSLPDSGEAFGVYYFNSNAQEFVLQPAPAITYRTIGGILDIFIFSGGTPETTVSQYTELIGRPMLPPFWSLGFHLSKYGQNNIADVSNTLYRNINISIPIEVQWSDIDYMDKYKDFTSDPIRYPNFGSFVAHLNQSLGIKYIVIIDPGISIQSPGVYSAYDEGLELNIFIKDANTKKDLISNVWPGETCFPDFTHPNASKYWSHQIQRFHSQVPIDGLWIDMNEPASFYYGSHIGCPGNNPYDYPFFVPTIRDSSLITKTICSSSLHYNNVMHYNLHNLYGYTEAVATHSALLNTIPNKRPFILSRSTFSGSGKYTFHWTGDNWSHWDQLANSIRQLLNFNMFGMPMVGEDICGFNDNCNEELCIRWMQLGAFYPFMRNHNTYGVRDQDPASWSKEAQNIMRKSINLRYVWLPNFYTLLVKSYLYGGTVMRPLSFQFYDDVETREIERQFMIGSSMLVNPVVVQGARNVVAYFPSGVWYDGYTNQVVHSGPIGKWISLDAPIDKLNYAIRGGSILTGLFPAMTTTSSRNGPCFLYCALSLNRTASGELYWDDGESFDSYSGNKYSYITFTADSRGLKVTPQFVGFRSIPLLASISVVGLENLSITKVSLNGKEVPFIVLNNCL 865          
BLAST of Lysosomal alpha-glucosidase vs. Planmine SMEST
Match: SMESG000005069.1 (SMESG000005069.1)

HSP 1 Score: 1124.77 bits (2908), Expect = 0.000e+0
Identity = 545/875 (62.29%), Postives = 666/875 (76.11%), Query Frame = 2
Query:  155 VSNALQCSVPNNNYRLDCFPGSNANQNDCLARGCCWSPP-ETREYSQNNP-TIPYCFFPIEYPNYQINSFTPTDRGFKARLTKQQKSFLRKEILNLNFEVIFETNTRLRIRITDPNVQRFEVPIQLGSPDPTPPSNIQYKFTMPTNGSFGFEVKRNSDGLSLFKTFGPLLYSDQFIQISSLMSIQHVYGIGEQNRPFLHDLSTQWERIGLWARDNGIDTYNNLYGTHPFYMSLPDSGEAFGVYYFNSNAQEFVLQPAPAITYRTIGGILDIFIFSGGTPETTVSQYTELIGRPMLPPFWSLGFHLSKYGYKSIADVSNTLYRNINISIPIEVQWSDIDYMDKYKDFTSDPIRYPNFGSFVAHLNQSLGIKYIVIIDPGISIQSPGVYSAYDEGLELNIFIKDANTKKDLISNVWPGETCFPDFTHPNASKYWSHQIQRFHSQVPIDGLWIDMNEPSNFYDGSRTGCALNNPYDYPFFVPTIRDGSLIKKTICSSSLHYNNVMHYNLHNLYGYTEAVATHSALLNTIPNKRPFILSRSTFSGSGKYTFHWTGDNSANWDQLANSIRQVLNFNMFGIPMTGADICGFNGDSNEELCIRWMQLGAFYPFMRNHNSIGAKAQDPASWSQEAQIIMKKSIIIRYVWLPNFYTLLVKSYLYGGTVMRPLSFQFYSDAETHEIERQFMIGSSMLVNPVVVQGARNVVAYFPAGIWYDATDLSVIYSGKTGKWISLNAPLERTNVALRGGH--ALILSSLVNSTEYSRKVINLVCILSMNQTAAGDLYWDDGESMDSYSGKKFSYFKFTATSSSVLINPEILGYSVLPSLNSIIILGXXXXXXXXXXXXDKPI--QFYKKSNLLDALLGGL-FPIGQKLILKW 2758
             +N+ QC + NNN RLDC P  NAN+  C ++GCCWS P  +    Q  P +IPYC+FP  YPNY +     ++RG KA+L KQ+ + L +EIL+LN +VI+ET +R+RIRI+D   +RFEVPI+L   DPTPP++  Y   +P++GSF  E+KR SDG SLFKTFGPLLYSDQF+QIS+LMS   VYGIGEQNRPFLH LS  W RIGLWARD GI+T+NNLYGTHPFYM +PD G+AFGV++FNSNAQEF LQPAPAITYR+IGGILDIFIF+G TPE TV QY  LIG+PMLPP+WSLGFHLSK+GYK+I  +S    RNIN   PI  QWSDIDYM+ YKDFT D  ++   G FV  + Q    +++ I+DPGIS  S   YS Y EG+ ++IFIKD++T + ++  VWPGET +PDFTHPN S YW  QIQRF++ VPIDGLWIDMNEPSNFYDGS+ GC  N+ YD PFFVP IRD SLI KTICSS+LHYNN  HYNLHNLYGYTE+V T+ ALL TI  KRPFILSRSTFSGSGKYTFHWTGDN A+WDQL NSIRQVLNFNMFGIPMTGADICGFNG+SNEELCIRWMQLGAFYPFMRNHN+I  + QDPASWS EAQ IMK +I IRY   P+FYT LVKS+LYGGTVM+P+SF+FYSD  TH ++ QFMIGSS++V PVV QGAR V AYFPAGIWYD    S++YS   G  ++L+APL++ N ALRGGH  +LI  S+ N    + K+I L C LS +  A+GD YWDDGE++DSYSGKK++Y KF A  + + I+ E  GY ++P L+ ++ILG+  + +  V+IND+P+  QF  + ++L  L+  +   I   ++L W
Sbjct:   31 AANSPQCLIQNNNERLDCHPEPNANEQSCRSKGCCWSEPMRSSNKLQALPGSIPYCYFPTNYPNYAVKDIEVSNRGIKAKLIKQKFNHLPEEILSLNLDVIYETKSRVRIRISDTENKRFEVPIKLNPADPTPPTDTDYDVIIPSDGSFSIEIKRKSDGRSLFKTFGPLLYSDQFLQISTLMSTDQVYGIGEQNRPFLHQLSNGWTRIGLWARDYGIETFNNLYGTHPFYMGIPDDGKAFGVFHFNSNAQEFSLQPAPAITYRSIGGILDIFIFTGDTPEETVKQYVTLIGKPMLPPYWSLGFHLSKWGYKNIEQLSEIFQRNINAGFPIGTQWSDIDYMENYKDFTVDKEKFNGLGRFVREIKQKYNSRFVAIVDPGISCTSGNEYSPYYEGVFMDIFIKDSHTNQPIVGKVWPGETVYPDFTHPNISMYWYKQIQRFYNDVPIDGLWIDMNEPSNFYDGSKRGCQGNSKYDNPFFVPDIRDQSLISKTICSSALHYNNEKHYNLHNLYGYTESVTTNKALLKTIHGKRPFILSRSTFSGSGKYTFHWTGDNQASWDQLRNSIRQVLNFNMFGIPMTGADICGFNGNSNEELCIRWMQLGAFYPFMRNHNAINQRDQDPASWSIEAQKIMKIAINIRYALFPHFYTSLVKSHLYGGTVMKPMSFEFYSDRNTHGLDLQFMIGSSIMVVPVVDQGARKVNAYFPAGIWYDFQSGSILYSDSKGAQVTLDAPLDKINFALRGGHIVSLISDSMTNPQMSTNKMI-LYCALSEDSQASGDAYWDDGENVDSYSGKKYNYLKFIANGNRLEISVEFKGYELVPVLSKVVILGVKQTGVQNVSINDRPVDYQFDAEKSIL--LISNIDLSIDSHILLSW 902          
BLAST of Lysosomal alpha-glucosidase vs. Planmine SMEST
Match: SMESG000004892.1 (SMESG000004892.1)

HSP 1 Score: 1092.03 bits (2823), Expect = 0.000e+0
Identity = 516/860 (60.00%), Postives = 645/860 (75.00%), Query Frame = 2
Query:  158 SNA-LQCSVPNNNYRLDCFPGSNANQNDCLARGCCWSPP-ETREYSQNNP-TIPYCFFPIEYPNYQINSFTPTDRGFKARLTKQQKSFLRKEILNLNFEVIFETNTRLRIRITDPNVQRFEVPIQLGSPDPTPPSNIQYKFTMPTNGSFGFEVKRNSDGLSLFKTFGPLLYSDQFIQISSLMSIQHVYGIGEQNRPFLHDLSTQWERIGLWARDNGIDTYNNLYGTHPFYMSLPDSGEAFGVYYFNSNAQEFVLQPAPAITYRTIGGILDIFIFSGGTPETTVSQYTELIGRPMLPPFWSLGFHLSKYGYKSIADVSNTLYRNINISIPIEVQWSDIDYMDKYKDFTSDPIRYPNFGSFVAHLNQSLGIKYIVIIDPGISIQSPGVYSAYDEGLELNIFIKDANTKKDLISNVWPGETCFPDFTHPNASKYWSHQIQRFHSQVPIDGLWIDMNEPSNFYDGSRTGCALNNPYDYPFFVPTIRDGSLIKKTICSSSLHYNNVMHYNLHNLYGYTEAVATHSALLNTIPNKRPFILSRSTFSGSGKYTFHWTGDNSANWDQLANSIRQVLNFNMFGIPMTGADICGFNGDSNEELCIRWMQLGAFYPFMRNHNSIGAKAQDPASWSQEAQIIMKKSIIIRYVWLPNFYTLLVKSYLYGGTVMRPLSFQFYSDAETHEIERQFMIGSSMLVNPVVVQGARNVVAYFPAGIWYDATDLSVIYSGKTGKWISLNAPLERTNVALRGGHAL-ILSSLVNSTEYSRKVINLVCILSMNQTAAGDLYWDDGESMDSYSGKKFSYFKFTATSSSVLINPEILGYSVLPSLNSIIILGXXXXXXXXXXXXDKPIQFYKKSNLLDALLGGL 2725
            SNA  QC + NNN RLDC+P S ANQ+ C++RGCCWS P       Q  P +IPYC++P +Y NY I S   + RG KA+L ++  S+L  E+  L+ EVI+ET +R R+RITDP  +R+EVP++L S D  PP++ +Y+  +P++GSF  E+KR SD  SLFK+FGPLLYSDQF+QISS+MS   +YGIGEQNRPFLH LS  WERIGLWARD+ ++T+ NLYG HPFY+ +P+ G+AFGV++FNSN QEF LQPAPA+TYRTIGG+LD FIF+GG+PE TV QY EL+G+PMLPP+WSLGFHLSKYGYK I ++  TL RN+N  I ++VQWSD+DYMD YKDF+ D  +Y NFG FV  +  +   +Y+VIID  IS  +   Y  Y +GLE++IFIK+ +T + +I  VWPG+T FPDFTHP+ +KYWS QI+ FH  VP+DGLWIDMN+PS+F DGS TGC+ NN YD PFFVP IRD SLI KTICSSSLHYN   HYNLHN+YG+ E+V T+  LL   P KRPF+LSRSTFSGSGKY FHWTGDN A+WD L NSIRQVLNFNMFGIPMTGADICGFNG+S+EELCIRWMQLGAFYPFMRNHN+I  + QDPASW+ EAQ IMK +I  RY  LP FYTLLVKS++ GGTVMRP+SF+F+SD  TH IE QFMIGSS++  PVV  GAR+V AYFPAG+WYD     +++S   G W++L+APL++ N+ALRGGH + +L S  NS       + L C ++ + +A+GDLYWDDGES+DSYS  ++SY  F A+   +LI P  LGY +LP LN I+ILG +  SIT   +ND  I F+        +L  L
Sbjct:   19 SNATAQCQIANNNERLDCYPESGANQDSCISRGCCWSEPMRLSNKLQGVPLSIPYCYYPTDYSNYMIKSLRKSSRGIKAKLVRESPSYLPNEVAMLDLEVIYETKSRTRVRITDPKQKRYEVPMKLSSQDLKPPTDREYEVIIPSDGSFSIEIKRKSDDRSLFKSFGPLLYSDQFLQISSIMSTDQIYGIGEQNRPFLHQLSNGWERIGLWARDHPVETFINLYGAHPFYIGMPEDGKAFGVFHFNSNGQEFALQPAPAVTYRTIGGVLDFFIFTGGSPEETVKQYLELVGKPMLPPYWSLGFHLSKYGYKDIKEIHETLQRNVNSGISVDVQWSDVDYMDGYKDFSVDNQKYQNFGEFVKQIRDTYNTRYVVIIDSAIS--NSENYIPYTDGLEMDIFIKNPDTNEPIIGEVWPGKTVFPDFTHPDITKYWSKQIRAFHDMVPVDGLWIDMNDPSSFVDGSTTGCSNNNRYDRPFFVPEIRDQSLIAKTICSSSLHYNKEKHYNLHNIYGFKESVVTNDVLLQMFPKKRPFLLSRSTFSGSGKYAFHWTGDNQASWDHLRNSIRQVLNFNMFGIPMTGADICGFNGNSDEELCIRWMQLGAFYPFMRNHNAINQRDQDPASWNTEAQKIMKTAISNRYAMLPLFYTLLVKSHMNGGTVMRPMSFEFFSDKVTHSIELQFMIGSSIMATPVVYPGARSVDAYFPAGVWYDFHSGKLLHSDAEGAWLTLDAPLDKINIALRGGHIVPLLDSNRNSKSNIPNKMTLYCGMAQDMSASGDLYWDDGESIDSYSRNRYSYVSFNASPEQLLITPVYLGYDLLPVLNKIVILGFDNKSITKFVLNDNDIPFHYNPETSSVVLSSL 876          
The following BLAST results are available for this feature:
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GAA0.000e+042.32glucosidase alpha, acid [Source:HGNC Symbol;Acc:HG... [more]
GAA0.000e+042.32glucosidase alpha, acid [Source:HGNC Symbol;Acc:HG... [more]
MGAM9.178e-17441.14maltase-glucoamylase [Source:HGNC Symbol;Acc:HGNC:... [more]
MGAM1.978e-17441.14maltase-glucoamylase [Source:HGNC Symbol;Acc:HGNC:... [more]
MGAM1.978e-17441.14maltase-glucoamylase [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
aagr-13.259e-15635.96Acid Alpha Glucosidase Relate [Source:UniProtKB/T... [more]
aagr-13.259e-15635.96Acid Alpha Glucosidase Relate [Source:UniProtKB/T... [more]
aagr-13.259e-15635.96Acid Alpha Glucosidase Relate [Source:UniProtKB/T... [more]
aagr-22.322e-14635.75Acid Alpha Glucosidase Relate [Source:UniProtKB/T... [more]
aagr-35.248e-7629.91Acid Alpha Glucosidase Relate [Source:UniProtKB/T... [more]
back to top
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GCS2alpha3.441e-7629.95gene:FBgn0027588 transcript:FBtr0070058[more]
GCS2alpha3.441e-7629.95gene:FBgn0027588 transcript:FBtr0070062[more]
GCS2alpha3.441e-7629.95gene:FBgn0027588 transcript:FBtr0070061[more]
GCS2alpha3.441e-7629.95gene:FBgn0027588 transcript:FBtr0070060[more]
GCS2alpha3.441e-7629.95gene:FBgn0027588 transcript:FBtr0070059[more]
back to top
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch73-12o23.10.000e+044.97si:ch73-12o23.1 [Source:ZFIN;Acc:ZDB-GENE-130530-7... [more]
CABZ01079192.12.822e-15235.05sucrase-isomaltase (alpha-glucosidase) [Source:NCB... [more]
GAA2.352e-11040.97glucosidase alpha, acid [Source:HGNC Symbol;Acc:HG... [more]
gaa6.951e-9842.18glucosidase, alpha; acid (Pompe disease, glycogen ... [more]
CABZ01088484.11.328e-8535.43pep chromosome:GRCz11:18:1768804:1791127:1 gene:EN... [more]
back to top
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GAA0.000e+044.74glucosidase, alpha; acid [Source:NCBI gene;Acc:100... [more]
GAA0.000e+044.35glucosidase, alpha; acid [Source:NCBI gene;Acc:100... [more]
GAA0.000e+044.76glucosidase, alpha; acid [Source:NCBI gene;Acc:100... [more]
GAA0.000e+043.43glucosidase, alpha; acid [Source:NCBI gene;Acc:100... [more]
GAA0.000e+044.17glucosidase, alpha; acid [Source:NCBI gene;Acc:100... [more]
back to top
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Gaa0.000e+042.27glucosidase, alpha, acid [Source:MGI Symbol;Acc:MG... [more]
Gaa0.000e+042.27glucosidase, alpha, acid [Source:MGI Symbol;Acc:MG... [more]
Mgam2.000e-17141.38maltase-glucoamylase [Source:MGI Symbol;Acc:MGI:12... [more]
Mgam1.311e-17141.38maltase-glucoamylase [Source:MGI Symbol;Acc:MGI:12... [more]
Mgam2.000e-17141.38maltase-glucoamylase [Source:MGI Symbol;Acc:MGI:12... [more]
back to top
BLAST of Lysosomal alpha-glucosidase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6P7A9|LYAG_RAT0.000e+042.28Lysosomal alpha-glucosidase OS=Rattus norvegicus O... [more]
sp|P70699|LYAG_MOUSE0.000e+042.27Lysosomal alpha-glucosidase OS=Mus musculus OX=100... [more]
sp|P10253|LYAG_HUMAN0.000e+042.32Lysosomal alpha-glucosidase OS=Homo sapiens OX=960... [more]
sp|Q5R7A9|LYAG_PONAB0.000e+041.95Lysosomal alpha-glucosidase OS=Pongo abelii OX=960... [more]
sp|Q9MYM4|LYAG_BOVIN0.000e+042.13Lysosomal alpha-glucosidase OS=Bos taurus OX=9913 ... [more]
back to top
BLAST of Lysosomal alpha-glucosidase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5J4NLU20.000e+044.97Lysosomal alpha-glucosidase OS=Paragonimus westerm... [more]
V8PHZ80.000e+044.43Lysosomal alpha-glucosidase (Fragment) OS=Ophiopha... [more]
A0A1D1VXK30.000e+043.33P-type domain-containing protein OS=Ramazzottius v... [more]
R7V9X30.000e+047.01P-type domain-containing protein OS=Capitella tele... [more]
H2KPA90.000e+044.26Lysosomal alpha-glucosidase OS=Clonorchis sinensis... [more]
back to top
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch73-12o23.10.000e+043.27lysosomal alpha-glucosidase [Source:NCBI gene;Acc:... [more]
gaa0.000e+042.82glucosidase alpha, acid [Source:NCBI gene;Acc:1030... [more]
gaa0.000e+043.06glucosidase alpha, acid [Source:NCBI gene;Acc:1030... [more]
ganab8.065e-6927.59glucosidase, alpha; neutral AB [Source:ZFIN;Acc:ZD... [more]
ENSAMXT00000016120.24.005e-6727.96neutral alpha-glucosidase AB-like [Source:NCBI gen... [more]
back to top
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000005523.18.939e-14936.58pep scaffold:Pmarinus_7.0:GL480123:76219:97698:-1 ... [more]
ENSPMAT00000008911.13.240e-8639.15pep scaffold:Pmarinus_7.0:GL496136:1712:3787:1 gen... [more]
ENSPMAT00000008912.13.614e-8438.42pep scaffold:Pmarinus_7.0:GL496136:2540:3769:1 gen... [more]
ENSPMAT00000008215.13.434e-6126.68pep scaffold:Pmarinus_7.0:GL476974:10756:37747:1 g... [more]
ENSPMAT00000008908.13.135e-4834.71pep scaffold:Pmarinus_7.0:GL496136:110:3787:1 gene... [more]
back to top
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
ROT26.821e-7030.70Glucosidase II catalytic subunit; required to trim... [more]
back to top
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO418110.000e+043.39Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO486322.210e-6130.16Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO457562.034e-725.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch73-12o23.10.000e+043.18lysosomal alpha-glucosidase [Source:NCBI gene;Acc:... [more]
si:ch73-12o23.10.000e+043.18lysosomal alpha-glucosidase [Source:NCBI gene;Acc:... [more]
gaa0.000e+042.43glucosidase alpha, acid [Source:NCBI gene;Acc:1011... [more]
ENSORLT00000015393.25.735e-17740.48sucrase-isomaltase [Source:NCBI gene;Acc:101164831... [more]
ENSORLT00000015395.24.087e-17740.48sucrase-isomaltase [Source:NCBI gene;Acc:101164831... [more]
back to top
BLAST of Lysosomal alpha-glucosidase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000005054.10.000e+093.19SMESG000005054.1[more]
SMESG000005050.10.000e+088.90SMESG000005050.1[more]
SMESG000005053.10.000e+085.32SMESG000005053.1[more]
SMESG000005069.10.000e+062.29SMESG000005069.1[more]
SMESG000004892.10.000e+060.00SMESG000004892.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30028453 ID=SMED30028453|Name=Lysosomal alpha-glucosidase|organism=Schmidtea mediterranea sexual|type=transcript|length=2906bp
AGAATTAGGTAAAGTGCTAAATTTCAAGATGATGGATAGAGAAAATGAAT
GACCAAAGTACAAAATATAAAGATATTTAAGTAATAAAATTGAATTCCGA
ACTTAAATTGAAATGTTGAAGTTATTGTTGATAATCTCCTTGAACTTTAT
AATTGTGTCCAATGCTCTCCAATGTTCAGTACCGAATAACAATTATAGGC
TAGACTGCTTTCCTGGGTCCAATGCAAATCAGAACGATTGTTTGGCTAGA
GGATGTTGTTGGTCACCACCGGAAACCCGGGAATATAGTCAGAATAATCC
GACTATTCCATACTGCTTCTTTCCAATAGAATATCCAAACTACCAAATTA
ATTCATTCACTCCTACCGATCGAGGATTCAAAGCTCGTCTAACAAAACAA
CAAAAATCATTTTTACGGAAGGAAATATTAAATTTGAACTTTGAAGTGAT
CTTTGAGACAAATACTCGATTGAGAATAAGAATCACCGATCCGAATGTGC
AAAGATTTGAAGTTCCGATTCAGCTTGGATCTCCTGATCCGACTCCACCT
TCAAATATTCAATATAAATTCACAATGCCCACAAATGGTTCTTTTGGATT
CGAAGTCAAAAGAAATTCCGACGGATTGAGCTTGTTCAAAACATTTGGTC
CTCTATTGTATTCTGATCAGTTCATACAAATATCTTCTTTGATGTCAATC
CAACACGTTTATGGAATCGGAGAACAGAATCGTCCATTTCTACATGATTT
GTCTACTCAATGGGAAAGAATAGGACTGTGGGCACGCGATAATGGAATAG
ATACATATAATAATTTATATGGTACTCACCCATTCTATATGTCACTGCCT
GATTCTGGAGAAGCGTTTGGAGTTTATTATTTCAATAGCAATGCACAAGA
ATTTGTTTTACAACCGGCTCCAGCGATTACTTACCGAACAATCGGAGGAA
TACTCGATATTTTCATTTTTTCAGGAGGAACACCGGAAACCACCGTTAGT
CAATACACTGAATTAATAGGAAGACCAATGCTTCCTCCGTTTTGGTCTCT
TGGATTCCATCTATCAAAATACGGTTATAAAAGTATTGCAGATGTTTCTA
ACACTCTGTATAGAAATATTAATATAAGCATACCAATAGAGGTCCAGTGG
TCTGACATTGATTACATGGACAAATACAAAGACTTCACATCGGATCCGAT
AAGATACCCTAACTTTGGTTCTTTTGTCGCCCATTTGAATCAATCTTTAG
GAATAAAGTATATTGTTATAATTGATCCTGGAATCAGTATACAAAGTCCC
GGTGTATATTCTGCTTACGATGAAGGACTTGAATTGAATATATTCATTAA
AGATGCGAATACTAAGAAAGATTTGATTTCAAATGTTTGGCCAGGAGAAA
CATGTTTTCCTGACTTTACTCATCCTAATGCTTCAAAGTATTGGTCACAT
CAAATTCAACGATTTCATTCTCAAGTACCAATAGATGGTTTGTGGATTGA
TATGAATGAACCATCAAATTTCTACGATGGATCTAGAACCGGATGCGCTC
TAAATAATCCGTACGACTATCCATTCTTTGTACCGACAATCAGAGATGGT
TCATTAATTAAGAAAACAATATGTTCATCCTCTCTTCATTATAACAATGT
CATGCATTACAACTTGCATAATTTATATGGTTACACCGAGGCAGTAGCCA
CTCATAGTGCTTTATTGAATACCATTCCAAACAAAAGACCATTTATTTTA
TCTCGTTCCACATTCAGCGGATCTGGTAAGTACACCTTTCATTGGACCGG
TGATAATTCGGCAAATTGGGATCAGTTAGCCAATTCAATCAGGCAAGTCC
TCAATTTTAACATGTTTGGTATTCCAATGACGGGTGCGGATATTTGTGGA
TTCAATGGAGATAGTAATGAAGAACTGTGTATAAGATGGATGCAATTAGG
TGCTTTCTATCCATTCATGCGAAATCATAATAGTATTGGCGCTAAAGCCC
AAGATCCAGCTTCATGGAGTCAAGAAGCTCAAATTATTATGAAAAAAAGT
ATTATAATAAGATATGTTTGGTTACCTAACTTTTATACATTATTGGTTAA
ATCATATTTGTACGGTGGCACTGTGATGCGACCATTGAGTTTCCAGTTTT
ACAGTGATGCTGAGACGCATGAAATTGAGAGGCAATTTATGATTGGTTCC
TCGATGCTCGTCAATCCAGTTGTTGTCCAAGGAGCTAGAAATGTTGTAGC
ATATTTCCCAGCTGGGATTTGGTATGATGCAACAGATTTGAGTGTTATTT
ATTCGGGGAAAACTGGAAAATGGATTTCTTTGAATGCACCTCTTGAAAGA
ACTAATGTTGCATTACGTGGAGGACATGCTTTGATTTTATCAAGTTTGGT
AAACAGTACCGAGTATTCAAGAAAGGTCATTAATTTGGTTTGTATATTAT
CAATGAATCAAACAGCTGCGGGAGATTTGTATTGGGATGATGGAGAGAGT
ATGGACAGTTATTCTGGTAAGAAATTCAGTTATTTTAAATTTACTGCAAC
TTCCAGCAGTGTTCTTATCAATCCTGAAATATTAGGATATAGTGTTCTTC
CGTCTTTGAATAGTATTATAATACTCGGAATTAATACCTCCTCAATCACT
ACTGTAACTATAAATGATAAACCAATACAGTTTTATAAAAAATCTAATTT
GTTAGACGCCCTCCTTGGCGGCTTGTTTCCTATTGGTCAGAAATTAATTT
TAAAATGGAAATGACGAGATTCATTATTTAGTGCATAATTATGATTTTAT
ATTTTTTATTTTTTTATTTTTTTAATGAAGATTGATTGATTGATTGACTA
ATCATTAAATTGTGATTTATTGAAATTAAAAATTTGTTCGATTTTTATAA
AAAAAA
back to top

protein sequence of SMED30028453-orf-1

>SMED30028453-orf-1 ID=SMED30028453-orf-1|Name=SMED30028453-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=884bp
MLKLLLIISLNFIIVSNALQCSVPNNNYRLDCFPGSNANQNDCLARGCCW
SPPETREYSQNNPTIPYCFFPIEYPNYQINSFTPTDRGFKARLTKQQKSF
LRKEILNLNFEVIFETNTRLRIRITDPNVQRFEVPIQLGSPDPTPPSNIQ
YKFTMPTNGSFGFEVKRNSDGLSLFKTFGPLLYSDQFIQISSLMSIQHVY
GIGEQNRPFLHDLSTQWERIGLWARDNGIDTYNNLYGTHPFYMSLPDSGE
AFGVYYFNSNAQEFVLQPAPAITYRTIGGILDIFIFSGGTPETTVSQYTE
LIGRPMLPPFWSLGFHLSKYGYKSIADVSNTLYRNINISIPIEVQWSDID
YMDKYKDFTSDPIRYPNFGSFVAHLNQSLGIKYIVIIDPGISIQSPGVYS
AYDEGLELNIFIKDANTKKDLISNVWPGETCFPDFTHPNASKYWSHQIQR
FHSQVPIDGLWIDMNEPSNFYDGSRTGCALNNPYDYPFFVPTIRDGSLIK
KTICSSSLHYNNVMHYNLHNLYGYTEAVATHSALLNTIPNKRPFILSRST
FSGSGKYTFHWTGDNSANWDQLANSIRQVLNFNMFGIPMTGADICGFNGD
SNEELCIRWMQLGAFYPFMRNHNSIGAKAQDPASWSQEAQIIMKKSIIIR
YVWLPNFYTLLVKSYLYGGTVMRPLSFQFYSDAETHEIERQFMIGSSMLV
NPVVVQGARNVVAYFPAGIWYDATDLSVIYSGKTGKWISLNAPLERTNVA
LRGGHALILSSLVNSTEYSRKVINLVCILSMNQTAAGDLYWDDGESMDSY
SGKKFSYFKFTATSSSVLINPEILGYSVLPSLNSIIILGINTSSITTVTI
NDKPIQFYKKSNLLDALLGGLFPIGQKLILKWK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000101muscle cell
PLANA:0000420parapharyngeal region
PLANA:0003001lateral region of the whole animal
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR013780Glyco_hydro_b
IPR000322Glyco_hydro_31
IPR025887Glyco_hydro_31_N_dom
IPR000519P_trefoil_dom
IPR031727Gal_mutarotase_N
IPR030459Glyco_hydro_31_CS
IPR030458Glyco_hydro_31_AS
IPR017853Glycoside_hydrolase_SF
IPR011013Gal_mutarotase_sf_dom
Vocabulary: molecular function
TermDefinition
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0003824catalytic activity
GO:0030246carbohydrate binding
GO:0004558alpha-1,4-glucosidase activity
GO:0016787hydrolase activity
GO:0016798hydrolase activity, acting on glycosyl bonds
GO:0032450maltose alpha-glucosidase activity
Vocabulary: biological process
TermDefinition
GO:0005975carbohydrate metabolic process
GO:0000023maltose metabolic process
GO:0005980glycogen catabolic process
GO:0008152metabolic process
Vocabulary: cellular component
TermDefinition
GO:0005764lysosome
GO:0005765lysosomal membrane
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR025887Glycoside hydrolase family 31, N-terminal domainPFAMPF13802Gal_mutarotas_2coord: 197..261
e-value: 3.9E-9
score: 36.7
NoneNo IPR availableGENE3DG3DSA:3.20.20.80coord: 305..652
e-value: 3.0E-147
score: 492.3
NoneNo IPR availableGENE3DG3DSA:2.60.40.1760coord: 72..303
e-value: 1.1E-67
score: 230.0
NoneNo IPR availableGENE3DG3DSA:4.10.110.10coord: 19..69
e-value: 1.4E-11
score: 45.8
NoneNo IPR availablePANTHERPTHR22762ALPHA-GLUCOSIDASEcoord: 20..715
NoneNo IPR availablePANTHERPTHR22762:SF92LYSOSOMAL ALPHA-GLUCOSIDASEcoord: 20..715
NoneNo IPR availableCDDcd06602GH31_MGAM_SI_GAAcoord: 303..665
e-value: 0.0
score: 606.045
NoneNo IPR availableCDDcd14752GH31_Ncoord: 198..303
e-value: 1.54166E-24
score: 97.2564
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..18
score: 0.87
NoneNo IPR availableSUPERFAMILYSSF57492Trefoilcoord: 17..75
NoneNo IPR availableSUPERFAMILYSSF51011Glycosyl hydrolase domaincoord: 671..715
IPR000519P-type trefoil domainPFAMPF00088Trefoilcoord: 21..71
e-value: 2.7E-9
score: 36.7
IPR000519P-type trefoil domainPROSITEPS51448P_TREFOIL_2coord: 19..72
score: 13.336
IPR000519P-type trefoil domainCDDcd00111Trefoilcoord: 20..71
e-value: 8.26E-9
score: 49.6498
IPR013780Glycosyl hydrolase, all-betaGENE3DG3DSA:2.60.40.1180coord: 653..715
e-value: 8.4E-16
score: 59.9
IPR031727Galactose mutarotase, N-terminal barrelPFAMPF16863NtCtMGAM_Ncoord: 88..194
e-value: 8.3E-25
score: 87.2
IPR000322Glycoside hydrolase family 31PFAMPF01055Glyco_hydro_31coord: 284..715
e-value: 1.4E-138
score: 462.8
IPR030459Glycosyl hydrolases family 31, conserved sitePROSITEPS00707GLYCOSYL_HYDROL_F31_2coord: 591..621
IPR030458Glycosyl hydrolases family 31, active sitePROSITEPS00129GLYCOSYL_HYDROL_F31_1coord: 459..466
IPR011013Galactose mutarotase-like domain superfamilySUPERFAMILYSSF74650Galactose mutarotase-likecoord: 45..291
IPR017853Glycoside hydrolase superfamilySUPERFAMILYSSF51445(Trans)glycosidasescoord: 294..668