High density lipoprotein binding protein (Vigilin)

Overview
NameHigh density lipoprotein binding protein (Vigilin)
Smed IDSMED30028449
Length (bp)4615
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of High density lipoprotein binding protein (Vigilin) (SMED30028449) t-SNE clustered cells

Violin plots show distribution of expression levels for High density lipoprotein binding protein (Vigilin) (SMED30028449) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of High density lipoprotein binding protein (Vigilin) (SMED30028449) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for High density lipoprotein binding protein (Vigilin) (SMED30028449) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30028449

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 24

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30028449SMESG000043196.1 Contig5029GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30028449SMESG000016436.1 Contig5029GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
nervous systemSMED30028449SMESG000016436.1 dd_Smed_v4_553_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30028449SMESG000016436.1 dd_Smed_v4_553_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30028449SMESG000016436.1 dd_Smed_v4_553_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30028449SMESG000016436.1 dd_Smed_v4_553_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30028449SMESG000016436.1 dd_Smed_v4_553_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30028449SMESG000016436.1 dd_Smed_v4_553_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30028449SMESG000016436.1 dd_Smed_v4_553_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30028449SMESG000016436.1 dd_Smed_v4_553_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30028449SMESG000016436.1 dd_Smed_v4_553_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30028449SMESG000016436.1 Contig38058newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30028449SMESG000016436.1 Contig38058uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30028449SMESG000016436.1 Contig14292newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30028449SMESG000016436.1 Contig14292uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30028449SMESG000016436.1 Contig25997newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30028449SMESG000016436.1 Contig47913newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Category 2 cellSMED30028449SMESG000016436.1 dd_Smed_v6_553_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30028449SMESG000016436.1 dd_Smed_v6_553_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 3 cellSMED30028449SMESG000016436.1 dd_Smed_v6_553_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
intestinal phagocyteSMED30028449SMESG000016436.1 dd_Smed_v6_553_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
musculature systemSMED30028449SMESG000016436.1 dd_Smed_v6_553_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
goblet cellSMED30028449SMESG000016436.1 dd_Smed_v6_553_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
secretory systemSMED30028449SMESG000016436.1 dd_Smed_v6_553_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of High density lipoprotein binding protein (Vigilin) vs. Ensembl Human
Match: HDLBP (high density lipoprotein binding protein [Source:HGNC Symbol;Acc:HGNC:4857])

HSP 1 Score: 869.381 bits (2245), Expect = 0.000e+0
Identity = 518/1246 (41.57%), Postives = 774/1246 (62.12%), Query Frame = 3
Query:  243 YDDQFPPLP-------TCNTPKIVQNSKPRIGQTKTSHVTQTLTVPLAERRFSNREANNSVKNDAQKKICQTVAQKCGVSIELNSGNKDQNLMVFISGPQDNVSNAKRILTKEXXXXXXXXMKVPKEYHKFILGRNGASLREIESGSNTNVTIPRSIENNDIITIFGTKEGIDKARAEINQIVAERSKLATERITIPKRFYPFINGSNNSKIYKIREMTNAKXXXXXXXXXXXXXXXXGEKDGVYQALEIIQKIYEDTKKCSSSLNLPIPKSQHCYVIGAKGSGIAEIFERTGVSIEMPSQDSDDDTIVLYGPNEFLAPALSMVIQKSESMIRVNIEAPNWLHRFIIGKQGSNLNKLMEKYEHVFINFPENSDLIVIEGPKDDVNELKGQITHKIAELKSTMAITEIQVDPRFHRHIIGRSGANIQRMQEEYKVQIRMPGNNAVGTSGWTIRIEGDPEGVKLAKTEIESMSVKLENEKTKDVILDHKYHNQLIGAQGSRVKELRNQYPDVIIMFPDLSSKSDIVQLRGPRQQVDQVAVKLNKFIQEVIENNYTKDVKIFKQYHKNIIGKGGVNIRKIREEMNIRIDFPDEHSDSDKIRLTGKKENVEEAAKRIEAMQAELISIKEDTISIPQRLHISLIGTRGKLIKCIQQECGGVQIQFPASDSNSDIIKIRGPESDVDKAXXXXXXXXXXXXXXXHQDSVSAKSEFHKFLIGRKGAQLAEFRKRHAVMLIFPDSEDTNKDTIQIIGAKEAVQKAKEELEVTIKSLENEIEKYITIDTKWHKHFFKKRQAVMEEISREFGGVRIFFPKQDAVENIDQVRVIGPKGCVEAAVVRIEDIIENLEAQTSLSVFIEQKHHRNLITRNMMEIKSIQSNYDVTIKFPNRDLSSKPGENGME--EIHLNGNGDVNIETMEEVDSTLESEQNNPANWVTISGRKENCESAEDALLELVPITEDVPLANEFHRNFIGQKGQGINTFSTKHNVVVNIPPANKCSDFISIKGPRVNIIDAKAGLDELITMWENEKQDRIARNYENHVTVPIVFHRNIIGQRGANIEIFRTKFNVSIQIPDQ---NSKSEEITIRGYEEDVKKAEEELISMVEKWKAQVKEELHIPRDVHPQLIGTRGIALRKLRDQFKVEINFPNRNVDDEKAHLVEVIGDKENVDKCCDILVERANELLNEWEERNQVREVKNLIKDRENINSSSNIKEKGP--GFLLTGAPW----QQRVPDASSNVDFPKIDA 3926
            Y D FPPLP       +   P     +K R    K S +TQ   VPL ER++ +    N      Q KIC  + Q+ G  +EL S  KDQ L + +SG  D V  A++ +   LQTQ    + +PKE+H+F++G+NG  L+++E  + T + IPR  + ++ I I GTKEGI+KAR E+  I AE+ K A ER+ + K F+PFI G  N  + +I + T  +INIPPPSV   EI+ +GEK+ + QA+  I+KIYE+ KK ++++ + + KSQH YVIG KG+ + EI ERTGVS+E+P  DS  +T++L G  E L  AL+ V  K+ S    ++ AP+WLHRFIIGK+G NL K+ ++   V I F E  D I +EGP +DVN  + QI   + +L + M   EI +D +FHRH+IG+SGANI R++++YKV +R+P ++        IRIEGDP+GV+ AK E+  ++ ++ENE+TKD+I++ ++H  +IG +G R++E+R+++P+VII FPD + KSDIVQLRGP+ +V++    + K + +++EN+Y+  V IFKQ+HKNIIGKGG NI+KIREE N +ID P E+S+S+ I +TGK+ N E A  RI ++Q +L +I E  +SIP +LH SLIGT+G+LI+ I +ECGGV I FP   S SD + IRGP SDV+KAKKQLL L+E+    S    + AK E+HKFLIG+ G ++ + R      +IFP +ED ++D I IIG ++AV++A++ELE  I++L+N +E  + +D K H+HF  +R  V+ EI+ E+GGV + FP+       D+V + G K CVEAA  RI++IIE+LEAQ +L   I QK HR+++      I+ I  ++ V IKFP+R+      EN +   E  +  NGD   E  E  D    S +    + + ISGRKE CE+A++AL  LVP+T +V +  + HR  IGQKG GI     +  V +++P     SD I+I G   N+  AKAGL E +   + E++DR  R+++  VTV   +H  IIG++GA I   R + +V+IQ PD+   N   ++ITI GYE++ + A + ++ +V + +  V E++ +   VH ++IG RG A+RK+ D+FKV+I FP     D   + V V G  ENV++  D ++    E L +  +   ++           +   ++ + K P  GF++  APW     ++ PD SS+ +FP   A
Sbjct:   40 YKDAFPPLPEKAACLESAQEPAGAWGNKIR--PIKASVITQVFHVPLEERKYKDM---NQFGEGEQAKICLEIMQRTGAHLEL-SLAKDQGLSIMVSGKLDAVMKARKDIVARLQTQASATVAIPKEHHRFVIGKNGEKLQDLELKTATKIQIPRPDDPSNQIKITGTKEGIEKARHEVLLISAEQDKRAVERLEVEKAFHPFIAGPYNRLVGEIMQETGTRINIPPPSVNRTEIVFTGEKEQLAQAVARIKKIYEEKKKKTTTIAVEVKKSQHKYVIGPKGNSLQEILERTGVSVEIPPSDSISETVILRGEPEKLGQALTEVYAKANSFTVSSVAAPSWLHRFIIGKKGQNLAKITQQMPKVHIEFTEGEDKITLEGPTEDVNVAQEQIEGMVKDLINRMDYVEINIDHKFHRHLIGKSGANINRIKDQYKVSVRIPPDS---EKSNLIRIEGDPQGVQQAKRELLELASRMENERTKDLIIEQRFHRTIIGQKGERIREIRDKFPEVIINFPDPAQKSDIVQLRGPKNEVEKCTKYMQKMVADLVENSYSISVPIFKQFHKNIIGKGGANIKKIREESNTKIDLPAENSNSETIIITGKRANCEAARSRILSIQKDLANIAEVEVSIPAKLHNSLIGTKGRLIRSIMEECGGVHIHFPVEGSGSDTVVIRGPSSDVEKAKKQLLHLAEEKQTKSFTVDIRAKPEYHKFLIGKGGGKIRKVRDSTGARVIFPAAEDKDQDLITIIGKEDAVREAQKELEALIQNLDNVVEDSMLVDPKHHRHFVIRRGQVLREIAEEYGGVMVSFPRSGT--QSDKVTLKGAKDCVEAAKKRIQEIIEDLEAQVTLECAIPQKFHRSVMGPKGSRIQQITRDFSVQIKFPDRE------ENAVHSTEPVVQENGDEAGEGREAKDCDPGSPRR--CDIIIISGRKEKCEAAKEALEALVPVTIEVEVPFDLHRYVIGQKGSGIRKMMDEFEVNIHVPAPELQSDIIAITGLAANLDRAKAGLLERVKELQAEQEDRALRSFKLSVTVDPKYHPKIIGRKGAVITQIRLEHDVNIQFPDKDDGNQPQDQITITGYEKNTEAARDAILRIVGELEQMVSEDVPLDHRVHARIIGARGKAIRKIMDEFKVDIRFPQSGAPD--PNCVTVTGLPENVEEAIDHILNLEEEYLADVVDSEALQVY---------MKPPAHEEAKAPSRGFVVRDAPWTASSSEKAPDMSSSEEFPSFGA 1255          
BLAST of High density lipoprotein binding protein (Vigilin) vs. Ensembl Human
Match: HDLBP (high density lipoprotein binding protein [Source:HGNC Symbol;Acc:HGNC:4857])

HSP 1 Score: 869.381 bits (2245), Expect = 0.000e+0
Identity = 518/1246 (41.57%), Postives = 774/1246 (62.12%), Query Frame = 3
Query:  243 YDDQFPPLP-------TCNTPKIVQNSKPRIGQTKTSHVTQTLTVPLAERRFSNREANNSVKNDAQKKICQTVAQKCGVSIELNSGNKDQNLMVFISGPQDNVSNAKRILTKEXXXXXXXXMKVPKEYHKFILGRNGASLREIESGSNTNVTIPRSIENNDIITIFGTKEGIDKARAEINQIVAERSKLATERITIPKRFYPFINGSNNSKIYKIREMTNAKXXXXXXXXXXXXXXXXGEKDGVYQALEIIQKIYEDTKKCSSSLNLPIPKSQHCYVIGAKGSGIAEIFERTGVSIEMPSQDSDDDTIVLYGPNEFLAPALSMVIQKSESMIRVNIEAPNWLHRFIIGKQGSNLNKLMEKYEHVFINFPENSDLIVIEGPKDDVNELKGQITHKIAELKSTMAITEIQVDPRFHRHIIGRSGANIQRMQEEYKVQIRMPGNNAVGTSGWTIRIEGDPEGVKLAKTEIESMSVKLENEKTKDVILDHKYHNQLIGAQGSRVKELRNQYPDVIIMFPDLSSKSDIVQLRGPRQQVDQVAVKLNKFIQEVIENNYTKDVKIFKQYHKNIIGKGGVNIRKIREEMNIRIDFPDEHSDSDKIRLTGKKENVEEAAKRIEAMQAELISIKEDTISIPQRLHISLIGTRGKLIKCIQQECGGVQIQFPASDSNSDIIKIRGPESDVDKAXXXXXXXXXXXXXXXHQDSVSAKSEFHKFLIGRKGAQLAEFRKRHAVMLIFPDSEDTNKDTIQIIGAKEAVQKAKEELEVTIKSLENEIEKYITIDTKWHKHFFKKRQAVMEEISREFGGVRIFFPKQDAVENIDQVRVIGPKGCVEAAVVRIEDIIENLEAQTSLSVFIEQKHHRNLITRNMMEIKSIQSNYDVTIKFPNRDLSSKPGENGME--EIHLNGNGDVNIETMEEVDSTLESEQNNPANWVTISGRKENCESAEDALLELVPITEDVPLANEFHRNFIGQKGQGINTFSTKHNVVVNIPPANKCSDFISIKGPRVNIIDAKAGLDELITMWENEKQDRIARNYENHVTVPIVFHRNIIGQRGANIEIFRTKFNVSIQIPDQ---NSKSEEITIRGYEEDVKKAEEELISMVEKWKAQVKEELHIPRDVHPQLIGTRGIALRKLRDQFKVEINFPNRNVDDEKAHLVEVIGDKENVDKCCDILVERANELLNEWEERNQVREVKNLIKDRENINSSSNIKEKGP--GFLLTGAPW----QQRVPDASSNVDFPKIDA 3926
            Y D FPPLP       +   P     +K R    K S +TQ   VPL ER++ +    N      Q KIC  + Q+ G  +EL S  KDQ L + +SG  D V  A++ +   LQTQ    + +PKE+H+F++G+NG  L+++E  + T + IPR  + ++ I I GTKEGI+KAR E+  I AE+ K A ER+ + K F+PFI G  N  + +I + T  +INIPPPSV   EI+ +GEK+ + QA+  I+KIYE+ KK ++++ + + KSQH YVIG KG+ + EI ERTGVS+E+P  DS  +T++L G  E L  AL+ V  K+ S    ++ AP+WLHRFIIGK+G NL K+ ++   V I F E  D I +EGP +DVN  + QI   + +L + M   EI +D +FHRH+IG+SGANI R++++YKV +R+P ++        IRIEGDP+GV+ AK E+  ++ ++ENE+TKD+I++ ++H  +IG +G R++E+R+++P+VII FPD + KSDIVQLRGP+ +V++    + K + +++EN+Y+  V IFKQ+HKNIIGKGG NI+KIREE N +ID P E+S+S+ I +TGK+ N E A  RI ++Q +L +I E  +SIP +LH SLIGT+G+LI+ I +ECGGV I FP   S SD + IRGP SDV+KAKKQLL L+E+    S    + AK E+HKFLIG+ G ++ + R      +IFP +ED ++D I IIG ++AV++A++ELE  I++L+N +E  + +D K H+HF  +R  V+ EI+ E+GGV + FP+       D+V + G K CVEAA  RI++IIE+LEAQ +L   I QK HR+++      I+ I  ++ V IKFP+R+      EN +   E  +  NGD   E  E  D    S +    + + ISGRKE CE+A++AL  LVP+T +V +  + HR  IGQKG GI     +  V +++P     SD I+I G   N+  AKAGL E +   + E++DR  R+++  VTV   +H  IIG++GA I   R + +V+IQ PD+   N   ++ITI GYE++ + A + ++ +V + +  V E++ +   VH ++IG RG A+RK+ D+FKV+I FP     D   + V V G  ENV++  D ++    E L +  +   ++           +   ++ + K P  GF++  APW     ++ PD SS+ +FP   A
Sbjct:   40 YKDAFPPLPEKAACLESAQEPAGAWGNKIR--PIKASVITQVFHVPLEERKYKDM---NQFGEGEQAKICLEIMQRTGAHLEL-SLAKDQGLSIMVSGKLDAVMKARKDIVARLQTQASATVAIPKEHHRFVIGKNGEKLQDLELKTATKIQIPRPDDPSNQIKITGTKEGIEKARHEVLLISAEQDKRAVERLEVEKAFHPFIAGPYNRLVGEIMQETGTRINIPPPSVNRTEIVFTGEKEQLAQAVARIKKIYEEKKKKTTTIAVEVKKSQHKYVIGPKGNSLQEILERTGVSVEIPPSDSISETVILRGEPEKLGQALTEVYAKANSFTVSSVAAPSWLHRFIIGKKGQNLAKITQQMPKVHIEFTEGEDKITLEGPTEDVNVAQEQIEGMVKDLINRMDYVEINIDHKFHRHLIGKSGANINRIKDQYKVSVRIPPDS---EKSNLIRIEGDPQGVQQAKRELLELASRMENERTKDLIIEQRFHRTIIGQKGERIREIRDKFPEVIINFPDPAQKSDIVQLRGPKNEVEKCTKYMQKMVADLVENSYSISVPIFKQFHKNIIGKGGANIKKIREESNTKIDLPAENSNSETIIITGKRANCEAARSRILSIQKDLANIAEVEVSIPAKLHNSLIGTKGRLIRSIMEECGGVHIHFPVEGSGSDTVVIRGPSSDVEKAKKQLLHLAEEKQTKSFTVDIRAKPEYHKFLIGKGGGKIRKVRDSTGARVIFPAAEDKDQDLITIIGKEDAVREAQKELEALIQNLDNVVEDSMLVDPKHHRHFVIRRGQVLREIAEEYGGVMVSFPRSGT--QSDKVTLKGAKDCVEAAKKRIQEIIEDLEAQVTLECAIPQKFHRSVMGPKGSRIQQITRDFSVQIKFPDRE------ENAVHSTEPVVQENGDEAGEGREAKDCDPGSPRR--CDIIIISGRKEKCEAAKEALEALVPVTIEVEVPFDLHRYVIGQKGSGIRKMMDEFEVNIHVPAPELQSDIIAITGLAANLDRAKAGLLERVKELQAEQEDRALRSFKLSVTVDPKYHPKIIGRKGAVITQIRLEHDVNIQFPDKDDGNQPQDQITITGYEKNTEAARDAILRIVGELEQMVSEDVPLDHRVHARIIGARGKAIRKIMDEFKVDIRFPQSGAPD--PNCVTVTGLPENVEEAIDHILNLEEEYLADVVDSEALQVY---------MKPPAHEEAKAPSRGFVVRDAPWTASSSEKAPDMSSSEEFPSFGA 1255          
BLAST of High density lipoprotein binding protein (Vigilin) vs. Ensembl Human
Match: HDLBP (high density lipoprotein binding protein [Source:HGNC Symbol;Acc:HGNC:4857])

HSP 1 Score: 869.381 bits (2245), Expect = 0.000e+0
Identity = 518/1246 (41.57%), Postives = 774/1246 (62.12%), Query Frame = 3
Query:  243 YDDQFPPLP-------TCNTPKIVQNSKPRIGQTKTSHVTQTLTVPLAERRFSNREANNSVKNDAQKKICQTVAQKCGVSIELNSGNKDQNLMVFISGPQDNVSNAKRILTKEXXXXXXXXMKVPKEYHKFILGRNGASLREIESGSNTNVTIPRSIENNDIITIFGTKEGIDKARAEINQIVAERSKLATERITIPKRFYPFINGSNNSKIYKIREMTNAKXXXXXXXXXXXXXXXXGEKDGVYQALEIIQKIYEDTKKCSSSLNLPIPKSQHCYVIGAKGSGIAEIFERTGVSIEMPSQDSDDDTIVLYGPNEFLAPALSMVIQKSESMIRVNIEAPNWLHRFIIGKQGSNLNKLMEKYEHVFINFPENSDLIVIEGPKDDVNELKGQITHKIAELKSTMAITEIQVDPRFHRHIIGRSGANIQRMQEEYKVQIRMPGNNAVGTSGWTIRIEGDPEGVKLAKTEIESMSVKLENEKTKDVILDHKYHNQLIGAQGSRVKELRNQYPDVIIMFPDLSSKSDIVQLRGPRQQVDQVAVKLNKFIQEVIENNYTKDVKIFKQYHKNIIGKGGVNIRKIREEMNIRIDFPDEHSDSDKIRLTGKKENVEEAAKRIEAMQAELISIKEDTISIPQRLHISLIGTRGKLIKCIQQECGGVQIQFPASDSNSDIIKIRGPESDVDKAXXXXXXXXXXXXXXXHQDSVSAKSEFHKFLIGRKGAQLAEFRKRHAVMLIFPDSEDTNKDTIQIIGAKEAVQKAKEELEVTIKSLENEIEKYITIDTKWHKHFFKKRQAVMEEISREFGGVRIFFPKQDAVENIDQVRVIGPKGCVEAAVVRIEDIIENLEAQTSLSVFIEQKHHRNLITRNMMEIKSIQSNYDVTIKFPNRDLSSKPGENGME--EIHLNGNGDVNIETMEEVDSTLESEQNNPANWVTISGRKENCESAEDALLELVPITEDVPLANEFHRNFIGQKGQGINTFSTKHNVVVNIPPANKCSDFISIKGPRVNIIDAKAGLDELITMWENEKQDRIARNYENHVTVPIVFHRNIIGQRGANIEIFRTKFNVSIQIPDQ---NSKSEEITIRGYEEDVKKAEEELISMVEKWKAQVKEELHIPRDVHPQLIGTRGIALRKLRDQFKVEINFPNRNVDDEKAHLVEVIGDKENVDKCCDILVERANELLNEWEERNQVREVKNLIKDRENINSSSNIKEKGP--GFLLTGAPW----QQRVPDASSNVDFPKIDA 3926
            Y D FPPLP       +   P     +K R    K S +TQ   VPL ER++ +    N      Q KIC  + Q+ G  +EL S  KDQ L + +SG  D V  A++ +   LQTQ    + +PKE+H+F++G+NG  L+++E  + T + IPR  + ++ I I GTKEGI+KAR E+  I AE+ K A ER+ + K F+PFI G  N  + +I + T  +INIPPPSV   EI+ +GEK+ + QA+  I+KIYE+ KK ++++ + + KSQH YVIG KG+ + EI ERTGVS+E+P  DS  +T++L G  E L  AL+ V  K+ S    ++ AP+WLHRFIIGK+G NL K+ ++   V I F E  D I +EGP +DVN  + QI   + +L + M   EI +D +FHRH+IG+SGANI R++++YKV +R+P ++        IRIEGDP+GV+ AK E+  ++ ++ENE+TKD+I++ ++H  +IG +G R++E+R+++P+VII FPD + KSDIVQLRGP+ +V++    + K + +++EN+Y+  V IFKQ+HKNIIGKGG NI+KIREE N +ID P E+S+S+ I +TGK+ N E A  RI ++Q +L +I E  +SIP +LH SLIGT+G+LI+ I +ECGGV I FP   S SD + IRGP SDV+KAKKQLL L+E+    S    + AK E+HKFLIG+ G ++ + R      +IFP +ED ++D I IIG ++AV++A++ELE  I++L+N +E  + +D K H+HF  +R  V+ EI+ E+GGV + FP+       D+V + G K CVEAA  RI++IIE+LEAQ +L   I QK HR+++      I+ I  ++ V IKFP+R+      EN +   E  +  NGD   E  E  D    S +    + + ISGRKE CE+A++AL  LVP+T +V +  + HR  IGQKG GI     +  V +++P     SD I+I G   N+  AKAGL E +   + E++DR  R+++  VTV   +H  IIG++GA I   R + +V+IQ PD+   N   ++ITI GYE++ + A + ++ +V + +  V E++ +   VH ++IG RG A+RK+ D+FKV+I FP     D   + V V G  ENV++  D ++    E L +  +   ++           +   ++ + K P  GF++  APW     ++ PD SS+ +FP   A
Sbjct:   40 YKDAFPPLPEKAACLESAQEPAGAWGNKIR--PIKASVITQVFHVPLEERKYKDM---NQFGEGEQAKICLEIMQRTGAHLEL-SLAKDQGLSIMVSGKLDAVMKARKDIVARLQTQASATVAIPKEHHRFVIGKNGEKLQDLELKTATKIQIPRPDDPSNQIKITGTKEGIEKARHEVLLISAEQDKRAVERLEVEKAFHPFIAGPYNRLVGEIMQETGTRINIPPPSVNRTEIVFTGEKEQLAQAVARIKKIYEEKKKKTTTIAVEVKKSQHKYVIGPKGNSLQEILERTGVSVEIPPSDSISETVILRGEPEKLGQALTEVYAKANSFTVSSVAAPSWLHRFIIGKKGQNLAKITQQMPKVHIEFTEGEDKITLEGPTEDVNVAQEQIEGMVKDLINRMDYVEINIDHKFHRHLIGKSGANINRIKDQYKVSVRIPPDS---EKSNLIRIEGDPQGVQQAKRELLELASRMENERTKDLIIEQRFHRTIIGQKGERIREIRDKFPEVIINFPDPAQKSDIVQLRGPKNEVEKCTKYMQKMVADLVENSYSISVPIFKQFHKNIIGKGGANIKKIREESNTKIDLPAENSNSETIIITGKRANCEAARSRILSIQKDLANIAEVEVSIPAKLHNSLIGTKGRLIRSIMEECGGVHIHFPVEGSGSDTVVIRGPSSDVEKAKKQLLHLAEEKQTKSFTVDIRAKPEYHKFLIGKGGGKIRKVRDSTGARVIFPAAEDKDQDLITIIGKEDAVREAQKELEALIQNLDNVVEDSMLVDPKHHRHFVIRRGQVLREIAEEYGGVMVSFPRSGT--QSDKVTLKGAKDCVEAAKKRIQEIIEDLEAQVTLECAIPQKFHRSVMGPKGSRIQQITRDFSVQIKFPDRE------ENAVHSTEPVVQENGDEAGEGREAKDCDPGSPRR--CDIIIISGRKEKCEAAKEALEALVPVTIEVEVPFDLHRYVIGQKGSGIRKMMDEFEVNIHVPAPELQSDIIAITGLAANLDRAKAGLLERVKELQAEQEDRALRSFKLSVTVDPKYHPKIIGRKGAVITQIRLEHDVNIQFPDKDDGNQPQDQITITGYEKNTEAARDAILRIVGELEQMVSEDVPLDHRVHARIIGARGKAIRKIMDEFKVDIRFPQSGAPD--PNCVTVTGLPENVEEAIDHILNLEEEYLADVVDSEALQVY---------MKPPAHEEAKAPSRGFVVRDAPWTASSSEKAPDMSSSEEFPSFGA 1255          
BLAST of High density lipoprotein binding protein (Vigilin) vs. Ensembl Human
Match: HDLBP (high density lipoprotein binding protein [Source:HGNC Symbol;Acc:HGNC:4857])

HSP 1 Score: 721.465 bits (1861), Expect = 0.000e+0
Identity = 436/1126 (38.72%), Postives = 671/1126 (59.59%), Query Frame = 3
Query:  597 KEYHKFILGRNGASLREIESGSNTNVTIPRSIENNDIITIFGTKEGIDKARAEINQIVAERSKLATERITIPKRFYPFINGSNNSKIYKIREMTNAKXXXXXXXXXXXXXXXXGEKDGVYQAL-EIIQKIYEDTKKCSSSLNLPIPKSQHCYVIGAKGSGIAEIFERTGVSIEMPSQDSDDDTIVLYGPNEFLAPALSMVI----QKSESMIRVNIEAPNWLHRFIIGKQGSNLNKLMEKYEHVFINFPENSDLIVIEGPKDDVNELKGQITHKIAELKSTMAITEIQVDPRFHRHIIGRSGANIQRMQEEYKVQIRMPGNNAVGTSGWTIRIEGDPEGVKLAKTEIESMSVKLENEKTKDVILDHKYHNQLIGAQGSRVKELRNQYPDVIIMFPDLSSKSDIVQLRGPRQQVDQVAVKLNKFIQEVIENNYTKDVKIFKQYHKNIIGKGGVNIRKIREEMNIRIDFPDEHSDSDKIRLTGKKENVEEAAKRIEAMQAELISIKEDTISIPQRLHISLIGTRGKLIKCIQQECGGVQIQFPASDSNSDIIKIRGPESDVDKAXXXXXXXXXXXXXXXHQDSVSAKSEFHKFLIGRKGAQLAEFRKRHAVMLIFPDSEDTNKDTIQIIGAKEAVQKAKEELEVTIKSLENEIEKYITIDTKWHKHFFKKRQAVMEEISREFGGVRIFFPKQDAVENIDQVRVIGPKGCVEAAVVRIEDIIENLEAQTSLSVFIEQKHHRNLITRNMMEIKSIQSNYDVTIKFPNRDLSSKPGENGME--EIHLNGNGDVNIETMEEVDSTLESEQNNPANWVTISGRKENCESAEDALLELVPITEDVPLANEFHRNFIGQKGQGINTFSTKHNVVVNIPPANKCSDFISIKGPRVNIIDAKAGLDELITMWENEKQDRIARNYENHVTVPIVFHRNIIGQRGANIEIFRTKFNVSIQIPDQ---NSKSEEITIRGYEEDVKKAEEELISMVEKWKAQVKEELHIPRDVHPQLIGTRGIALRKLRDQFKVEINFPNRNVDDEKAHLVEVIGDKENVDKCCDILVERANELLNEWEERNQVREVKNLIKDRENINSSSNIKEKGP--GFLLTGAPW----QQRVPDASSNVDFPKIDA 3926
            K+ ++F  G       EI   +  ++ +  + +    I + G  + + KAR +I   VA     A+  + IPK  + F+ G N  K+  +   T  KI IP P   S +I I+G K+G+ +A  E++    E  K+    L   + K+ H ++ G     + EI + TG  I +P    +   IV  G  E LA A++ +     +K+ S    ++ AP+WLHRFIIGK+G NL K+ ++   V I F E  D I +EGP +DVN  + QI   + +L + M   EI +D +FHRH+IG+SGANI R++++YKV +R+P ++        IRIEGDP+GV+ AK E+  ++ ++ENE+TKD+I++ ++H  +IG +G R++E+R+++P+VII FPD + KSDIVQLRGP+ +V++    + K + +++EN+Y+  V IFKQ+HKNIIGKGG NI+KIREE N +ID P E+S+S+ I +TGK+ N E A  RI ++Q +L +I E  +SIP +LH SLIGT+G+LI+ I +ECGGV I FP   S SD + IRGP SDV+KAKKQLL L+E+    S    + AK E+HKFLIG+ G ++ + R      +IFP +ED ++D I IIG ++AV++A++ELE  I++L+N +E  + +D K H+HF  +R  V+ EI+ E+GGV + FP+       D+V + G K CVEAA  RI++IIE+LEAQ +L   I QK HR+++      I+ I  ++ V IKFP+R+      EN +   E  +  NGD   E  E  D    S +    + + ISGRKE CE+A++AL  LVP+T +V +  + HR  IGQKG GI     +  V +++P     SD I+I G   N+  AKAGL E +   + E++DR  R+++  VTV   +H  IIG++GA I   R + +V+IQ PD+   N   ++ITI GYE++ + A + ++ +V + +  V E++ +   VH ++IG RG A+RK+ D+FKV+I FP     D   + V V G  ENV++  D ++    E L +  +   ++           +   ++ + K P  GF++  APW     ++ PD SS+ +FP   A
Sbjct:  126 KDMNQFGEGEQAKICLEIMQRTGAHLELSLAKDQGLSIMVSGKLDAVMKARKDI---VARLQTQASATVAIPKEHHRFVIGKNGEKLQDLELKTATKIQIPRPDDPSNQIKITGTKEGIEKARHEVLLISAEQDKRAVERLE--VEKAFHPFIAGPYNRLVGEIMQETGTRINIPPPSVNRTEIVFTGEKEQLAQAVARIKKIYEEKANSFTVSSVAAPSWLHRFIIGKKGQNLAKITQQMPKVHIEFTEGEDKITLEGPTEDVNVAQEQIEGMVKDLINRMDYVEINIDHKFHRHLIGKSGANINRIKDQYKVSVRIPPDSEKSN---LIRIEGDPQGVQQAKRELLELASRMENERTKDLIIEQRFHRTIIGQKGERIREIRDKFPEVIINFPDPAQKSDIVQLRGPKNEVEKCTKYMQKMVADLVENSYSISVPIFKQFHKNIIGKGGANIKKIREESNTKIDLPAENSNSETIIITGKRANCEAARSRILSIQKDLANIAEVEVSIPAKLHNSLIGTKGRLIRSIMEECGGVHIHFPVEGSGSDTVVIRGPSSDVEKAKKQLLHLAEEKQTKSFTVDIRAKPEYHKFLIGKGGGKIRKVRDSTGARVIFPAAEDKDQDLITIIGKEDAVREAQKELEALIQNLDNVVEDSMLVDPKHHRHFVIRRGQVLREIAEEYGGVMVSFPRSGT--QSDKVTLKGAKDCVEAAKKRIQEIIEDLEAQVTLECAIPQKFHRSVMGPKGSRIQQITRDFSVQIKFPDRE------ENAVHSTEPVVQENGDEAGEGREAKDCDPGSPRR--CDIIIISGRKEKCEAAKEALEALVPVTIEVEVPFDLHRYVIGQKGSGIRKMMDEFEVNIHVPAPELQSDIIAITGLAANLDRAKAGLLERVKELQAEQEDRALRSFKLSVTVDPKYHPKIIGRKGAVITQIRLEHDVNIQFPDKDDGNQPQDQITITGYEKNTEAARDAILRIVGELEQMVSEDVPLDHRVHARIIGARGKAIRKIMDEFKVDIRFPQSGAPD--PNCVTVTGLPENVEEAIDHILNLEEEYLADVVDSEALQVY---------MKPPAHEEAKAPSRGFVVRDAPWTASSSEKAPDMSSSEEFPSFGA 1222          

HSP 2 Score: 366.696 bits (940), Expect = 3.733e-105
Identity = 325/1114 (29.17%), Postives = 523/1114 (46.95%), Query Frame = 3
Query:  243 YDDQFPPLP-------TCNTPKIVQNSKPRIGQTKTSHVTQTLTVPLAERRFSNREANNSVKNDAQKKICQTVAQKCGVSIELNSGNKDQNLMVFISGPQDNVSNAKRILTKEXXXXXXXXMKVPKEYHKFILGRNGASLREIESGSNTNVTIPRSIENNDIITIFGTKEGIDKARAEINQIVAERSKLATERITIPKRFYPFINGSNNSKIYKIREMTNAKXXXXXXXXXXXXXXXXGEKDGVYQALEIIQKIYEDTKKCSSSLNLPIPKSQHCYVIGAKGSGIAEIFERT-GVSIEMPSQDSDDDTIVLYGPNEFLAPAL----SMVIQKSESMIRVNIEAPNWLHRFIIGKQGSNLNKLMEKYEHVFINFP---ENSDLIVIEGPKDDVNELKGQITHKIAELKSTMA---ITEIQVDPRFHRHIIGRSGANIQRMQEEYK---------------VQIRMPGN---------------------------------NAVGTSGW-----------------------TIRIEGDPEGVKLAKTEIESMSVKLENEKTKDVILDHKYHNQLIGAQGSRVKELRNQYPDVIIMFPDLSSKSDIVQLRGPRQQVDQVAVKLNKFIQEVIENNYTKDVKIFKQYHKNIIGKGGVNIRKIREEMNIRIDFP-DEHSDSDKIRLTGKKENVEEAAKRIEAMQAELISIKEDTISIPQRLHISLIGTRGKLIKCIQQECGGVQIQFPASDSNSDIIKIRGPESDVDKAXXXXXXXXXXXXXXXHQDSVSAKSEFHKFLIGRKGAQLAEFRKRHAVMLIFPDSEDT-------------------------------NKDTIQIIGAKEAVQKAKEELEVTIKSLENEIEKYITIDTKWHKHFFKKRQAVMEEISREFGGVRIFFPKQDAVENIDQVRVIGPKGCVEAAVVRIEDIIENLEAQT--------SLSVFIEQKHHRNLITRNMMEIKSIQSNYDVTIKFPNRDLSSKPGENGMEEIHLNGNGDVNIETMEEVDSTLESEQNNPANWVTISGRKENCESAEDALLELVP-----ITEDVPLANEFHRNFIGQKGQGINTFSTKHNVVVNIP 3182
            Y D FPPLP       +   P     +K R    K S +TQ   VPL ER++ +    N      Q KIC  + Q+ G  +EL S  KDQ L + +SG  D V  A++ +   LQTQ    + +PKE+H+F++G+NG  L+++E  + T + IPR  + ++ I I GTKEGI+KAR E+  I AE+ K A ER+ + K F+PFI G  N  + +I + T  +INIPPPSV   EI+ +GEK+ + QA+  I+KIYE+     +  ++  P   H ++IG KG  +A+I ++   V IE       +D I L GP E +  A      MV      M  V I   +  HR +IGK G+N+N++ ++Y+ V +  P   E S+LI IEG    V + K     ++ EL S M      ++ ++ RFHR IIG+ G  I+ +++++                VQ+R P N                                 N +G  G                        TI I G     + A++ I S+   L N    +V +  K HN LIG +G  ++ +  +   V I FP   S SD V +RGP   V++   +L    +E    ++T D++   +YHK +IGKGG  IRK+R+    R+ FP  E  D D I + GK++ V EA K +EA+   L ++ ED++ +  + H   +  RG++++ I +E GGV + FP S + SD + ++G +  V+ AKK++ E+ E        +  +   +FH+ ++G KG+++ +  +  +V + FPD E+                                  D I I G KE  + AKE LE  +      IE  +  D   H++   ++ + + ++  EF  V I  P  +   +I  + + G    ++ A   + + ++ L+A+          LSV ++ K+H  +I R    I  I+  +DV I+FP++D                                   + N P + +TI+G ++N E+A DA+L +V      ++EDVPL +  H   IG +G+ I     +  V +  P
Sbjct:   76 YKDAFPPLPEKAACLESAQEPAGAWGNKIR--PIKASVITQVFHVPLEERKYKDM---NQFGEGEQAKICLEIMQRTGAHLEL-SLAKDQGLSIMVSGKLDAVMKARKDIVARLQTQASATVAIPKEHHRFVIGKNGEKLQDLELKTATKIQIPRPDDPSNQIKITGTKEGIEKARHEVLLISAEQDKRAVERLEVEKAFHPFIAGPYNRLVGEIMQETGTRINIPPPSVNRTEIVFTGEKEQLAQAVARIKKIYEEKANSFTVSSVAAPSWLHRFIIGKKGQNLAKITQQMPKVHIEF---TEGEDKITLEGPTEDVNVAQEQIEGMVKDLINRMDYVEINIDHKFHRHLIGKSGANINRIKDQYK-VSVRIPPDSEKSNLIRIEGDPQGVQQAK----RELLELASRMENERTKDLIIEQRFHRTIIGQKGERIREIRDKFPEVIINFPDPAQKSDIVQLRGPKNEVEKCTKYMQKMVADLVENSYSISVPIFKQFHKNIIGKGGANIKKIREESNTKIDLPAENSNSETIIITGKRANCEAARSRILSIQKDLANIAEVEVSIPAKLHNSLIGTKGRLIRSIMEECGGVHIHFPVEGSGSDTVVIRGPSSDVEKAKKQLLHLAEEKQTKSFTVDIRAKPEYHKFLIGKGGGKIRKVRDSTGARVIFPAAEDKDQDLITIIGKEDAVREAQKELEALIQNLDNVVEDSMLVDPKHHRHFVIRRGQVLREIAEEYGGVMVSFPRSGTQSDKVTLKGAKDCVEAAKKRIQEIIEDLEAQVTLE-CAIPQKFHRSVMGPKGSRIQQITRDFSVQIKFPDREENAVHSTEPVVQENGDEAGEGREAKDCDPGSPRRCDIIIISGRKEKCEAAKEALEALVPVT---IEVEVPFD--LHRYVIGQKGSGIRKMMDEF-EVNIHVPAPELQSDI--IAITGLAANLDRAKAGLLERVKELQAEQEDRALRSFKLSVTVDPKYHPKIIGRKGAVITQIRLEHDVNIQFPDKD-----------------------------------DGNQPQDQITITGYEKNTEAARDAILRIVGELEQMVSEDVPLDHRVHARIIGARGKAIRKIMDEFKVDIRFP 1131          

HSP 3 Score: 60.4622 bits (145), Expect = 3.341e-8
Identity = 70/330 (21.21%), Postives = 148/330 (44.85%), Query Frame = 3
Query:  273 CNTPKIVQNSKPRIGQTKTSHVTQTLTVPLAERRFSNREANNSVKNDAQKKICQTVAQKCGVSIE---LNSGNKDQNLMVFISGPQDNVSNAKRILTKEXXXXXXXXMKVPKEYHKFILGRNGASLREIESGSNTNVTIPRSIENNDIITIFGTKEGIDKARAEINQIVAERSKLATER--------ITIPKRFYPFINGSNNSKIYKIR---EMTNAKXXXXXXXXXXXXXXXXGEKDGVYQALEIIQKIYEDTKKCSSSLNLPIPKSQHCYVIGAKGSGIAEIFERTGVSIEMP-SQDSDDDTIVLYGPNEFLAPALSMVIQKSESMI 1217
            C  P+    S      ++   +T+  +V +   +F +RE N      + + + Q    + G   E    + G+  +  ++ ISG ++    AK  L  E      ++++VP + H++++G+ G+ +R++      N+ +P     +DII I G    +D+A+A + + V E      +R        +T+  +++P I G   + I +IR   ++     +    +   ++I I+G +     A + I +I  + ++  S  ++P+    H  +IGA+G  I +I +   V I  P S   D + + + G  E +  A+  ++   E  +
Sbjct:  845 CAIPQKFHRSVMGPKGSRIQQITRDFSVQI---KFPDREENAV---HSTEPVVQENGDEAGEGREAKDCDPGSPRRCDIIIISGRKEKCEAAKEAL--EALVPVTIEVEVPFDLHRYVIGQKGSGIRKMMDEFEVNIHVPAPELQSDIIAITGLAANLDRAKAGLLERVKELQAEQEDRALRSFKLSVTVDPKYHPKIIGRKGAVITQIRLEHDVNIQFPDKDDGNQPQDQITITGYEKNTEAARDAILRIVGELEQMVSE-DVPLDHRVHARIIGARGKAIRKIMDEFKVDIRFPQSGAPDPNCVTVTGLPENVEEAIDHILNLEEEYL 1165          
BLAST of High density lipoprotein binding protein (Vigilin) vs. Ensembl Human
Match: HDLBP (high density lipoprotein binding protein [Source:HGNC Symbol;Acc:HGNC:4857])

HSP 1 Score: 643.654 bits (1659), Expect = 0.000e+0
Identity = 377/909 (41.47%), Postives = 563/909 (61.94%), Query Frame = 3
Query:  708 ITIFGTKEGIDKARAEINQIVAERSKLATERITIPKRFYPFINGSNNSKIYKIREMTNAKXXXXXXXXXXXXXXXXGEKDGVYQAL-EIIQKIYEDTKKCSSSLNLPIPKSQHCYVIGAKGSGIAEIFERTGVSIEMPSQDSDDDTIVLYGPNEFLAPALSMVI----QKSESMIRVNIEAPNWLHRFIIGKQGSNLNKLMEKYEHVFINFPENSDLIVIEGPKDDVNELKGQITHKIAELKSTMAITEIQVDPRFHRHIIGRSGANIQRMQEEYKVQIRMPGNNAVGTSGWTIRIEGDPEGVKLAKTEIESMSVKLENEKTKDVILDHKYHNQLIGAQGSRVKELRNQYPDVIIMFPDLSSKSDIVQLRGPRQQVDQVAVKLNKFIQEVIENNYTKDVKIFKQYHKNIIGKGGVNIRKIREEMNIRIDFPDEHSDSDKIRLTGKKENVEEAAKRIEAMQAELISIKEDTISIPQRLHISLIGTRGKLIKCIQQECGGVQIQFPASDSNSDIIKIRGPESDVDKAXXXXXXXXXXXXXXXHQDSVSAKSEFHKFLIGRKGAQLAEFRKRHAVMLIFPDSEDTNKDTIQIIGAKEAVQKAKEELEVTIKSLENEIEKYITIDTKWHKHFFKKRQAVMEEISREFGGVRIFFPKQDAVENIDQVRVIGPKGCVEAAVVRIEDIIENLEAQTSLSVFIEQKHHRNLITRNMMEIKSIQSNYDVTIKFPNRDLSSKPGENGME--EIHLNGNGDVNIETMEEVDSTLESEQNNPANWVTISGRKENCESAEDALLELVPITEDVPLANEFHRNFIGQKGQGINTFSTKHNVVVNIPPANKCSDFISIKGPRVNIIDAKAGLDELITMWENEKQDRIARNYENHVTVPIVFHRNIIGQRGANIEIFRTKFNVSI 3413
            I + G  + + KAR +I   VA     A+  + IPK  + F+ G N  K+  +   T  KI IP P   S +I I+G K+G+ +A  E++    E  K+    L   + K+ H ++ G     + EI + TG  I +P    +   IV  G  E LA A++ +     +K+ S    ++ AP+WLHRFIIGK+G NL K+ ++   V I F E  D I +EGP +DVN  + QI   + +L + M   EI +D +FHRH+IG+SGANI R++++YKV +R+P ++        IRIEGDP+GV+ AK E+  ++ ++ENE+TKD+I++ ++H  +IG +G R++E+R+++P+VII FPD + KSDIVQLRGP+ +V++    + K + +++EN+Y+  V IFKQ+HKNIIGKGG NI+KIREE N +ID P E+S+S+ I +TGK+ N E A  RI ++Q +L +I E  +SIP +LH SLIGT+G+LI+ I +ECGGV I FP   S SD + IRGP SDV+KAKKQLL L+E+    S    + AK E+HKFLIG+ G ++ + R      +IFP +ED ++D I IIG ++AV++A++ELE  I++L+N +E  + +D K H+HF  +R  V+ EI+ E+GGV + FP+       D+V + G K CVEAA  RI++IIE+LEAQ +L   I QK HR+++      I+ I  ++ V IKFP+R+      EN +   E  +  NGD   E  E  D    S +    + + ISGRKE CE+A++AL  LVP+T +V +  + HR  IGQKG GI     +  V +++P     SD I+I G   N+  AKAGL E +   + E++DR  R+++  VTV   +H  IIG++GA I   R + +V+I
Sbjct:    5 IMVSGKLDAVMKARKDI---VARLQTQASATVAIPKEHHRFVIGKNGEKLQDLELKTATKIQIPRPDDPSNQIKITGTKEGIEKARHEVLLISAEQDKRAVERLE--VEKAFHPFIAGPYNRLVGEIMQETGTRINIPPPSVNRTEIVFTGEKEQLAQAVARIKKIYEEKANSFTVSSVAAPSWLHRFIIGKKGQNLAKITQQMPKVHIEFTEGEDKITLEGPTEDVNVAQEQIEGMVKDLINRMDYVEINIDHKFHRHLIGKSGANINRIKDQYKVSVRIPPDSEKSN---LIRIEGDPQGVQQAKRELLELASRMENERTKDLIIEQRFHRTIIGQKGERIREIRDKFPEVIINFPDPAQKSDIVQLRGPKNEVEKCTKYMQKMVADLVENSYSISVPIFKQFHKNIIGKGGANIKKIREESNTKIDLPAENSNSETIIITGKRANCEAARSRILSIQKDLANIAEVEVSIPAKLHNSLIGTKGRLIRSIMEECGGVHIHFPVEGSGSDTVVIRGPSSDVEKAKKQLLHLAEEKQTKSFTVDIRAKPEYHKFLIGKGGGKIRKVRDSTGARVIFPAAEDKDQDLITIIGKEDAVREAQKELEALIQNLDNVVEDSMLVDPKHHRHFVIRRGQVLREIAEEYGGVMVSFPRSGT--QSDKVTLKGAKDCVEAAKKRIQEIIEDLEAQVTLECAIPQKFHRSVMGPKGSRIQQITRDFSVQIKFPDRE------ENAVHSTEPVVQENGDEAGEGREAKDCDPGSPRR--CDIIIISGRKEKCEAAKEALEALVPVTIEVEVPFDLHRYVIGQKGSGIRKMMDEFEVNIHVPAPELQSDIIAITGLAANLDRAKAGLLERVKELQAEQEDRALRSFKLSVTVDPKYHPKIIGRKGAVITQIRLEHDVNI 895          

HSP 2 Score: 291.197 bits (744), Expect = 3.138e-81
Identity = 266/911 (29.20%), Postives = 436/911 (47.86%), Query Frame = 3
Query:  492 NLMVFISGPQDNVSNAKRILTKEXXXXXXXXMKVPKEYHKFILGRNGASLREIESGSNTNVTIPRSIENNDIITIFGTKEGIDKARAEINQIVAERSKLATERITIPKRFYPFINGSNNSKIYKIREMTNAKXXXXXXXXXXXXXXXXGEKDGVYQALEIIQKIYEDTKKCSSSLNLPIPKSQHCYVIGAKGSGIAEIFERT-GVSIEMPSQDSDDDTIVLYGPNEFLAPAL----SMVIQKSESMIRVNIEAPNWLHRFIIGKQGSNLNKLMEKYEHVFINFP---ENSDLIVIEGPKDDVNELKGQITHKIAELKSTMA---ITEIQVDPRFHRHIIGRSGANIQRMQEEYK---------------VQIRMPGN---------------------------------NAVGTSGW-----------------------TIRIEGDPEGVKLAKTEIESMSVKLENEKTKDVILDHKYHNQLIGAQGSRVKELRNQYPDVIIMFPDLSSKSDIVQLRGPRQQVDQVAVKLNKFIQEVIENNYTKDVKIFKQYHKNIIGKGGVNIRKIREEMNIRIDFP-DEHSDSDKIRLTGKKENVEEAAKRIEAMQAELISIKEDTISIPQRLHISLIGTRGKLIKCIQQECGGVQIQFPASDSNSDIIKIRGPESDVDKAXXXXXXXXXXXXXXXHQDSVSAKSEFHKFLIGRKGAQLAEFRKRHAVMLIFPDSEDT-------------------------------NKDTIQIIGAKEAVQKAKEELEVTIKSLENEIEKYITIDTKWHKHFFKKRQAVMEEISREFGGVRIFFPKQDAVENIDQVRVIGPKGCVEAAVVRIEDIIENLEAQT--------SLSVFIEQKHHRNLITRNMMEIKSIQSNYDVTI 2858
             L + +SG  D V  A++ +   LQTQ    + +PKE+H+F++G+NG  L+++E  + T + IPR  + ++ I I GTKEGI+KAR E+  I AE+ K A ER+ + K F+PFI G  N  + +I + T  +INIPPPSV   EI+ +GEK+ + QA+  I+KIYE+     +  ++  P   H ++IG KG  +A+I ++   V IE       +D I L GP E +  A      MV      M  V I   +  HR +IGK G+N+N++ ++Y+ V +  P   E S+LI IEG    V + K     ++ EL S M      ++ ++ RFHR IIG+ G  I+ +++++                VQ+R P N                                 N +G  G                        TI I G     + A++ I S+   L N    +V +  K HN LIG +G  ++ +  +   V I FP   S SD V +RGP   V++   +L    +E    ++T D++   +YHK +IGKGG  IRK+R+    R+ FP  E  D D I + GK++ V EA K +EA+   L ++ ED++ +  + H   +  RG++++ I +E GGV + FP S + SD + ++G +  V+ AKK++ E+ E        +  +   +FH+ ++G KG+++ +  +  +V + FPD E+                                  D I I G KE  + AKE LE  +      IE  +  D   H++   ++ + + ++  EF  V I  P  +   +I  + + G    ++ A   + + ++ L+A+          LSV ++ K+H  +I R    I  I+  +DV I
Sbjct:    2 GLSIMVSGKLDAVMKARKDIVARLQTQASATVAIPKEHHRFVIGKNGEKLQDLELKTATKIQIPRPDDPSNQIKITGTKEGIEKARHEVLLISAEQDKRAVERLEVEKAFHPFIAGPYNRLVGEIMQETGTRINIPPPSVNRTEIVFTGEKEQLAQAVARIKKIYEEKANSFTVSSVAAPSWLHRFIIGKKGQNLAKITQQMPKVHIEF---TEGEDKITLEGPTEDVNVAQEQIEGMVKDLINRMDYVEINIDHKFHRHLIGKSGANINRIKDQYK-VSVRIPPDSEKSNLIRIEGDPQGVQQAK----RELLELASRMENERTKDLIIEQRFHRTIIGQKGERIREIRDKFPEVIINFPDPAQKSDIVQLRGPKNEVEKCTKYMQKMVADLVENSYSISVPIFKQFHKNIIGKGGANIKKIREESNTKIDLPAENSNSETIIITGKRANCEAARSRILSIQKDLANIAEVEVSIPAKLHNSLIGTKGRLIRSIMEECGGVHIHFPVEGSGSDTVVIRGPSSDVEKAKKQLLHLAEEKQTKSFTVDIRAKPEYHKFLIGKGGGKIRKVRDSTGARVIFPAAEDKDQDLITIIGKEDAVREAQKELEALIQNLDNVVEDSMLVDPKHHRHFVIRRGQVLREIAEEYGGVMVSFPRSGTQSDKVTLKGAKDCVEAAKKRIQEIIEDLEAQVTLE-CAIPQKFHRSVMGPKGSRIQQITRDFSVQIKFPDREENAVHSTEPVVQENGDEAGEGREAKDCDPGSPRRCDIIIISGRKEKCEAAKEALEALVPVT---IEVEVPFD--LHRYVIGQKGSGIRKMMDEF-EVNIHVPAPELQSDI--IAITGLAANLDRAKAGLLERVKELQAEQEDRALRSFKLSVTVDPKYHPKIIGRKGAVITQIRLEHDVNI 895          

HSP 3 Score: 241.506 bits (615), Expect = 7.460e-65
Identity = 240/1022 (23.48%), Postives = 461/1022 (45.11%), Query Frame = 3
Query: 1140 TIVLYGPNEFLAPALSMVIQKSESMIRVNIEAPNWLHRFIIGKQGSNLNKL-MEKYEHVFINFPEN-SDLIVIEGPKDDVNELKGQITHKIAELKSTMAITEIQVDPRFHRHIIGRSGANIQRMQEEYKVQIRMPGNNAVGTSGWTIRIEGDPEGVKLAKTEIESMSVKLENEKTKDVILDHKY-HNQLIGAQGSRVKELRNQYPDVIIMFPDLSSKSDIVQLRGPRQQVDQVAVKLNKFIQEVIENNYTKDVKIFKQYHKNIIGKGGVNIRKIREEMNIRIDFPDEHSDSDKIRLTGKKENVEEAAKRIEAMQAELISIKEDTISIPQRLHISLIGTRGKLIKCIQQECGGVQIQFPASDSNSDIIKIRGPESDVDKAXXXXXXXXXXXXXXXHQDSVSAKSEFHKFLIGRKGAQLAEFRKRHAVMLIFPDSEDTNKDTIQIIGAKEAVQKAKEELEVTIKSLENEIEKYITIDTKWHKHFFKKRQAVMEEISREFGGVRIFFPKQDAVENIDQVRVIGPKGCVEAAVVRIEDIIENLEAQT-SLSVFIEQK--HHRNLITRNMMEIKSIQSNYDVTIKFPNRDLSSKPGENGMEEIHLNGNGDVNIETMEEVDSTLESEQNNPANWVTISGRKENCESAEDALLELVP----ITEDVPLAN-EFHRNFIGQKGQGINTFSTKHN-VVVNIPPANKCSDFISIKGPRVNIIDAKAGLDELITMWENEKQDRIARNYENHVTVPIVFHRNIIGQRGANIEIFRTKFNVSIQIPDQNS--------------------------------KSEEITIRGYEEDVKKAEEELISMVEKWKAQVKEELHIPRDVHPQLIGTRGIALRKLRDQFKVEINFPNRNVDDEKAHLVEVIGDKENVDKCCDILVERANELLNEWEER---------------------------NQVR-----EVKNL-------IKDRENIN----SSSNIKEKGP--GFLLTGAPW----QQRVPDASSNVDFPKIDA 3926
            +I++ G  + +  A   ++ + ++     +  P   HRF+IGK G  L  L ++    + I  P++ S+ I I G K+ + + + ++    AE +   A+  ++V+  FH  I G     +  + +E   +I +P  +   T    I   G+ E +  A   I+ +  +  N  T   +    + H  +IG +G  + ++  Q P V I F   +   D + L GP + V+    ++   ++++I      ++ I  ++H+++IGK G NI +I+++  + +  P +   S+ IR+ G  + V++A + +  + + + + +   + I QR H ++IG +G+ I+ I+ +   V I FP     SDI+++RGP+++V+K  K + ++    +  S+  SV    +FHK +IG+ GA + + R+     +  P +E++N +TI I G +   + A+  +    K L N  E  ++I  K H      +  ++  I  E GGV I FP + +    D V + GP   VE A  ++  + E  E QT S +V I  K  +H+ LI +   +I+ ++ +    + FP                                     + ++   + +TI G+++    A+  L  L+     + ED  L + + HR+F+ ++GQ +   + ++  V+V+ P +   SD +++KG +  +  AK  + E+I   E +     A        +P  FHR+++G +G+ I+     F+V I+ PD+                                  + + I I G +E  + A+E L ++V      V  E+ +P D+H  +IG +G  +RK+ D+F+V I+ P   +   ++ ++ + G   N+D+    L+ER  EL  E E+R                            Q+R      + NL       + D E +       ++ + K P  GF++  APW     ++ PD SS+ +FP   A
Sbjct:    4 SIMVSGKLDAVMKARKDIVARLQTQASATVAIPKEHHRFVIGKNGEKLQDLELKTATKIQIPRPDDPSNQIKITGTKEGIEKARHEVLLISAE-QDKRAVERLEVEKAFHPFIAGPYNRLVGEIMQETGTRINIPPPSVNRTE---IVFTGEKEQLAQAVARIKKIYEEKANSFTVSSVAAPSWLHRFIIGKKGQNLAKITQQMPKVHIEF---TEGEDKITLEGPTEDVNVAQEQIEGMVKDLINRMDYVEINIDHKFHRHLIGKSGANINRIKDQYKVSVRIPPDSEKSNLIRIEGDPQGVQQAKRELLELASRMENERTKDLIIEQRFHRTIIGQKGERIREIRDKFPEVIINFPDPAQKSDIVQLRGPKNEVEKCTKYMQKMVADLVENSYSISVPIFKQFHKNIIGKGGANIKKIREESNTKIDLP-AENSNSETIIITGKRANCEAARSRILSIQKDLANIAEVEVSIPAKLHNSLIGTKGRLIRSIMEECGGVHIHFPVEGS--GSDTVVIRGPSSDVEKAKKQLLHLAE--EKQTKSFTVDIRAKPEYHKFLIGKGGGKIRKVRDSTGARVIFP-------------------------------------AAEDKDQDLITIIGKEDAVREAQKELEALIQNLDNVVEDSMLVDPKHHRHFVIRRGQVLREIAEEYGGVMVSFPRSGTQSDKVTLKGAKDCVEAAKKRIQEIIEDLEAQVTLECA--------IPQKFHRSVMGPKGSRIQQITRDFSVQIKFPDREENAVHSTEPVVQENGDEAGEGREAKDCDPGSPRRCDIIIISGRKEKCEAAKEALEALV-----PVTIEVEVPFDLHRYVIGQKGSGIRKMMDEFEVNIHVPAPEL---QSDIIAITGLAANLDRAKAGLLERVKELQAEQEDRALRSFKLSVTVDPKYHPKIIGRKGAVITQIRLEHDVNILNLEEEYLADVVDSEALQVYMKPPAHEEAKAPSRGFVVRDAPWTASSSEKAPDMSSSEEFPSFGA 960          

HSP 4 Score: 227.639 bits (579), Expect = 2.249e-60
Identity = 181/653 (27.72%), Postives = 338/653 (51.76%), Query Frame = 3
Query:  600 EYHKFILGRNGASLREIESGSNTNVTIPRSIENNDIITIFGTKEGIDKARAEINQIVAERSKLATERITIPKRFYPFINGSNNSKIYKIRE-MTNAKXXXXXXXXXXXXXXXXGEKDGVYQALEIIQKIYEDTKKCSSSLNLPIPKSQHCYVIGAKGSGIAEIFERTGVSIEMPSQDSDDDTIVLYGPNEFLAPALSMV--IQKSESMI-RVNIEAPNWLHRFIIGKQGSNLNKLMEKYEHVFINFP---ENSDLIVIEGPKDDVNELKGQITHKIAELKSTMAIT-EIQVDPRFHRHIIGRSGANIQRMQEEYKVQIRMPGNNAVGTSGWTIRIEGDPEGVKLAKTEIESMSVKLENEKTKDVILDHKYHNQLIGAQGSRVKELRNQYPDVIIMFPDLSSKSDIVQLRGPRQQVDQVAVKLNKFIQEVIENNYTKDVKIFKQYHKNIIGKGGVNIRKIREEMNIRIDFPDEHSDS--------------------------------DKIRLTGKKENVEEAAKRIEAMQAELISIKEDTISIPQRLHISLIGTRGKLIKCIQQECGGVQIQFPASDSNSDIIKIRGPESDVDKAXX-------XXXXXXXXXXXXXHQDSVSAKSEFHKFLIGRKGAQLAEFRKRHAVMLI 2417
            ++H+ ++G++GA++  I+     +V IP   E +++I I G  +G+ +A+ E+ ++ +      T+ + I +RF+  I G    +I +IR+      IN P P+ +S+ + + G K+ V +  + +QK+  D  + S S+++PI K  H  +IG  G+ I +I E +   I++P+++S+ +TI++ G       A S +  IQK  + I  V +  P  LH  +IG +G  +  +ME+   V I+FP     SD +VI GP  DV + K Q+ H +AE K T + T +I+  P +H+ +IG+ G  I+++++    ++  P   A       I I G  + V+ A+ E+E++   L+N     +++D K+H   +  +G  ++E+  +Y  V++ FP   ++SD V L+G +  V+    ++ + I++ +E   T +  I +++H++++G  G  I++I  + +++I FPD   ++                                D I ++G+KE  E A + +EA+    I ++     +P  LH  +IG +G  I+ +  E   V I  PA +  SDII I G  +++D+AK        +L    E   L S + SV+   ++H  +IGRKGA + + R  H V ++
Sbjct:  254 KFHRHLIGKSGANINRIKDQYKVSVRIPPDSEKSNLIRIEGDPQGVQQAKRELLELASRMENERTKDLIIEQRFHRTIIGQKGERIREIRDKFPEVIINFPDPAQKSDIVQLRGPKNEVEKCTKYMQKMVADLVENSYSISVPIFKQFHKNIIGKGGANIKKIREESNTKIDLPAENSNSETIIITGKRANCEAARSRILSIQKDLANIAEVEVSIPAKLHNSLIGTKGRLIRSIMEECGGVHIHFPVEGSGSDTVVIRGPSSDVEKAKKQLLH-LAEEKQTKSFTVDIRAKPEYHKFLIGKGGGKIRKVRDSTGARVIFPA--AEDKDQDLITIIGKEDAVREAQKELEALIQNLDNVVEDSMLVDPKHHRHFVIRRGQVLREIAEEYGGVMVSFPRSGTQSDKVTLKGAKDCVEAAKKRIQEIIED-LEAQVTLECAIPQKFHRSVMGPKGSRIQQITRDFSVQIKFPDREENAVHSTEPVVQENGDEAGEGREAKDCDPGSPRRCDIIIISGRKEKCEAAKEALEALVPVTIEVE-----VPFDLHRYVIGQKGSGIRKMMDEFE-VNIHVPAPELQSDIIAITGLAANLDRAKAGLLERVKELQAEQEDRALRSFKLSVTVDPKYHPKIIGRKGAVITQIRLEHDVNIL 896          

HSP 5 Score: 178.718 bits (452), Expect = 1.003e-44
Identity = 181/740 (24.46%), Postives = 346/740 (46.76%), Query Frame = 3
Query: 1563 GWTIRIEGDPEGVKLAKTEIESMSVKLENEKTKDVILDHKYHNQLIGAQGSRVKELRNQYPDVIIMFPDLSSKSDIVQLRGPRQQVDQVAVKLNKFIQEVIENNYTKDVKIFKQYHKNIIGKGGVNIRKIREEMNIRIDFPDEHSDSDKIRLTGKKENVEEAAKRIEAMQAELI-SIKEDTISIPQRLHISLIGTRGKLIKCIQQECGGVQIQFPASDSNSDIIKIRGPESDVDKAXXXXXXXXXXXXXXXHQDSVSAKSEFHKFLIGRKGAQLAEFRKRHAVML-IFPDSEDTNKDTIQIIGAKEAVQKAKEELEVTIKSLENEIEKYITIDTKWHKHFFKKRQAVMEEISREFGGVRIFFPKQDAVENIDQVRVIGPKGCVEAAVVRIEDIIENL-EAQTSLSVFIEQKHHRNLITRNMMEIKSIQSNYDVTIKFP----------------------NRDLSSKPGENGMEEIHLN-----------GNGDVNIETMEEVDSTL--ESEQNNPANWVTISGRKENCESAEDALLELV------PITEDVPLANEFHRNFIGQKGQGINTFSTKHNVVVNIPPA-NKCSDFISIKGPRVNIIDAKAGLDELITMWENEKQDRIARNYENHVTVPIVFHRNIIGQRGANI-EIFRTKFNVSIQIPDQNSKSEEITIRGYEEDVKKAEEELISMVEKWKAQVKEELHIPRDVHPQLIGTRGIALRKLRDQFKVEINFPNR 3644
            G +I + G  + V  A+ +I +   +L+ + +  V +  ++H  +IG  G ++++L  +     I  P     S+ +++ G ++ +++   ++   I    +    + +++ K +H  I G     + +I +E   RI+ P    +  +I  TG+KE + +A  RI+ +  E   S    +++ P  LH  +IG +G+ +  I Q+   V I+F   +   D I + GP  DV+ A++Q+  + +  +       ++   +FH+ LIG+ GA +   + ++ V + I PDSE +N   I+I G  + VQ+AK EL      +ENE  K + I+ ++H+    ++   + EI  +F  V I FP  D  +  D V++ GPK  VE     ++ ++ +L E   S+SV I ++ H+N+I +    IK I+   +  I  P                      +R LS +     + E+ ++             G +    MEE          + + ++ V I G   + E A+  LL L         T D+    E+H+  IG+ G  I          V  P A +K  D I+I G    + +A+  L+ LI   +N  +D +  + ++H        R+ + +RG  + EI      V +  P   ++S+++T++G ++ V+ A++ +  ++E  +AQV  E  IP+  H  ++G +G  ++++   F V+I FP+R
Sbjct:    2 GLSIMVSGKLDAVMKARKDIVA---RLQTQASATVAIPKEHHRFVIGKNGEKLQDLELKTA-TKIQIPRPDDPSNQIKITGTKEGIEKARHEV-LLISAEQDKRAVERLEVEKAFHPFIAGPYNRLVGEIMQETGTRINIPPPSVNRTEIVFTGEKEQLAQAVARIKKIYEEKANSFTVSSVAAPSWLHRFIIGKKGQNLAKITQQMPKVHIEFTEGE---DKITLEGPTEDVNVAQEQIEGMVKDLINRMDYVEINIDHKFHRHLIGKSGANINRIKDQYKVSVRIPPDSEKSN--LIRIEGDPQGVQQAKRELLELASRMENERTKDLIIEQRFHRTIIGQKGERIREIRDKFPEVIINFP--DPAQKSDIVQLRGPKNEVEKCTKYMQKMVADLVENSYSISVPIFKQFHKNIIGKGGANIKKIREESNTKIDLPAENSNSETIIITGKRANCEAARSRILSIQKDLANIAEVEVSIPAKLHNSLIGTKGRLIRSIMEECGGVHIHFPVEGSGSDTVVIRGPSSDVEKAKKQLLHLAEEKQTKSFTVDIRAKPEYHKFLIGKGGGKIRKVRDSTGARVIFPAAEDKDQDLITIIGKEDAVREAQKELEALIQNLDNVVEDSMLVDPKHH--------RHFVIRRGQVLREIAEEYGGVMVSFPRSGTQSDKVTLKGAKDCVEAAKKRIQEIIEDLEAQVTLECAIPQKFHRSVMGPKGSRIQQITRDFSVQIKFPDR 721          
BLAST of High density lipoprotein binding protein (Vigilin) vs. Ensembl Celegans
Match: vgln-1 (ViGiLN homolog [Source:UniProtKB/TrEMBL;Acc:B3GWB2])

HSP 1 Score: 707.983 bits (1826), Expect = 0.000e+0
Identity = 439/1248 (35.18%), Postives = 701/1248 (56.17%), Query Frame = 3
Query:  204 VEESTQSPLLVLQYDDQFPPLPTCNTPKIVQNSKPRIGQTKTSHVTQTLTVPLAER----RFSNREANNSVKN----DAQKKICQTVAQKCGVSIELNSGNKDQNLMVFISGPQDNVSNAKRILTKEXXXXXXXXMKVPKEYHKFILGRNGASLREIESGSNTNVTIPRSIENNDIITIFGTKEGIDKARAEINQIVAERSKLATERITIPKRFYPFINGSNNSKIYKIREMTNAKXXXXXXXXXXXXXXXXGEKDGVYQALEIIQKIYEDTKKCSSSLNLPIPKSQHCYVIGAKGSGIAEIFERTGVSIEMPSQDSDDDTIVLYGPNEFLAPALSMVIQKSESMIRVNIEAPNWLHRFIIGKQGSNLNKLMEKYEHVFINFPENSDLIVIEGPKDDVNELKGQITHKIAELKSTMAITEIQVDPRFHRHIIGRSGANIQRMQEEYKVQIRMPGNNAVGTSGWTIRIEGDPEGVKLAKTEIESMSVKLENEKTKDVILDHKYHNQLIGAQGSRVKELRNQYPDVIIMFPDLSSKSDIVQLRGPRQQVDQVAVKLNKFIQEVIENNYTKDVKIFKQYHKNIIGKGGVNIRKIREEMNIRIDFPDEHSDSDKIRLTGKKENVEEAAKRIEAMQAELISIKEDTISIPQRLHISLIGTRGKLIKCIQQECGGVQIQFPASDSNSDIIKIRGPESDVDKAXXXXXXXXXXXXXXXHQDSVSAKSEFHKFLIGRKGAQLAEFRKRHAVMLIFPDSEDTNKDTIQIIGAKEAVQKAKEELEVTIKSLENEIEKYITIDTKWHKHFFKKRQAVMEEISREFGGVRIFFPKQDAVENIDQVRVIGPKGCVEAAVVRIEDIIENLEAQTSLSVFIEQKHHRNLITRNMMEIKSIQSNYDVTIKFPNRDLSSKPGENGMEEIHLNGNGDVNIETMEEVDSTLESEQNNPANWVTISGRKENCESAEDALLELVPITEDVPLANEFHRNFIGQKGQGINTFSTKHNVVVNIPPANKCSDFISIKGPRVNIIDAKAGLDELITMWENEKQDRIARNYENHVTVPIVFHRNIIGQRGANIEIFRTKFNVSIQIPDQNSKSEEITIRGYEEDVKKAEEELISMVEKWKAQVKEELHIPRDVHPQLIGTRGIALRKLRDQFKVEINFPNRNVDDEKAHLVEVIGDKEN-VDKCCDILVERANELLNEWEERNQVREVKNLIKDRENINSSSNIKEKGPGFLLTGAPWQQRVPDASSNVDFPKI 3920
            ++ +T   ++   Y   FP LP          S P   QT   HV    T+  +E     R ++ E +N VK+      + K  Q +A      IEL S +KD  L V + G +     A+  + ++LQTQ   ++ +PK++H  ++G+ GA LR +E+ +N  + IP     +  ITI G +EGI +A A I  +    +KLATE I  PK    F+ G  N    ++ +    KINIPPP V +E I ++GEKDGV +    I++I E +KK  SS+ + + ++QH Y++G   SGI ++ ++TG  +E+P++DS  D + L G  + LA AL++VI+++ S++  +I APNWLH+ +IG +G+ L  L+    +V I F +NS+ I +EG  ++V      ++ ++A L+  +AI +++V P  HRH+IGR G+ I ++++++ VQI +P      T+   I +EG  EGVK A TEI ++  K+ENEK++D+I+  + H  +IG++GS V+ +R+ +P+V ++FPD  SKSD+V +RG + +VD V  KL    +E  ENNY + V IFK++ K+I+GKGG +IRK+R+E   RID P+  SD  KI +TGK+ NVE+A  ++  +Q EL ++ E++I IPQ++     G   +LI  I+ ECGGV I+FP+  S S  + IRGP  DV KA   L  L++       +D+V AK EFH+FLIG+ G+++A+ R    V ++FP   D  K+TI ++G KE V KAK  LE  IK L   ++  IT+D K++K+F  +  A+++EI  + GGV I FPK     +  +V + G K CVEAA  RIED++E+ E Q + +V I  + HR L+     +I  +QS Y+V+I+FPN                                     E +  ++ VT+SGR    E A++ALL +VPI++ + L  + HR+ IG+ G+ +      ++V ++IP  N   D I++ G   N+  A   L   +  +E + +DR  + +   + VP  +H+ IIGQRGA I   + K+ V I +P ++  +E ITI+GYEE   +    +  M+ + ++   +E+ +    HP+LIG RG  L+K+ + ++VEI  P +  +D   +LV V G  EN V  C D L     E L +  ER Q       +  R+  ++++   ++     + GAPWQ    D  S+  FP +
Sbjct:   14 IDPATGGAVMSFSYASDFPTLPDA-----APASAPTAKQT---HVWSRPTLSKSEVNITFRLASDERSNKVKSFGSTSEESKKAQAIATATKTRIEL-SESKDGELTVVVKGERAKAEEARARIIRDLQTQASREIDIPKDHHGRLIGKEGALLRNLEAETNCRIQIPNRDGPSSKITITGPREGIQRAAAHILAVSEREAKLATEHIVCPKNLVAFVRGPKNETYDRLTQNNGVKINIPPPHVTNEVISVTGEKDGVLRVAAEIRQIIE-SKKNVSSIQVAVARTQHRYIVGQSRSGIHDVLQKTGCVVEVPAEDSGSDQVTLIGNAQDLAKALALVIERASSVVTQSISAPNWLHKHLIGPKGATLTALVPNRNNVQIEF-DNSNQIFLEGSPEEVKLAFEPLSKEVARLQMELAIEKVKVHPTLHRHVIGRGGSLISKIKDQHGVQITIPNEE---TNSDEIVVEGKKEGVKKAVTEIRAIVTKIENEKSRDIIIPQRLHKLIIGSKGSGVQVIRDSHPNVSVVFPDAKSKSDVVNIRGDKTEVDAVYKKLTALSKEYAENNYQQTVAIFKEFLKHIVGKGGASIRKLRDETETRIDLPESGSDDGKITVTGKQANVEKAVAQLNKIQEELANVAEESIEIPQKVQSRFFGNGRRLISDIEDECGGVHIRFPSEKSESTKVTIRGPAGDVAKAVGLLSALAKDKEENYVEDTVKAKPEFHRFLIGKGGSKIAKLRDTLNVRVMFPKEGDAEKETIHLLGKKEDVPKAKAALEDAIKQLSETVDIKITVDPKYYKNFLARGAALVKEIQEQNGGVVISFPKNGT--DSSEVSIRGSKQCVEAAKNRIEDVVEDYEKQITDNVTIPAQFHRGLLAGRGAKIHELQSKYNVSIRFPNN----------------------------------REEGSEGSDQVTVSGRDTKVEEAKEALLAMVPISKVIQLPVDMHRSIIGRGGETVRKLMQDYDVNISIPKDNSSED-ITVTGQTENVDQALEALRGKLGEYEAQAEDRKLKQWSMSINVPTDYHQKIIGQRGATITALKEKYGVIINVPREDG-NETITIQGYEEKANECAAAIEEMISELRSMFTQEISLDARYHPRLIGQRGKNLKKVMEDYRVEIRLPRQGAED--PNLVVVAGKDENDVYDCIDHLRAEEEEFLLDNVERTQ------YMSPRQQESNNTRHHQQPTSVQMKGAPWQL---DLGSSEQFPDM 1198          
BLAST of High density lipoprotein binding protein (Vigilin) vs. Ensembl Celegans
Match: vgln-1 (ViGiLN homolog [Source:UniProtKB/TrEMBL;Acc:B3GWB2])

HSP 1 Score: 342.813 bits (878), Expect = 1.313e-99
Identity = 251/837 (29.99%), Postives = 445/837 (53.17%), Query Frame = 3
Query:  204 VEESTQSPLLVLQYDDQFPPLPTCNTPKIVQNSKPRIGQTKTSHVTQTLTVPLAER----RFSNREANNSVKN----DAQKKICQTVAQKCGVSIELNSGNKDQNLMVFISGPQDNVSNAKRILTKEXXXXXXXXMKVPKEYHKFILGRNGASLREIESGSNTNVTIPRSIENNDIITIFGTKEGIDKARAEINQIVAERSKLATERITIPKRFYPFINGSNNSKIYKIREMTNAKXXXXXXXXXXXXXXXXGEKDGVYQALEIIQKIYEDTKKCSSSLNLPIPKSQHCYVIGAKGSGIAEIFERTGVSIEMPSQDSDDDTIVLYGPNEFLAPALSMVIQKSESMIRVNIEAPNWLHRFIIGKQGSNLNKLMEKYEHVFINFPENSDLIVIEGPKDDVNELKGQITHKIAELKSTMAITEIQVDPRFHRHIIGRSGANIQRMQEEYKVQIRMPGNNAVGTSGWTIRIEGDPEGVKLAKTEIESMSVKLENEKTKDVILDHKYHNQLIGAQGSRVKELRNQYPDVIIMFPDLSSKSDIVQLRGPRQQVDQVAVKLNKFIQEVIENNYTKDVKIFKQYHKNIIGKGGVNIRKIREEMNIRIDFPDEHSD----SDKIRLTGKKENVEEAAKRIEAMQAELISIKEDTISIPQRLHISLIGTRGKLIKCIQQECGGVQIQFPASDSNSDIIKIRGPESDVDKAXXXXXXXXXXXXXXXHQD-------SVSAKSEFHKFLIGRKGAQLAEFRKRHAVMLIFPDSEDTNKDTIQIIGAKEAVQKAKEELEVTIKSLENEIEKYITIDTKWHKHFFKKRQAVMEEISREFGGVRIFFPKQDA 2657
            ++ +T   ++   Y   FP LP          S P   QT   HV    T+  +E     R ++ E +N VK+      + K  Q +A      IEL S +KD  L V + G +     A+  + ++LQTQ   ++ +PK++H  ++G+ GA LR +E+ +N  + IP     +  ITI G +EGI +A A I  +    +KLATE I  PK    F+ G  N    ++ +    KINIPPP V +E I ++GEKDGV +    I++I E +KK  SS+ + + ++QH Y++G   SGI ++ ++TG  +E+P++DS  D + L G  + LA AL++VI+++ S++  +I APNWLH+ +IG +G+ L  L+    +V I F +NS+ I +EG  ++V      ++ ++A L+  +AI +++V P  HRH+IGR G+ I ++++++ VQI +P      T+   I +EG  EGVK  K  +E    +L       + +D KY+   +    + VKE++ Q   V+I FP   + S  V +RG +Q V+    ++   +++  E   T +V I  Q+H+ ++   G  I +++ + N+ I FP+   +    SD++ ++G+   VEEA + + AM    + I +  I +P  +H S+IG  G+ ++ + Q+   V I  P  +S+ DI  + G   +VD+A + L     +    +          S++  +++H+ +IG++GA +   ++++ V++  P  ED N +TI I G +E   +    +E  I  L +   + I++D ++H     +R   ++++  ++  V I  P+Q A
Sbjct:   14 IDPATGGAVMSFSYASDFPTLPDA-----APASAPTAKQT---HVWSRPTLSKSEVNITFRLASDERSNKVKSFGSTSEESKKAQAIATATKTRIEL-SESKDGELTVVVKGERAKAEEARARIIRDLQTQASREIDIPKDHHGRLIGKEGALLRNLEAETNCRIQIPNRDGPSSKITITGPREGIQRAAAHILAVSEREAKLATEHIVCPKNLVAFVRGPKNETYDRLTQNNGVKINIPPPHVTNEVISVTGEKDGVLRVAAEIRQIIE-SKKNVSSIQVAVARTQHRYIVGQSRSGIHDVLQKTGCVVEVPAEDSGSDQVTLIGNAQDLAKALALVIERASSVVTQSISAPNWLHKHLIGPKGATLTALVPNRNNVQIEF-DNSNQIFLEGSPEEVKLAFEPLSKEVARLQMELAIEKVKVHPTLHRHVIGRGGSLISKIKDQHGVQITIPNEE---TNSDEIVVEGKKEGVK--KAALEDAIKQLSETVDIKITVDPKYYKNFLARGAALVKEIQEQNGGVVISFPKNGTDSSEVSIRGSKQCVEAAKNRIEDVVEDY-EKQITDNVTIPAQFHRGLLAGRGAKIHELQSKYNVSIRFPNNREEGSEGSDQVTVSGRDTKVEEAKEALLAM----VPISK-VIQLPVDMHRSIIGRGGETVRKLMQDY-DVNISIPKDNSSEDIT-VTGQTENVDQALEALRGKLGEYEAQAEDRKLKQWSMSINVPTDYHQKIIGQRGATITALKEKYGVIINVP-REDGN-ETITIQGYEEKANECAAAIEEMISELRSMFTQEISLDARYHPRLIGQRGKNLKKVMEDY-RVEIRLPRQGA 823          

HSP 2 Score: 318.931 bits (816), Expect = 2.612e-91
Identity = 242/860 (28.14%), Postives = 421/860 (48.95%), Query Frame = 3
Query: 1344 IVIEGPKDDVNELKGQITHKIAELKSTMAITEIQVDPRFHRHIIGRSGANIQRMQEEYKVQIRMPGNNAVGTSGWTIRIEGDPEGVKLAKTEIESMSVKLENEKTKDVILDHKYHNQLIGAQGSRVKELRNQYPDVIIMFPDLSSKSDIVQLRGPRQQVDQVAVKLNKFIQEVIENNYTKDVKIFKQYHKNIIGKGGVNIRKIREEMNIRIDFPDEHSDSDKIRLTGKKENVEEAAKRIEAMQAELISIKEDTISIPQRLHISLIGTRGKLIKCIQQECGGVQIQFPASDSNSDIIKIRGPESDVDKAXXXXXXXXXXXXXXXHQDSVSAKSEFHKFLIGRKGAQLAEFRKRHAVMLIFPDSEDTNKDTIQIIGAKEAVQKAKEELEVTIKSLENEIEKYITIDTKWHKHFFKKRQAVMEEISREFGGVRIFFPKQDAVENIDQVRVIGPKGCVEAAVVRIEDIIENLEAQTSLSVFIEQKHHRNLITRNMMEIKSIQSNYDVTIKFPNRDLSSKPGENGMEEIHLNGNGDVNIETMEEVDSTLESEQNNPANWVTISGRKENCESAEDALLELVPITEDVPLANEFHRNFIGQKGQGINTFSTKHNVVVNIPPANKCSDFISIKGPRVNIIDAKAGLDELITMWENEKQDRIARNYENHVTVPIVFHRNIIGQRGANIEIFRTKFNVSIQIPDQNSKSEEITIRGYEEDVKKAEEELISMVEKWKAQVKEELHIPRDVHPQLIGTRGIALRKLRDQFKVEINFPNRNVDDEKAHLVEVIGDKEN-VDKCCDILVERANELLNEWEERNQVREVKNLIKDRENINSSSNIKEKGPGFLLTGAPWQQRVPDASSNVDFPKI 3920
            +V++G +    E + +I   +     T A  EI +    H  +IG+ GA ++ ++ E   +I++P  +   +    I I G  EG++ A   I ++S +     T+ ++        + G +      L  Q   V I  P     ++++ + G +  V +VA ++ + I E  +N  +  V + +  H+ I+G+    I  + ++    ++ P E S SD++ L G   N ++ AK +  +     S+   +IS P  LH  LIG +G  +  +      VQI+F     NS+ I + G   +V  A + L +   +  +    + V      H+ +IGR G+ +++ + +H V +  P+ E+TN D I + G KE V+KA   LE  IK L   ++  IT+D K++K+F  +  A+++EI  + GGV I FPK     +  +V + G K CVEAA  RIED++E+ E Q + +V I  + HR L+     +I  +QS Y+V+I+FPN   + + G  G ++                               VT+SGR    E A++ALL +VPI++ + L  + HR+ IG+ G+ +      ++V ++IP  N   D I++ G   N+  A   L   +  +E + +DR  + +   + VP  +H+ IIGQRGA I   + K+ V I +P ++  +E ITI+GYEE   +    +  M+ + ++   +E+ +    HP+LIG RG  L+K+ + ++VEI  P +  +D   +LV V G  EN V  C D L     E L +  ER Q       +  R+  ++++   ++     + GAPWQ    D  S+  FP +
Sbjct:  112 VVVKGERAKAEEARARIIRDL----QTQASREIDIPKDHHGRLIGKEGALLRNLEAETNCRIQIPNRDGPSSK---ITITGPREGIQRAAAHILAVSEREAKLATEHIVCPKNLVAFVRGPKNETYDRL-TQNNGVKINIPPPHVTNEVISVTGEKDGVLRVAAEIRQII-ESKKNVSSIQVAVARTQHRYIVGQSRSGIHDVLQKTGCVVEVPAEDSGSDQVTLIG---NAQDLAKALALVIERASSVVTQSISAPNWLHKHLIGPKGATLTALVPNRNNVQIEF----DNSNQIFLEGSPEEVKLAFEPLSKEVARLQMELAIEKVKVHPTLHRHVIGRGGSLISKIKDQHGVQITIPN-EETNSDEIVVEGKKEGVKKAA--LEDAIKQLSETVDIKITVDPKYYKNFLARGAALVKEIQEQNGGVVISFPKNGT--DSSEVSIRGSKQCVEAAKNRIEDVVEDYEKQITDNVTIPAQFHRGLLAGRGAKIHELQSKYNVSIRFPN---NREEGSEGSDQ-------------------------------VTVSGRDTKVEEAKEALLAMVPISKVIQLPVDMHRSIIGRGGETVRKLMQDYDVNISIPKDNSSED-ITVTGQTENVDQALEALRGKLGEYEAQAEDRKLKQWSMSINVPTDYHQKIIGQRGATITALKEKYGVIINVPREDG-NETITIQGYEEKANECAAAIEEMISELRSMFTQEISLDARYHPRLIGQRGKNLKKVMEDYRVEIRLPRQGAED--PNLVVVAGKDENDVYDCIDHLRAEEEEFLLDNVERTQ------YMSPRQQESNNTRHHQQPTSVQMKGAPWQL---DLGSSEQFPDM 903          
BLAST of High density lipoprotein binding protein (Vigilin) vs. Ensembl Fly
Match: Dp1 (gene:FBgn0027835 transcript:FBtr0086681)

HSP 1 Score: 764.607 bits (1973), Expect = 0.000e+0
Identity = 479/1256 (38.14%), Postives = 746/1256 (59.39%), Query Frame = 3
Query:  234 VLQYDDQFPPLPTCNTPKIVQN--SKPRIGQTKTSHVTQTLTVPLAERRFSNREANNSVKNDAQKKICQTVAQKCGVSIELNSGNKDQNLMVFISGPQDNVSNAKRILTKEXXXXXXXXMKVPKEYHKFILGRNGASLREIESGSNTNVTIPRSIENNDIITIFGTKEGIDKARAEINQIVAERSKLATERITIPKRFYPFINGSNNSKIYKIREMTNAKXXXXXXXXXXXXXXXXGEKDGVYQALEIIQKIYEDTKKCSSSLNLPIPKSQHCYVIGAKGSGIAEIFERTGVSIEMPSQDSDDDTIVLYGPNEFLAPALSMVIQKSESMIRVNIEAPNWLHRFIIGKQGSNLNKLMEKYEHVFINFPENSDLIVIEGPKDDVNELKGQITHKIAELKSTMAITEIQVDPRFHRHIIGRSGANIQRMQEEYKVQIRMP---GNNAVGTSGWTIRIEGDPEGVKLAKTEIESMSVKLENEKTKDVILDHKYHNQLIGAQGSRVKELRNQYPDVIIMFPDLSSKSDIVQLRGPRQQVDQVAVKLNKFIQEVIENNYTKDVKIFKQYHKNIIGKGGVNIRKIREEMNIRIDFPDEHSDSDKIRLTGKKENVEEAAKRIEAMQAELISIKEDTISIPQRLHISLIGTRGKLIKCIQQECGGVQIQFPASDSNSDIIKIRGPESDVDKAXXXXXXXXXXXXXXXHQDSVSAKSEFHKFLIGRKGAQLAEFRKRHAVMLIFPDSEDTNKDTIQIIGAKEAVQKAKEELEVTIKSLENEIEKYITIDTKWHKHFFKKRQAVMEEISREFGGVRIFFPKQDAVENIDQVRVIGPKGCVEAAVVRIEDIIENLEAQTSLSVFIEQKHHRNLITRNMMEIKSIQSNYDVTIKFPNRDLSSKPGENGMEEIHLNGNGDVNIETMEEVDSTLESEQN--NPANWVTISGRKENCESAEDALLELVPITEDVPLANEFHRNFIGQKGQGINTFSTKHNVVVNIPPANKCSDFISIKGPRVNIIDAKAGLDELITMWENEKQDRIARNYENHVTVPIVFHRNIIGQRGANIEIFRTKFNVSIQIPDQNSKSEE-ITIRGYEEDVKKAEEELISMVEKWKAQVKEELHIPRDVHPQLIGTRGIALRKLRDQFKVEINFPNRNVDDEKAHLVEVIGDKENVDKCCDILVERANELLNEWEERNQVR--EVKNLIKDRENINSSSNIKEKGPGFLLTGAPWQQR-------VPDASSNVDFPKIDANGDKIAGT 3950
               YDD FP LP  NT    Q+  S   + +  +S  T  + VP  ER+ +  E          K+ICQ + ++ G  IE+ SG K+Q+L   I G Q  + +A+R +     TQ   Q+ VP+E+ + ILG+ G  LREIE  + T + IP   + ++ ITI GTKEGI +A  EI Q+ AE+ K +++RIT+PK ++PFI G  +  + K++E T A+IN+PP  V+ +EI+ISGEKD V  A   ++ IY+D +K  S++++ + K +H YVIG KGS IAEI + TGVS+EMP  DS  +TI L GP   L  AL++V QKS S+  V I A +W+H+++IG++G+N+ +L E   +V +N  E  D I +EG  ++V+     ++  I   +       + V+P +++HIIG++GAN+ R+++E KV I +    G N        IRIEG  EGV+ A+ E++    KLENEK+KDVI+D + H  +IGA+G +++E++++Y  V I  P     +DIV+LRGP++ VD+    L K ++E+ E+++  +V IFKQ+HK +IGKGG NI+KIR+E   +ID P E   ++ I +TGKKENV EA +RI+ +Q EL  I  + + IP + + S+IGT GKLI  I +ECGGV I+FP SDS SD + IRGP+ DV+KAK QLLEL+ +  L S    V AK + HKFLIG+ GA + + R      +IFP +EDT+K+ I IIG +E+V+KA+E+LE  IK  +   E  +++D K HKHF  KR  ++  IS E GGV I FP+     N D+V + G K C+EAA  RIE+I+ +LEAQT++ V I Q+HHR ++     +++ +   +DV IKFP+RD +++P E G+       NG  N     E +   E+EQ      + + I+GR E CE+A+ ALL+L+PI E++ +  + HR  IG +G  +  F +KH+V V +PP+   SD I + G    + +A+  L ++I  +E ++ DR  R++   V V   FH  +IG+ GA I   R   +V I +P ++  ++  I+I GY+ + + A + ++ +V   +   +E + I + +HP LIG R   +RK+ +  KV I F   + DD+  + + + G  E+V+   ++L   A +   ++ +   +    +   +  + + + ++   E   GF++  APW+++        P+  S  DFP   A G  +A T
Sbjct:   59 AFSYDDLFPALP-ANTSAQSQSGASGSTLARVTSSQKTHIVHVPCKERKSTESE---KFGEGESKRICQQITKETGAQIEIVSG-KNQSLTFLIKGKQSELLDARRKILMGFSTQASRQVTVPREHFRVILGKGGQRLREIERVTATRINIPSQSDESEFITIAGTKEGIAQAEQEIRQLSAEQYKKSSDRITVPKVYHPFIVGPYSENLNKLQEETGARINVPPQQVQKDEIVISGEKDAVAAAKAKVEAIYKDMEKKCSTVSVEVAKPKHRYVIGPKGSTIAEILQLTGVSVEMPPNDSPSETITLRGPQVALGNALTVVYQKSNSVKSVEINAAHWIHKYVIGRKGANMKQLEEDCPNVNVNCLE--DKIKLEGDPENVDRAVAYLSEIIKNYEENFTFEVMTVNPSYYKHIIGKAGANVNRLKDELKVNINIEEREGQN-------NIRIEGPKEGVRQAQLELQEKIDKLENEKSKDVIIDRRLHRSIIGAKGEKIREVKDRYRQVTITIPTPQENTDIVKLRGPKEDVDKCHKDLLKLVKEIQESSHIIEVPIFKQFHKFVIGKGGANIKKIRDETQTKIDLPAEGDTNEVIVITGKKENVLEAKERIQKIQNELSDIVTEEVQIPPKYYNSIIGTGGKLISSIMEECGGVSIKFPNSDSKSDKVTIRGPKDDVEKAKVQLLELANERQLASFTAEVRAKQQHHKFLIGKNGASIRKIRDATGARIIFPSNEDTDKEVITIIGKEESVKKAREQLEAIIKECDEVTEGEVSVDPKHHKHFVAKRGFILHRISEECGGVMISFPRVGI--NSDKVTIKGAKDCIEAARQRIEEIVADLEAQTTIEVVIPQRHHRTIMGARGFKVQQVTFEFDVQIKFPDRD-ATEPVE-GLTNGGSGENGGENEGQEGEQEVEKEAEQEPVRQCDVIRITGRIEKCEAAKQALLDLIPIEEELSVPFDLHRTIIGPRGANVRQFMSKHDVHVELPPSELKSDVIKVCGTPARVAEAREALVKMIEDYEADRADRELRSFVLQVDVDTEFHSKLIGRHGAVINKLRADHDVIISLPKRDEPNDRIISITGYQANAEAARDAILEIVGDPETLHREVIEIDKRIHPHLIGQRRRTIRKIIEDNKVNIKF---SADDDNPNSIFISGKIEDVENVKELLFGMAEDYERDYLDNVAIAPPTIGAFLTGQGSGSDAAGASEN--GFVIKDAPWEKQKQAKNLTAPNTQSQEDFPHFAAGGAPVAST 1291          
BLAST of High density lipoprotein binding protein (Vigilin) vs. Ensembl Fly
Match: Dp1 (gene:FBgn0027835 transcript:FBtr0345226)

HSP 1 Score: 764.607 bits (1973), Expect = 0.000e+0
Identity = 479/1256 (38.14%), Postives = 746/1256 (59.39%), Query Frame = 3
Query:  234 VLQYDDQFPPLPTCNTPKIVQN--SKPRIGQTKTSHVTQTLTVPLAERRFSNREANNSVKNDAQKKICQTVAQKCGVSIELNSGNKDQNLMVFISGPQDNVSNAKRILTKEXXXXXXXXMKVPKEYHKFILGRNGASLREIESGSNTNVTIPRSIENNDIITIFGTKEGIDKARAEINQIVAERSKLATERITIPKRFYPFINGSNNSKIYKIREMTNAKXXXXXXXXXXXXXXXXGEKDGVYQALEIIQKIYEDTKKCSSSLNLPIPKSQHCYVIGAKGSGIAEIFERTGVSIEMPSQDSDDDTIVLYGPNEFLAPALSMVIQKSESMIRVNIEAPNWLHRFIIGKQGSNLNKLMEKYEHVFINFPENSDLIVIEGPKDDVNELKGQITHKIAELKSTMAITEIQVDPRFHRHIIGRSGANIQRMQEEYKVQIRMP---GNNAVGTSGWTIRIEGDPEGVKLAKTEIESMSVKLENEKTKDVILDHKYHNQLIGAQGSRVKELRNQYPDVIIMFPDLSSKSDIVQLRGPRQQVDQVAVKLNKFIQEVIENNYTKDVKIFKQYHKNIIGKGGVNIRKIREEMNIRIDFPDEHSDSDKIRLTGKKENVEEAAKRIEAMQAELISIKEDTISIPQRLHISLIGTRGKLIKCIQQECGGVQIQFPASDSNSDIIKIRGPESDVDKAXXXXXXXXXXXXXXXHQDSVSAKSEFHKFLIGRKGAQLAEFRKRHAVMLIFPDSEDTNKDTIQIIGAKEAVQKAKEELEVTIKSLENEIEKYITIDTKWHKHFFKKRQAVMEEISREFGGVRIFFPKQDAVENIDQVRVIGPKGCVEAAVVRIEDIIENLEAQTSLSVFIEQKHHRNLITRNMMEIKSIQSNYDVTIKFPNRDLSSKPGENGMEEIHLNGNGDVNIETMEEVDSTLESEQN--NPANWVTISGRKENCESAEDALLELVPITEDVPLANEFHRNFIGQKGQGINTFSTKHNVVVNIPPANKCSDFISIKGPRVNIIDAKAGLDELITMWENEKQDRIARNYENHVTVPIVFHRNIIGQRGANIEIFRTKFNVSIQIPDQNSKSEE-ITIRGYEEDVKKAEEELISMVEKWKAQVKEELHIPRDVHPQLIGTRGIALRKLRDQFKVEINFPNRNVDDEKAHLVEVIGDKENVDKCCDILVERANELLNEWEERNQVR--EVKNLIKDRENINSSSNIKEKGPGFLLTGAPWQQR-------VPDASSNVDFPKIDANGDKIAGT 3950
               YDD FP LP  NT    Q+  S   + +  +S  T  + VP  ER+ +  E          K+ICQ + ++ G  IE+ SG K+Q+L   I G Q  + +A+R +     TQ   Q+ VP+E+ + ILG+ G  LREIE  + T + IP   + ++ ITI GTKEGI +A  EI Q+ AE+ K +++RIT+PK ++PFI G  +  + K++E T A+IN+PP  V+ +EI+ISGEKD V  A   ++ IY+D +K  S++++ + K +H YVIG KGS IAEI + TGVS+EMP  DS  +TI L GP   L  AL++V QKS S+  V I A +W+H+++IG++G+N+ +L E   +V +N  E  D I +EG  ++V+     ++  I   +       + V+P +++HIIG++GAN+ R+++E KV I +    G N        IRIEG  EGV+ A+ E++    KLENEK+KDVI+D + H  +IGA+G +++E++++Y  V I  P     +DIV+LRGP++ VD+    L K ++E+ E+++  +V IFKQ+HK +IGKGG NI+KIR+E   +ID P E   ++ I +TGKKENV EA +RI+ +Q EL  I  + + IP + + S+IGT GKLI  I +ECGGV I+FP SDS SD + IRGP+ DV+KAK QLLEL+ +  L S    V AK + HKFLIG+ GA + + R      +IFP +EDT+K+ I IIG +E+V+KA+E+LE  IK  +   E  +++D K HKHF  KR  ++  IS E GGV I FP+     N D+V + G K C+EAA  RIE+I+ +LEAQT++ V I Q+HHR ++     +++ +   +DV IKFP+RD +++P E G+       NG  N     E +   E+EQ      + + I+GR E CE+A+ ALL+L+PI E++ +  + HR  IG +G  +  F +KH+V V +PP+   SD I + G    + +A+  L ++I  +E ++ DR  R++   V V   FH  +IG+ GA I   R   +V I +P ++  ++  I+I GY+ + + A + ++ +V   +   +E + I + +HP LIG R   +RK+ +  KV I F   + DD+  + + + G  E+V+   ++L   A +   ++ +   +    +   +  + + + ++   E   GF++  APW+++        P+  S  DFP   A G  +A T
Sbjct:   59 AFSYDDLFPALP-ANTSAQSQSGASGSTLARVTSSQKTHIVHVPCKERKSTESE---KFGEGESKRICQQITKETGAQIEIVSG-KNQSLTFLIKGKQSELLDARRKILMGFSTQASRQVTVPREHFRVILGKGGQRLREIERVTATRINIPSQSDESEFITIAGTKEGIAQAEQEIRQLSAEQYKKSSDRITVPKVYHPFIVGPYSENLNKLQEETGARINVPPQQVQKDEIVISGEKDAVAAAKAKVEAIYKDMEKKCSTVSVEVAKPKHRYVIGPKGSTIAEILQLTGVSVEMPPNDSPSETITLRGPQVALGNALTVVYQKSNSVKSVEINAAHWIHKYVIGRKGANMKQLEEDCPNVNVNCLE--DKIKLEGDPENVDRAVAYLSEIIKNYEENFTFEVMTVNPSYYKHIIGKAGANVNRLKDELKVNINIEEREGQN-------NIRIEGPKEGVRQAQLELQEKIDKLENEKSKDVIIDRRLHRSIIGAKGEKIREVKDRYRQVTITIPTPQENTDIVKLRGPKEDVDKCHKDLLKLVKEIQESSHIIEVPIFKQFHKFVIGKGGANIKKIRDETQTKIDLPAEGDTNEVIVITGKKENVLEAKERIQKIQNELSDIVTEEVQIPPKYYNSIIGTGGKLISSIMEECGGVSIKFPNSDSKSDKVTIRGPKDDVEKAKVQLLELANERQLASFTAEVRAKQQHHKFLIGKNGASIRKIRDATGARIIFPSNEDTDKEVITIIGKEESVKKAREQLEAIIKECDEVTEGEVSVDPKHHKHFVAKRGFILHRISEECGGVMISFPRVGI--NSDKVTIKGAKDCIEAARQRIEEIVADLEAQTTIEVVIPQRHHRTIMGARGFKVQQVTFEFDVQIKFPDRD-ATEPVE-GLTNGGSGENGGENEGQEGEQEVEKEAEQEPVRQCDVIRITGRIEKCEAAKQALLDLIPIEEELSVPFDLHRTIIGPRGANVRQFMSKHDVHVELPPSELKSDVIKVCGTPARVAEAREALVKMIEDYEADRADRELRSFVLQVDVDTEFHSKLIGRHGAVINKLRADHDVIISLPKRDEPNDRIISITGYQANAEAARDAILEIVGDPETLHREVIEIDKRIHPHLIGQRRRTIRKIIEDNKVNIKF---SADDDNPNSIFISGKIEDVENVKELLFGMAEDYERDYLDNVAIAPPTIGAFLTGQGSGSDAAGASEN--GFVIKDAPWEKQKQAKNLTAPNTQSQEDFPHFAAGGAPVAST 1291          
BLAST of High density lipoprotein binding protein (Vigilin) vs. Ensembl Fly
Match: Dp1 (gene:FBgn0027835 transcript:FBtr0340329)

HSP 1 Score: 764.607 bits (1973), Expect = 0.000e+0
Identity = 479/1256 (38.14%), Postives = 746/1256 (59.39%), Query Frame = 3
Query:  234 VLQYDDQFPPLPTCNTPKIVQN--SKPRIGQTKTSHVTQTLTVPLAERRFSNREANNSVKNDAQKKICQTVAQKCGVSIELNSGNKDQNLMVFISGPQDNVSNAKRILTKEXXXXXXXXMKVPKEYHKFILGRNGASLREIESGSNTNVTIPRSIENNDIITIFGTKEGIDKARAEINQIVAERSKLATERITIPKRFYPFINGSNNSKIYKIREMTNAKXXXXXXXXXXXXXXXXGEKDGVYQALEIIQKIYEDTKKCSSSLNLPIPKSQHCYVIGAKGSGIAEIFERTGVSIEMPSQDSDDDTIVLYGPNEFLAPALSMVIQKSESMIRVNIEAPNWLHRFIIGKQGSNLNKLMEKYEHVFINFPENSDLIVIEGPKDDVNELKGQITHKIAELKSTMAITEIQVDPRFHRHIIGRSGANIQRMQEEYKVQIRMP---GNNAVGTSGWTIRIEGDPEGVKLAKTEIESMSVKLENEKTKDVILDHKYHNQLIGAQGSRVKELRNQYPDVIIMFPDLSSKSDIVQLRGPRQQVDQVAVKLNKFIQEVIENNYTKDVKIFKQYHKNIIGKGGVNIRKIREEMNIRIDFPDEHSDSDKIRLTGKKENVEEAAKRIEAMQAELISIKEDTISIPQRLHISLIGTRGKLIKCIQQECGGVQIQFPASDSNSDIIKIRGPESDVDKAXXXXXXXXXXXXXXXHQDSVSAKSEFHKFLIGRKGAQLAEFRKRHAVMLIFPDSEDTNKDTIQIIGAKEAVQKAKEELEVTIKSLENEIEKYITIDTKWHKHFFKKRQAVMEEISREFGGVRIFFPKQDAVENIDQVRVIGPKGCVEAAVVRIEDIIENLEAQTSLSVFIEQKHHRNLITRNMMEIKSIQSNYDVTIKFPNRDLSSKPGENGMEEIHLNGNGDVNIETMEEVDSTLESEQN--NPANWVTISGRKENCESAEDALLELVPITEDVPLANEFHRNFIGQKGQGINTFSTKHNVVVNIPPANKCSDFISIKGPRVNIIDAKAGLDELITMWENEKQDRIARNYENHVTVPIVFHRNIIGQRGANIEIFRTKFNVSIQIPDQNSKSEE-ITIRGYEEDVKKAEEELISMVEKWKAQVKEELHIPRDVHPQLIGTRGIALRKLRDQFKVEINFPNRNVDDEKAHLVEVIGDKENVDKCCDILVERANELLNEWEERNQVR--EVKNLIKDRENINSSSNIKEKGPGFLLTGAPWQQR-------VPDASSNVDFPKIDANGDKIAGT 3950
               YDD FP LP  NT    Q+  S   + +  +S  T  + VP  ER+ +  E          K+ICQ + ++ G  IE+ SG K+Q+L   I G Q  + +A+R +     TQ   Q+ VP+E+ + ILG+ G  LREIE  + T + IP   + ++ ITI GTKEGI +A  EI Q+ AE+ K +++RIT+PK ++PFI G  +  + K++E T A+IN+PP  V+ +EI+ISGEKD V  A   ++ IY+D +K  S++++ + K +H YVIG KGS IAEI + TGVS+EMP  DS  +TI L GP   L  AL++V QKS S+  V I A +W+H+++IG++G+N+ +L E   +V +N  E  D I +EG  ++V+     ++  I   +       + V+P +++HIIG++GAN+ R+++E KV I +    G N        IRIEG  EGV+ A+ E++    KLENEK+KDVI+D + H  +IGA+G +++E++++Y  V I  P     +DIV+LRGP++ VD+    L K ++E+ E+++  +V IFKQ+HK +IGKGG NI+KIR+E   +ID P E   ++ I +TGKKENV EA +RI+ +Q EL  I  + + IP + + S+IGT GKLI  I +ECGGV I+FP SDS SD + IRGP+ DV+KAK QLLEL+ +  L S    V AK + HKFLIG+ GA + + R      +IFP +EDT+K+ I IIG +E+V+KA+E+LE  IK  +   E  +++D K HKHF  KR  ++  IS E GGV I FP+     N D+V + G K C+EAA  RIE+I+ +LEAQT++ V I Q+HHR ++     +++ +   +DV IKFP+RD +++P E G+       NG  N     E +   E+EQ      + + I+GR E CE+A+ ALL+L+PI E++ +  + HR  IG +G  +  F +KH+V V +PP+   SD I + G    + +A+  L ++I  +E ++ DR  R++   V V   FH  +IG+ GA I   R   +V I +P ++  ++  I+I GY+ + + A + ++ +V   +   +E + I + +HP LIG R   +RK+ +  KV I F   + DD+  + + + G  E+V+   ++L   A +   ++ +   +    +   +  + + + ++   E   GF++  APW+++        P+  S  DFP   A G  +A T
Sbjct:   59 AFSYDDLFPALP-ANTSAQSQSGASGSTLARVTSSQKTHIVHVPCKERKSTESE---KFGEGESKRICQQITKETGAQIEIVSG-KNQSLTFLIKGKQSELLDARRKILMGFSTQASRQVTVPREHFRVILGKGGQRLREIERVTATRINIPSQSDESEFITIAGTKEGIAQAEQEIRQLSAEQYKKSSDRITVPKVYHPFIVGPYSENLNKLQEETGARINVPPQQVQKDEIVISGEKDAVAAAKAKVEAIYKDMEKKCSTVSVEVAKPKHRYVIGPKGSTIAEILQLTGVSVEMPPNDSPSETITLRGPQVALGNALTVVYQKSNSVKSVEINAAHWIHKYVIGRKGANMKQLEEDCPNVNVNCLE--DKIKLEGDPENVDRAVAYLSEIIKNYEENFTFEVMTVNPSYYKHIIGKAGANVNRLKDELKVNINIEEREGQN-------NIRIEGPKEGVRQAQLELQEKIDKLENEKSKDVIIDRRLHRSIIGAKGEKIREVKDRYRQVTITIPTPQENTDIVKLRGPKEDVDKCHKDLLKLVKEIQESSHIIEVPIFKQFHKFVIGKGGANIKKIRDETQTKIDLPAEGDTNEVIVITGKKENVLEAKERIQKIQNELSDIVTEEVQIPPKYYNSIIGTGGKLISSIMEECGGVSIKFPNSDSKSDKVTIRGPKDDVEKAKVQLLELANERQLASFTAEVRAKQQHHKFLIGKNGASIRKIRDATGARIIFPSNEDTDKEVITIIGKEESVKKAREQLEAIIKECDEVTEGEVSVDPKHHKHFVAKRGFILHRISEECGGVMISFPRVGI--NSDKVTIKGAKDCIEAARQRIEEIVADLEAQTTIEVVIPQRHHRTIMGARGFKVQQVTFEFDVQIKFPDRD-ATEPVE-GLTNGGSGENGGENEGQEGEQEVEKEAEQEPVRQCDVIRITGRIEKCEAAKQALLDLIPIEEELSVPFDLHRTIIGPRGANVRQFMSKHDVHVELPPSELKSDVIKVCGTPARVAEAREALVKMIEDYEADRADRELRSFVLQVDVDTEFHSKLIGRHGAVINKLRADHDVIISLPKRDEPNDRIISITGYQANAEAARDAILEIVGDPETLHREVIEIDKRIHPHLIGQRRRTIRKIIEDNKVNIKF---SADDDNPNSIFISGKIEDVENVKELLFGMAEDYERDYLDNVAIAPPTIGAFLTGQGSGSDAAGASEN--GFVIKDAPWEKQKQAKNLTAPNTQSQEDFPHFAAGGAPVAST 1291          
BLAST of High density lipoprotein binding protein (Vigilin) vs. Ensembl Fly
Match: Dp1 (gene:FBgn0027835 transcript:FBtr0086682)

HSP 1 Score: 764.607 bits (1973), Expect = 0.000e+0
Identity = 479/1256 (38.14%), Postives = 746/1256 (59.39%), Query Frame = 3
Query:  234 VLQYDDQFPPLPTCNTPKIVQN--SKPRIGQTKTSHVTQTLTVPLAERRFSNREANNSVKNDAQKKICQTVAQKCGVSIELNSGNKDQNLMVFISGPQDNVSNAKRILTKEXXXXXXXXMKVPKEYHKFILGRNGASLREIESGSNTNVTIPRSIENNDIITIFGTKEGIDKARAEINQIVAERSKLATERITIPKRFYPFINGSNNSKIYKIREMTNAKXXXXXXXXXXXXXXXXGEKDGVYQALEIIQKIYEDTKKCSSSLNLPIPKSQHCYVIGAKGSGIAEIFERTGVSIEMPSQDSDDDTIVLYGPNEFLAPALSMVIQKSESMIRVNIEAPNWLHRFIIGKQGSNLNKLMEKYEHVFINFPENSDLIVIEGPKDDVNELKGQITHKIAELKSTMAITEIQVDPRFHRHIIGRSGANIQRMQEEYKVQIRMP---GNNAVGTSGWTIRIEGDPEGVKLAKTEIESMSVKLENEKTKDVILDHKYHNQLIGAQGSRVKELRNQYPDVIIMFPDLSSKSDIVQLRGPRQQVDQVAVKLNKFIQEVIENNYTKDVKIFKQYHKNIIGKGGVNIRKIREEMNIRIDFPDEHSDSDKIRLTGKKENVEEAAKRIEAMQAELISIKEDTISIPQRLHISLIGTRGKLIKCIQQECGGVQIQFPASDSNSDIIKIRGPESDVDKAXXXXXXXXXXXXXXXHQDSVSAKSEFHKFLIGRKGAQLAEFRKRHAVMLIFPDSEDTNKDTIQIIGAKEAVQKAKEELEVTIKSLENEIEKYITIDTKWHKHFFKKRQAVMEEISREFGGVRIFFPKQDAVENIDQVRVIGPKGCVEAAVVRIEDIIENLEAQTSLSVFIEQKHHRNLITRNMMEIKSIQSNYDVTIKFPNRDLSSKPGENGMEEIHLNGNGDVNIETMEEVDSTLESEQN--NPANWVTISGRKENCESAEDALLELVPITEDVPLANEFHRNFIGQKGQGINTFSTKHNVVVNIPPANKCSDFISIKGPRVNIIDAKAGLDELITMWENEKQDRIARNYENHVTVPIVFHRNIIGQRGANIEIFRTKFNVSIQIPDQNSKSEE-ITIRGYEEDVKKAEEELISMVEKWKAQVKEELHIPRDVHPQLIGTRGIALRKLRDQFKVEINFPNRNVDDEKAHLVEVIGDKENVDKCCDILVERANELLNEWEERNQVR--EVKNLIKDRENINSSSNIKEKGPGFLLTGAPWQQR-------VPDASSNVDFPKIDANGDKIAGT 3950
               YDD FP LP  NT    Q+  S   + +  +S  T  + VP  ER+ +  E          K+ICQ + ++ G  IE+ SG K+Q+L   I G Q  + +A+R +     TQ   Q+ VP+E+ + ILG+ G  LREIE  + T + IP   + ++ ITI GTKEGI +A  EI Q+ AE+ K +++RIT+PK ++PFI G  +  + K++E T A+IN+PP  V+ +EI+ISGEKD V  A   ++ IY+D +K  S++++ + K +H YVIG KGS IAEI + TGVS+EMP  DS  +TI L GP   L  AL++V QKS S+  V I A +W+H+++IG++G+N+ +L E   +V +N  E  D I +EG  ++V+     ++  I   +       + V+P +++HIIG++GAN+ R+++E KV I +    G N        IRIEG  EGV+ A+ E++    KLENEK+KDVI+D + H  +IGA+G +++E++++Y  V I  P     +DIV+LRGP++ VD+    L K ++E+ E+++  +V IFKQ+HK +IGKGG NI+KIR+E   +ID P E   ++ I +TGKKENV EA +RI+ +Q EL  I  + + IP + + S+IGT GKLI  I +ECGGV I+FP SDS SD + IRGP+ DV+KAK QLLEL+ +  L S    V AK + HKFLIG+ GA + + R      +IFP +EDT+K+ I IIG +E+V+KA+E+LE  IK  +   E  +++D K HKHF  KR  ++  IS E GGV I FP+     N D+V + G K C+EAA  RIE+I+ +LEAQT++ V I Q+HHR ++     +++ +   +DV IKFP+RD +++P E G+       NG  N     E +   E+EQ      + + I+GR E CE+A+ ALL+L+PI E++ +  + HR  IG +G  +  F +KH+V V +PP+   SD I + G    + +A+  L ++I  +E ++ DR  R++   V V   FH  +IG+ GA I   R   +V I +P ++  ++  I+I GY+ + + A + ++ +V   +   +E + I + +HP LIG R   +RK+ +  KV I F   + DD+  + + + G  E+V+   ++L   A +   ++ +   +    +   +  + + + ++   E   GF++  APW+++        P+  S  DFP   A G  +A T
Sbjct:   59 AFSYDDLFPALP-ANTSAQSQSGASGSTLARVTSSQKTHIVHVPCKERKSTESE---KFGEGESKRICQQITKETGAQIEIVSG-KNQSLTFLIKGKQSELLDARRKILMGFSTQASRQVTVPREHFRVILGKGGQRLREIERVTATRINIPSQSDESEFITIAGTKEGIAQAEQEIRQLSAEQYKKSSDRITVPKVYHPFIVGPYSENLNKLQEETGARINVPPQQVQKDEIVISGEKDAVAAAKAKVEAIYKDMEKKCSTVSVEVAKPKHRYVIGPKGSTIAEILQLTGVSVEMPPNDSPSETITLRGPQVALGNALTVVYQKSNSVKSVEINAAHWIHKYVIGRKGANMKQLEEDCPNVNVNCLE--DKIKLEGDPENVDRAVAYLSEIIKNYEENFTFEVMTVNPSYYKHIIGKAGANVNRLKDELKVNINIEEREGQN-------NIRIEGPKEGVRQAQLELQEKIDKLENEKSKDVIIDRRLHRSIIGAKGEKIREVKDRYRQVTITIPTPQENTDIVKLRGPKEDVDKCHKDLLKLVKEIQESSHIIEVPIFKQFHKFVIGKGGANIKKIRDETQTKIDLPAEGDTNEVIVITGKKENVLEAKERIQKIQNELSDIVTEEVQIPPKYYNSIIGTGGKLISSIMEECGGVSIKFPNSDSKSDKVTIRGPKDDVEKAKVQLLELANERQLASFTAEVRAKQQHHKFLIGKNGASIRKIRDATGARIIFPSNEDTDKEVITIIGKEESVKKAREQLEAIIKECDEVTEGEVSVDPKHHKHFVAKRGFILHRISEECGGVMISFPRVGI--NSDKVTIKGAKDCIEAARQRIEEIVADLEAQTTIEVVIPQRHHRTIMGARGFKVQQVTFEFDVQIKFPDRD-ATEPVE-GLTNGGSGENGGENEGQEGEQEVEKEAEQEPVRQCDVIRITGRIEKCEAAKQALLDLIPIEEELSVPFDLHRTIIGPRGANVRQFMSKHDVHVELPPSELKSDVIKVCGTPARVAEAREALVKMIEDYEADRADRELRSFVLQVDVDTEFHSKLIGRHGAVINKLRADHDVIISLPKRDEPNDRIISITGYQANAEAARDAILEIVGDPETLHREVIEIDKRIHPHLIGQRRRTIRKIIEDNKVNIKF---SADDDNPNSIFISGKIEDVENVKELLFGMAEDYERDYLDNVAIAPPTIGAFLTGQGSGSDAAGASEN--GFVIKDAPWEKQKQAKNLTAPNTQSQEDFPHFAAGGAPVAST 1291          
BLAST of High density lipoprotein binding protein (Vigilin) vs. Ensembl Fly
Match: Dp1 (gene:FBgn0027835 transcript:FBtr0086680)

HSP 1 Score: 764.607 bits (1973), Expect = 0.000e+0
Identity = 479/1256 (38.14%), Postives = 746/1256 (59.39%), Query Frame = 3
Query:  234 VLQYDDQFPPLPTCNTPKIVQN--SKPRIGQTKTSHVTQTLTVPLAERRFSNREANNSVKNDAQKKICQTVAQKCGVSIELNSGNKDQNLMVFISGPQDNVSNAKRILTKEXXXXXXXXMKVPKEYHKFILGRNGASLREIESGSNTNVTIPRSIENNDIITIFGTKEGIDKARAEINQIVAERSKLATERITIPKRFYPFINGSNNSKIYKIREMTNAKXXXXXXXXXXXXXXXXGEKDGVYQALEIIQKIYEDTKKCSSSLNLPIPKSQHCYVIGAKGSGIAEIFERTGVSIEMPSQDSDDDTIVLYGPNEFLAPALSMVIQKSESMIRVNIEAPNWLHRFIIGKQGSNLNKLMEKYEHVFINFPENSDLIVIEGPKDDVNELKGQITHKIAELKSTMAITEIQVDPRFHRHIIGRSGANIQRMQEEYKVQIRMP---GNNAVGTSGWTIRIEGDPEGVKLAKTEIESMSVKLENEKTKDVILDHKYHNQLIGAQGSRVKELRNQYPDVIIMFPDLSSKSDIVQLRGPRQQVDQVAVKLNKFIQEVIENNYTKDVKIFKQYHKNIIGKGGVNIRKIREEMNIRIDFPDEHSDSDKIRLTGKKENVEEAAKRIEAMQAELISIKEDTISIPQRLHISLIGTRGKLIKCIQQECGGVQIQFPASDSNSDIIKIRGPESDVDKAXXXXXXXXXXXXXXXHQDSVSAKSEFHKFLIGRKGAQLAEFRKRHAVMLIFPDSEDTNKDTIQIIGAKEAVQKAKEELEVTIKSLENEIEKYITIDTKWHKHFFKKRQAVMEEISREFGGVRIFFPKQDAVENIDQVRVIGPKGCVEAAVVRIEDIIENLEAQTSLSVFIEQKHHRNLITRNMMEIKSIQSNYDVTIKFPNRDLSSKPGENGMEEIHLNGNGDVNIETMEEVDSTLESEQN--NPANWVTISGRKENCESAEDALLELVPITEDVPLANEFHRNFIGQKGQGINTFSTKHNVVVNIPPANKCSDFISIKGPRVNIIDAKAGLDELITMWENEKQDRIARNYENHVTVPIVFHRNIIGQRGANIEIFRTKFNVSIQIPDQNSKSEE-ITIRGYEEDVKKAEEELISMVEKWKAQVKEELHIPRDVHPQLIGTRGIALRKLRDQFKVEINFPNRNVDDEKAHLVEVIGDKENVDKCCDILVERANELLNEWEERNQVR--EVKNLIKDRENINSSSNIKEKGPGFLLTGAPWQQR-------VPDASSNVDFPKIDANGDKIAGT 3950
               YDD FP LP  NT    Q+  S   + +  +S  T  + VP  ER+ +  E          K+ICQ + ++ G  IE+ SG K+Q+L   I G Q  + +A+R +     TQ   Q+ VP+E+ + ILG+ G  LREIE  + T + IP   + ++ ITI GTKEGI +A  EI Q+ AE+ K +++RIT+PK ++PFI G  +  + K++E T A+IN+PP  V+ +EI+ISGEKD V  A   ++ IY+D +K  S++++ + K +H YVIG KGS IAEI + TGVS+EMP  DS  +TI L GP   L  AL++V QKS S+  V I A +W+H+++IG++G+N+ +L E   +V +N  E  D I +EG  ++V+     ++  I   +       + V+P +++HIIG++GAN+ R+++E KV I +    G N        IRIEG  EGV+ A+ E++    KLENEK+KDVI+D + H  +IGA+G +++E++++Y  V I  P     +DIV+LRGP++ VD+    L K ++E+ E+++  +V IFKQ+HK +IGKGG NI+KIR+E   +ID P E   ++ I +TGKKENV EA +RI+ +Q EL  I  + + IP + + S+IGT GKLI  I +ECGGV I+FP SDS SD + IRGP+ DV+KAK QLLEL+ +  L S    V AK + HKFLIG+ GA + + R      +IFP +EDT+K+ I IIG +E+V+KA+E+LE  IK  +   E  +++D K HKHF  KR  ++  IS E GGV I FP+     N D+V + G K C+EAA  RIE+I+ +LEAQT++ V I Q+HHR ++     +++ +   +DV IKFP+RD +++P E G+       NG  N     E +   E+EQ      + + I+GR E CE+A+ ALL+L+PI E++ +  + HR  IG +G  +  F +KH+V V +PP+   SD I + G    + +A+  L ++I  +E ++ DR  R++   V V   FH  +IG+ GA I   R   +V I +P ++  ++  I+I GY+ + + A + ++ +V   +   +E + I + +HP LIG R   +RK+ +  KV I F   + DD+  + + + G  E+V+   ++L   A +   ++ +   +    +   +  + + + ++   E   GF++  APW+++        P+  S  DFP   A G  +A T
Sbjct:   59 AFSYDDLFPALP-ANTSAQSQSGASGSTLARVTSSQKTHIVHVPCKERKSTESE---KFGEGESKRICQQITKETGAQIEIVSG-KNQSLTFLIKGKQSELLDARRKILMGFSTQASRQVTVPREHFRVILGKGGQRLREIERVTATRINIPSQSDESEFITIAGTKEGIAQAEQEIRQLSAEQYKKSSDRITVPKVYHPFIVGPYSENLNKLQEETGARINVPPQQVQKDEIVISGEKDAVAAAKAKVEAIYKDMEKKCSTVSVEVAKPKHRYVIGPKGSTIAEILQLTGVSVEMPPNDSPSETITLRGPQVALGNALTVVYQKSNSVKSVEINAAHWIHKYVIGRKGANMKQLEEDCPNVNVNCLE--DKIKLEGDPENVDRAVAYLSEIIKNYEENFTFEVMTVNPSYYKHIIGKAGANVNRLKDELKVNINIEEREGQN-------NIRIEGPKEGVRQAQLELQEKIDKLENEKSKDVIIDRRLHRSIIGAKGEKIREVKDRYRQVTITIPTPQENTDIVKLRGPKEDVDKCHKDLLKLVKEIQESSHIIEVPIFKQFHKFVIGKGGANIKKIRDETQTKIDLPAEGDTNEVIVITGKKENVLEAKERIQKIQNELSDIVTEEVQIPPKYYNSIIGTGGKLISSIMEECGGVSIKFPNSDSKSDKVTIRGPKDDVEKAKVQLLELANERQLASFTAEVRAKQQHHKFLIGKNGASIRKIRDATGARIIFPSNEDTDKEVITIIGKEESVKKAREQLEAIIKECDEVTEGEVSVDPKHHKHFVAKRGFILHRISEECGGVMISFPRVGI--NSDKVTIKGAKDCIEAARQRIEEIVADLEAQTTIEVVIPQRHHRTIMGARGFKVQQVTFEFDVQIKFPDRD-ATEPVE-GLTNGGSGENGGENEGQEGEQEVEKEAEQEPVRQCDVIRITGRIEKCEAAKQALLDLIPIEEELSVPFDLHRTIIGPRGANVRQFMSKHDVHVELPPSELKSDVIKVCGTPARVAEAREALVKMIEDYEADRADRELRSFVLQVDVDTEFHSKLIGRHGAVINKLRADHDVIISLPKRDEPNDRIISITGYQANAEAARDAILEIVGDPETLHREVIEIDKRIHPHLIGQRRRTIRKIIEDNKVNIKF---SADDDNPNSIFISGKIEDVENVKELLFGMAEDYERDYLDNVAIAPPTIGAFLTGQGSGSDAAGASEN--GFVIKDAPWEKQKQAKNLTAPNTQSQEDFPHFAAGGAPVAST 1291          
BLAST of High density lipoprotein binding protein (Vigilin) vs. Ensembl Zebrafish
Match: hdlbpa (high density lipoprotein binding protein a [Source:ZFIN;Acc:ZDB-GENE-030131-2032])

HSP 1 Score: 874.004 bits (2257), Expect = 0.000e+0
Identity = 502/1208 (41.56%), Postives = 758/1208 (62.75%), Query Frame = 3
Query:  309 RIGQTKTSHVTQTLTVPLAERRFSNREANNSVKNDAQKKICQTVAQKCGVSIELNSGNKDQNLMVFISGPQDNVSNAKRILTKEXXXXXXXXMKVPKEYHKFILGRNGASLREIESGSNTNVTIPRSIENNDIITIFGTKEGIDKARAEINQIVAERSKLATERITIPKRFYPFINGSNNSKIYKIREMTNAKXXXXXXXXXXXXXXXXGEKDGVYQALEIIQKIYEDTKKCSSSLNLPIPKSQHCYVIGAKGSGIAEIFERTGVSIEMPSQDSDDDTIVLYGPNEFLAPALSMVIQKSESMIRVNIEAPNWLHRFIIGKQGSNLNKLMEKYEHVFINFPENSDLIVIEGPKDDVNELKGQITHKIAELKSTMAITEIQVDPRFHRHIIGRSGANIQRMQEEYKVQIRMPGNNAVGTSGWTIRIEGDPEGVKLAKTEIESMSVKLENEKTKDVILDHKYHNQLIGAQGSRVKELRNQYPDVIIMFPDLSSKSDIVQLRGPRQQVDQVAVKLNKFIQEVIENNYTKDVKIFKQYHKNIIGKGGVNIRKIREEMNIRIDFPDEHSDSDKIRLTGKKENVEEAAKRIEAMQAELISIKEDTISIPQRLHISLIGTRGKLIKCIQQECGGVQIQFPASDSNSDIIKIRGPESDVDKAXXXXXXXXXXXXXXXHQDSVSAKSEFHKFLIGRKGAQLAEFRKRHAVMLIFPDSEDTNKDTIQIIGAKEAVQKAKEELEVTIKSLENEIEKYITIDTKWHKHFFKKRQAVMEEISREFGGVRIFFPKQDAVENIDQVRVIGPKGCVEAAVVRIEDIIENLEAQTSLSVFIEQKHHRNLITRNMMEIKSIQSNYDVTIKFPNRDLSSKPGENGMEEIHLNGNGDVNIETMEEVDSTLESEQNNPANWVTISGRKENCESAEDALLELVPITEDVPLANEFHRNFIGQKGQGINTFSTKHNVVVNIPPANKCSDFISIKGPRVNIIDAKAGLDELITMWENEKQDRIARNYENHVTVPIVFHRNIIGQRGANIEIFRTKFNVSIQIPDQNSKSE-EITIRGYEEDVKKAEEELISMVEKWKAQVKEELHIPRDVHPQLIGTRGIALRKLRDQFKVEINFPNRNVDDEKAHLVEVIGDKENVDKCCDILVERANELLNEWEERNQVREVKNLIKDRENINSSSNIKEKGP--GFLLTGAPWQ---QRVPDASSNVDFP 3914
            +I   K+S +TQ   VPL ER++ +    N      Q K+C  +  K G  +EL S  KDQ L + +SG  D V  A++ +   LQTQ    + +PKE+H+F++G++G  L+E+E  + T + IPR  + ++ I I GTKEG++KA+ EI  I AE+ K A ER+ I K F+PFI G++   +  + + T A+IN+PPPSV   EI+I+GEK+ V  A+  I+K+YE+ KK ++++ + + KSQH YVIG KG+ + EI ERTGVS+E+P  DS  +T++L G    L  AL+ V  K+ S    ++ AP+WLHRFIIGK+G NL K+ ++   V I F E  D I +EGP  DV  ++GQI   + +L S M  TEI VDP+FHRH+IG+ GANI R++E +KV +R+P +N        IRIEGDP+GV+ AK E+  ++ ++ENE+TKD+I++ ++H  +IG +G ++KE+R+++P+VII FPD + KSDIVQLRGPR +V++ +  + K + E++EN+++  V IFKQ+HKNIIGKGG NI+KIREE N +ID P E+S+S+ I +TGKK N E A  RI A+Q EL +I E  +SIP +LH SLIG++G+ ++ I +ECGGV I FP   S  D + IRGP  +V+KAKKQLL L+E+    SH   + AK E+HKFLIG+ G  + + R      +IFP +ED + + I +IG +EAV +A++ELE  IKSL+N +E ++ +D K H+ F  +R  V+ +I+ E+GGV + FP+  A    D+V + G K CVEAA  R+ ++IE+L+AQ ++   I QK HR+++      I+ I  +++V IKFP+R+      E    +  +  NG+ N E  E VD T   +     + + +SGRKE CE+A +AL  LVP+T  V +  E HR  IGQKG GI     +  V + +P     SD ISI G   ++  AK GL E +   + E++DR  R+++  +TV   +H  IIG++GA I   R    V+IQ P++N +++ +ITI GYE++   A + + ++V++ +  + E++ +   VH ++IG RG  +RK+ D+FKV++ FP     D   +LV V G  E+VD+  D L+    E + +  E     E K         ++SS  + +GP  GF++  APW    ++ PD SS+ +FP
Sbjct:   70 KIKPLKSSIITQVFHVPLEERKYKDM---NQFGEGDQAKVCLDIMHKTGAHLEL-SMAKDQGLSIMVSGKYDAVMKARKEIVSRLQTQASATVAIPKEHHRFVIGKSGEKLQELELKTATKIQIPRPDDPSNQIKISGTKEGLEKAKHEILLISAEQDKRAVERMNIDKVFHPFITGAHGKLVGDLMQETGARINVPPPSVNKTEIVITGEKEQVALAMVKIKKLYEEKKKNATTIAVEVKKSQHKYVIGPKGNTLQEILERTGVSVEIPPLDSSSETVILRGEPARLGQALTEVYAKANSYTVSSVSAPSWLHRFIIGKKGQNLAKITQQMPKVHIEFTEGEDKITLEGPTKDVQIVQGQIEVIVTDLVSRMDYTEISVDPKFHRHLIGKGGANINRIKELHKVSVRIPPDNEKSN---LIRIEGDPQGVQEAKKELLELASRMENERTKDMIIEQRFHRAIIGQKGEKIKEIRDKFPEVIINFPDPAQKSDIVQLRGPRTEVEKCSKFMQKMVAEMVENSFSVSVPIFKQFHKNIIGKGGANIKKIREETNTKIDLPAENSNSEMIVITGKKANCEAAKNRILAIQKELANITEVEVSIPSKLHNSLIGSKGRFVRSIMEECGGVHIHFPTEGSGIDAVTIRGPAEEVEKAKKQLLSLAEEKQTKSHTVELRAKPEYHKFLIGKGGGNIRKVRDSTGARIIFPTAEDKDHELITVIGTEEAVAEAQKELEALIKSLDNIVEDFMIVDPKHHRFFVARRGQVLRDIADEYGGVIVSFPRTAA--QSDKVTLKGAKDCVEAAKKRMLEMIEDLDAQVTMECVIPQKFHRSIMGPKGSRIQQITKDHNVQIKFPDRE------EQQQADASVQENGEANGEVKEPVDPTAPKK----CDVIVLSGRKERCEAAVEALKALVPVTIAVEVPFELHRYIIGQKGSGIRKMMDEFEVNIQVPAHELQSDIISITGLASHLDRAKEGLLERVKELQAEQEDRALRSFKLTITVEPKYHPKIIGRKGAIISHIRHDHEVNIQFPEKNDENQDQITITGYEQNAIAARDAIQAIVDELEEMISEDITLDSRVHARIIGARGKGIRKIMDEFKVDVRFPQSGAAD--PNLVTVTGRPEHVDEAIDHLLNLEEEYMADVVE----NEAKMAYMKPSGSSASSMEEPRGPSKGFVVREAPWATGNEKAPDMSSSEEFP 1252          
BLAST of High density lipoprotein binding protein (Vigilin) vs. Ensembl Zebrafish
Match: hdlbpb (high density lipoprotein binding protein b [Source:ZFIN;Acc:ZDB-GENE-030131-6822])

HSP 1 Score: 855.129 bits (2208), Expect = 0.000e+0
Identity = 495/1234 (40.11%), Postives = 769/1234 (62.32%), Query Frame = 3
Query:  243 YDDQFPPLPTCNTPKIVQNSKP-----RIGQTKTSHVTQTLTVPLAERRFSNREANNSVKNDAQKKICQTVAQKCGVSIELNSGNKDQNLMVFISGPQDNVSNAKRILTKEXXXXXXXXMKVPKEYHKFILGRNGASLREIESGSNTNVTIPRSIENNDIITIFGTKEGIDKARAEINQIVAERSKLATERITIPKRFYPFINGSNNSKIYKIREMTNAKXXXXXXXXXXXXXXXXGEKDGVYQALEIIQKIYEDTKKCSSSLNLPIPKSQHCYVIGAKGSGIAEIFERTGVSIEMPSQDSDDDTIVLYGPNEFLAPALSMVIQKSESMIRVNIEAPNWLHRFIIGKQGSNLNKLMEKYEHVFINFPENSDLIVIEGPKDDVNELKGQITHKIAELKSTMAITEIQVDPRFHRHIIGRSGANIQRMQEEYKVQIRMPGNNAVGTSGWTIRIEGDPEGVKLAKTEIESMSVKLENEKTKDVILDHKYHNQLIGAQGSRVKELRNQYPDVIIMFPDLSSKSDIVQLRGPRQQVDQVAVKLNKFIQEVIENNYTKDVKIFKQYHKNIIGKGGVNIRKIREEMNIRIDFPDEHSDSDKIRLTGKKENVEEAAKRIEAMQAELISIKEDTISIPQRLHISLIGTRGKLIKCIQQECGGVQIQFPASDSNSDIIKIRGPESDVDKAXXXXXXXXXXXXXXXHQDSVSAKSEFHKFLIGRKGAQLAEFRKRHAVMLIFPDSEDTNKDTIQIIGAKEAVQKAKEELEVTIKSLENEIEKYITIDTKWHKHFFKKRQAVMEEISREFGGVRIFFPKQDAVENIDQVRVIGPKGCVEAAVVRIEDIIENLEAQTSLSVFIEQKHHRNLITRNMMEIKSIQSNYDVTIKFPNRDLSSKPGENGMEEIHLNGNGDVNIETMEEVDSTLESEQNNPANWVTISGRKENCESAEDALLELVPITEDVPLANEFHRNFIGQKGQGINTFSTKHNVVVNIPPANKCSDFISIKGPRVNIIDAKAGLDELITMWENEKQDRIARNYENHVTVPIVFHRNIIGQRGANIEIFRTKFNVSIQIPDQNSKSEE-ITIRGYEEDVKKAEEELISMVEKWKAQVKEELHIPRDVHPQLIGTRGIALRKLRDQFKVEINFPNRNVDDEKAHLVEVIGDKENVDKCCDILVERANE-LLNEWEERNQVREVKNLIKDRENINSSSNIKEKGPGFLLTGAPWQQ---RVPDASSNVDFP 3914
            Y + FPPLP   +P   ++ +P     +I   K S +TQ   VPL ERR+ +   N+      + K+C  + QK G  IEL S  KDQ L + ++G  D+V  A++ +   LQTQ    + +PKE+H+F++G+NG  L+E+E  + T + IPRS + N  I I GTKEGI+KAR EI  I AE+ K A ER+   K F+PFI G+ N  + ++ + T A+I+IPPPS+  +EI+I+GEK+ V  A+  I+  YE+ K+ ++++++ + KSQH Y++G KG+ + EI E TGVS+EMP  DS  +TI+L G  + L PAL+ V  K++S+I   + AP WLHRFIIGK+G N++++ ++   V I F +  + I +EGP ++V + + QI   I +L   M  TEI +D RFHRH+IG++GANI R++E+YKV +R+P ++        +RIEGDP+GV+LA+ E+  M+ ++ENE+TKD+I++ K+H  +IG +G ++KE+R+++P+VII+FPD   KSDIVQLRGP+ +V++ A  L K I E++E++++  V I KQ+HKNIIGKGG NI+KIREE N +ID P E+S+S+ I +TGKK N E A +RI A++ EL S+KE  +SIP +LH SLIG++G L++ I ++CGGV I FPA  S  D + IRGP  +V++A+KQLL+L+E+  + +    + AK E+HK+LIGR GA +   R R    +IFP ++D  ++ I I+G +EAV  A+ ELE  IK+L++ IE  + ++ + H+HF  +R  V+ E++ E+GGV + FP+     + D + + GP+ CV+AA  RI++I+ +LE+Q S+ V I Q++HR ++      I+ I   ++V IKFP+RD      E+  +E     NGD ++   +              + +T++GR E CE A  ALL LVP+T DV ++ + HR  IGQKG GI      + V + +P   + SD I I G   ++  AK GL + +   + E++DR  R+Y+  ++V   +H  IIG++GA I   R +++V++Q PD+  + ++ I I GYE +   A+  +  +V   +  V E++ + R VH ++IG RG A+RK+ ++FKV+I FP    +D   + V V G  ENVD   D L+    E +L+  E       +K   K      +  + +    GF++  APW     + PD SS  +FP
Sbjct:   38 YLEAFPPLPEKGSPG-EKSGEPAGAWSKIRPIKASVITQVFHVPLEERRYKD---NSQFGEGEEAKVCLDIMQKTGAHIEL-SLAKDQGLSIMVTGKLDSVMKARKEIVARLQTQASATVLIPKEHHRFVIGKNGEKLQELELKTATKIAIPRSDDPNANIRITGTKEGIEKARHEIQLISAEQDKRAVERLCFEKAFHPFIAGAYNRLVQELSQETGARISIPPPSIPKDEIVITGEKEAVAMAIARIRATYEEKKRKTTTISVEVKKSQHKYIVGPKGNTLQEILENTGVSVEMPPLDSASETIILRGEPDKLGPALTQVYAKAKSVIVAEVIAPAWLHRFIIGKKGQNISRITQQLPKVHIEFTDGEERICLEGPTEEVEQAQIQIQEIIKDLMVRMDYTEINIDQRFHRHLIGKNGANINRIKEQYKVSVRIPQDS---ERCGLVRIEGDPQGVQLARKELMDMAQRMENERTKDLIIEQKFHRTIIGQKGEKIKEVRDKFPEVIIIFPDQQQKSDIVQLRGPKNEVEKCAKFLQKLIAELVESSFSISVPIHKQFHKNIIGKGGANIKKIREETNTKIDLPTENSNSEVIVITGKKSNCEAARERILAIEKELASMKEVEVSIPAKLHNSLIGSKGSLVRSIMEDCGGVHIHFPAEGSGLDRVTIRGPAEEVERARKQLLQLAEEKQVNNFSVELQAKPEYHKYLIGRGGANIRRVRDRTGARIIFPSADDQEQEHITIMGKEEAVILAQRELETLIKNLDDVIEDSMIVEPRHHRHFVCRRGQVLRELAEEYGGVAVSFPRTGT--HSDSITLKGPRECVDAAKKRIQEIVCDLESQVSMEVLIPQRYHRAIMGPKGCRIQQITREHEVQIKFPDRD------ESAAQEPTSQENGDTDLTPRK-------------CDIITVTGRAEKCELARAALLALVPVTIDVEVSYDLHRYIIGQKGSGIRKMMEDYEVNIWVPQPEQQSDIIKITGQVASVERAKHGLLDRVKELQAEQEDRALRSYKVTLSVDPKYHPKIIGRKGAVISQIRKEYDVNVQFPDKGDEQQDVIVISGYERNANDAKSAIEQLVAALQEMVSEDVRLDRRVHARIIGARGKAIRKIMEEFKVDIRFPQPGSED--PNKVTVTGLPENVDNTIDHLLNLEEEYMLSVTETETMAAYMKPPSKTMGTGGNDEDNRALAKGFVVRDAPWNAQGNKAPDVSSAEEFP 1240          
BLAST of High density lipoprotein binding protein (Vigilin) vs. Ensembl Zebrafish
Match: hdlbpb (high density lipoprotein binding protein b [Source:ZFIN;Acc:ZDB-GENE-030131-6822])

HSP 1 Score: 855.129 bits (2208), Expect = 0.000e+0
Identity = 495/1234 (40.11%), Postives = 769/1234 (62.32%), Query Frame = 3
Query:  243 YDDQFPPLPTCNTPKIVQNSKP-----RIGQTKTSHVTQTLTVPLAERRFSNREANNSVKNDAQKKICQTVAQKCGVSIELNSGNKDQNLMVFISGPQDNVSNAKRILTKEXXXXXXXXMKVPKEYHKFILGRNGASLREIESGSNTNVTIPRSIENNDIITIFGTKEGIDKARAEINQIVAERSKLATERITIPKRFYPFINGSNNSKIYKIREMTNAKXXXXXXXXXXXXXXXXGEKDGVYQALEIIQKIYEDTKKCSSSLNLPIPKSQHCYVIGAKGSGIAEIFERTGVSIEMPSQDSDDDTIVLYGPNEFLAPALSMVIQKSESMIRVNIEAPNWLHRFIIGKQGSNLNKLMEKYEHVFINFPENSDLIVIEGPKDDVNELKGQITHKIAELKSTMAITEIQVDPRFHRHIIGRSGANIQRMQEEYKVQIRMPGNNAVGTSGWTIRIEGDPEGVKLAKTEIESMSVKLENEKTKDVILDHKYHNQLIGAQGSRVKELRNQYPDVIIMFPDLSSKSDIVQLRGPRQQVDQVAVKLNKFIQEVIENNYTKDVKIFKQYHKNIIGKGGVNIRKIREEMNIRIDFPDEHSDSDKIRLTGKKENVEEAAKRIEAMQAELISIKEDTISIPQRLHISLIGTRGKLIKCIQQECGGVQIQFPASDSNSDIIKIRGPESDVDKAXXXXXXXXXXXXXXXHQDSVSAKSEFHKFLIGRKGAQLAEFRKRHAVMLIFPDSEDTNKDTIQIIGAKEAVQKAKEELEVTIKSLENEIEKYITIDTKWHKHFFKKRQAVMEEISREFGGVRIFFPKQDAVENIDQVRVIGPKGCVEAAVVRIEDIIENLEAQTSLSVFIEQKHHRNLITRNMMEIKSIQSNYDVTIKFPNRDLSSKPGENGMEEIHLNGNGDVNIETMEEVDSTLESEQNNPANWVTISGRKENCESAEDALLELVPITEDVPLANEFHRNFIGQKGQGINTFSTKHNVVVNIPPANKCSDFISIKGPRVNIIDAKAGLDELITMWENEKQDRIARNYENHVTVPIVFHRNIIGQRGANIEIFRTKFNVSIQIPDQNSKSEE-ITIRGYEEDVKKAEEELISMVEKWKAQVKEELHIPRDVHPQLIGTRGIALRKLRDQFKVEINFPNRNVDDEKAHLVEVIGDKENVDKCCDILVERANE-LLNEWEERNQVREVKNLIKDRENINSSSNIKEKGPGFLLTGAPWQQ---RVPDASSNVDFP 3914
            Y + FPPLP   +P   ++ +P     +I   K S +TQ   VPL ERR+ +   N+      + K+C  + QK G  IEL S  KDQ L + ++G  D+V  A++ +   LQTQ    + +PKE+H+F++G+NG  L+E+E  + T + IPRS + N  I I GTKEGI+KAR EI  I AE+ K A ER+   K F+PFI G+ N  + ++ + T A+I+IPPPS+  +EI+I+GEK+ V  A+  I+  YE+ K+ ++++++ + KSQH Y++G KG+ + EI E TGVS+EMP  DS  +TI+L G  + L PAL+ V  K++S+I   + AP WLHRFIIGK+G N++++ ++   V I F +  + I +EGP ++V + + QI   I +L   M  TEI +D RFHRH+IG++GANI R++E+YKV +R+P ++        +RIEGDP+GV+LA+ E+  M+ ++ENE+TKD+I++ K+H  +IG +G ++KE+R+++P+VII+FPD   KSDIVQLRGP+ +V++ A  L K I E++E++++  V I KQ+HKNIIGKGG NI+KIREE N +ID P E+S+S+ I +TGKK N E A +RI A++ EL S+KE  +SIP +LH SLIG++G L++ I ++CGGV I FPA  S  D + IRGP  +V++A+KQLL+L+E+  + +    + AK E+HK+LIGR GA +   R R    +IFP ++D  ++ I I+G +EAV  A+ ELE  IK+L++ IE  + ++ + H+HF  +R  V+ E++ E+GGV + FP+     + D + + GP+ CV+AA  RI++I+ +LE+Q S+ V I Q++HR ++      I+ I   ++V IKFP+RD      E+  +E     NGD ++   +              + +T++GR E CE A  ALL LVP+T DV ++ + HR  IGQKG GI      + V + +P   + SD I I G   ++  AK GL + +   + E++DR  R+Y+  ++V   +H  IIG++GA I   R +++V++Q PD+  + ++ I I GYE +   A+  +  +V   +  V E++ + R VH ++IG RG A+RK+ ++FKV+I FP    +D   + V V G  ENVD   D L+    E +L+  E       +K   K      +  + +    GF++  APW     + PD SS  +FP
Sbjct:   38 YLEAFPPLPEKGSPG-EKSGEPAGAWSKIRPIKASVITQVFHVPLEERRYKD---NSQFGEGEEAKVCLDIMQKTGAHIEL-SLAKDQGLSIMVTGKLDSVMKARKEIVARLQTQASATVLIPKEHHRFVIGKNGEKLQELELKTATKIAIPRSDDPNANIRITGTKEGIEKARHEIQLISAEQDKRAVERLCFEKAFHPFIAGAYNRLVQELSQETGARISIPPPSIPKDEIVITGEKEAVAMAIARIRATYEEKKRKTTTISVEVKKSQHKYIVGPKGNTLQEILENTGVSVEMPPLDSASETIILRGEPDKLGPALTQVYAKAKSVIVAEVIAPAWLHRFIIGKKGQNISRITQQLPKVHIEFTDGEERICLEGPTEEVEQAQIQIQEIIKDLMVRMDYTEINIDQRFHRHLIGKNGANINRIKEQYKVSVRIPQDS---ERCGLVRIEGDPQGVQLARKELMDMAQRMENERTKDLIIEQKFHRTIIGQKGEKIKEVRDKFPEVIIIFPDQQQKSDIVQLRGPKNEVEKCAKFLQKLIAELVESSFSISVPIHKQFHKNIIGKGGANIKKIREETNTKIDLPTENSNSEVIVITGKKSNCEAARERILAIEKELASMKEVEVSIPAKLHNSLIGSKGSLVRSIMEDCGGVHIHFPAEGSGLDRVTIRGPAEEVERARKQLLQLAEEKQVNNFSVELQAKPEYHKYLIGRGGANIRRVRDRTGARIIFPSADDQEQEHITIMGKEEAVILAQRELETLIKNLDDVIEDSMIVEPRHHRHFVCRRGQVLRELAEEYGGVAVSFPRTGT--HSDSITLKGPRECVDAAKKRIQEIVCDLESQVSMEVLIPQRYHRAIMGPKGCRIQQITREHEVQIKFPDRD------ESAAQEPTSQENGDTDLTPRK-------------CDIITVTGRAEKCELARAALLALVPVTIDVEVSYDLHRYIIGQKGSGIRKMMEDYEVNIWVPQPEQQSDIIKITGQVASVERAKHGLLDRVKELQAEQEDRALRSYKVTLSVDPKYHPKIIGRKGAVISQIRKEYDVNVQFPDKGDEQQDVIVISGYERNANDAKSAIEQLVAALQEMVSEDVRLDRRVHARIIGARGKAIRKIMEEFKVDIRFPQPGSED--PNKVTVTGLPENVDNTIDHLLNLEEEYMLSVTETETMAAYMKPPSKTMGTGGNDEDNRALAKGFVVRDAPWNAQGNKAPDVSSAEEFP 1240          
BLAST of High density lipoprotein binding protein (Vigilin) vs. Ensembl Zebrafish
Match: hdlbpb (high density lipoprotein binding protein b [Source:ZFIN;Acc:ZDB-GENE-030131-6822])

HSP 1 Score: 855.129 bits (2208), Expect = 0.000e+0
Identity = 495/1234 (40.11%), Postives = 769/1234 (62.32%), Query Frame = 3
Query:  243 YDDQFPPLPTCNTPKIVQNSKP-----RIGQTKTSHVTQTLTVPLAERRFSNREANNSVKNDAQKKICQTVAQKCGVSIELNSGNKDQNLMVFISGPQDNVSNAKRILTKEXXXXXXXXMKVPKEYHKFILGRNGASLREIESGSNTNVTIPRSIENNDIITIFGTKEGIDKARAEINQIVAERSKLATERITIPKRFYPFINGSNNSKIYKIREMTNAKXXXXXXXXXXXXXXXXGEKDGVYQALEIIQKIYEDTKKCSSSLNLPIPKSQHCYVIGAKGSGIAEIFERTGVSIEMPSQDSDDDTIVLYGPNEFLAPALSMVIQKSESMIRVNIEAPNWLHRFIIGKQGSNLNKLMEKYEHVFINFPENSDLIVIEGPKDDVNELKGQITHKIAELKSTMAITEIQVDPRFHRHIIGRSGANIQRMQEEYKVQIRMPGNNAVGTSGWTIRIEGDPEGVKLAKTEIESMSVKLENEKTKDVILDHKYHNQLIGAQGSRVKELRNQYPDVIIMFPDLSSKSDIVQLRGPRQQVDQVAVKLNKFIQEVIENNYTKDVKIFKQYHKNIIGKGGVNIRKIREEMNIRIDFPDEHSDSDKIRLTGKKENVEEAAKRIEAMQAELISIKEDTISIPQRLHISLIGTRGKLIKCIQQECGGVQIQFPASDSNSDIIKIRGPESDVDKAXXXXXXXXXXXXXXXHQDSVSAKSEFHKFLIGRKGAQLAEFRKRHAVMLIFPDSEDTNKDTIQIIGAKEAVQKAKEELEVTIKSLENEIEKYITIDTKWHKHFFKKRQAVMEEISREFGGVRIFFPKQDAVENIDQVRVIGPKGCVEAAVVRIEDIIENLEAQTSLSVFIEQKHHRNLITRNMMEIKSIQSNYDVTIKFPNRDLSSKPGENGMEEIHLNGNGDVNIETMEEVDSTLESEQNNPANWVTISGRKENCESAEDALLELVPITEDVPLANEFHRNFIGQKGQGINTFSTKHNVVVNIPPANKCSDFISIKGPRVNIIDAKAGLDELITMWENEKQDRIARNYENHVTVPIVFHRNIIGQRGANIEIFRTKFNVSIQIPDQNSKSEE-ITIRGYEEDVKKAEEELISMVEKWKAQVKEELHIPRDVHPQLIGTRGIALRKLRDQFKVEINFPNRNVDDEKAHLVEVIGDKENVDKCCDILVERANE-LLNEWEERNQVREVKNLIKDRENINSSSNIKEKGPGFLLTGAPWQQ---RVPDASSNVDFP 3914
            Y + FPPLP   +P   ++ +P     +I   K S +TQ   VPL ERR+ +   N+      + K+C  + QK G  IEL S  KDQ L + ++G  D+V  A++ +   LQTQ    + +PKE+H+F++G+NG  L+E+E  + T + IPRS + N  I I GTKEGI+KAR EI  I AE+ K A ER+   K F+PFI G+ N  + ++ + T A+I+IPPPS+  +EI+I+GEK+ V  A+  I+  YE+ K+ ++++++ + KSQH Y++G KG+ + EI E TGVS+EMP  DS  +TI+L G  + L PAL+ V  K++S+I   + AP WLHRFIIGK+G N++++ ++   V I F +  + I +EGP ++V + + QI   I +L   M  TEI +D RFHRH+IG++GANI R++E+YKV +R+P ++        +RIEGDP+GV+LA+ E+  M+ ++ENE+TKD+I++ K+H  +IG +G ++KE+R+++P+VII+FPD   KSDIVQLRGP+ +V++ A  L K I E++E++++  V I KQ+HKNIIGKGG NI+KIREE N +ID P E+S+S+ I +TGKK N E A +RI A++ EL S+KE  +SIP +LH SLIG++G L++ I ++CGGV I FPA  S  D + IRGP  +V++A+KQLL+L+E+  + +    + AK E+HK+LIGR GA +   R R    +IFP ++D  ++ I I+G +EAV  A+ ELE  IK+L++ IE  + ++ + H+HF  +R  V+ E++ E+GGV + FP+     + D + + GP+ CV+AA  RI++I+ +LE+Q S+ V I Q++HR ++      I+ I   ++V IKFP+RD      E+  +E     NGD ++   +              + +T++GR E CE A  ALL LVP+T DV ++ + HR  IGQKG GI      + V + +P   + SD I I G   ++  AK GL + +   + E++DR  R+Y+  ++V   +H  IIG++GA I   R +++V++Q PD+  + ++ I I GYE +   A+  +  +V   +  V E++ + R VH ++IG RG A+RK+ ++FKV+I FP    +D   + V V G  ENVD   D L+    E +L+  E       +K   K      +  + +    GF++  APW     + PD SS  +FP
Sbjct:   38 YLEAFPPLPEKGSPG-EKSGEPAGAWSKIRPIKASVITQVFHVPLEERRYKD---NSQFGEGEEAKVCLDIMQKTGAHIEL-SLAKDQGLSIMVTGKLDSVMKARKEIVARLQTQASATVLIPKEHHRFVIGKNGEKLQELELKTATKIAIPRSDDPNANIRITGTKEGIEKARHEIQLISAEQDKRAVERLCFEKAFHPFIAGAYNRLVQELSQETGARISIPPPSIPKDEIVITGEKEAVAMAIARIRATYEEKKRKTTTISVEVKKSQHKYIVGPKGNTLQEILENTGVSVEMPPLDSASETIILRGEPDKLGPALTQVYAKAKSVIVAEVIAPAWLHRFIIGKKGQNISRITQQLPKVHIEFTDGEERICLEGPTEEVEQAQIQIQEIIKDLMVRMDYTEINIDQRFHRHLIGKNGANINRIKEQYKVSVRIPQDS---ERCGLVRIEGDPQGVQLARKELMDMAQRMENERTKDLIIEQKFHRTIIGQKGEKIKEVRDKFPEVIIIFPDQQQKSDIVQLRGPKNEVEKCAKFLQKLIAELVESSFSISVPIHKQFHKNIIGKGGANIKKIREETNTKIDLPTENSNSEVIVITGKKSNCEAARERILAIEKELASMKEVEVSIPAKLHNSLIGSKGSLVRSIMEDCGGVHIHFPAEGSGLDRVTIRGPAEEVERARKQLLQLAEEKQVNNFSVELQAKPEYHKYLIGRGGANIRRVRDRTGARIIFPSADDQEQEHITIMGKEEAVILAQRELETLIKNLDDVIEDSMIVEPRHHRHFVCRRGQVLRELAEEYGGVAVSFPRTGT--HSDSITLKGPRECVDAAKKRIQEIVCDLESQVSMEVLIPQRYHRAIMGPKGCRIQQITREHEVQIKFPDRD------ESAAQEPTSQENGDTDLTPRK-------------CDIITVTGRAEKCELARAALLALVPVTIDVEVSYDLHRYIIGQKGSGIRKMMEDYEVNIWVPQPEQQSDIIKITGQVASVERAKHGLLDRVKELQAEQEDRALRSYKVTLSVDPKYHPKIIGRKGAVISQIRKEYDVNVQFPDKGDEQQDVIVISGYERNANDAKSAIEQLVAALQEMVSEDVRLDRRVHARIIGARGKAIRKIMEEFKVDIRFPQPGSED--PNKVTVTGLPENVDNTIDHLLNLEEEYMLSVTETETMAAYMKPPSKTMGTGGNDEDNRALAKGFVVRDAPWNAQGNKAPDVSSAEEFP 1240          
BLAST of High density lipoprotein binding protein (Vigilin) vs. Ensembl Zebrafish
Match: hdlbpa (high density lipoprotein binding protein a [Source:ZFIN;Acc:ZDB-GENE-030131-2032])

HSP 1 Score: 256.914 bits (655), Expect = 1.161e-74
Identity = 154/362 (42.54%), Postives = 228/362 (62.98%), Query Frame = 3
Query:  309 RIGQTKTSHVTQTLTVPLAERRFSNREANNSVKNDAQKKICQTVAQKCGVSIELNSGNKDQNLMVFISGPQDNVSNAKRILTKEXXXXXXXXMKVPKEYHKFILGRNGASLREIESGSNTNVTIPRSIENNDIITIFGTKEGIDKARAEINQIVAERSKLATERITIPKRFYPFINGSNNSKIYKIREMTNAKXXXXXXXXXXXXXXXXGEKDGVYQALEIIQKIYEDTKKCSSSLNLPIPKSQHCYVIGAKGSGIAEIFERTGVSIEMPSQDSDDDTIVLYGPNEFLAPALSMVIQKSESMIRVNIEAPNWLHRFIIGKQGSNLNKLMEKYEHVFINFPENSDLIVIEGPKDDVNELKGQI 1394
            +I   K+S +TQ   VPL ER++ +    N      Q K+C  +  K G  +EL S  KDQ L + +SG  D V  A++ +   LQTQ    + +PKE+H+F++G++G  L+E+E  + T + IPR  + ++ I I GTKEG++KA+ EI  I AE+ K A ER+ I K F+PFI G++   +  + + T A+IN+PPPSV   EI+I+GEK+ V  A+  I+K+YE+ KK ++++ + + KSQH YVIG KG+ + EI ERTGVS+E+P  DS  +T++L G    L  AL+ V  K+ S    ++ AP+WLHRFIIGK+G NL K+ ++   V I F E  D I +EGP  DV  ++GQI
Sbjct:   70 KIKPLKSSIITQVFHVPLEERKYKDM---NQFGEGDQAKVCLDIMHKTGAHLEL-SMAKDQGLSIMVSGKYDAVMKARKEIVSRLQTQASATVAIPKEHHRFVIGKSGEKLQELELKTATKIQIPRPDDPSNQIKISGTKEGLEKAKHEILLISAEQDKRAVERMNIDKVFHPFITGAHGKLVGDLMQETGARINVPPPSVNKTEIVITGEKEQVALAMVKIKKLYEEKKKNATTIAVEVKKSQHKYVIGPKGNTLQEILERTGVSVEIPPLDSSSETVILRGEPARLGQALTEVYAKANSYTVSSVSAPSWLHRFIIGKKGQNLAKITQQMPKVHIEFTEGEDKITLEGPTKDVQIVQGQI 427          

HSP 2 Score: 103.219 bits (256), Expect = 1.734e-22
Identity = 89/340 (26.18%), Postives = 167/340 (49.12%), Query Frame = 3
Query: 1245 LHRFIIGKQGSNLNKLMEKY-EHVFINFPENSDL-IVIEGPKDDVNELKGQITHKIAELKSTMAITEIQVDPRFHRHIIGRSGANIQRMQEEYKVQIRMPGNNAVGTSGWTIRIEGDPEGVKLAKTEIESMSVKLENEKTKDVILDHKYHNQLIGAQGSRVKELRNQYPDVIIMFPDLSSKSDIVQLRGPRQQVDQVAVKLNKFIQEVIENNYTKDVKIFKQYHKNIIGKGGVNIRKIREEMNIRIDFPDEHSDSDKIRLTGKKENVEEAAKRIEAMQAELISIKEDTISIPQRLHISLIGTRGKLIKCIQQECGGVQIQFPASDSNSDIIKIRGPESDV 2258
            +++F  G Q      +M K   H+ ++  ++  L I++ G  D V + + +I  ++     T A   + +    HR +IG+SG  +Q ++ +   +I++P  +        I+I G  EG++ AK EI  +S + +    + + +D  +H  + GA G  V +L  +    I + P   +K++IV + G ++QV    VK+ K  +E  +N  T  V++ K  HK +IG  G  +++I E   + ++ P   S S+ + L G+   + +A   +  + A+  S    ++S P  LH  +IG +G+ +  I Q+   V I+F   +   D I + GP  DV
Sbjct:   95 MNQFGEGDQAKVCLDIMHKTGAHLELSMAKDQGLSIMVSGKYDAVMKARKEIVSRL----QTQASATVAIPKEHHRFVIGKSGEKLQELELKTATKIQIPRPDDPSNQ---IKISGTKEGLEKAKHEILLISAEQDKRAVERMNIDKVFHPFITGAHGKLVGDLMQETGARINVPPPSVNKTEIV-ITGEKEQVALAMVKIKKLYEEKKKNATTIAVEVKKSQHKYVIGPKGNTLQEILERTGVSVEIPPLDSSSETVILRGEPARLGQA---LTEVYAKANSYTVSSVSAPSWLHRFIIGKKGQNLAKITQQMPKVHIEFTEGE---DKITLEGPTKDV 420          

HSP 3 Score: 74.3294 bits (181), Expect = 4.958e-13
Identity = 75/304 (24.67%), Postives = 141/304 (46.38%), Query Frame = 3
Query: 1833 VKLNKFIQEVIENNYTKDVKIFKQYHKNIIGKGGVNIRKIREEMNIRIDFPDEHSDSDKIRLTGKKENVEEAAKRIEAMQAELISIKEDTISIPQRLHISLIGTRGKLIKCIQQECGGVQIQFPASDSNSDIIKIRGPESDVDKAXXXXXXXXXXXXXXXHQDSVSAKSEFHKFLIGRKGAQLAEFRKRHAVMLIFPDSEDTNKDTIQIIGAKEAVQKAKEELEVTIKSLENEIEKYITIDTKWHKHFFKKRQAVMEEISREFGGVRIFFPKQDAVENIDQVRVIGPKGCVEAAVVRIEDIIEN 2744
            +K  K I   ++   +  V I K++H+ +IGK G  ++++  +   +I  P     S++I+++G KE +E+A   I  + AE      + ++I +  H  + G  GKL+  + QE G  +I  P    N   I I G +  V  A  ++ +L E+    +   +V  K   HK++IG KG  L E  +R  V +  P   D++ +T+ + G    + +A  E+     S        ++  +  H+    K+   + +I+++   V I F      E  D++ + GP   V+    +IE I+ +
Sbjct:  140 MKARKEIVSRLQTQASATVAIPKEHHRFVIGKSGEKLQELELKTATKIQIPRPDDPSNQIKISGTKEGLEKAKHEILLISAEQDKRAVERMNIDKVFHPFITGAHGKLVGDLMQETGA-RINVPPPSVNKTEIVITGEKEQVALAMVKIKKLYEEKKKNATTIAVEVKKSQHKYVIGPKGNTLQEILERTGVSVEIPPL-DSSSETVILRGEPARLGQALTEVYAKANSY---TVSSVSAPSWLHRFIIGKKGQNLAKITQQMPKVHIEF-----TEGEDKITLEGPTKDVQIVQGQIEVIVTD 433          

HSP 4 Score: 67.3958 bits (163), Expect = 7.606e-11
Identity = 73/329 (22.19%), Postives = 135/329 (41.03%), Query Frame = 3
Query: 2670 DQVRVIGPKGCVEAAVVRIEDIIENLEAQTSLSVFIEQKHHRNLITRNMMEIKSIQSNYDVTIKFPNRDLSSKPGENGMEEIHLNGNGDVNIETMEEVDSTLESEQNNPANWVTISGRKENCESAEDALLELVPITED------VPLANEFHRNFIGQKGQGINTFSTKHNVVVNIPPANKCSDFISIKGPRVNIIDAKAGLDELITMWENEKQDRIARNYENHVTVPIVFHRNIIGQRGANIEIFRTKFNVSIQIPDQNSKSEEITIRGYEEDVKKAEEELISMVEKWKAQVKEELHIPRDVHPQLIGTRGIALRKLRDQF-KVEINF 3635
            DQ   I   G  +A +   ++I+  L+ Q S +V I ++HHR +I ++  +++ ++      I+ P  D                                      +P+N + ISG KE  E A+  +L L+   +D      + +   FH    G  G+ +     +    +N+PP +     I I G +  +  A   + +L   +E +K++      E    V    H+ +IG +G  ++    +  VS++IP  +S SE + +RG    + +A  E+ +    +       +  P  +H  +IG +G  L K+  Q  KV I F
Sbjct:  125 DQGLSIMVSGKYDAVMKARKEIVSRLQTQASATVAIPKEHHRFVIGKSGEKLQELELKTATKIQIPRPD--------------------------------------DPSNQIKISGTKEGLEKAKHEIL-LISAEQDKRAVERMNIDKVFHPFITGAHGKLVGDLMQETGARINVPPPSVNKTEIVITGEKEQVALAMVKIKKL---YEEKKKNATTIAVE----VKKSQHKYVIGPKGNTLQEILERTGVSVEIPPLDSSSETVILRGEPARLGQALTEVYAKANSYTVS---SVSAPSWLHRFIIGKKGQNLAKITQQMPKVHIEF 404          

HSP 5 Score: 56.9954 bits (136), Expect = 1.362e-7
Identity = 46/180 (25.56%), Postives = 80/180 (44.44%), Query Frame = 3
Query: 3186 ANKCSDFISIKGPRVNIIDAK--------AGLDELITMWENEKQDRIARNYENHVTVPIVFHRNIIGQRGANIEIFRTKFNVSIQIPDQNSKSEEITIRGYEEDVKKAEEELISMVEKWKAQVKEELHIPRDVHPQLIGTRGIALRKLRDQFKVEINFPNRNVDDEKAHLVEVIGDKENV 3701
            A  C D +   G  + +  AK        +G  + +     E   R+       V +P   HR +IG+ G  ++    K    IQIP  +  S +I I G +E ++KA+ E++ +  +   +  E ++I +  HP + G  G  +  L  +    IN P  +V+  K  +V + G+KE V
Sbjct:  104 AKVCLDIMHKTGAHLELSMAKDQGLSIMVSGKYDAVMKARKEIVSRLQTQASATVAIPKEHHRFVIGKSGEKLQELELKTATKIQIPRPDDPSNQIKISGTKEGLEKAKHEILLISAEQDKRAVERMNIDKVFHPFITGAHGKLVGDLMQETGARINVPPPSVN--KTEIV-ITGEKEQV 280          
BLAST of High density lipoprotein binding protein (Vigilin) vs. Ensembl Xenopus
Match: hdlbp (high density lipoprotein binding protein (vigilin) [Source:NCBI gene;Acc:448610])

HSP 1 Score: 895.575 bits (2313), Expect = 0.000e+0
Identity = 512/1233 (41.52%), Postives = 772/1233 (62.61%), Query Frame = 3
Query:  243 YDDQFPPLPTCNTPKIVQ----NSKPRIGQTKTSHVTQTLTVPLAERRFSNREANNSVKNDAQKKICQTVAQKCGVSIELNSGNKDQNLMVFISGPQDNVSNAKRILTKEXXXXXXXXMKVPKEYHKFILGRNGASLREIESGSNTNVTIPRSIENNDIITIFGTKEGIDKARAEINQIVAERSKLATERITIPKRFYPFINGSNNSKIYKIREMTNAKXXXXXXXXXXXXXXXXGEKDGVYQALEIIQKIYEDTKKCSSSLNLPIPKSQHCYVIGAKGSGIAEIFERTGVSIEMPSQDSDDDTIVLYGPNEFLAPALSMVIQKSESMIRVNIEAPNWLHRFIIGKQGSNLNKLMEKYEHVFINFPENSDLIVIEGPKDDVNELKGQITHKIAELKSTMAITEIQVDPRFHRHIIGRSGANIQRMQEEYKVQIRMPGNNAVGTSGWTIRIEGDPEGVKLAKTEIESMSVKLENEKTKDVILDHKYHNQLIGAQGSRVKELRNQYPDVIIMFPDLSSKSDIVQLRGPRQQVDQVAVKLNKFIQEVIENNYTKDVKIFKQYHKNIIGKGGVNIRKIREEMNIRIDFPDEHSDSDKIRLTGKKENVEEAAKRIEAMQAELISIKEDTISIPQRLHISLIGTRGKLIKCIQQECGGVQIQFPASDSNSDIIKIRGPESDVDKAXXXXXXXXXXXXXXXHQDSVSAKSEFHKFLIGRKGAQLAEFRKRHAVMLIFPDSEDTNKDTIQIIGAKEAVQKAKEELEVTIKSLENEIEKYITIDTKWHKHFFKKRQAVMEEISREFGGVRIFFPKQDAVENIDQVRVIGPKGCVEAAVVRIEDIIENLEAQTSLSVFIEQKHHRNLITRNMMEIKSIQSNYDVTIKFPNRDLSSKPGENGMEEIHLNGNGDVNIETMEEVDSTLESEQNNPANWVTISGRKENCESAEDALLELVPITEDVPLANEFHRNFIGQKGQGINTFSTKHNVVVNIPPANKCSDFISIKGPRVNIIDAKAGLDELITMWENEKQDRIARNYENHVTVPIVFHRNIIGQRGANIEIFRTKFNVSIQIPDQNSKSE-EITIRGYEEDVKKAEEELISMVEKWKAQVKEELHIPRDVHPQLIGTRGIALRKLRDQFKVEINFPNRNVDDEKAHLVEVIGDKENVDKCCDILVERANELLNEWEERNQVREVKNLIKDRENINSSSNIKEKGPGFLLTGAPW----QQRVPDASSNVDFP 3914
            Y D FPPLP        Q     +  +I   K+S +TQ   VPL ER++ +           Q KIC  + QK G  +EL S  KDQ L + +SG  D+V  A++ +   LQTQ    + +PKE+H+F++G+NG  L+++E  + T + IPR  E ++ I I GTKEGI+KAR EI  I AE+ K A ER+ I K ++PFI G  N  + +I + T  +INIPPPSV   EI+ +GEK+ + QA+  I++IYE+ KK ++S+ + + KSQH YVIG KG+ + EI ERTGVS+E+P  DS  +T++L G  E L  AL+ V  K+ S    ++ AP+WLHRFIIGK+G NL K+ ++   V I F E  D I +EGP +DV   + Q+   + +L S M   EI +D RFHRH+IG+SGA I +++E+YKV +R+P ++        IRIEGDP+GV+ AK E+  ++ ++ENE+TKD+I++ K+H  +IG +G R++E+R ++P+VII FPD + KSDIVQLRGP+ +V++    L K + E++EN+Y+  V IFKQ+HKNIIGKGG NI+KIREE N +ID P E+S+S+ I +TGK+ N E A  RI A+Q EL +I E  ++IP +LH SLIG +G+ I+ I +ECGGV I FP+  S SD + IRGP  DV++AKKQLL+L+E+    S    + AK E+HKFLIG+ G  + + R +    +IFP ++D ++  I I+G +++V++A++ELE  IKSL+N +E  +++D K H+HF  +R  V+ +I+ E+GGV + FP+       D+V + G K CVEAA  +I DIIE+LEAQ ++   I Q+ HR+++    + ++ I   + V IKFP+R+++ +   N   E H+  NGD   E         + E     + + ISGRKE CE+A DAL  LVP++ +V +  + HR  IGQKG GI     +  V + +P   +  D I+I G   N+  AKAGL E +   + E++DR  R+++  V+V   FH  IIG++GA I + R+  +V+IQ PD+N +++ +I I GYE + + A + ++ +V   +  V E++ +   VH ++IG RG A+RK+ D+FKV+I FP     D   +LV V G  E+VD+  D L+    E +++  + N+V  +++ +K   +  S S   +   GF++  APW     ++ PD SS+ DFP
Sbjct:   42 YKDAFPPLPEKAVGNETQAEPVGAWSKIRPIKSSIITQVFHVPLEERKYKDM---AQFGEGEQAKICLDIMQKTGAQLEL-SLAKDQGLSIMVSGKHDSVMKARKEIVTRLQTQASASVAIPKEHHRFVIGKNGEKLQDLELKTATKIQIPRPEEASNQIKITGTKEGIEKARHEILLISAEQDKRAVERLEIEKAYHPFIAGPYNKVVTEIMQETATRINIPPPSVNKTEIVCTGEKEQLAQAVARIKQIYEEKKKKTTSIAVEVRKSQHKYVIGPKGNNLQEILERTGVSVEIPPSDSSSETVILRGEPEKLGQALTEVYAKANSFTVASVSAPSWLHRFIIGKKGQNLAKITQQIPKVHIEFTEGEDKISLEGPTEDVTVAQQQMEALVRDLISRMDFAEINIDHRFHRHLIGKSGAKINKIKEQYKVSVRIPQDSEKSNH---IRIEGDPQGVQQAKKELLELASRMENERTKDLIIEQKFHRTIIGQKGERIREIREKFPEVIINFPDPAQKSDIVQLRGPKNEVEKCTKYLQKMVSELVENSYSISVPIFKQFHKNIIGKGGANIKKIREECNTKIDLPAENSNSEMIVITGKRPNCEAARDRILAIQKELANITELEVNIPSKLHNSLIGAKGRFIRSIMEECGGVHIHFPSEGSGSDTVTIRGPVQDVERAKKQLLQLAEEKQTKSFTSELKAKPEYHKFLIGKGGGNIRKVRDQTGARIIFPTADDKDQQLITIVGTEDSVKEAQKELEFLIKSLDNIVEDSMSVDPKHHRHFVIRRGQVLRDIAEEYGGVIVSFPRSGV--QSDRVTLKGAKECVEAAKKKILDIIEDLEAQVTIECLITQRFHRSIMGPKGIRVQQITREFGVQIKFPDREVTPQGAPNA--EPHVQENGDEGTEV-----KATDPESPKKCDIILISGRKEKCEAASDALKALVPVSIEVEVPFDLHRYIIGQKGSGIRKMMDEFEVNIQVPSPEQQCDTITITGQSANLDRAKAGLLERVRELQAEQEDRALRSFKLAVSVDPKFHPKIIGRKGAVISLIRSDHDVNIQFPDKNDENQDQIIITGYERNTESARDAILHIVGDLEKMVSEDITVDHRVHARIIGARGKAIRKIMDEFKVDIRFPQTGAPD--PNLVTVTGKPEDVDEAIDHLLNLEEEYMSDVVD-NEV--MQSYMKPHSHEESKS---QPSKGFVVRDAPWTTGSNEKAPDMSSSEDFP 1250          
BLAST of High density lipoprotein binding protein (Vigilin) vs. Ensembl Xenopus
Match: hdlbp (high density lipoprotein binding protein (vigilin) [Source:NCBI gene;Acc:448610])

HSP 1 Score: 850.892 bits (2197), Expect = 0.000e+0
Identity = 501/1240 (40.40%), Postives = 763/1240 (61.53%), Query Frame = 3
Query:  243 YDDQFPPLPTCNTPKIVQ----NSKPRIGQTKTSHVTQTLTVPLAERRFSNREANNSVKNDAQKKICQTVAQKCGVSIELNSGNKDQNLMVFISGPQDNVSNAKRILTKEXXXXXXXXMKVPKEYHKFILGRNGASLREIESGSNTNVTIPRSIENNDIITIFGTKEGIDKARAEINQIVAERSKLATERITIPKRFYPFINGSNNSKIYKIREMTNAKXXXXXXXXXXXXXXXXGEKDGVYQALEIIQKIYEDTKKCSSSLNLPIPKSQHCYVIGAKGSGIAEIFERTGVSIEMPSQDSDDDTIVLYGPNEFLAPALSMVIQKSESMIRVNIEAPNWLHRFIIGKQGSNLNKLMEKYEHVFINFPENSDLIVIEGPKDDVNELKGQITHKIAELK---STMAITEIQVDPRF---HRHIIG-RSGANIQRMQEEYKVQIRMPGNNAVGTSGWTIRIEGDPEGVKLAKTEIESMSVKLENEKTKDVILDHKYHNQLIGAQGSRVKELRNQYPDVIIMFPDLSSKSDIVQLRGPRQQVDQVAVKLNKFIQEVIENNYTKDVKIFKQYHKNIIGKGGVNIRKIREEMNIRIDFPDEHSDSDKIRLTGKKENVEEAAKRIEAMQAELISIKEDTISIPQRLHISLIGTRGKLIKCIQQECGGVQIQFPASDSNSDIIKIRGPESDVDKAXXXXXXXXXXXXXXXHQDSVSAKSEFHKFLIGRKGAQLAEFRKRHAVMLIFPDSEDTNKDTIQIIGAKEAVQKAKEELEVTIKSLENEIEKYITIDTKWHKHFFKKRQAVMEEISREFGGVRIFFPKQDAVENIDQVRVIGPKGCVEAAVVRIEDIIENLEAQTSLSVFIEQKHHRNLITRNMMEIKSIQSNYDVTIKFPNRDLSSKPGENGMEEIHLNGNGDVNIETMEEVDSTLESEQNNPANWVTISGRKENCESAEDALLELVPITEDVPLANEFHRNFIGQKGQGINTFSTKHNVVVNIPPANKCSDFISIKGPRVNIIDAKAGLDELITMWENEKQDRIARNYENHVTVPIVFHRNIIGQRGANIEIFRTKFNVSIQIPDQNSKSE-EITIRGYEEDVKKAEEELISMVEKWKAQVKEELHIPRDVHPQLIGTRGIALRKLRDQFKVEINFPNRNVDDEKAHLVEVIGDKENVDKCCDILVERANELLNEWEERNQVREVKNLIKDRENINSSSNIKEKGPGFLLTGAPWQ----QRVPDASSNVDFP 3914
            Y D FPPLP        Q     +  +I   K+S +TQ   VPL ER++ +           Q KIC  + QK G  +EL S  KDQ L + +SG  D+V  A++ +   LQTQ    + +PKE+H+F++G+NG  L+++E  + T + IPR  E ++ I I GTKEGI+KAR EI  I AE+ K A ER+ I K ++PFI G  N  + +I + T  +INIPPPSV   EI+ +GEK+ + QA+  I++IYE+ KK ++S+ + + KSQH YVIG KG+ + EI ERTGVS+E+P  DS  +T++L G  E L  AL+ V  K+ S    ++ AP+WLHRFIIGK+G NL K+ ++   V I F E  D I +EGP +DV   + Q+   + +L    + + +  I V   F    R +IG      + +++E+YKV +R+P ++        IRIEGDP+GV+ AK E+  ++ ++ENE+TKD+I++ K+H  +IG +G R++E+R ++P+VII FPD + KSDIVQLRGP+ +V++    L K + E++EN+Y+  V IFKQ+HKNIIGKGG NI+KIREE N +ID P E+S+S+ I +TGK+ N E A  RI A+Q EL +I E  ++IP +LH SLIG +G+ I+ I +ECGGV I FP+  S SD + IRGP  DV++AKKQLL+L+E+    S    + AK E+HKFLIG+ G  + + R +    +IFP ++D ++  I I+G +++V++A++ELE  IKSL+N +E  +++D K H+HF  +R  V+ +I+ E+GGV + FP+       D+V + G K CVEAA  +I DIIE+LEAQ ++   I Q+ HR+++    + ++ I   + V IKFP+R+++ +       E H+  NGD   E         + E     + + ISGRKE CE+A DAL  LVP++ +V +  + HR  IGQKG GI     +  V + +P   +  D I+I G   N+  AKAGL E +   + E++DR  R+++  V+V   FH  IIG++GA I + R+  +V+IQ PD+N +++ +I I GYE + + A + ++ +V   +  V E++ +   VH ++IG RG A+RK+ D+FKV+I FP     D   +LV V G  E+VD+  D L+    E +++  + N+V  +++ +K   +  S S   +   GF++  APW     ++ PD SS+ DFP
Sbjct:   38 YKDAFPPLPEKAVGNETQAEPVGAWSKIRPIKSSIITQVFHVPLEERKYKDM---AQFGEGEQAKICLDIMQKTGAQLEL-SLAKDQGLSIMVSGKHDSVMKARKEIVTRLQTQASASVAIPKEHHRFVIGKNGEKLQDLELKTATKIQIPRPEEASNQIKITGTKEGIEKARHEILLISAEQDKRAVERLEIEKAYHPFIAGPYNKVVTEIMQETATRINIPPPSVNKTEIVCTGEKEQLAQAVARIKQIYEEKKKKTTSIAVEVRKSQHKYVIGPKGNNLQEILERTGVSVEIPPSDSSSETVILRGEPEKLGQALTEVYAKANSFTVASVSAPSWLHRFIIGKKGQNLAKITQQIPKVHIEFTEGEDKISLEGPTEDVTVAQQQMEALVRDLVKYFTCICVYVIHVYVLFLLVMRSVIGLMDHIAVNKIKEQYKVSVRIPQDSEKSNH---IRIEGDPQGVQQAKKELLELASRMENERTKDLIIEQKFHRTIIGQKGERIREIREKFPEVIINFPDPAQKSDIVQLRGPKNEVEKCTKYLQKMVSELVENSYSISVPIFKQFHKNIIGKGGANIKKIREECNTKIDLPAENSNSEMIVITGKRPNCEAARDRILAIQKELANITELEVNIPSKLHNSLIGAKGRFIRSIMEECGGVHIHFPSEGSGSDTVTIRGPVQDVERAKKQLLQLAEEKQTKSFTSELKAKPEYHKFLIGKGGGNIRKVRDQTGARIIFPTADDKDQQLITIVGTEDSVKEAQKELEFLIKSLDNIVEDSMSVDPKHHRHFVIRRGQVLRDIAEEYGGVIVSFPRSGV--QSDRVTLKGAKECVEAAKKKILDIIEDLEAQVTIECLITQRFHRSIMGPKGIRVQQITREFGVQIKFPDREVTPQ------GEPHVQENGDEGTEV-----KATDPESPKKCDIILISGRKEKCEAASDALKALVPVSIEVEVPFDLHRYIIGQKGSGIRKMMDEFEVNIQVPSPEQQCDTITITGQSANLDRAKAGLLERVRELQAEQEDRALRSFKLAVSVDPKFHPKIIGRKGAVISLIRSDHDVNIQFPDKNDENQDQIIITGYERNTESARDAILHIVGDLEKMVSEDITVDHRVHARIIGARGKAIRKIMDEFKVDIRFPQTGAPD--PNLVTVTGKPEDVDEAIDHLLNLEEEYMSDVVD-NEV--MQSYMKPHSHEESKS---QPSKGFVVRDAPWTTGSNEKAPDMSSSEDFP 1249          
BLAST of High density lipoprotein binding protein (Vigilin) vs. Ensembl Xenopus
Match: hdlbp (high density lipoprotein binding protein (vigilin) [Source:NCBI gene;Acc:448610])

HSP 1 Score: 726.087 bits (1873), Expect = 0.000e+0
Identity = 425/1079 (39.39%), Postives = 652/1079 (60.43%), Query Frame = 3
Query:  708 ITIFGTKEGIDKARAEINQIVAERSKLATERITIPKRFYPFINGSNNSKIYKIREMTNAKXXXXXXXXXXXXXXXXGEKDGVYQAL-EIIQKIYEDTKKCSSSLNLPIPKSQHCYVIGAKGSGIAEIFERTGVSIEMPSQDSDDDTIVLYGPNEFLAPALSMVIQ----KSESMIRVNIEAPNWLHRFIIGKQGSNLNKLMEKYEHVFINFPENSDLIVIEGPKDDVNELKGQITHKIAELKSTMAITEIQVDPRFHRHIIGRSGANIQRMQEEYKVQIRMPGNNAVGTSGWTIRIEGDPEGVKLAKTEIESMSVKLENEKTKDVILDHKYHNQLIGAQGSRVKELRNQYPDVIIMFPDLSSKSDIVQLRGPRQQVDQVAVKLNKFIQEVIENNYTKDVKIFKQYHKNIIGKGGVNIRKIREEMNIRIDFPDEHSDSDKIRLTGKKENVEEAAKRIEAMQAELISIKEDTISIPQRLHISLIGTRGKLIKCIQQECGGVQIQFPASDSNSDIIKIRGPESDVDKAXXXXXXXXXXXXXXXHQDSVSAKSEFHKFLIGRKGAQLAEFRKRHAVMLIFPDSEDTNKDTIQIIGAKEAVQKAKEELEVTIKSLENEIEKYITIDTKWHKHFFKKRQAVMEEISREFGGVRIFFPKQDAVENIDQVRVIGPKGCVEAAVVRIEDIIENLEAQTSLSVFIEQKHHRNLITRNMMEIKSIQSNYDVTIKFPNRDLSSKPGENGMEEIHLNGNGDVNIETMEEVDSTLESEQNNPANWVTISGRKENCESAEDALLELVPITEDVPLANEFHRNFIGQKGQGINTFSTKHNVVVNIPPANKCSDFISIKGPRVNIIDAKAGLDELITMWENEKQDRIARNYENHVTVPIVFHRNIIGQRGANIEIFRTKFNVSIQIPDQNSKSE-EITIRGYEEDVKKAEEELISMVEKWKAQVKEELHIPRDVHPQLIGTRGIALRKLRDQFKVEINFPNRNVDDEKAHLVEVIGDKENVDKCCDILVERANELLNEWEERNQVREVKNLIKDRENINSSSNIKEKGPGFLLTGAPW----QQRVPDASSNVDFP 3914
            I + G  + + KAR EI   V      A+  + IPK  + F+ G N  K+  +   T  KI IP P   S +I I+G K+G+ +A  EI+    E  K+    L   I K+ H ++ G     + EI + T   I +P    +   IV  G  E LA A++ + Q    K+ S    ++ AP+WLHRFIIGK+G NL K+ ++   V I F E  D I +EGP +DV   + Q+   + +L S M   EI +D RFHRH+IG+SGA I +++E+YKV +R+P ++        IRIEGDP+GV+ AK E+  ++ ++ENE+TKD+I++ K+H  +IG +G R++E+R ++P+VII FPD + KSDIVQLRGP+ +V++    L K + E++EN+Y+  V IFKQ+HKNIIGKGG NI+KIREE N +ID P E+S+S+ I +TGK+ N E A  RI A+Q EL +I E  ++IP +LH SLIG +G+ I+ I +ECGGV I FP+  S SD + IRGP  DV++AKKQLL+L+E+    S    + AK E+HKFLIG+ G  + + R +    +IFP ++D ++  I I+G +++V++A++ELE  IKSL+N +E  +++D K H+HF  +R  V+ +I+ E+GGV + FP+       D+V + G K CVEAA  +I DIIE+LEAQ ++   I Q+ HR+++    + ++ I   + V IKFP+R+++ +       E H+  NGD   E         + E     + + ISGRKE CE+A DAL  LVP++ +V +  + HR  IGQKG GI     +  V + +P   +  D I+I G   N+  AKAGL E +   + E++DR  R+++  V+V   FH  IIG++GA I + R+  +V+IQ PD+N +++ +I I GYE + + A + ++ +V   +  V E++ +   VH ++IG RG A+RK+ D+FKV+I FP     D   +LV V G  E+VD+  D L+    E +++  + N+V  +++ +K   +  S S   +   GF++  APW     ++ PD SS+ DFP
Sbjct:  124 IMVSGKHDSVMKARKEI---VTRLQTQASASVAIPKEHHRFVIGKNGEKLQDLELKTATKIQIPRPEEASNQIKITGTKEGIEKARHEILLISAEQDKRAVERLE--IEKAYHPFIAGPYNKVVTEIMQETATRINIPPPSVNKTEIVCTGEKEQLAQAVARIKQIYEEKANSFTVASVSAPSWLHRFIIGKKGQNLAKITQQIPKVHIEFTEGEDKISLEGPTEDVTVAQQQMEALVRDLISRMDFAEINIDHRFHRHLIGKSGAKINKIKEQYKVSVRIPQDSEKSNH---IRIEGDPQGVQQAKKELLELASRMENERTKDLIIEQKFHRTIIGQKGERIREIREKFPEVIINFPDPAQKSDIVQLRGPKNEVEKCTKYLQKMVSELVENSYSISVPIFKQFHKNIIGKGGANIKKIREECNTKIDLPAENSNSEMIVITGKRPNCEAARDRILAIQKELANITELEVNIPSKLHNSLIGAKGRFIRSIMEECGGVHIHFPSEGSGSDTVTIRGPVQDVERAKKQLLQLAEEKQTKSFTSELKAKPEYHKFLIGKGGGNIRKVRDQTGARIIFPTADDKDQQLITIVGTEDSVKEAQKELEFLIKSLDNIVEDSMSVDPKHHRHFVIRRGQVLRDIAEEYGGVIVSFPRSGV--QSDRVTLKGAKECVEAAKKKILDIIEDLEAQVTIECLITQRFHRSIMGPKGIRVQQITREFGVQIKFPDREVTPQ------GEPHVQENGDEGTEV-----KATDPESPKKCDIILISGRKEKCEAASDALKALVPVSIEVEVPFDLHRYIIGQKGSGIRKMMDEFEVNIQVPSPEQQCDTITITGQSANLDRAKAGLLERVRELQAEQEDRALRSFKLAVSVDPKFHPKIIGRKGAVISLIRSDHDVNIQFPDKNDENQDQIIITGYERNTESARDAILHIVGDLEKMVSEDITVDHRVHARIIGARGKAIRKIMDEFKVDIRFPQTGAPD--PNLVTVTGKPEDVDEAIDHLLNLEEEYMSDVVD-NEV--MQSYMKPHSHEESKS---QPSKGFVVRDAPWTTGSNEKAPDMSSSEDFP 1173          

HSP 2 Score: 349.747 bits (896), Expect = 1.463e-99
Identity = 323/1151 (28.06%), Postives = 544/1151 (47.26%), Query Frame = 3
Query:  243 YDDQFPPLPTCNTPKIVQ----NSKPRIGQTKTSHVTQTLTVPLAERRFSNREANNSVKNDAQKKICQTVAQKCGVSIELNSGNKDQNLMVFISGPQDNVSNAKRILTKEXXXXXXXXMKVPKEYHKFILGRNGASLREIESGSNTNVTIPRSIENNDIITIFGTKEGIDKARAEINQIVAERSKLATERITIPKRFYPFINGSNNSKIYKIREMTNAKXXXXXXXXXXXXXXXXGEKDGVYQALEIIQKIYEDTKKCSSSLNLPIPKSQHCYVIGAKGSGIAEIFERT-GVSIEMPSQDSDDDTIVLYGPNEFLAPALSMVIQKSESMIR----------VNIEAPNWLHRFIIGKQGSNLNKLMEKYEHVFINFP---ENSDLIVIEGPKDDVNELKGQITHKIAELKSTMA---ITEIQVDPRFHRHIIGRSGANIQRMQEEYK---------------VQIRMPGN---------------------------------NAVGTSGWTIR-----------------------IEGDPEGVKLAKTEIESMSVKLENEKTKDVILDHKYHNQLIGAQGSRVKELRNQYPDVIIMFPDLSSKSDIVQLRGPRQQVDQVAVKLNKFIQEVIENNYTKDVKIFKQYHKNIIGKGGVNIRKIREEMNIRIDFPD-EHSDSDKIRLTGKKENVEEAAKRIEAMQAELISIKEDTISIPQRLHISLIGTRGKLIKCIQQECGGVQIQFPASDSNSDIIKIRGPESDVDKAXXXXXXXXXXXXXXXHQDSVSAKSEFHKFLIGRKGAQLAEFRKRHAVMLIFPDSEDTNK--------------------------DTIQIIGAKEAVQKAKEELEVTIKSLENEIEKYITIDTKWHKHFFKKRQAVMEEISREFGGVRIFFPKQDAVENIDQVRVIGPKGCVEAAVVRIEDIIENLEAQT--------SLSVFIEQKHHRNLITRNMMEIKSIQSNYDVTIKFPNRDLSSKPGENGMEEIHLNGNGDVNIETMEEVDSTLESEQNNPANWVTISGRKENCESAEDALLELVP-----ITEDVPLANEFHRNFIGQKGQGINTFSTKHNVVVNIPPANKCS-DFISIKGPRVNIIDAKAGLDELITMWENEKQD 3296
            Y D FPPLP        Q     +  +I   K+S +TQ   VPL ER++ +           Q KIC  + QK G  +EL S  KDQ L + +SG  D+V  A++ +   LQTQ    + +PKE+H+F++G+NG  L+++E  + T + IPR  E ++ I I GTKEGI+KAR EI  I AE+ K A ER+ I K ++PFI G  N  + +I + T  +INIPPPSV   EI+ +GEK+ + QA+  I++IYE+     +  ++  P   H ++IG KG  +A+I ++   V IE       +D I L GP E     +++  Q+ E+++R          +NI+  +  HR +IGK G+ +NK+ E+Y+ V +  P   E S+ I IEG    V + K ++     EL S M      ++ ++ +FHR IIG+ G  I+ ++E++                VQ+R P N                                 N +G  G  I+                       I G     + A+  I ++  +L N    +V +  K HN LIGA+G  ++ +  +   V I FP   S SD V +RGP Q V++   +L +  +E    ++T ++K   +YHK +IGKGG NIRK+R++   RI FP  +  D   I + G +++V+EA K +E +   L +I ED++S+  + H   +  RG++++ I +E GGV + FP S   SD + ++G +  V+ AKK++L++ E        + +  +  FH+ ++G KG ++ +  +   V + FPD E T +                          D I I G KE  + A + L+  +      IE  +  D   H++   ++ + + ++  EF  V I  P  +  +  D + + G    ++ A   + + +  L+A+          L+V ++ K H  +I R    I  I+S++DV I+FP+++                                   ++N   + + I+G + N ESA DA+L +V      ++ED+ + +  H   IG +G+ I     +  V +  P       + +++ G   ++ +A   +D L+ + E    D
Sbjct:   38 YKDAFPPLPEKAVGNETQAEPVGAWSKIRPIKSSIITQVFHVPLEERKYKDM---AQFGEGEQAKICLDIMQKTGAQLEL-SLAKDQGLSIMVSGKHDSVMKARKEIVTRLQTQASASVAIPKEHHRFVIGKNGEKLQDLELKTATKIQIPRPEEASNQIKITGTKEGIEKARHEILLISAEQDKRAVERLEIEKAYHPFIAGPYNKVVTEIMQETATRINIPPPSVNKTEIVCTGEKEQLAQAVARIKQIYEEKANSFTVASVSAPSWLHRFIIGKKGQNLAKITQQIPKVHIEF---TEGEDKISLEGPTE----DVTVAQQQMEALVRDLISRMDFAEINID--HRFHRHLIGKSGAKINKIKEQYK-VSVRIPQDSEKSNHIRIEGDPQGVQQAKKELL----ELASRMENERTKDLIIEQKFHRTIIGQKGERIREIREKFPEVIINFPDPAQKSDIVQLRGPKNEVEKCTKYLQKMVSELVENSYSISVPIFKQFHKNIIGKGGANIKKIREECNTKIDLPAENSNSEMIVITGKRPNCEAARDRILAIQKELANITELEVNIPSKLHNSLIGAKGRFIRSIMEECGGVHIHFPSEGSGSDTVTIRGPVQDVERAKKQLLQLAEEKQTKSFTSELKAKPEYHKFLIGKGGGNIRKVRDQTGARIIFPTADDKDQQLITIVGTEDSVKEAQKELEFLIKSLDNIVEDSMSVDPKHHRHFVIRRGQVLRDIAEEYGGVIVSFPRSGVQSDRVTLKGAKECVEAAKKKILDIIEDLEAQVTIECLITQ-RFHRSIMGPKGIRVQQITREFGVQIKFPDREVTPQGEPHVQENGDEGTEVKATDPESPKKCDIILISGRKEKCEAASDALKALVPV---SIEVEVPFD--LHRYIIGQKGSGIRKMMDEF-EVNIQVPSPE--QQCDTITITGQSANLDRAKAGLLERVRELQAEQEDRALRSFKLAVSVDPKFHPKIIGRKGAVISLIRSDHDVNIQFPDKN-----------------------------------DENQ--DQIIITGYERNTESARDAILHIVGDLEKMVSEDITVDHRVHARIIGARGKAIRKIMDEFKVDIRFPQTGAPDPNLVTVTGKPEDVDEA---IDHLLNLEEEYMSD 1121          
BLAST of High density lipoprotein binding protein (Vigilin) vs. Ensembl Xenopus
Match: hdlbp (high density lipoprotein binding protein (vigilin) [Source:NCBI gene;Acc:448610])

HSP 1 Score: 636.721 bits (1641), Expect = 0.000e+0
Identity = 358/952 (37.61%), Postives = 566/952 (59.45%), Query Frame = 3
Query:  936 GEKDGVYQAL-EIIQKIYEDTKKCSSSLNLPIPKSQHCYVIGAKGSGIAEIFERTGVSIEMPSQDSDDDTIVLYGPNEFLAPALSMVIQKSESMIR------------VNIEAPNWLHRFIIGKQGSNLNKLMEKYEHVFINFPENSDLIVIEGPKDDVNELKGQITHKIAELKSTMAITEIQVDPRFHRHIIGRSGANIQRMQEEYKVQIRMPGNNAVGTSGWTIRIEGDPEGVKLAKTEIESMSVKLENEKTKDVILDHKYHNQLIGAQGSRVKELRNQYPDVIIMFPDLSSKSDIVQLRGPRQQVDQVAVKLNKFIQEVIENNYTKDVKIFKQYHKNIIGKGGVNIRKIREEMNIRIDFPDEHSDSDKIRLTGKKENVEEAAKRIEAMQAELISIKEDTISIPQRLHISLIGTRGKLIKCIQQECGGVQIQFPASDSNSDIIKIRGPESDVDKAXXXXXXXXXXXXXXXHQDSVSAKSEFHKFLIGRKGAQLAEFRKRHAVMLIFPDSEDTNKDTIQIIGAKEAVQKAKEELEVTIKSLENEIEKYITIDTKWHKHFFKKRQAVMEEISREFGGVRIFFPKQDAVENIDQVRVIGPKGCVEAAVVRIEDIIENLEAQTSLSVFIEQKHHRNLITRNMMEIKSIQSNYDVTIKFPNRDLSSKPGENGMEEIHLNGNGDVNIETMEEVDSTLESEQNNPANWVTISGRKENCESAEDALLELVPITEDVPLANEFHRNFIGQKGQGINTFSTKHNVVVNIPPANKCSDFISIKGPRVNIIDAKAGLDELITMWENEKQDRIARNYENHVTVPIVFHRNIIGQRGANIEIFRTKFNVSIQIPDQNSKSE-EITIRGYEEDVKKAEEELISMVEKWKAQVKEELHIPRDVHPQLIGTRGIALRKLRDQFKVEINFPNRNVDDEKAHLVEVIGDKENVDKCCDILVERANELLN 3749
            G+ D V +A  EI+ ++     +  +S ++ IPK  H +VIG  G  + ++  +T   I++P  +   + I + G  E +  A   ++  S   ++             ++ AP+WLHRFIIGK+G NL K+ ++   V I F E  D I +EGP +DV   + Q+   + +L S M   EI +D RFHRH+IG+SGA I +++E+YKV +R+P ++        IRIEGDP+GV+ AK E+  ++ ++ENE+TKD+I++ K+H  +IG +G R++E+R ++P+VII FPD + KSDIVQLRGP+ +V+    K  K++Q+++EN+Y+  V IFKQ+HKNIIGKGG NI+KIREE N +ID P E+S+S+ I +TGK+ N E A  RI A+Q EL +I E  ++IP +LH SLIG +G+ I+ I +ECGGV I FP+  S ++  +++                              AK E+HKFLIG+ G  + + R +    +IFP ++D ++  I I+G +++V++A++ELE  IKSL+N +E  +++D K H+HF  +R  V+ +I+ E+GGV + FP+       D+V + G K CVEAA  +I DIIE+L         I Q+ HR+++    + ++ I   + V IKFP+R+++ + GE       + G          EV +T + E     + + ISGRKE CE+A DAL  LVP++ +V +  + HR  IGQKG GI     +  V + +P   +  D I+I G   N+  AKAGL E +   + E++DR  R+++  V+V   FH  IIG++GA I + R+  +V+IQ PD+N +++ +I I GYE + + A + ++ +V   +  V E++ +   VH ++IG RG A+RK+ D+FKV+I FP     D   +LV V G  E+VD+  D L+    E ++
Sbjct:   67 GKHDSVMKARKEIVTRL-----QTQASASVAIPKEHHRFVIGKNGEKLQDLELKTATKIQIPRPEEASNQIKITGTKEGIEKARHEILLISAEQVKNICTFFPFLFTVASVSAPSWLHRFIIGKKGQNLAKITQQIPKVHIEFTEGEDKISLEGPTEDVTVAQQQMEALVRDLISRMDFAEINIDHRFHRHLIGKSGAKINKIKEQYKVSVRIPQDSEKSNH---IRIEGDPQGVQQAKKELLELASRMENERTKDLIIEQKFHRTIIGQKGERIREIREKFPEVIINFPDPAQKSDIVQLRGPKNEVE----KCTKYLQKMVENSYSISVPIFKQFHKNIIGKGGANIKKIREECNTKIDLPAENSNSEMIVITGKRPNCEAARDRILAIQKELANITELEVNIPSKLHNSLIGAKGRFIRSIMEECGGVHIHFPSEGSGTNYAELK------------------------------AKPEYHKFLIGKGGGNIRKVRDQTGARIIFPTADDKDQQLITIVGTEDSVKEAQKELEFLIKSLDNIVEDSMSVDPKHHRHFVIRRGQVLRDIAEEYGGVIVSFPRSGV--QSDRVTLKGAKECVEAAKKKILDIIEDL-------CLITQRFHRSIMGPKGIRVQQITREFGVQIKFPDREVTPQGGE-------ILGT---------EVKAT-DPESPKKCDIILISGRKEKCEAASDALKALVPVSIEVEVPFDLHRYIIGQKGSGIRKMMDEFEVNIQVPSPEQQCDTITITGQSANLDRAKAGLLERVRELQAEQEDRALRSFKLAVSVDPKFHPKIIGRKGAVISLIRSDHDVNIQFPDKNDENQDQIIITGYERNTESARDAILHIVGDLEKMVSEDITVDHRVHARIIGARGKAIRKIMDEFKVDIRFPQTGAPD--PNLVTVTGKPEDVDEAIDHLLNLEEEYVS 948          

HSP 2 Score: 298.13 bits (762), Expect = 1.730e-83
Identity = 280/1069 (26.19%), Postives = 490/1069 (45.84%), Query Frame = 3
Query:  243 YDDQFPPLPTCNTPKIVQNSKPRIGQTKTSHVTQTLTVPLAERRFSNREANNSVKNDAQKKICQTVAQKCGVSIELNSGNKDQNLMVFISGPQDNVSNAKRILTKEXXXXXXXXMKVPKEYHKFILGRNGASLREIESGSNTNVTIPRSIENNDIITIFGTKEGIDKARAEINQIVAERSK---------LATERITIPKRFYPFINGSNNSKIYKIREMTNAKXXXXXXXXXXXXXXXXGEKDGVYQALEIIQKIYEDTKKCSSSLNLPIPKSQHCYVIGAKGSGIAEIFERTGVSIEMPSQDSD---------DDTIVLYGPNEFLAPALSMVIQKSESMIRVNIEAPNWLHRFIIGKQGSNLNKLMEKYEHVFINFP---ENSDLIVIEGPKDDVNELKGQITHKIAELKSTMAITEIQVDPRFHRHIIGRSGANIQRMQEEYKVQIRMPGNNAVGTSGWTIRIEGDPEGVKLAKTEIESMSVKLENEKTKDVILDHKYHNQLIGAQGSRVKELRNQYPDVIIMFPDLSSKSDIVQLRGPRQQVDQVAVKLNKFIQEVIENNYTKDVKIFKQYHKNIIGKGGVNIRKIREEMNIRIDFPD-EHSDSDKIRLTGKKENVEEAAKRIEAMQAELISIKEDTISIPQRLHISLIGTRGKLIKCIQQECGGVQIQFPASDSNSDIIKIRGPESDVDKAXXXXXXXXXXXXXXXHQDSVSAKSEFHKFLIGRKGAQLAEFRKRHAVMLIFPDSEDTNK--------------------DTIQIIGAKEAVQKAKEELEVTIKSLENEIEKYITIDTKWHKHFFKKRQAVMEEISREFGGVRIFFPKQDAVENIDQVRVIGPKGCVEAAVVRIEDIIENLEAQT--------SLSVFIEQKHHRNLITRNMMEIKSIQSNYDVTIKFPNRDLSSKPGENGMEEIHLNGNGDVNIETMEEVDSTLESEQNNPANWVTISGRKENCESAEDALLELVP-----ITEDVPLANEFHRNFIGQKGQGINTFSTKHNVVVNIPPANKCS-DFISIKGPRVNIIDAKAGLDELITMWE 3281
            Y D FPPLP                        +   VPL ER++ +           Q KIC  + QK G  +EL S  KDQ L + +SG  D+V  A++ +   LQTQ    + +PKE+H+F++G+NG  L+++E  + T + IPR  E ++ I I GTKEGI+KAR EI  I AE+ K              ++ P   + FI G     + KI +           +   ++I + G  + V  A + ++ +  D         + I    H ++IG  G+ I +I E+  VS+ +P QDS+         D   V     E L  A  M  ++++ +I   IE     HR IIG++G  + ++ EK+  V INFP   + SD++ + GPK++V +   +   K+ E   ++++    +  +FH++IIG+ GANI++++EE   +I +P  N   ++   I I G     + A+  I ++  +L N    +V +  K HN LIGA+G  ++ +  +   V I FP   S ++  +L+                                 +YHK +IGKGG NIRK+R++   RI FP  +  D   I + G +++V+EA K +E +   L +I ED++S+  + H   +  RG++++ I +E GGV + FP S   SD + ++G +  V+ AKK++L++         +D       FH+ ++G KG ++ +  +   V + FPD E T +                    D I I G KE  + A + L+  +      IE  +  D   H++   ++ + + ++  EF  V I  P  +  +  D + + G    ++ A   + + +  L+A+          L+V ++ K H  +I R    I  I+S++DV I+FP+++                                   ++N   + + I+G + N ESA DA+L +V      ++ED+ + +  H   IG +G+ I     +  V +  P       + +++ G   ++ +A   +D L+ + E
Sbjct:    4 YKDAFPPLPE-----------------------KVFHVPLEERKYKDMA---QFGEGEQAKICLDIMQKTGAQLEL-SLAKDQGLSIMVSGKHDSVMKARKEIVTRLQTQASASVAIPKEHHRFVIGKNGEKLQDLELKTATKIQIPRPEEASNQIKITGTKEGIEKARHEILLISAEQVKNICTFFPFLFTVASVSAPSWLHRFIIGKKGQNLAKITQQI--PKVHIEFTEGEDKISLEGPTEDVTVAQQQMEALVRDLISRMDFAEINIDHRFHRHLIGKSGAKINKIKEQYKVSVRIP-QDSEKSNHIRIEGDPQGVQQAKKELLELASRMENERTKDLI---IE--QKFHRTIIGQKGERIREIREKFPEVIINFPDPAQKSDIVQLRGPKNEVEKCT-KYLQKMVENSYSISVP---IFKQFHKNIIGKGGANIKKIREECNTKIDLPAEN---SNSEMIVITGKRPNCEAARDRILAIQKELANITELEVNIPSKLHNSLIGAKGRFIRSIMEECGGVHIHFPSEGSGTNYAELKAK------------------------------PEYHKFLIGKGGGNIRKVRDQTGARIIFPTADDKDQQLITIVGTEDSVKEAQKELEFLIKSLDNIVEDSMSVDPKHHRHFVIRRGQVLRDIAEEYGGVIVSFPRSGVQSDRVTLKGAKECVEAAKKKILDII--------EDLCLITQRFHRSIMGPKGIRVQQITREFGVQIKFPDREVTPQGGEILGTEVKATDPESPKKCDIILISGRKEKCEAASDALKALVPV---SIEVEVPFD--LHRYIIGQKGSGIRKMMDEF-EVNIQVPSPE--QQCDTITITGQSANLDRAKAGLLERVRELQAEQEDRALRSFKLAVSVDPKFHPKIIGRKGAVISLIRSDHDVNIQFPDKN-----------------------------------DENQ--DQIIITGYERNTESARDAILHIVGDLEKMVSEDITVDHRVHARIIGARGKAIRKIMDEFKVDIRFPQTGAPDPNLVTVTGKPEDVDEA---IDHLLNLEE 944          

HSP 3 Score: 224.172 bits (570), Expect = 3.069e-59
Identity = 203/873 (23.25%), Postives = 384/873 (43.99%), Query Frame = 3
Query: 1344 IVIEGPKDDVNELKGQITHKIAELKSTMAITEIQVDPRFHRHIIGRSGANIQRMQEEYKVQIRMPGNNAVGTSGWTIRIEGDPEGVKLAKTEIESMSVKLENEKTKDVILDHKY-------------HNQLIGAQGSRVKELRNQYPDVIIMFPDLSSKSDIVQLRGPRQQVDQVAVKLNKFIQEVIENNYTKDVKIFKQYHKNIIGKGGVNIRKIREEMNIRIDFPDEHSDSDKIRLTGKKENVEEAAKRIEAMQAELISIKEDTISIPQRLHISLIGTRGKLIKCIQQECGGVQIQFPASDSNSDIIKIRGPESDVDKAXXXXXXXXXXXXXXXHQDSVSAKSEFHKFLIGRKGAQLAEFRKRHAVMLIFPDSEDTNKDTIQIIGAKEAVQKAKEELEVTIKSLENEIEKYITIDTKWHKHFFKKRQAVMEEISREFGGVRIFFPKQDAVE---------------------NIDQVR---------------------VIGPKGCVEAAVVRIEDIIENLEAQTSLSVFIEQKHHRNLITRNMMEIKSIQSNY-DVTIKFPNRDLSSKPGENGMEEIHLNGNGDVNIETMEEVDSTLESEQNNPANWVTISGRKENCESAEDALLELVPITEDVPLANE-FHRNFIGQKGQGINTFSTKHNVVVNIPPANKCSDFISIKGPRVNIIDAKA--GLDELITMWENEKQDRIARNYEN------HVTVPIVFHRNIIGQRGANIEIFRTKFNVSIQIPDQNSKSEEITIRGYEEDVKKAEEELISMVEKWKAQ--------VKEELHIPRDVHPQLIGTRGIALRKLRDQFKVEINFPNRNVDDEKAHLVEVIGDKENVDKCCDILVERANEL 3743
            I++ G  D V + + +I  ++     T A   + +    HR +IG++G  +Q ++ +   +I++P           I+I G  EG++ A+ EI  +S     E+ K++     +             H  +IG +G  + ++  Q P V I F   +   D + L GP + V     ++   ++++I      ++ I  ++H+++IGK G  I KI+E+  + +  P +   S+ IR+ G  + V++A K +  + + + + +   + I Q+ H ++IG +G+ I+ I+++   V I FP     SDI+++RGP+++V+K      +  +K +  S+  SV    +FHK +IG+ GA + + R+     +  P +E++N + I I G +   + A++ +    K L N  E  + I +K H      +   +  I  E GGV I FP + +                       NI +VR                     ++G +  V+ A   +E +I++L+     S+ ++ KHHR+ + R    ++ I   Y  V + FP   + S                                      + VT+ G KE  E+A+  +L+++   ED+ L  + FHR+ +G KG  +   + +  V +  P          I G  V   D ++    D ++     EK +  +   +        V VP   HR IIGQ+G+ I     +F V+IQ+P    + + ITI G   ++ +A+  L+  V + +A+         K  + +    HP++IG +G  +  +R    V I FP++N  DE    + + G + N +   D ++    +L
Sbjct:   63 IMVSGKHDSVMKARKEIVTRL----QTQASASVAIPKEHHRFVIGKNGEKLQDLELKTATKIQIPRPEEASNQ---IKITGTKEGIEKARHEILLISA----EQVKNICTFFPFLFTVASVSAPSWLHRFIIGKKGQNLAKITQQIPKVHIEF---TEGEDKISLEGPTEDVTVAQQQMEALVRDLISRMDFAEINIDHRFHRHLIGKSGAKINKIKEQYKVSVRIPQDSEKSNHIRIEGDPQGVQQAKKELLELASRMENERTKDLIIEQKFHRTIIGQKGERIREIREKFPEVIINFPDPAQKSDIVQLRGPKNEVEKC----TKYLQKMVENSYSISVPIFKQFHKNIIGKGGANIKKIREECNTKIDLP-AENSNSEMIVITGKRPNCEAARDRILAIQKELANITELEVNIPSKLHNSLIGAKGRFIRSIMEECGGVHIHFPSEGSGTNYAELKAKPEYHKFLIGKGGGNIRKVRDQTGARIIFPTADDKDQQLITIVGTEDSVKEAQKELEFLIKSLDNIVEDSMSVDPKHHRHFVIRRGQVLRDIAEEYGGVIVSFPRSGVQS--------------------------------------DRVTLKGAKECVEAAKKKILDII---EDLCLITQRFHRSIMGPKGIRVQQITREFGVQIKFPDREVTPQGGEILGTEVKATDPESPKKCDIILISGRKEKCEAASDALKALVPVSIEVEVPFDLHRYIIGQKGSGIRKMMDEFEVNIQVPSPEQQCDTITITGQSANLDRAKAGLLERVRELQAEQEDRALRSFKLAVSVDPKFHPKIIGRKGAVISLIRSDHDVNIQFPDKN--DENQDQIIITGYERNTESARDAILHIVGDL 873          

HSP 4 Score: 182.185 bits (461), Expect = 8.365e-46
Identity = 205/779 (26.32%), Postives = 371/779 (47.63%), Query Frame = 3
Query: 1563 GWTIRIEGDPEGVKLAKTEIESMSVKLENEKTKDVILDHKYHNQLIGAQGSRVKELRNQYPDVIIMFPDLSSKSDIVQLRGPRQQVDQVAVKLNKFIQEVIENNYT--------KDVKIFKQYHKNIIGKGGVNIRKIREEM-NIRIDFPDEHSDSDKIRLTGKKENVEEAAKRIEAMQAELIS-IKEDTISIPQRLHISLIGTRGKLIKCIQQECGGVQIQFPASDSNSDIIKIRGPESDVDKAXXXXXXXXXXXXXXXHQDSVSAKSEFHKFLIGRKGAQLAEFRKRHAVMLI-FPDSEDTNKDTIQIIGAKEAVQKAKEELEVTIKSLENEIEKYITIDTKWHKHFFKKRQAVMEEISREFGGVRIFFPKQDAVENIDQVRVIGPKGCVEAAVVRIEDIIENLEAQTSLSVFIEQKHHRNLITRNMMEIKSIQSNYD-VTIKFPNRDLSSKPGE-NGMEEIH--LNGNGDVNIETMEEVDST---LESEQNNPANWVTISGRKENCESAEDALLELVP----ITED-VPLANEFHRNFIGQKGQGINTFSTKHN-VVVNIPPANKCSDFISIKGPRVNIIDAKAGLDELITMWENEKQDRIARNYENHVTVPIVFHRNIIGQRGANIEIFRTKFNVSIQIPDQN---------------------SKSEEITIRGYEEDVKKAEEELISMVEKWKAQVKEELHIPRDVHPQLIGTRGIALRKLRDQFKVEINFPNRNVDDEKAHLVEVIGDKENVDKCCDILVERANELLNEWEER 3764
            G +I + G  + V  A+ EI +   +L+ + +  V +  ++H  +IG  G ++++L  +     I  P     S+ +++ G ++ +++   ++     E ++N  T          V      H+ IIGK G N+ KI +++  + I+F +     DKI L G  E+V  A +++EA+  +LIS +    I+I  R H  LIG  G  I  I+++   V ++ P     S+ I+I G    V +AKK+LLEL+ +      +D +  + +FH+ +IG+KG ++ E R++   ++I FPD    + D +Q+ G K  V+K  + L+   K +EN     + I  ++HK+   K  A +++I RE    +I  P +++  N + + + G +   EAA  RI  I + L   T L V I  K H +LI      I+SI      V I FP+    +   E     E H  L G G  NI  + +         +  +     +TI G +++ + A+  L  L+     I ED + +  + HR+F+ ++GQ +   + ++  V+V+ P +   SD +++KG +  +  AK  + ++I               E+   +   FHR+I+G +G  ++    +F V I+ PD+                       K + I I G +E  + A + L ++V      V  E+ +P D+H  +IG +G  +RK+ D+F+V I  P+    +++   + + G   N+D+    L+ER  EL  E E+R
Sbjct:   60 GLSIMVSGKHDSVMKARKEIVT---RLQTQASASVAIPKEHHRFVIGKNGEKLQDLELKTA-TKIQIPRPEEASNQIKITGTKEGIEKARHEILLISAEQVKNICTFFPFLFTVASVSAPSWLHRFIIGKKGQNLAKITQQIPKVHIEFTE---GEDKISLEGPTEDVTVAQQQMEALVRDLISRMDFAEINIDHRFHRHLIGKSGAKINKIKEQYK-VSVRIPQDSEKSNHIRIEGDPQGVQQAKKELLELASRMENERTKDLI-IEQKFHRTIIGQKGERIREIREKFPEVIINFPDPAQKS-DIVQLRGPKNEVEKCTKYLQ---KMVENSYSISVPIFKQFHKNIIGKGGANIKKI-REECNTKIDLPAENS--NSEMIVITGKRPNCEAARDRILAIQKELANITELEVNIPSKLHNSLIGAKGRFIRSIMEECGGVHIHFPSEGSGTNYAELKAKPEYHKFLIGKGGGNIRKVRDQTGARIIFPTADDKDQQLITIVGTEDSVKEAQKELEFLIKSLDNIVEDSMSVDPKHHRHFVIRRGQVLRDIAEEYGGVIVSFPRSGVQSDRVTLKGAKECVEAAKKKILDII---------------EDLCLITQRFHRSIMGPKGIRVQQITREFGVQIKFPDREVTPQGGEILGTEVKATDPESPKKCDIILISGRKEKCEAASDALKALVP-----VSIEVEVPFDLHRYIIGQKGSGIRKMMDEFEVNIQVPS---PEQQCDTITITGQSANLDRAKAGLLERVRELQAEQEDR 799          
BLAST of High density lipoprotein binding protein (Vigilin) vs. Ensembl Xenopus
Match: hdlbp (high density lipoprotein binding protein (vigilin) [Source:NCBI gene;Acc:448610])

HSP 1 Score: 529.25 bits (1362), Expect = 9.603e-165
Identity = 299/679 (44.04%), Postives = 434/679 (63.92%), Query Frame = 3
Query:  243 YDDQFPPLPTCNTPKIVQ----NSKPRIGQTKTSHVTQTLTVPLAERRFSNREANNSVKNDAQKKICQTVAQKCGVSIELNSGNKDQNLMVFISGPQDNVSNAKRILTKEXXXXXXXXMKVPKEYHKFILGRNGASLREIESGSNTNVTIPRSIENNDIITIFGTKEGIDKARAEINQIVAERSKLATERITIPKRFYPFINGSNNSKIYKIREMTNAKXXXXXXXXXXXXXXXXGEKDGVYQALEIIQKIYEDTKKCSSSLNLPIPKSQHCYVIGAKGSGIAEIFERTGVSIEMPSQDSDDDTIVLYGPNEFLAPALSMVIQKSESMIRVNIEAPNWLHRFIIGKQGSNLNKLMEKYEHVFINFPENSDLIVIEGPKDDVNELKGQITHKIAELKSTMAITEIQVDPRFHRHIIGRSGANIQRMQEEYKVQIRMPGNNAVGTSGWTIRIEGDPEGVKLAKTEIESMSVKLENEKTKDVILDHKYHNQLIGAQGSRVKELRNQYPDVIIMFPDLSSKSDIVQLRGPRQQVDQVAVKLNKFIQEVIENNYTKDVKIFKQYHKNIIGKGGVNIRKIREEMNIRIDFPDEHSDSDKIRLTGKKENVEEAAKRIEAMQAELISIKEDTISIPQRLHISLIGTRGKLIKCIQQECGGVQIQFPASDSNSDIIKIRGPESDVDKA 2267
            Y D FPPLP        Q     +  +I   K+S +TQ   VPL ER++ +           Q KIC  + QK G  +EL S  KDQ L + +SG  D+V  A++ +   LQTQ    + +PKE+H+F++G+NG  L+++E  + T + IPR  E ++ I I GTKEGI+KAR EI  I AE+ K A ER+ I K ++PFI G  N  + +I + T  +INIPPPSV   EI+ +GEK+ + QA+  I++IYE+ KK ++S+ + + KSQH YVIG KG+ + EI ERTGVS+E+P  DS  +T++L G  E L  AL+ V  K+ S    ++ AP+WLHRFIIGK+G NL K+ ++   V I F E  D I +EGP +DV   + Q+   + +L    A+        F  H++        +++E+YKV +R+P ++        IRIEGDP+GV+ AK E+  ++ ++ENE+TKD+I++ K+H  +IG +G R++E+R ++P+VII FPD + KSDIVQLRGP+ +V++    L K + E++EN+Y+  V IFKQ+HKNIIGKGG NI+KIREE N +ID P E+S+S+ I +TGK+ N E A  RI A+Q EL +I E  ++IP +LH SLIG +G+ I+ I +ECGGV I FP+  S SD + IRGP  DV++A
Sbjct:   38 YKDAFPPLPEKAVGNETQAEPVGAWSKIRPIKSSIITQVFHVPLEERKYKDM---AQFGEGEQAKICLDIMQKTGAQLEL-SLAKDQGLSIMVSGKHDSVMKARKEIVTRLQTQASASVAIPKEHHRFVIGKNGEKLQDLELKTATKIQIPRPEEASNQIKITGTKEGIEKARHEILLISAEQDKRAVERLEIEKAYHPFIAGPYNKVVTEIMQETATRINIPPPSVNKTEIVCTGEKEQLAQAVARIKQIYEEKKKKTTSIAVEVRKSQHKYVIGPKGNNLQEILERTGVSVEIPPSDSSSETVILRGEPEKLGQALTEVYAKANSFTVASVSAPSWLHRFIIGKKGQNLAKITQQIPKVHIEFTEGEDKISLEGPTEDVTVAQQQMEALVRDLVKYFALHF-----SFFDHLLN-PRHQFNKIKEQYKVSVRIPQDSEKSNH---IRIEGDPQGVQQAKKELLELASRMENERTKDLIIEQKFHRTIIGQKGERIREIREKFPEVIINFPDPAQKSDIVQLRGPKNEVEKCTKYLQKMVSELVENSYSISVPIFKQFHKNIIGKGGANIKKIREECNTKIDLPAENSNSEMIVITGKRPNCEAARDRILAIQKELANITELEVNIPSKLHNSLIGAKGRFIRSIMEECGGVHIHFPSEGSGSDTVTIRGPVQDVERA 703          

HSP 2 Score: 340.117 bits (871), Expect = 7.752e-97
Identity = 276/1012 (27.27%), Postives = 494/1012 (48.81%), Query Frame = 3
Query:  936 GEKDGVYQAL-EIIQKIYEDTKKCSSSLNLPIPKSQHCYVIGAKGSGIAEIFERTGVSIEMPSQDSDDDTIVLYGPNEFLAPALSMVI-----QKSESMIRVNIEAPNWLHRFIIGKQGSNLNKLMEKYEHVFINFPE---NSDLIVIEGPKDDVNELKGQITHKIAELKSTMAITEIQVDPRFHRHIIGRSGANIQRMQEEYKVQIRMPGNNAVGTSGWTIRIEGDPEGVKLAKTEIESMSVKLENEKTKDVILDHKYHNQLIGAQGSRVKELRNQYPDVIIMFPDLSSKSDIVQLRGPRQQVDQVAVKLNKFIQEVIENNYTKDVKIFKQYHKNIIGKGGVNIRKIREEMNIRIDFPDEHSDSDKIRLTGKKENVEEAAKRIEAMQAELISIKEDTISIPQRLHISLIGTRGKLIKCIQQECGGVQIQFPASDSNSDIIKIRGPESDVDKAXXXXXXXXXXXXXXXHQDSVSAKSEFHKFLIGRKGAQLAEFRKRHAVMLIFPDSEDTNKDTIQIIGAKEAVQKAKEELEVTIKSLENEIEKYITIDTKWHKHFFKKRQAVMEEISREFGGVRIFFPKQDAVENIDQVRVIGPKGCVEAAVVRI----EDIIENLEAQTSLSVFIEQKHHRNLI-TRNMMEIKSIQSNYDVTIKFPNRDLSSKPGENGMEEIHLNGNGDVNIETMEEVDSTLESEQNNPANWVTISGRKENCESAEDALLELVPITEDVPLANEFHRNFIGQKGQGINTFSTKHNVVVNIPPANKCSDFISIKGPRVNIIDAKAGLDELITMWENEKQDRIARNYENHVTVPIVFHRNIIGQRGANIEIFRTKFNVSIQIPDQNSKSE-EITIRGYEEDVKKAEEELISMVEKWKAQVKEELHIPRDVHPQLIGTRGIALRKLRDQFKVEINFPNRNVDDEKAHLVEVIGDKENVDKCCDILVERANELLNEWEERNQVREVKNLIKDRENINSSSNIKEKGPGFLLTGAPW----QQRVPDASSNVDFP 3914
            G+ D V +A  EI+ ++     +  +S ++ IPK  H +VIG  G  + ++  +T   I++P  +   + I + G  E +  A   ++     Q   ++ R+ IE     H FI G     + ++M++     IN P    N   IV  G K+ + +   +I     E K       ++V    H+++IG  G N+Q + E   V + +P ++   +S  T+ + G+PE +  A TE+ +   K  +     V      H  +IG +G  + ++  Q P V I F   +   D + L GP + V     ++   +++++     K   +   +  +++        KI+E+  + +  P +   S+ IR+ G  + V++A K +  + + + + +   + I Q+ H ++IG +G+ I+ I+++   V I FP     SDI+++RGP+++V+K  K L ++  + +  S+  SV    +FHK +IG+ GA + + R+     +  P +E++N + I I G +   + A++ +    K L N  E  + I +K H      +   +  I  E GGV I FP + +    D V + GP   VE A  ++    E+ + +++    L+ +        L+  + +  I S    +      PN             E H+  NGD   E         + E     + + ISGRKE CE+A DAL  LVP++ +V +  + HR  IGQKG GI     +  V + +P   +  D I+I G   N+  AKAGL E +   + E++DR  R+++  V+V   FH  IIG++GA I + R+  +V+IQ PD+N +++ +I I GYE + + A + ++ +V   +  V E++ +   VH ++IG RG A+RK+ D+FKV+I FP     D   +LV V G  E+VD+  D L+    E +++  + N+V  +++ +K   +  S S   +   GF++  APW     ++ PD SS+ DFP
Sbjct:  128 GKHDSVMKARKEIVTRL-----QTQASASVAIPKEHHRFVIGKNGEKLQDLELKTATKIQIPRPEEASNQIKITGTKEGIEKARHEILLISAEQDKRAVERLEIE--KAYHPFIAGPYNKVVTEIMQETA-TRINIPPPSVNKTEIVCTGEKEQLAQAVARIKQIYEEKKKKTTSIAVEVRKSQHKYVIGPKGNNLQEILERTGVSVEIPPSD---SSSETVILRGEPEKLGQALTEVYA---KANSFTVASVSAPSWLHRFIIGKKGQNLAKITQQIPKVHIEF---TEGEDKISLEGPTEDVTVAQQQMEALVRDLV-----KYFALHFSFFDHLLNPRH-QFNKIKEQYKVSVRIPQDSEKSNHIRIEGDPQGVQQAKKELLELASRMENERTKDLIIEQKFHRTIIGQKGERIREIREKFPEVIINFPDPAQKSDIVQLRGPKNEVEKCTKYLQKMVSELVENSYSISVPIFKQFHKNIIGKGGANIKKIREECNTKIDLP-AENSNSEMIVITGKRPNCEAARDRILAIQKELANITELEVNIPSKLHNSLIGAKGRFIRSIMEECGGVHIHFPSEGS--GSDTVTIRGPVQDVERAKKQLLQLAEEKVRSVQYINRLNFYFFPFPRITLLRIQCLHHIYSFLHFFFFFFLAPN------------AEPHVQENGDEGTEV-----KATDPESPKKCDIILISGRKEKCEAASDALKALVPVSIEVEVPFDLHRYIIGQKGSGIRKMMDEFEVNIQVPSPEQQCDTITITGQSANLDRAKAGLLERVRELQAEQEDRALRSFKLAVSVDPKFHPKIIGRKGAVISLIRSDHDVNIQFPDKNDENQDQIIITGYERNTESARDAILHIVGDLEKMVSEDITVDHRVHARIIGARGKAIRKIMDEFKVDIRFPQTGAPD--PNLVTVTGKPEDVDEAIDHLLNLEEEYMSDVVD-NEV--MQSYMKPHSHEESKS---QPSKGFVVRDAPWTTGSNEKAPDMSSSEDFP 1088          

HSP 3 Score: 60.4622 bits (145), Expect = 2.536e-8
Identity = 67/258 (25.97%), Postives = 121/258 (46.90%), Query Frame = 3
Query:  651 ESGSNTNVTIPRSIENNDIITIFGTKEGIDKARAEINQIVAERSKLATERITIPKRFYPFINGSNNSKIYKIREMTNAKXXXXXXXXXXXXXXXXGE-------KDGVYQALEIIQKIYEDTKKCSSSLNLPIPKSQHCYVIGAKGSGIAEIFERTGVSIEMPSQ-DSDDDTIVLYGP---NEFLAPALSMVIQKSESMIRVNIEAPNWLHRFIIGKQGSNLNKLMEKYEHVFINFPE----NSDLIVIEGPKDDVNE 1379
            + G+    T P S +  DII I G KE  + A   +  +V       +  + +P   + +I G   S I K+ +     I +P P  + + I I+G+       K G+ + +  +Q   ED    S  L + +    H  +IG KG+ I+ I     V+I+ P + D + D I++ G     E    A+  ++   E M+  +I   + +H  IIG +G  + K+M++++ V I FP+    + +L+ + G  +DV+E
Sbjct:  770 DEGTEVKATDPESPKKCDIILISGRKEKCEAASDALKALVP-----VSIEVEVPFDLHRYIIGQKGSGIRKMMDEFEVNIQVPSPEQQCDTITITGQSANLDRAKAGLLERVRELQAEQEDRALRSFKLAVSVDPKFHPKIIGRKGAVISLIRSDHDVNIQFPDKNDENQDQIIITGYERNTESARDAILHIVGDLEKMVSEDITVDHRVHARIIGARGKAIRKIMDEFK-VDIRFPQTGAPDPNLVTVTGKPEDVDE 1021          

HSP 4 Score: 55.4546 bits (132), Expect = 8.544e-7
Identity = 55/226 (24.34%), Postives = 105/226 (46.46%), Query Frame = 3
Query:  498 MVFISGPQDNVSNAKRILTKEXXXXXXXXMKVPKEYHKFILGRNGASLREIESGSNTNVTIPRSIENNDIITIFGTKEGIDKARA----EINQIVAERSKLATER----ITIPKRFYPFINGSNNSKIYKIREMTNAKXX-XXXXXXXXXXXXXXGEKDGVYQALEIIQKIYEDTKKCSSSLNLPIPKSQHCYVIGAKGSGIAEIFERTGVSIEMPSQDSDDDTIV 1148
            ++ ISG ++    A   L  +      ++++VP + H++I+G+ G+ +R++      N+ +P   +  D ITI G    +D+A+A     + ++ AE+   A       +++  +F+P I G   + I  IR   +  I          ++III+G +     A + I  I  D +K  S  ++ +    H  +IGA+G  I +I +   V I  P   + D  +V
Sbjct:  788 IILISGRKEKCEAASDAL--KALVPVSIEVEVPFDLHRYIIGQKGSGIRKMMDEFEVNIQVPSPEQQCDTITITGQSANLDRAKAGLLERVRELQAEQEDRALRSFKLAVSVDPKFHPKIIGRKGAVISLIRSDHDVNIQFPDKNDENQDQIIITGYERNTESARDAILHIVGDLEKMVSE-DITVDHRVHARIIGARGKAIRKIMDEFKVDIRFPQTGAPDPNLV 1010          

HSP 5 Score: 52.373 bits (124), Expect = 7.825e-6
Identity = 44/180 (24.44%), Postives = 77/180 (42.78%), Query Frame = 3
Query: 3186 ANKCSDFISIKGPRVNIIDAK--------AGLDELITMWENEKQDRIARNYENHVTVPIVFHRNIIGQRGANIEIFRTKFNVSIQIPDQNSKSEEITIRGYEEDVKKAEEELISMVEKWKAQVKEELHIPRDVHPQLIGTRGIALRKLRDQFKVEINFPNRNVDDEKAHLVEVIGDKENV 3701
            A  C D +   G ++ +  AK        +G  + +     E   R+       V +P   HR +IG+ G  ++    K    IQIP     S +I I G +E ++KA  E++ +  +   +  E L I +  HP + G     + ++  +    IN P  +V+  K  +V   G+KE +
Sbjct:   98 AKICLDIMQKTGAQLELSLAKDQGLSIMVSGKHDSVMKARKEIVTRLQTQASASVAIPKEHHRFVIGKNGEKLQDLELKTATKIQIPRPEEASNQIKITGTKEGIEKARHEILLISAEQDKRAVERLEIEKAYHPFIAGPYNKVVTEIMQETATRINIPPPSVN--KTEIV-CTGEKEQL 274          
BLAST of High density lipoprotein binding protein (Vigilin) vs. Ensembl Mouse
Match: Hdlbp (high density lipoprotein (HDL) binding protein [Source:MGI Symbol;Acc:MGI:99256])

HSP 1 Score: 872.078 bits (2252), Expect = 0.000e+0
Identity = 517/1249 (41.39%), Postives = 775/1249 (62.05%), Query Frame = 3
Query:  243 YDDQFPPLP-------TCNTPKIVQNSKPRIGQTKTSHVTQTLTVPLAERRFSNREANNSVKNDAQKKICQTVAQKCGVSIELNSGNKDQNLMVFISGPQDNVSNAKRILTKEXXXXXXXXMKVPKEYHKFILGRNGASLREIESGSNTNVTIPRSIENNDIITIFGTKEGIDKARAEINQIVAERSKLATERITIPKRFYPFINGSNNSKIYKIREMTNAKXXXXXXXXXXXXXXXXGEKDGVYQALEIIQKIYEDTKKCSSSLNLPIPKSQHCYVIGAKGSGIAEIFERTGVSIEMPSQDSDDDTIVLYGPNEFLAPALSMVIQKSESMIRVNIEAPNWLHRFIIGKQGSNLNKLMEKYEHVFINFPENSDLIVIEGPKDDVNELKGQITHKIAELKSTMAITEIQVDPRFHRHIIGRSGANIQRMQEEYKVQIRMPGNNAVGTSGWTIRIEGDPEGVKLAKTEIESMSVKLENEKTKDVILDHKYHNQLIGAQGSRVKELRNQYPDVIIMFPDLSSKSDIVQLRGPRQQVDQVAVKLNKFIQEVIENNYTKDVKIFKQYHKNIIGKGGVNIRKIREEMNIRIDFPDEHSDSDKIRLTGKKENVEEAAKRIEAMQAELISIKEDTISIPQRLHISLIGTRGKLIKCIQQECGGVQIQFPASDSNSDIIKIRGPESDVDKAXXXXXXXXXXXXXXXHQDSVSAKSEFHKFLIGRKGAQLAEFRKRHAVMLIFPDSEDTNKDTIQIIGAKEAVQKAKEELEVTIKSLENEIEKYITIDTKWHKHFFKKRQAVMEEISREFGGVRIFFPKQDAVENIDQVRVIGPKGCVEAAVVRIEDIIENLEAQTSLSVFIEQKHHRNLITRNMMEIKSIQSNYDVTIKFPNRDLSSKPGENGMEEIH--LNGNGDVNIETMEEVDSTLESEQNNPA-----NWVTISGRKENCESAEDALLELVPITEDVPLANEFHRNFIGQKGQGINTFSTKHNVVVNIPPANKCSDFISIKGPRVNIIDAKAGLDELITMWENEKQDRIARNYENHVTVPIVFHRNIIGQRGANIEIFRTKFNVSIQIPDQ---NSKSEEITIRGYEEDVKKAEEELISMVEKWKAQVKEELHIPRDVHPQLIGTRGIALRKLRDQFKVEINFPNRNVDDEKAHLVEVIGDKENVDKCCDILVERANELLNEWEERNQVREVKNLIKDRENINSSSNIKEKGPGFLLTGAPW----QQRVPDASSNVDFPKIDA 3926
            Y D FPPLP       +   P    ++K R    K S +TQ   VPL ER++ +    N      Q KIC  + Q+ G  +EL S  KDQ L + +SG  D V  A++ +   LQTQ    + +PKE+H+F++G+NG  L+++E  + T + IPR  + ++ I I GTKEGI+KAR E+  I AE+ K A ER+ + K F+PFI G  N  + +I + T  +INIPPPSV   EI+ +GEK+ + QA+  I+KIYE+ KK ++++ + + KSQH YVIG KG+ + EI ERTGVS+E+P  DS  +T++L G  E L  AL+ V  K+ S    ++ AP+WLHRFIIGK+G NL K+ ++   V I F E  D I +EGP +DVN  + QI   + +L + M   EI +D +FHRH+IG+SGANI R++++YKV +R+P ++        IRIEGDP+GV+ AK E+  ++ ++ENE+TKD+I++ ++H  +IG +G R++E+R+++P+VII FPD + KSDIVQLRGP+ +V++    + K + +++EN+Y+  V IFKQ+HKNIIGKGG NI+KIREE N +ID P E+S+S+ I +TGK+ N E A  RI ++Q +L +I E  +SIP +LH SLIGT+G+LI+ I +ECGGV I FP   S SD + IRGP SDV+KAKKQLL L+E+    S    + AK E+HKFLIG+ G ++ + R      +IFP +ED ++D I IIG ++AV++A++ELE  I++LEN +E Y+ +D K H+HF  +R  V+ EI+ E+GGV + FP+       D+V + G K CVEAA  RI++IIE+LEAQ ++   I QK HR+++      I+ I  +Y+V IKFP+R+      EN +  +   +  NGD       E     E+++ +P      + + ISGRKE CE+A++AL  LVP+T +V +  + HR  IGQKG GI     +  V +++P     SD I+I G   N+  AKAGL + +   + E++DR  R+++  VTV   +H  IIG++GA I   R +  V+IQ PD+   N   ++ITI GYE++ + A + ++ +V + +  V E++ +   VH ++IG RG A+RK+ D+FKV+I FP     D   + V V G  ENV++  D ++    E L +  +   ++         E+   S        GF++  APW     ++ PD SS+ +FP   A
Sbjct:   40 YKDAFPPLPEKAACLESAQEPAGAWSNKIR--PIKASVITQVFHVPLEERKYKDM---NQFGEGEQAKICLEIMQRTGAHLEL-SLAKDQGLSIMVSGKLDAVMKARKDIVARLQTQASATVPIPKEHHRFVIGKNGEKLQDLELKTATKIQIPRPDDPSNQIKITGTKEGIEKARHEVLLISAEQDKRAVERLEVEKAFHPFIAGPYNRLVGEIMQETGTRINIPPPSVNRTEIVFTGEKEQLAQAVARIKKIYEEKKKKTTTIAVEVKKSQHKYVIGPKGNSLQEILERTGVSVEIPPSDSISETVILRGEPEKLGQALTEVYAKANSFTVSSVSAPSWLHRFIIGKKGQNLAKITQQMPKVHIEFTEGEDKITLEGPTEDVNVAQEQIEGMVKDLINRMDYVEINIDHKFHRHLIGKSGANINRIKDQYKVSVRIPPDSEKSN---LIRIEGDPQGVQQAKRELLELASRMENERTKDLIIEQRFHRTIIGQKGERIREIRDKFPEVIINFPDPAQKSDIVQLRGPKNEVEKCTKYMQKMVADLVENSYSISVPIFKQFHKNIIGKGGANIKKIREESNTKIDLPAENSNSETIIITGKRANCEAARSRILSIQKDLANIAEVEVSIPAKLHNSLIGTKGRLIRSIMEECGGVHIHFPVEGSGSDTVVIRGPSSDVEKAKKQLLHLAEEKQTKSFTVDIRAKPEYHKFLIGKGGGKIRKVRDSTGARIIFPAAEDKDQDLITIIGKEDAVREAQKELEALIQNLENVVEDYMLVDPKHHRHFVIRRGQVLREIAEEYGGVMVSFPRSGT--QSDKVTLKGAKDCVEAAKKRIQEIIEDLEAQVTVECAIPQKFHRSVMGPKGSRIQQITRDYNVQIKFPDRE------ENPVHSVEPSIQENGD-------EAGEGREAKETDPGSPRRCDIIIISGRKEKCEAAKEALEALVPVTIEVEVPFDLHRYIIGQKGSGIRKMMDEFEVNIHVPAPELQSDTIAITGLAANLDRAKAGLLDRVKELQAEQEDRALRSFKLSVTVDPKYHPKIIGRKGAVITQIRLEHEVNIQFPDKDDGNQPQDQITITGYEKNTEAARDAILKIVGELEQMVSEDVPLDHRVHARIIGARGKAIRKIMDEFKVDIRFPQSGAPD--PNCVTVTGLPENVEEAIDHILNLEEEYLADVVDSEALQVYMKPPAHEESRAPSK-------GFVVRDAPWTSNSSEKAPDMSSSEEFPSFGA 1255          
BLAST of High density lipoprotein binding protein (Vigilin) vs. Ensembl Mouse
Match: Hdlbp (high density lipoprotein (HDL) binding protein [Source:MGI Symbol;Acc:MGI:99256])

HSP 1 Score: 872.078 bits (2252), Expect = 0.000e+0
Identity = 517/1249 (41.39%), Postives = 775/1249 (62.05%), Query Frame = 3
Query:  243 YDDQFPPLP-------TCNTPKIVQNSKPRIGQTKTSHVTQTLTVPLAERRFSNREANNSVKNDAQKKICQTVAQKCGVSIELNSGNKDQNLMVFISGPQDNVSNAKRILTKEXXXXXXXXMKVPKEYHKFILGRNGASLREIESGSNTNVTIPRSIENNDIITIFGTKEGIDKARAEINQIVAERSKLATERITIPKRFYPFINGSNNSKIYKIREMTNAKXXXXXXXXXXXXXXXXGEKDGVYQALEIIQKIYEDTKKCSSSLNLPIPKSQHCYVIGAKGSGIAEIFERTGVSIEMPSQDSDDDTIVLYGPNEFLAPALSMVIQKSESMIRVNIEAPNWLHRFIIGKQGSNLNKLMEKYEHVFINFPENSDLIVIEGPKDDVNELKGQITHKIAELKSTMAITEIQVDPRFHRHIIGRSGANIQRMQEEYKVQIRMPGNNAVGTSGWTIRIEGDPEGVKLAKTEIESMSVKLENEKTKDVILDHKYHNQLIGAQGSRVKELRNQYPDVIIMFPDLSSKSDIVQLRGPRQQVDQVAVKLNKFIQEVIENNYTKDVKIFKQYHKNIIGKGGVNIRKIREEMNIRIDFPDEHSDSDKIRLTGKKENVEEAAKRIEAMQAELISIKEDTISIPQRLHISLIGTRGKLIKCIQQECGGVQIQFPASDSNSDIIKIRGPESDVDKAXXXXXXXXXXXXXXXHQDSVSAKSEFHKFLIGRKGAQLAEFRKRHAVMLIFPDSEDTNKDTIQIIGAKEAVQKAKEELEVTIKSLENEIEKYITIDTKWHKHFFKKRQAVMEEISREFGGVRIFFPKQDAVENIDQVRVIGPKGCVEAAVVRIEDIIENLEAQTSLSVFIEQKHHRNLITRNMMEIKSIQSNYDVTIKFPNRDLSSKPGENGMEEIH--LNGNGDVNIETMEEVDSTLESEQNNPA-----NWVTISGRKENCESAEDALLELVPITEDVPLANEFHRNFIGQKGQGINTFSTKHNVVVNIPPANKCSDFISIKGPRVNIIDAKAGLDELITMWENEKQDRIARNYENHVTVPIVFHRNIIGQRGANIEIFRTKFNVSIQIPDQ---NSKSEEITIRGYEEDVKKAEEELISMVEKWKAQVKEELHIPRDVHPQLIGTRGIALRKLRDQFKVEINFPNRNVDDEKAHLVEVIGDKENVDKCCDILVERANELLNEWEERNQVREVKNLIKDRENINSSSNIKEKGPGFLLTGAPW----QQRVPDASSNVDFPKIDA 3926
            Y D FPPLP       +   P    ++K R    K S +TQ   VPL ER++ +    N      Q KIC  + Q+ G  +EL S  KDQ L + +SG  D V  A++ +   LQTQ    + +PKE+H+F++G+NG  L+++E  + T + IPR  + ++ I I GTKEGI+KAR E+  I AE+ K A ER+ + K F+PFI G  N  + +I + T  +INIPPPSV   EI+ +GEK+ + QA+  I+KIYE+ KK ++++ + + KSQH YVIG KG+ + EI ERTGVS+E+P  DS  +T++L G  E L  AL+ V  K+ S    ++ AP+WLHRFIIGK+G NL K+ ++   V I F E  D I +EGP +DVN  + QI   + +L + M   EI +D +FHRH+IG+SGANI R++++YKV +R+P ++        IRIEGDP+GV+ AK E+  ++ ++ENE+TKD+I++ ++H  +IG +G R++E+R+++P+VII FPD + KSDIVQLRGP+ +V++    + K + +++EN+Y+  V IFKQ+HKNIIGKGG NI+KIREE N +ID P E+S+S+ I +TGK+ N E A  RI ++Q +L +I E  +SIP +LH SLIGT+G+LI+ I +ECGGV I FP   S SD + IRGP SDV+KAKKQLL L+E+    S    + AK E+HKFLIG+ G ++ + R      +IFP +ED ++D I IIG ++AV++A++ELE  I++LEN +E Y+ +D K H+HF  +R  V+ EI+ E+GGV + FP+       D+V + G K CVEAA  RI++IIE+LEAQ ++   I QK HR+++      I+ I  +Y+V IKFP+R+      EN +  +   +  NGD       E     E+++ +P      + + ISGRKE CE+A++AL  LVP+T +V +  + HR  IGQKG GI     +  V +++P     SD I+I G   N+  AKAGL + +   + E++DR  R+++  VTV   +H  IIG++GA I   R +  V+IQ PD+   N   ++ITI GYE++ + A + ++ +V + +  V E++ +   VH ++IG RG A+RK+ D+FKV+I FP     D   + V V G  ENV++  D ++    E L +  +   ++         E+   S        GF++  APW     ++ PD SS+ +FP   A
Sbjct:   40 YKDAFPPLPEKAACLESAQEPAGAWSNKIR--PIKASVITQVFHVPLEERKYKDM---NQFGEGEQAKICLEIMQRTGAHLEL-SLAKDQGLSIMVSGKLDAVMKARKDIVARLQTQASATVPIPKEHHRFVIGKNGEKLQDLELKTATKIQIPRPDDPSNQIKITGTKEGIEKARHEVLLISAEQDKRAVERLEVEKAFHPFIAGPYNRLVGEIMQETGTRINIPPPSVNRTEIVFTGEKEQLAQAVARIKKIYEEKKKKTTTIAVEVKKSQHKYVIGPKGNSLQEILERTGVSVEIPPSDSISETVILRGEPEKLGQALTEVYAKANSFTVSSVSAPSWLHRFIIGKKGQNLAKITQQMPKVHIEFTEGEDKITLEGPTEDVNVAQEQIEGMVKDLINRMDYVEINIDHKFHRHLIGKSGANINRIKDQYKVSVRIPPDSEKSN---LIRIEGDPQGVQQAKRELLELASRMENERTKDLIIEQRFHRTIIGQKGERIREIRDKFPEVIINFPDPAQKSDIVQLRGPKNEVEKCTKYMQKMVADLVENSYSISVPIFKQFHKNIIGKGGANIKKIREESNTKIDLPAENSNSETIIITGKRANCEAARSRILSIQKDLANIAEVEVSIPAKLHNSLIGTKGRLIRSIMEECGGVHIHFPVEGSGSDTVVIRGPSSDVEKAKKQLLHLAEEKQTKSFTVDIRAKPEYHKFLIGKGGGKIRKVRDSTGARIIFPAAEDKDQDLITIIGKEDAVREAQKELEALIQNLENVVEDYMLVDPKHHRHFVIRRGQVLREIAEEYGGVMVSFPRSGT--QSDKVTLKGAKDCVEAAKKRIQEIIEDLEAQVTVECAIPQKFHRSVMGPKGSRIQQITRDYNVQIKFPDRE------ENPVHSVEPSIQENGD-------EAGEGREAKETDPGSPRRCDIIIISGRKEKCEAAKEALEALVPVTIEVEVPFDLHRYIIGQKGSGIRKMMDEFEVNIHVPAPELQSDTIAITGLAANLDRAKAGLLDRVKELQAEQEDRALRSFKLSVTVDPKYHPKIIGRKGAVITQIRLEHEVNIQFPDKDDGNQPQDQITITGYEKNTEAARDAILKIVGELEQMVSEDVPLDHRVHARIIGARGKAIRKIMDEFKVDIRFPQSGAPD--PNCVTVTGLPENVEEAIDHILNLEEEYLADVVDSEALQVYMKPPAHEESRAPSK-------GFVVRDAPWTSNSSEKAPDMSSSEEFPSFGA 1255          
BLAST of High density lipoprotein binding protein (Vigilin) vs. Ensembl Mouse
Match: Hdlbp (high density lipoprotein (HDL) binding protein [Source:MGI Symbol;Acc:MGI:99256])

HSP 1 Score: 724.546 bits (1869), Expect = 0.000e+0
Identity = 435/1129 (38.53%), Postives = 671/1129 (59.43%), Query Frame = 3
Query:  597 KEYHKFILGRNGASLREIESGSNTNVTIPRSIENNDIITIFGTKEGIDKARAEINQIVAERSKLATERITIPKRFYPFINGSNNSKIYKIREMTNAKXXXXXXXXXXXXXXXXGEKDGVYQAL-EIIQKIYEDTKKCSSSLNLPIPKSQHCYVIGAKGSGIAEIFERTGVSIEMPSQDSDDDTIVLYGPNEFLAPALSMVI----QKSESMIRVNIEAPNWLHRFIIGKQGSNLNKLMEKYEHVFINFPENSDLIVIEGPKDDVNELKGQITHKIAELKSTMAITEIQVDPRFHRHIIGRSGANIQRMQEEYKVQIRMPGNNAVGTSGWTIRIEGDPEGVKLAKTEIESMSVKLENEKTKDVILDHKYHNQLIGAQGSRVKELRNQYPDVIIMFPDLSSKSDIVQLRGPRQQVDQVAVKLNKFIQEVIENNYTKDVKIFKQYHKNIIGKGGVNIRKIREEMNIRIDFPDEHSDSDKIRLTGKKENVEEAAKRIEAMQAELISIKEDTISIPQRLHISLIGTRGKLIKCIQQECGGVQIQFPASDSNSDIIKIRGPESDVDKAXXXXXXXXXXXXXXXHQDSVSAKSEFHKFLIGRKGAQLAEFRKRHAVMLIFPDSEDTNKDTIQIIGAKEAVQKAKEELEVTIKSLENEIEKYITIDTKWHKHFFKKRQAVMEEISREFGGVRIFFPKQDAVENIDQVRVIGPKGCVEAAVVRIEDIIENLEAQTSLSVFIEQKHHRNLITRNMMEIKSIQSNYDVTIKFPNRDLSSKPGENGMEEIH--LNGNGDVNIETMEEVDSTLESEQNNPA-----NWVTISGRKENCESAEDALLELVPITEDVPLANEFHRNFIGQKGQGINTFSTKHNVVVNIPPANKCSDFISIKGPRVNIIDAKAGLDELITMWENEKQDRIARNYENHVTVPIVFHRNIIGQRGANIEIFRTKFNVSIQIPDQ---NSKSEEITIRGYEEDVKKAEEELISMVEKWKAQVKEELHIPRDVHPQLIGTRGIALRKLRDQFKVEINFPNRNVDDEKAHLVEVIGDKENVDKCCDILVERANELLNEWEERNQVREVKNLIKDRENINSSSNIKEKGPGFLLTGAPW----QQRVPDASSNVDFPKIDA 3926
            K+ ++F  G       EI   +  ++ +  + +    I + G  + + KAR +I   VA     A+  + IPK  + F+ G N  K+  +   T  KI IP P   S +I I+G K+G+ +A  E++    E  K+    L   + K+ H ++ G     + EI + TG  I +P    +   IV  G  E LA A++ +     +K+ S    ++ AP+WLHRFIIGK+G NL K+ ++   V I F E  D I +EGP +DVN  + QI   + +L + M   EI +D +FHRH+IG+SGANI R++++YKV +R+P ++        IRIEGDP+GV+ AK E+  ++ ++ENE+TKD+I++ ++H  +IG +G R++E+R+++P+VII FPD + KSDIVQLRGP+ +V++    + K + +++EN+Y+  V IFKQ+HKNIIGKGG NI+KIREE N +ID P E+S+S+ I +TGK+ N E A  RI ++Q +L +I E  +SIP +LH SLIGT+G+LI+ I +ECGGV I FP   S SD + IRGP SDV+KAKKQLL L+E+    S    + AK E+HKFLIG+ G ++ + R      +IFP +ED ++D I IIG ++AV++A++ELE  I++LEN +E Y+ +D K H+HF  +R  V+ EI+ E+GGV + FP+       D+V + G K CVEAA  RI++IIE+LEAQ ++   I QK HR+++      I+ I  +Y+V IKFP+R+      EN +  +   +  NGD       E     E+++ +P      + + ISGRKE CE+A++AL  LVP+T +V +  + HR  IGQKG GI     +  V +++P     SD I+I G   N+  AKAGL + +   + E++DR  R+++  VTV   +H  IIG++GA I   R +  V+IQ PD+   N   ++ITI GYE++ + A + ++ +V + +  V E++ +   VH ++IG RG A+RK+ D+FKV+I FP     D   + V V G  ENV++  D ++    E L +  +   ++         E+   S        GF++  APW     ++ PD SS+ +FP   A
Sbjct:   90 KDMNQFGEGEQAKICLEIMQRTGAHLELSLAKDQGLSIMVSGKLDAVMKARKDI---VARLQTQASATVPIPKEHHRFVIGKNGEKLQDLELKTATKIQIPRPDDPSNQIKITGTKEGIEKARHEVLLISAEQDKRAVERLE--VEKAFHPFIAGPYNRLVGEIMQETGTRINIPPPSVNRTEIVFTGEKEQLAQAVARIKKIYEEKANSFTVSSVSAPSWLHRFIIGKKGQNLAKITQQMPKVHIEFTEGEDKITLEGPTEDVNVAQEQIEGMVKDLINRMDYVEINIDHKFHRHLIGKSGANINRIKDQYKVSVRIPPDSEKSN---LIRIEGDPQGVQQAKRELLELASRMENERTKDLIIEQRFHRTIIGQKGERIREIRDKFPEVIINFPDPAQKSDIVQLRGPKNEVEKCTKYMQKMVADLVENSYSISVPIFKQFHKNIIGKGGANIKKIREESNTKIDLPAENSNSETIIITGKRANCEAARSRILSIQKDLANIAEVEVSIPAKLHNSLIGTKGRLIRSIMEECGGVHIHFPVEGSGSDTVVIRGPSSDVEKAKKQLLHLAEEKQTKSFTVDIRAKPEYHKFLIGKGGGKIRKVRDSTGARIIFPAAEDKDQDLITIIGKEDAVREAQKELEALIQNLENVVEDYMLVDPKHHRHFVIRRGQVLREIAEEYGGVMVSFPRSGT--QSDKVTLKGAKDCVEAAKKRIQEIIEDLEAQVTVECAIPQKFHRSVMGPKGSRIQQITRDYNVQIKFPDRE------ENPVHSVEPSIQENGD-------EAGEGREAKETDPGSPRRCDIIIISGRKEKCEAAKEALEALVPVTIEVEVPFDLHRYIIGQKGSGIRKMMDEFEVNIHVPAPELQSDTIAITGLAANLDRAKAGLLDRVKELQAEQEDRALRSFKLSVTVDPKYHPKIIGRKGAVITQIRLEHEVNIQFPDKDDGNQPQDQITITGYEKNTEAARDAILKIVGELEQMVSEDVPLDHRVHARIIGARGKAIRKIMDEFKVDIRFPQSGAPD--PNCVTVTGLPENVEEAIDHILNLEEEYLADVVDSEALQVYMKPPAHEESRAPSK-------GFVVRDAPWTSNSSEKAPDMSSSEEFPSFGA 1186          

HSP 2 Score: 366.696 bits (940), Expect = 1.494e-105
Identity = 333/1151 (28.93%), Postives = 539/1151 (46.83%), Query Frame = 3
Query:  243 YDDQFPPLP-------TCNTPKIVQNSKPRIGQTKTSHVTQTLTVPLAERRFSNREANNSVKNDAQKKICQTVAQKCGVSIELNSGNKDQNLMVFISGPQDNVSNAKRILTKEXXXXXXXXMKVPKEYHKFILGRNGASLREIESGSNTNVTIPRSIENNDIITIFGTKEGIDKARAEINQIVAERSKLATERITIPKRFYPFINGSNNSKIYKIREMTNAKXXXXXXXXXXXXXXXXGEKDGVYQALEIIQKIYEDTKKCSSSLNLPIPKSQHCYVIGAKGSGIAEIFERT-GVSIEMPSQDSDDDTIVLYGPNEFLAPAL----SMVIQKSESMIRVNIEAPNWLHRFIIGKQGSNLNKLMEKYEHVFINFP---ENSDLIVIEGPKDDVNELKGQITHKIAELKSTMA---ITEIQVDPRFHRHIIGRSGANIQRMQEEYK---------------VQIRMPGN---------------------------------NAVGTSGW-----------------------TIRIEGDPEGVKLAKTEIESMSVKLENEKTKDVILDHKYHNQLIGAQGSRVKELRNQYPDVIIMFPDLSSKSDIVQLRGPRQQVDQVAVKLNKFIQEVIENNYTKDVKIFKQYHKNIIGKGGVNIRKIREEMNIRIDFP-DEHSDSDKIRLTGKKENVEEAAKRIEAMQAELISIKEDTISIPQRLHISLIGTRGKLIKCIQQECGGVQIQFPASDSNSDIIKIRGPESDVDKAXXXXXXXXXXXXXXXHQDSVSAKSEFHKFLIGRKGAQLAEFRKRHAVMLIFPDSEDT-------------------------------NKDTIQIIGAKEAVQKAKEELEVTIKSLENEIEKYITIDTKWHKHFFKKRQAVMEEISREFGGVRIFFPKQDAVENIDQVRVIGPKGCVEAAVVRIEDIIENLEAQT--------SLSVFIEQKHHRNLITRNMMEIKSIQSNYDVTIKFPNRDLSSKPGENGMEEIHLNGNGDVNIETMEEVDSTLESEQNNPANWVTISGRKENCESAEDALLELVP-----ITEDVPLANEFHRNFIGQKGQGINTFSTKHNVVVNIP----PANKCSDFISIKGPRVNIIDAKAGLDELITMWE 3281
            Y D FPPLP       +   P    ++K  I   K S +TQ   VPL ER++ +    N      Q KIC  + Q+ G  +EL S  KDQ L + +SG  D V  A++ +   LQTQ    + +PKE+H+F++G+NG  L+++E  + T + IPR  + ++ I I GTKEGI+KAR E+  I AE+ K A ER+ + K F+PFI G  N  + +I + T  +INIPPPSV   EI+ +GEK+ + QA+  I+KIYE+     +  ++  P   H ++IG KG  +A+I ++   V IE       +D I L GP E +  A      MV      M  V I   +  HR +IGK G+N+N++ ++Y+ V +  P   E S+LI IEG    V + K     ++ EL S M      ++ ++ RFHR IIG+ G  I+ +++++                VQ+R P N                                 N +G  G                        TI I G     + A++ I S+   L N    +V +  K HN LIG +G  ++ +  +   V I FP   S SD V +RGP   V++   +L    +E    ++T D++   +YHK +IGKGG  IRK+R+    RI FP  E  D D I + GK++ V EA K +EA+   L ++ ED + +  + H   +  RG++++ I +E GGV + FP S + SD + ++G +  V+ AKK++ E+ E        +  +   +FH+ ++G KG+++ +  + + V + FPD E+                                  D I I G KE  + AKE LE  +      IE  +  D   H++   ++ + + ++  EF  V I  P  +     D + + G    ++ A   + D ++ L+A+          LSV ++ K+H  +I R    I  I+  ++V I+FP++D                                   + N P + +TI+G ++N E+A DA+L++V      ++EDVPL +  H   IG +G+ I     +  V +  P    P   C   +++ G   N+ +A   +D ++ + E
Sbjct:   40 YKDAFPPLPEKAACLESAQEPAGAWSNK--IRPIKASVITQVFHVPLEERKYKDM---NQFGEGEQAKICLEIMQRTGAHLEL-SLAKDQGLSIMVSGKLDAVMKARKDIVARLQTQASATVPIPKEHHRFVIGKNGEKLQDLELKTATKIQIPRPDDPSNQIKITGTKEGIEKARHEVLLISAEQDKRAVERLEVEKAFHPFIAGPYNRLVGEIMQETGTRINIPPPSVNRTEIVFTGEKEQLAQAVARIKKIYEEKANSFTVSSVSAPSWLHRFIIGKKGQNLAKITQQMPKVHIEF---TEGEDKITLEGPTEDVNVAQEQIEGMVKDLINRMDYVEINIDHKFHRHLIGKSGANINRIKDQYK-VSVRIPPDSEKSNLIRIEGDPQGVQQAK----RELLELASRMENERTKDLIIEQRFHRTIIGQKGERIREIRDKFPEVIINFPDPAQKSDIVQLRGPKNEVEKCTKYMQKMVADLVENSYSISVPIFKQFHKNIIGKGGANIKKIREESNTKIDLPAENSNSETIIITGKRANCEAARSRILSIQKDLANIAEVEVSIPAKLHNSLIGTKGRLIRSIMEECGGVHIHFPVEGSGSDTVVIRGPSSDVEKAKKQLLHLAEEKQTKSFTVDIRAKPEYHKFLIGKGGGKIRKVRDSTGARIIFPAAEDKDQDLITIIGKEDAVREAQKELEALIQNLENVVEDYMLVDPKHHRHFVIRRGQVLREIAEEYGGVMVSFPRSGTQSDKVTLKGAKDCVEAAKKRIQEIIEDLEAQVTVE-CAIPQKFHRSVMGPKGSRIQQITRDYNVQIKFPDREENPVHSVEPSIQENGDEAGEGREAKETDPGSPRRCDIIIISGRKEKCEAAKEALEALVPVT---IEVEVPFD--LHRYIIGQKGSGIRKMMDEF-EVNIHVPAPEL--QSDTIAITGLAANLDRAKAGLLDRVKELQAEQEDRALRSFKLSVTVDPKYHPKIIGRKGAVITQIRLEHEVNIQFPDKD-----------------------------------DGNQPQDQITITGYEKNTEAARDAILKIVGELEQMVSEDVPLDHRVHARIIGARGKAIRKIMDEFKVDIRFPQSGAPDPNC---VTVTGLPENVEEA---IDHILNLEE 1126          

HSP 3 Score: 61.2326 bits (147), Expect = 1.139e-8
Identity = 61/263 (23.19%), Postives = 124/263 (47.15%), Query Frame = 3
Query:  465 ELNSGNKDQNLMVFISGPQDNVSNAKRILTKEXXXXXXXXMKVPKEYHKFILGRNGASLREIESGSNTNVTIPRSIENNDIITIFGTKEGIDKARA----EINQIVAERSKLATE----RITIPKRFYPFINGSNNSKIYKIR---EMTNAKXXXXXXXXXXXXXXXXGEKDGVYQALEIIQKIYEDTKKCSSSLNLPIPKSQHCYVIGAKGSGIAEIFERTGVSIEMP-SQDSDDDTIVLYGPNEFLAPALSMVIQKSESMI 1217
            E + G+  +  ++ ISG ++    AK  L  E      ++++VP + H++I+G+ G+ +R++      N+ +P     +D I I G    +D+A+A     + ++ AE+   A       +T+  +++P I G   + I +IR   E+     +    +   ++I I+G +     A + I KI  + ++  S  ++P+    H  +IGA+G  I +I +   V I  P S   D + + + G  E +  A+  ++   E  +
Sbjct:  870 ETDPGSPRRCDIIIISGRKEKCEAAKEAL--EALVPVTIEVEVPFDLHRYIIGQKGSGIRKMMDEFEVNIHVPAPELQSDTIAITGLAANLDRAKAGLLDRVKELQAEQEDRALRSFKLSVTVDPKYHPKIIGRKGAVITQIRLEHEVNIQFPDKDDGNQPQDQITITGYEKNTEAARDAILKIVGELEQMVSE-DVPLDHRVHARIIGARGKAIRKIMDEFKVDIRFPQSGAPDPNCVTVTGLPENVEEAIDHILNLEEEYL 1129          
BLAST of High density lipoprotein binding protein (Vigilin) vs. Ensembl Mouse
Match: Gm382 (predicted gene 382 [Source:MGI Symbol;Acc:MGI:2685228])

HSP 1 Score: 435.261 bits (1118), Expect = 2.258e-129
Identity = 273/837 (32.62%), Postives = 461/837 (55.08%), Query Frame = 3
Query: 1206 ESMIRVNIEAPNWLHRFIIGKQGSNLNKLMEKYEHVFINFPENSDLIVIEGPKDDVNELKGQITHKIAELKSTMAITEIQVDPRFHRHIIGRSGANIQRMQEEYKVQIRMPGNNAVGTSGWTIRIEGDPEGVKLAKTEIESMSVKLENEKTKDVILDHKYHNQLIGAQGSRVKELRNQYPDVIIMFPDLSSKSDIVQLRGPRQQVDQVAVKLNKFIQEVIENNYTKDVKIFKQYHKNIIGKGGVNIRKIREEMNIRIDFPDEHSDSDKIRLTGKKENVEEAAKRIEAMQAELISIKEDTISIPQRLHISLIGTRGKLIKCIQQECGGVQIQFPASDSNSDIIKIRGPESDVDKAXXXXXXXXXXXXXXXHQDSVSAKSEFHKFLIGRKGAQLAEFRKRHAVMLIFPDSEDTNKDTIQIIGAKEAVQKAKEELEVTIKSLENEIEKYITIDTKWHKHFFKKRQAVMEEISREFGGVRIFFPKQDAVENIDQVRVIGPKGCVEAAVVRIEDIIENLEAQTSLSVFIEQKHHRNLITRNMMEIKSIQSNYDVTIKFPNRDLSSKPGENGMEEIHLNGNGDVNIETMEEVDSTLESEQNNPANWVTISGRKENCESAEDALLELVPITEDVPLANEFHRNFIGQKGQGINTFSTKHNVVVNIPPANKCSDFISIKGPRVNIIDAKAGLDELITMWENEKQDRIARNYENHVTVPIVFHRNIIGQRGANIEIFRTKFNVSIQIPDQNSK--SEEITIRGYEEDVKKAEEELISMVEKWKAQVKEELHIPRDVHPQLIGTRGIALRKLRDQFKVEINFPNRNVDDEKAHLVEVIGDKENVDKC 3710
            +  I  +I AP+WLHRFIIG +G  ++++ E    V I+F    D I ++GP DDVN  + +    + +L S M  TEI  D +F++++ G +G  + R+ E+ +V I M   N    S ++IRIEG+  GV  AK E+  ++  LE E ++D+I+ H++H+ LIG +G RV+E+  ++PDVI+ FP  + KSDIVQL GPR + ++ A  L   + ++ ENNY+  V I K+ HK IIGKG  NIRKI E  N +I FP E  +S++  +TG  EN E A   I ++Q EL    E+ I IP  L+  L   +  L+  I +ECG + + FP   SN + I I G   +V+KAK +LL+LSE+    ++ +++  KS++H+FL+ + G  +++        + FP+  + +++TI I G +E+V++ +++L+  +K  ENE++  I I+ ++H +F  +R  +++E++ ++GGV I F      +N  +V + G K CVEAA   I++I E L +Q +    +       ++      I+ I  +Y V IKFP+ +   KP  N     H  G      E  +     +        + + ISG+ ENC++A +AL  ++P+T +V +        IG KG G+     ++ V + +    K SD ISI G   N+  AK  L + +   + E +DR  RN++    +   +   I G +G  I    T+ +V+I  P + +    E+ITI GY+E+   A + ++ ++ K +  + +E+ + + V   +IG RG  + K+ DQ++V+I  P + + +     + V G  +NV+K 
Sbjct:  350 DDYIASSIFAPSWLHRFIIGTKGEEISEITECVPKVQIHFTA-KDKITLKGPIDDVNYAQEKFDIIVKDLMSKMEYTEINSDSKFYKYLTGNNGEILNRITEKNQVSITMFPENE---SNYSIRIEGESLGVHQAKKELLDLANNLEEEYSQDIIIKHQFHHILIGQKGERVREICKKFPDVILNFPHPAEKSDIVQLIGPRYESEKCAQYLENMLTDIKENNYSISVPIIKKLHKRIIGKGVSNIRKISEATNTKITFPPESCNSEEFIITGYPENCEIARNWILSLQQELADTAEEEIIIPANLYKHLTNPKECLLNSIIEECGKIHLHFPKGKSNLNKIIIMGTIENVEKAKTKLLKLSEEEQAKNYSETLHIKSKYHQFLLNKNGGNISKICDETGTCVFFPNPTNKDQETITITGTEESVKEVQKQLDDLVKDFENEVDDSILINRRFHHYFVMRRGQLLKEMAEDYGGVVITF-SYSGRQNT-KVTIRGAKPCVEAAKKHIKEIFEPLGSQITTRYVLPHSFQPFIMGPISSRIQQIARDYKVEIKFPDIE---KPALNMDLGTHEKGK-----EKWKRTAKEIAPNSPRKGDTIFISGQVENCKAATEALASIIPVTTEVHVPLHLQPYIIGHKGSGLRKLVKEYEVHMQVSQPGKNSDIISIMGLSANVEQAKIKLQKRVKSLQMEVEDRTLRNFKLMFNLDPKYQAKITGHKGLLITQICTEHDVTIHFPKKGTHDMQEQITITGYKENTLAARDAIMRLLHKIEKTISKEITLNQQVRGNVIGVRGKTINKIMDQYQVDIRLPPKGLYNPN---ITVTGLADNVEKA 1169          

HSP 2 Score: 132.494 bits (332), Expect = 1.913e-30
Identity = 159/753 (21.12%), Postives = 342/753 (45.42%), Query Frame = 3
Query:  447 KCGVSIELNSGNKDQNLMVFISGPQDNVSNAKR---ILTKE-XXXXXXXXMKVPKEYHKFILGRNGASLREIESGSNTNVTIPRSIENNDIITIFGTKEGIDKARAEINQIVAERSKLATERITIPKRFYPFINGSNNSKIYKI-REMTNAKXXXXXXXXXXXXXXXXGEKDGVYQALEIIQKIYEDTKKCSSSLNLPIPKSQHCYVIGAKGSGIAEIFERTGVSIEMPSQDSDDDTIVLYGPNEFLAPALSMVIQKSESMIRV---NIEAPNWLHRFIIGKQGSNLNKLMEKYEHVFINFPE---NSDLIVIEGPKDDVNELKGQITHKIAELKSTMAITE-IQVDPRFHRHIIGRSGANIQRMQEEYKVQIRMPGNNAVGTSGWTIRIEGDPEGVKLAKTEIESMSVKLENEKTKDVILDHKYHNQLIGAQGSRVKELRNQYPDVIIMFPDLSSKSDIVQLRGPRQQVDQVAVKLNKFIQEVIENNYTKDVKIFKQYHKNIIGKGGVNIRKIREEMNIRIDFPD------------------------------EHSDSDKIRLTGKKENVEEAAKRIEAMQAELISIKEDTISIPQRLHISLIGTRGKLIKCIQQECGGVQIQFPASDSNSDIIKIRGPESDVDKAXXXXXXXXXXXXXXXHQDSV-------SAKSEFHKFLIGRKGAQLAEFRKRHAVMLIFPDSEDTN-KDTIQIIGAKEAVQKAKEELEVTIKSLENEIEKYITID 2555
            +C   ++++   KD+   + + GP D+V+ A+    I+ K+ +      ++    +++K++ G NG  L  I   +  ++T+    E+N  I I G   G+ +A+ E+  +     +  ++ I I  +F+  + G    ++ +I ++  +  +N P P+ +S+ + + G +    +  + ++ +  D K+ + S+++PI K  H  +IG   S I +I E T   I  P +  + +  ++ G  E    A + ++   + +       I  P  L++ +   +   LN ++E+   + ++FP+   N + I+I G  ++V + K ++  K++E +     +E + +  ++H+ ++ ++G NI ++ +E    +  P  N       TI I G  E VK  + +++ +    ENE    ++++ ++H+  +  +G  +KE+   Y  V+I F     ++  V +RG +  V+  A K  K I E + +  T    +   +   I+G     I++I  +  + I FPD                                   D I ++G+ EN + A + +    A +I +  + + +P  L   +IG +G  ++ + +E   V +Q      NSDII I G  ++V++AK +L +  +   +     ++       +   ++   + G KG  + +    H V + FP     + ++ I I G KE    A++ +   +  +E  I K IT++
Sbjct:  380 ECVPKVQIHFTAKDK---ITLKGPIDDVNYAQEKFDIIVKDLMSKMEYTEINSDSKFYKYLTGNNGEILNRITEKNQVSITMFPENESNYSIRIEGESLGVHQAKKELLDLANNLEEEYSQDIIIKHQFHHILIGQKGERVREICKKFPDVILNFPHPAEKSDIVQLIGPRYESEKCAQYLENMLTDIKENNYSISVPIIKKLHKRIIGKGVSNIRKISEATNTKITFPPESCNSEEFIITGYPENCEIARNWILSLQQELADTAEEEIIIPANLYKHLTNPKECLLNSIIEECGKIHLHFPKGKSNLNKIIIMGTIENVEKAKTKLL-KLSEEEQAKNYSETLHIKSKYHQFLLNKNGGNISKICDETGTCVFFP--NPTNKDQETITITGTEESVKEVQKQLDDLVKDFENEVDDSILINRRFHHYFVMRRGQLLKEMAEDYGGVVITFSYSGRQNTKVTIRGAKPCVE-AAKKHIKEIFEPLGSQITTRYVLPHSFQPFIMGPISSRIQQIARDYKVEIKFPDIEKPALNMDLGTHEKGKEKWKRTAKEIAPNSPRKGDTIFISGQVENCKAATEAL----ASIIPVTTE-VHVPLHLQPYIIGHKGSGLRKLVKEY-EVHMQVSQPGKNSDIISIMGLSANVEQAKIKLQKRVKSLQMEVEDRTLRNFKLMFNLDPKYQAKITGHKGLLITQICTEHDVTIHFPKKGTHDMQEQITITGYKENTLAARDAIMRLLHKIEKTISKEITLN 1119          

HSP 3 Score: 126.331 bits (316), Expect = 1.693e-28
Identity = 151/602 (25.08%), Postives = 259/602 (43.02%), Query Frame = 3
Query:  597 KEYHKFILGRNGASLREIESGSNTNVTIPRSIENNDIITIFGTKEGIDKARAEINQIVAERSKLATERITIPKRFYPFINGSNNSKIYK-IREMTNAKXXXXXXXXXXXXXXXXGEKDGVYQALEIIQKIYEDTKKCSSSLNLPIPKSQHCYVIGAKGSGIAEIFERTGVSIEMPS-QDSDDDTIVLYGPNEFLAPA---LSMVIQKSESMIRVNIEAPNWLHRFIIGKQGSNLNKLMEKYEHVFINFP---ENSDLIVIEGPKDDVNELKGQITHKIAELKSTMAITEIQVDPR-FHRHIIGRSGANIQRMQEEYKVQIRMP-----------GNNAVGTSGW----------------TIRIEGDPEGVKLAKTEIESMSVKLENEKTKDVILDHKYHNQLIGAQGSRVKELRNQYPDVIIMFPDLSSKSDIVQLRGPRQQVDQVAVKLNKFIQEV---IENNYTKDVKIF----KQYHKNIIGKGGVNIRKIREEMNIRIDFPDE--HSDSDKIRLTGKKENVEEAAKRIEAMQAELISIKEDTISIPQRLHISLIGTRGKLIKCIQQECGGVQIQFPASDSNSDIIKIRGPESDVDKA 2267
            K+ HK I+G+  +++R+I   +NT +T P    N++   I G  E  + AR  I  +  E +  A E I IP   Y  +       +   I E     ++ P       +III G  + V +A   + K+ E+ +  + S  L I    H +++   G  I++I + TG  +  P+  + D +TI + G  E +      L  +++  E+ +  +I      H + + ++G  L ++ E Y  V I F      +  + I G K  V   K  I      L S   IT   V P  F   I+G   + IQ++  +YKV+I+ P           G +  G   W                TI I G  E  K A   + S+        T +V +       +IG +GS +++L  +Y +V +        SDI+ + G    V+Q  +KL K ++ +   +E+   ++ K+      +Y   I G  G+ I +I  E ++ I FP +  H   ++I +TG KEN   A   I  +  ++       I++ Q++  ++IG RGK I  I  +   V I+ P     +  I + G   +V+KA
Sbjct:  577 KKLHKRIIGKGVSNIRKISEATNTKITFPPESCNSEEFIITGYPENCEIARNWILSLQQELADTAEEEIIIPANLYKHLTNPKECLLNSIIEECGKIHLHFPKGKSNLNKIIIMGTIENVEKAKTKLLKLSEEEQAKNYSETLHIKSKYHQFLLNKNGGNISKICDETGTCVFFPNPTNKDQETITITGTEESVKEVQKQLDDLVKDFENEVDDSILINRRFHHYFVMRRGQLLKEMAEDYGGVVITFSYSGRQNTKVTIRGAKPCVEAAKKHIKEIFEPLGS--QITTRYVLPHSFQPFIMGPISSRIQQIARDYKVEIKFPDIEKPALNMDLGTHEKGKEKWKRTAKEIAPNSPRKGDTIFISGQVENCKAATEALASII-----PVTTEVHVPLHLQPYIIGHKGSGLRKLVKEY-EVHMQVSQPGKNSDIISIMGLSANVEQAKIKLQKRVKSLQMEVEDRTLRNFKLMFNLDPKYQAKITGHKGLLITQICTEHDVTIHFPKKGTHDMQEQITITGYKENTLAARDAIMRLLHKIEKTISKEITLNQQVRGNVIGVRGKTINKIMDQY-QVDIRLPPKGLYNPNITVTGLADNVEKA 1169          

HSP 4 Score: 123.25 bits (308), Expect = 1.309e-27
Identity = 194/825 (23.52%), Postives = 344/825 (41.70%), Query Frame = 3
Query:  591 VPKEYHKFILGRNGASLREIESGSNTNVTIPR---SIENNDIITIFGTKEGIDKARAEINQIVAE-RSKLATERITIPKRFYPFINGSNNSKIYKIREMTNAKXXXXXXXXXXXXXXXXGEKDGVYQA----LEIIQKIYEDTKKCSSSLNLPIPKSQHCYVIGAKGSGIAEIFER-TGVSIEMPSQDSDDDTIVLYGP---NEFLAPAL-SMVIQKSESMIRVNIEAPNWLHRFIIGKQGSNLNKLMEKYEHVFINFPE---NSDLIVIEGPKDDVNELKGQITHKIAELKSTMAITEIQVDPRFHRHIIGRSGANIQRMQEEY-KVQIRMPGNNAVGTSGWT-IRIEGDPEGVKLAKTEIESMSVKLENEKTKD----VILDHKYHNQLIGAQGSRVKELRNQYPDVIIMFPDLSSK-SDIVQLRGPRQQVDQVAVKLNKFIQEVIENNYTKDVKIFKQYHKNIIGKGGVNIRKIREEM-NIRIDFPDEHSDSDKIRLTGKKENVEEAAKRIEAMQAELISIKEDTISIPQRLHISLIGTRGKLIKCIQQECGGVQIQF------------------------------PASDSNSDIIKIRGPESDVDKAXXXXXXXXXXXXXXXHQDSVSAKSEFHKFLIGRKGAQLAEFRKRHAVMLIFPDSEDTNKDTIQIIGAKEAVQKAKEELEVTIKSLENEIEK--------YITIDTKWHKHFFKKRQAVMEEISREFGGVRIFFPKQDAVENIDQVRVIGPKGCVEAAVVRIEDIIENLEAQTSLSVFIEQKHHRNLITRNMMEIKSIQSNYDVTIKFPNRDL 2879
             P   H+FI+G  G  + EI         +P+        D IT+ G  + ++ A+ + + IV +  SK+    I    +FY ++ G+N   + +I E     I + P +  +  I I GE  GV+QA    L++   + E+      S ++ I    H  +IG KG  + EI ++   V +  P      D + L GP   +E  A  L +M+    E+   +++     LH+ IIGK  SN+ K+ E   +  I FP    NS+  +I G  ++    +  I     EL  T A  EI +    ++H+       +  + EE  K+ +  P     G S    I I G  E V+ AKT++  +S   E E+ K+    + +  KYH  L+   G  + ++ ++     + FP+ ++K  + + + G  + V +V  +L+  +++  EN     + I +++H   + + G  ++++ E+   + I F      + K+ + G K  VE A K I+ +   L S       +P      ++G     I+ I ++   V+I+F                              P S    D I I G   +   A + L  +            V        ++IG KG+ L +  K + V +        N D I I+G    V++AK +L+  +KSL+ E+E            +D K+       +  ++ +I  E   V I FPK+   +  +Q+ + G K    AA   I  ++  +E   S  + + Q+   N+I      I  I   Y V I+ P + L
Sbjct:  359 APSWLHRFIIGTKGEEISEITE------CVPKVQIHFTAKDKITLKGPIDDVNYAQEKFDIIVKDLMSKMEYTEINSDSKFYKYLTGNNGEILNRITEKNQVSITMFPENESNYSIRIEGESLGVHQAKKELLDLANNLEEEY-----SQDIIIKHQFHHILIGQKGERVREICKKFPDVILNFPHPAEKSDIVQLIGPRYESEKCAQYLENMLTDIKENNYSISVPIIKKLHKRIIGKGVSNIRKISEA-TNTKITFPPESCNSEEFIITGYPENCEIARNWILSLQQELADT-AEEEIIIPANLYKHLTNPKECLLNSIIEECGKIHLHFPK----GKSNLNKIIIMGTIENVEKAKTKLLKLS---EEEQAKNYSETLHIKSKYHQFLLNKNGGNISKICDE-TGTCVFFPNPTNKDQETITITGTEESVKEVQKQLDDLVKD-FENEVDDSILINRRFHHYFVMRRGQLLKEMAEDYGGVVITFSYSGRQNTKVTIRGAKPCVEAAKKHIKEIFEPLGSQITTRYVLPHSFQPFIMGPISSRIQQIARDY-KVEIKFPDIEKPALNMDLGTHEKGKEKWKRTAKEIAPNSPRKGDTIFISGQVENCKAATEALASIIPVTT------EVHVPLHLQPYIIGHKGSGLRKLVKEYEVHMQV-SQPGKNSDIISIMGLSANVEQAKIKLQKRVKSLQMEVEDRTLRNFKLMFNLDPKYQAKITGHKGLLITQICTEH-DVTIHFPKKGTHDMQEQITITGYKENTLAARDAIMRLLHKIEKTISKEITLNQQVRGNVIGVRGKTINKIMDQYQVDIRLPPKGL 1152          

HSP 5 Score: 110.923 bits (276), Expect = 9.404e-24
Identity = 192/880 (21.82%), Postives = 366/880 (41.59%), Query Frame = 3
Query: 1029 PKSQHCYVIGAKGSGIAEIFERT-GVSIEMPSQDSDDDTIVLYGPNE---FLAPALSMVIQKSES-MIRVNIEAPNWLHRFIIGKQGSNLNKLMEKYEHVFINFPENSD--LIVIEGPKDDVNELKGQITHKIAELKSTMAITEIQVDPRFHRHIIGRSGANIQRMQEEY-KVQIRMPGNNAVGTSGWTIRIEGDPEGVKLAKTEIESMSVKL-ENEKTKDVILDHKYHNQLIGAQGSRVKELRNQYPDVIIMFPDLSSKSDIVQLRGPRQQVDQVAVKLNKFIQEVIENNYTKDVKIFKQYHKNIIGKGGVNIRKIREEMN-IRIDFPDEHSDSDKIRLTGKKENVEEA-AKRIEAMQAELISIKEDTISIPQRLHISLIGTRGKLIKCIQQECGGVQIQFP-ASDSNSDIIKIRGPESDVDKAXXXXXXXXXXXXXXXHQDSVSAKSEFHKFLIGRKGAQLAEFRKRHAVMLIFPDSEDTNKDTIQIIGAKEAVQKAKEELEVTIKSLENEIEKYITIDTKWHKHFFKKRQAVMEEISREFGGVRIFFPK-QDAVENID-------------QVRVIGPKGCVEAAVVRIEDIIENLEAQT---------SLSVFIEQKHHRNLITRNMMEIKSIQSNYDVTIKFPNRDLSSKPGENGMEEIHLNGNGDVNIETMEEVDSTLESEQNNPANWVTISGRKENCESAEDALLELVPI----TEDVPLAN---------EFHRNFIGQKGQGINTFSTKHNVVVNIPP--ANKCSDFISIKGPRVNIIDAKAGLDELITMWENEKQDRIARNYENHVTVPIVFHRNIIGQRGANIEIFRTKFNVSIQIPDQNSKSEEITIRGYEEDVKKAEEELISMVEKW 3518
            P   H ++IG KG  I+EI E    V I   ++D     I L GP +   +      ++++   S M    I + +  ++++ G  G  LN++ EK +     FPEN     I IEG    V++ K ++      L+   +  +I +  +FH  +IG+ G  ++ + +++  V +  P  +    S     I    E  K A+  +E+M   + EN  +  V +  K H ++IG   S ++++ ++  +  I FP  S  S+   + G  +  + +A      +Q+ + +   +++ I    +K++       +  I EE   I + FP   S+ +KI + G  ENVE+A  K ++  + E      +T+ I  + H  L+   G  I  I  E G   + FP  ++ + + I I G E  V K  ++ L+   K+      DS+     FH + + R+G  L E  + +  ++I           + I GAK  V+ AK+ ++   + L ++I     +   +         + +++I+R++  V I FP  +    N+D               + I P    +   + I   +EN +A T         +  V +       +I      ++ +   Y+V ++       S+PG+N                                ++ ++I G   N E A+  L + V       ED  L N         ++     G KG  I    T+H+V ++ P    +   + I+I G + N + A+  +  L+         +I +     +T+      N+IG RG  I     ++ V I++P +   +  IT+ G  ++V+KA E ++++ EK+
Sbjct:  360 PSWLHRFIIGTKGEEISEITECVPKVQIHFTAKDK----ITLKGPIDDVNYAQEKFDIIVKDLMSKMEYTEINSDSKFYKYLTGNNGEILNRITEKNQVSITMFPENESNYSIRIEGESLGVHQAKKELLDLANNLEEEYS-QDIIIKHQFHHILIGQKGERVREICKKFPDVILNFP--HPAEKSDIVQLIGPRYESEKCAQY-LENMLTDIKENNYSISVPIIKKLHKRIIGKGVSNIRKI-SEATNTKITFPPESCNSEEFIITGYPENCE-IARNWILSLQQELADTAEEEIIIPANLYKHLTNPKECLLNSIIEECGKIHLHFPKGKSNLNKIIIMGTIENVEKAKTKLLKLSEEEQAKNYSETLHIKSKYHQFLLNKNGGNISKICDETGTC-VFFPNPTNKDQETITITGTEESV-KEVQKQLDDLVKDFENEVDDSILINRRFHHYFVMRRGQLLKEMAEDYGGVVITFSYSGRQNTKVTIRGAKPCVEAAKKHIKEIFEPLGSQITTRYVLPHSFQPFIMGPISSRIQQIARDYK-VEIKFPDIEKPALNMDLGTHEKGKEKWKRTAKEIAPNSPRKGDTIFISGQVENCKAATEALASIIPVTTEVHVPLHLQPYIIGHKGSGLRKLVKEYEVHMQV------SQPGKN--------------------------------SDIISIMGLSANVEQAKIKLQKRVKSLQMEVEDRTLRNFKLMFNLDPKYQAKITGHKGLLITQICTEHDVTIHFPKKGTHDMQEQITITGYKENTLAARDAIMRLL--------HKIEKTISKEITLNQQVRGNVIGVRGKTINKIMDQYQVDIRLPPKGLYNPNITVTGLADNVEKAIEHILNL-EKY 1179          

HSP 6 Score: 94.3597 bits (233), Expect = 9.550e-19
Identity = 123/571 (21.54%), Postives = 249/571 (43.61%), Query Frame = 3
Query:  426 ICQTVAQKCG-VSIELNSGNKDQNLMVFISGPQDNVSNAKRILTK----EXXXXXXXXMKVPKEYHKFILGRNGASLREIESGSNTNVTIPRSI-ENNDIITIFGTKEGIDKARAEINQIVAERSKLATERITIPKRFYPFINGSNNSKIYKIRE-MTNAKXXXXXXXXXXXXXXXXGEKDGVYQALEIIQKIYEDTKKCSSSLNLPIPKSQHCYVIGAKGSGIAEIFERTGVSIEMPSQDSDDDTIVLYGPNEFLAPALSMVIQKSESMIRVNIEAPNWLHRFIIGKQGSNLNKLMEKYEHVFINFPENSDLIVIEGPKDDVNELKGQITHKIAELKSTMAITEIQVDPRFHRHIIGRSGANIQRMQEEYKV--QIRMPGNNA--VGTSGWTIRIEGDPEGVKLAKTEIESMSVKLENEKTKDVIL----DHKYHNQLIGAQGSRVKELRNQYPDVIIMFPDLSSK--SDIVQLRGPRQQVDQVAVKLNKFIQEVIENNYTKDVKIFKQYHKNIIGKGGVNIRKIREEMNIRIDFPDEHSDSDKIRLTGKKENVEEAAKRIEAMQAELIS 2087
            +  ++ ++CG + +    G  + N ++ I G  +NV  AK  L K    E        + +  +YH+F+L +NG ++ +I   + T V  P    ++ + ITI GT+E + + + +++ +V +      + I I +RF+ +        + ++ E      I       ++ ++ I G K  V  A + I++I+E      ++  + +P S   +++G   S I +I     V I+ P               +   PAL+M +   E                  GK+     K     + +  N P   D I I G  ++       +   I         TE+ V      +IIG  G+ ++++ +EY+V  Q+  PG N+  +   G +  +E     +KL K  ++S+ +++E+   ++  L    D KY  ++ G +G  + ++  ++ DV I FP   +    + + + G ++        + + + + IE   +K++ + +Q   N+IG  G  I KI ++  + I  P +   +  I +TG  +NVE+A + I  ++   +S
Sbjct:  662 LLNSIIEECGKIHLHFPKGKSNLNKII-IMGTIENVEKAKTKLLKLSEEEQAKNYSETLHIKSKYHQFLLNKNGGNISKICDETGTCVFFPNPTNKDQETITITGTEESVKEVQKQLDDLVKDFENEVDDSILINRRFHHYFVMRRGQLLKEMAEDYGGVVITFSYSGRQNTKVTIRGAKPCVEAAKKHIKEIFEPLGSQITTRYV-LPHSFQPFIMGPISSRIQQIARDYKVEIKFP---------------DIEKPALNMDLGTHEK-----------------GKE-----KWKRTAKEIAPNSPRKGDTIFISGQVENCKAATEALASIIP------VTTEVHVPLHLQPYIIGHKGSGLRKLVKEYEVHMQVSQPGKNSDIISIMGLSANVE--QAKIKLQK-RVKSLQMEVEDRTLRNFKLMFNLDPKYQAKITGHKGLLITQICTEH-DVTIHFPKKGTHDMQEQITITGYKENTLAARDAIMRLLHK-IEKTISKEITLNQQVRGNVIGVRGKTINKIMDQYQVDIRLPPKGLYNPNITVTGLADNVEKAIEHILNLEKYYLS 1182          
BLAST of High density lipoprotein binding protein (Vigilin) vs. Ensembl Mouse
Match: 4921511C20Rik (RIKEN cDNA 4921511C20 gene [Source:MGI Symbol;Acc:MGI:2685229])

HSP 1 Score: 156.377 bits (394), Expect = 7.947e-40
Identity = 124/478 (25.94%), Postives = 228/478 (47.70%), Query Frame = 3
Query: 2511 IKSLENEIEKYITIDTKWHKHFFKKRQAVMEEISREFGGVRIFFPKQDAVENIDQVRVI--GPKGCVEAAVVRIEDIIENLEAQTSLSVFIEQKHHRNLITRNMMEIKSIQSNYDVTIKFPNRDLSSKPGENGMEEIHLNGNGDVNIETMEEVDSTLESEQNNPANWVTISGRKENCESAEDALLELVPITEDVPLANEFHRNFIGQKGQGINTFSTKHNVVVNIPPANKCSDFISIKGPRVNIIDAKAGLDELITMWENEKQDRIARNYENHVTVPIVFHRNIIGQRGANIEIFRTKFNVSIQIPDQNSK--SEEITIRGYEEDVKKAEEELISMVEKWKAQVKEELHIPRDVHPQLIGTRGIALRKLRDQFKVEINFPNRNVDDEKAHLVEVIGDKENVDKCCDILVERANELLNEW-EERNQVREVKNLIKDRENINSSSN-IKEKGPGFLLTGAPWQQRVPDASSN--VDFPKI 3920
            +K L++ +E  I I+ K+H +F  +R  ++ E++  + G+ I F      E    +RV   G K CVEAA   I+ I E L +  +    I QK +   +     +++ I  ++ V + FP+++  +      ++E      G    E +        +++ N    + ISG+ ENC++A +AL  L+P T +V + +  H   IG KG GI    ++ +V   +      SD ISI G    +  AK  L++ I   + E +DR  RN++   T+   +H  I G +G  I     + +V+I  P + ++   ++ITI GY+++   A++ ++ M+ K +  V +E+ I   V   + G  G  + K+ +QF V+I  P +   +     V V+G  +NV +  D + +     L+      +Q+  +KN    +  + S +N +K  GP          +  P++S++   DFPK+
Sbjct:    1 MKDLDHVVEDSILINRKFHHYFVMRRDQLIREMTEVYAGMIIHF----TYEGKQSIRVTMKGEKACVEAAKKHIQHIFEPLGSHVTTQYVIPQKFYTFFMGPLCSKVQQIARDFKVQLAFPDKEKPTTYIHPVIQEAEKEKWGKSTKEIV------FSNQRKNKT--ILISGQIENCKAAMEALEYLIPFTAEVQVPSHLHPYIIGPKGSGIKKIMSEFDVHTQVSQTGSNSDIISIMGLAAKVKQAKVKLEKQINALQTEIEDRALRNFKLMFTLDAKYHSTITGHKGLFIAQICREHDVTIHFPKKANREIQDQITITGYKKNTLAAKDAIMRMLHKIEKTVSKEIPINPQVRDSIFGFGGKFIHKMNEQFHVDIRLPPKGSWNTN---VSVVGLPDNVQEAIDHIFDLEKYYLSALINYDSQLESLKNTCLYKITMESPNNSVKNDGPH-------SAKSYPNSSNDDSEDFPKL 456          

HSP 2 Score: 82.8037 bits (203), Expect = 1.131e-15
Identity = 92/380 (24.21%), Postives = 161/380 (42.37%), Query Frame = 3
Query: 1245 LHRFIIGKQGSNLNKLMEKYEHVFINFP---ENSDLIVIEGPKDDVNELKGQITHKIAELKSTMAITEIQVDPRFHRHIIGRSGANIQRMQEEYKVQIRMPGNNAVGT-----------SGW----------------TIRIEGDPEGVKLAKTEIESMSVKLENEKTKDVILDHKYHNQLIGAQGSRVKELRNQYPDVIIMFPDLSSKSDIVQLRGPRQQVDQVAVKLNKFI---QEVIENNYTKDVKIF----KQYHKNIIGKGGVNIRKIREEMNIRIDFPDEHSD--SDKIRLTGKKENVEEAAKRIEAMQAELISIKEDTISIPQRLHISLIGTRGKLIKCIQQECGGVQIQFPASDSNSDIIKIRGPESDVDKA 2267
             H + + ++   + ++ E Y  + I+F    + S  + ++G K  V   K  I H    L S +  T+  +  +F+   +G   + +Q++  ++KVQ+  P      T             W                TI I G  E  K A   +E +        T +V +    H  +IG +GS +K++ +++ DV        S SDI+ + G   +V Q  VKL K I   Q  IE+   ++ K+      +YH  I G  G+ I +I  E ++ I FP + +    D+I +TG K+N   A   I  M  ++       I I  ++  S+ G  GK I  + ++   V I+ P   S +  + + G   +V +A
Sbjct:   18 FHHYFVMRRDQLIREMTEVYAGMIIHFTYEGKQSIRVTMKGEKACVEAAKKHIQHIFEPLGSHVT-TQYVIPQKFYTFFMGPLCSKVQQIARDFKVQLAFPDKEKPTTYIHPVIQEAEKEKWGKSTKEIVFSNQRKNKTILISGQIENCKAAMEALEYLI-----PFTAEVQVPSHLHPYIIGPKGSGIKKIMSEF-DVHTQVSQTGSNSDIISIMGLAAKVKQAKVKLEKQINALQTEIEDRALRNFKLMFTLDAKYHSTITGHKGLFIAQICREHDVTIHFPKKANREIQDQITITGYKKNTLAAKDAIMRMLHKIEKTVSKEIPINPQVRDSIFGFGGKFIHKMNEQF-HVDIRLPPKGSWNTNVSVVGLPDNVQEA 389          

HSP 3 Score: 75.0998 bits (183), Expect = 3.241e-13
Identity = 90/398 (22.61%), Postives = 175/398 (43.97%), Query Frame = 3
Query:  936 GEKDGVYQALEIIQKIYEDTKKCSSSLNLPIPKSQHCYVIGAKGSGIAEIFERTGVSIEMPSQDSDDDTIVLYGPNEFLAPALSMVIQKSESMIRVNIEAPNWLHRFIIGKQGSNLNKLMEKYEHVFINFPENSDLIVIEGPKDDVNELKGQITHKIAELKSTMAI----TEIQVDPRFHRHIIGRSGANIQRMQEEYKVQIRMPGNNAVGTSGWTIRIEGDPEGVKLAKTEIE----SMSVKLENEKTKD----VILDHKYHNQLIGAQGSRVKELRNQYPDVIIMFPDLSSK--SDIVQLRGPRQQVDQVAVKLNKFIQEVIENNYTKDVKIFKQYHKNIIGKGGVNIRKIREEMNIRIDFPDEHSDSDKIRLTGKKENVEEAAKRIEAMQAELIS 2087
            GEK  V  A + IQ I+E      ++  + IP+  + + +G   S + +I     V +  P ++          P  ++ P    VIQ++E           W      GK    +         VF N  +N  +++            GQI +  A +++   +     E+QV    H +IIG  G+ I+++  E+ V  ++   +  G++   I I G    VK AK ++E    ++  ++E+   ++      LD KYH+ + G +G  + ++  ++ DV I FP  +++   D + + G ++        + + + + IE   +K++ I  Q   +I G GG  I K+ E+ ++ I  P + S +  + + G  +NV+EA   I  ++   +S
Sbjct:   58 GEKACVEAAKKHIQHIFEPLGSHVTTQYV-IPQKFYTFFMGPLCSKVQQIARDFKVQLAFPDKEK---------PTTYIHP----VIQEAEK--------EKW------GKSTKEI---------VFSNQRKNKTILI-----------SGQIENCKAAMEALEYLIPFTAEVQVPSHLHPYIIGPKGSGIKKIMSEFDVHTQV---SQTGSNSDIISIMGLAAKVKQAKVKLEKQINALQTEIEDRALRNFKLMFTLDAKYHSTITGHKGLFIAQICREH-DVTIHFPKKANREIQDQITITGYKKNTLAAKDAIMRMLHK-IEKTVSKEIPINPQVRDSIFGFGGKFIHKMNEQFHVDIRLPPKGSWNTNVSVVGLPDNVQEAIDHIFDLEKYYLS 402          

HSP 4 Score: 58.5362 bits (140), Expect = 4.442e-8
Identity = 97/480 (20.21%), Postives = 194/480 (40.42%), Query Frame = 3
Query: 2316 QDSVSAKSEFHKFLIGRKGAQLAEFRKRHAVMLIFPDSEDTNKDTIQIIGAKEAVQKAKEELEVTIKSLENEIEKYITIDTKWHKHFFKKRQAVMEEISREFGGVRIFFPKQDAVENIDQVRVIGPKGCVEAAVVRIEDIIENLEAQTSLSVFIEQKHHRNLITRNMME-IKSIQSNYDVTIKFPNRDLSSKPGENGMEEIHLNGNGDVNIETMEEVD-STLESEQNNPANWVTISGRKENCESA----EDALLELVPITEDVPLAN---------EFHRNFIGQKGQGINTFSTKHNVVVNIP-PANK-CSDFISIKGPRVNIIDAKAGLDELITMWENEKQDRIARNYENHVTVPIVFHRNIIGQRGANIEIFRTKFNVSIQIPDQNSKSEEITIRGYEEDVKKAEEELISMVEKWKAQVKEELHIPRDVHPQLIGTRGIALRKLRDQFKVEINFPNRNVDDEKAHLVEVIGDKENVD 3704
            +DS+    +FH + + R+   + E  + +A M+I    E      + + G K  V+ AK+ ++   + L + +     I  K++  F     + +++I+R+F  V++ FP ++            P   +   +   E   E     T   VF  Q+ ++ ++    +E  K+     +  I F        P       I   G+G   I  M E D  T  S+  + ++ ++I G     + A    E  +  L    ED  L N         ++H    G KG  I     +H+V ++ P  AN+   D I+I G + N + AK  +  ++         +I +     + +      +I G  G  I     +F+V I++P + S +  +++ G  ++V++A + +  + + + + +     I  D   QL   +   L      +K+ +  PN +V ++  H  +   +  N D
Sbjct:    9 EDSILINRKFHHYFVMRRDQLIREMTEVYAGMIIHFTYEGKQSIRVTMKGEKACVEAAKKHIQHIFEPLGSHVTTQYVIPQKFYTFFMGPLCSKVQQIARDF-KVQLAFPDKEK-----------PTTYIHPVIQEAEK--EKWGKSTKEIVFSNQRKNKTILISGQIENCKAAMEALEYLIPFTAE--VQVPSHLHPYIIGPKGSGIKKI--MSEFDVHTQVSQTGSNSDIISIMGLAAKVKQAKVKLEKQINALQTEIEDRALRNFKLMFTLDAKYHSTITGHKGLFIAQICREHDVTIHFPKKANREIQDQITITGYKKNTLAAKDAIMRML--------HKIEKTVSKEIPINPQVRDSIFGFGGKFIHKMNEQFHVDIRLPPKGSWNTNVSVVGLPDNVQEAIDHIFDLEKYYLSAL-----INYD--SQLESLKNTCL------YKITMESPNNSVKNDGPHSAKSYPNSSNDD 449          
BLAST of High density lipoprotein binding protein (Vigilin) vs. UniProt/SwissProt
Match: sp|Q8VDJ3|VIGLN_MOUSE (Vigilin OS=Mus musculus OX=10090 GN=Hdlbp PE=1 SV=1)

HSP 1 Score: 872.078 bits (2252), Expect = 0.000e+0
Identity = 517/1249 (41.39%), Postives = 775/1249 (62.05%), Query Frame = 3
Query:  243 YDDQFPPLP-------TCNTPKIVQNSKPRIGQTKTSHVTQTLTVPLAERRFSNREANNSVKNDAQKKICQTVAQKCGVSIELNSGNKDQNLMVFISGPQDNVSNAKRILTKEXXXXXXXXMKVPKEYHKFILGRNGASLREIESGSNTNVTIPRSIENNDIITIFGTKEGIDKARAEINQIVAERSKLATERITIPKRFYPFINGSNNSKIYKIREMTNAKXXXXXXXXXXXXXXXXGEKDGVYQALEIIQKIYEDTKKCSSSLNLPIPKSQHCYVIGAKGSGIAEIFERTGVSIEMPSQDSDDDTIVLYGPNEFLAPALSMVIQKSESMIRVNIEAPNWLHRFIIGKQGSNLNKLMEKYEHVFINFPENSDLIVIEGPKDDVNELKGQITHKIAELKSTMAITEIQVDPRFHRHIIGRSGANIQRMQEEYKVQIRMPGNNAVGTSGWTIRIEGDPEGVKLAKTEIESMSVKLENEKTKDVILDHKYHNQLIGAQGSRVKELRNQYPDVIIMFPDLSSKSDIVQLRGPRQQVDQVAVKLNKFIQEVIENNYTKDVKIFKQYHKNIIGKGGVNIRKIREEMNIRIDFPDEHSDSDKIRLTGKKENVEEAAKRIEAMQAELISIKEDTISIPQRLHISLIGTRGKLIKCIQQECGGVQIQFPASDSNSDIIKIRGPESDVDKAXXXXXXXXXXXXXXXHQDSVSAKSEFHKFLIGRKGAQLAEFRKRHAVMLIFPDSEDTNKDTIQIIGAKEAVQKAKEELEVTIKSLENEIEKYITIDTKWHKHFFKKRQAVMEEISREFGGVRIFFPKQDAVENIDQVRVIGPKGCVEAAVVRIEDIIENLEAQTSLSVFIEQKHHRNLITRNMMEIKSIQSNYDVTIKFPNRDLSSKPGENGMEEIH--LNGNGDVNIETMEEVDSTLESEQNNPA-----NWVTISGRKENCESAEDALLELVPITEDVPLANEFHRNFIGQKGQGINTFSTKHNVVVNIPPANKCSDFISIKGPRVNIIDAKAGLDELITMWENEKQDRIARNYENHVTVPIVFHRNIIGQRGANIEIFRTKFNVSIQIPDQ---NSKSEEITIRGYEEDVKKAEEELISMVEKWKAQVKEELHIPRDVHPQLIGTRGIALRKLRDQFKVEINFPNRNVDDEKAHLVEVIGDKENVDKCCDILVERANELLNEWEERNQVREVKNLIKDRENINSSSNIKEKGPGFLLTGAPW----QQRVPDASSNVDFPKIDA 3926
            Y D FPPLP       +   P    ++K R    K S +TQ   VPL ER++ +    N      Q KIC  + Q+ G  +EL S  KDQ L + +SG  D V  A++ +   LQTQ    + +PKE+H+F++G+NG  L+++E  + T + IPR  + ++ I I GTKEGI+KAR E+  I AE+ K A ER+ + K F+PFI G  N  + +I + T  +INIPPPSV   EI+ +GEK+ + QA+  I+KIYE+ KK ++++ + + KSQH YVIG KG+ + EI ERTGVS+E+P  DS  +T++L G  E L  AL+ V  K+ S    ++ AP+WLHRFIIGK+G NL K+ ++   V I F E  D I +EGP +DVN  + QI   + +L + M   EI +D +FHRH+IG+SGANI R++++YKV +R+P ++        IRIEGDP+GV+ AK E+  ++ ++ENE+TKD+I++ ++H  +IG +G R++E+R+++P+VII FPD + KSDIVQLRGP+ +V++    + K + +++EN+Y+  V IFKQ+HKNIIGKGG NI+KIREE N +ID P E+S+S+ I +TGK+ N E A  RI ++Q +L +I E  +SIP +LH SLIGT+G+LI+ I +ECGGV I FP   S SD + IRGP SDV+KAKKQLL L+E+    S    + AK E+HKFLIG+ G ++ + R      +IFP +ED ++D I IIG ++AV++A++ELE  I++LEN +E Y+ +D K H+HF  +R  V+ EI+ E+GGV + FP+       D+V + G K CVEAA  RI++IIE+LEAQ ++   I QK HR+++      I+ I  +Y+V IKFP+R+      EN +  +   +  NGD       E     E+++ +P      + + ISGRKE CE+A++AL  LVP+T +V +  + HR  IGQKG GI     +  V +++P     SD I+I G   N+  AKAGL + +   + E++DR  R+++  VTV   +H  IIG++GA I   R +  V+IQ PD+   N   ++ITI GYE++ + A + ++ +V + +  V E++ +   VH ++IG RG A+RK+ D+FKV+I FP     D   + V V G  ENV++  D ++    E L +  +   ++         E+   S        GF++  APW     ++ PD SS+ +FP   A
Sbjct:   40 YKDAFPPLPEKAACLESAQEPAGAWSNKIR--PIKASVITQVFHVPLEERKYKDM---NQFGEGEQAKICLEIMQRTGAHLEL-SLAKDQGLSIMVSGKLDAVMKARKDIVARLQTQASATVPIPKEHHRFVIGKNGEKLQDLELKTATKIQIPRPDDPSNQIKITGTKEGIEKARHEVLLISAEQDKRAVERLEVEKAFHPFIAGPYNRLVGEIMQETGTRINIPPPSVNRTEIVFTGEKEQLAQAVARIKKIYEEKKKKTTTIAVEVKKSQHKYVIGPKGNSLQEILERTGVSVEIPPSDSISETVILRGEPEKLGQALTEVYAKANSFTVSSVSAPSWLHRFIIGKKGQNLAKITQQMPKVHIEFTEGEDKITLEGPTEDVNVAQEQIEGMVKDLINRMDYVEINIDHKFHRHLIGKSGANINRIKDQYKVSVRIPPDSEKSN---LIRIEGDPQGVQQAKRELLELASRMENERTKDLIIEQRFHRTIIGQKGERIREIRDKFPEVIINFPDPAQKSDIVQLRGPKNEVEKCTKYMQKMVADLVENSYSISVPIFKQFHKNIIGKGGANIKKIREESNTKIDLPAENSNSETIIITGKRANCEAARSRILSIQKDLANIAEVEVSIPAKLHNSLIGTKGRLIRSIMEECGGVHIHFPVEGSGSDTVVIRGPSSDVEKAKKQLLHLAEEKQTKSFTVDIRAKPEYHKFLIGKGGGKIRKVRDSTGARIIFPAAEDKDQDLITIIGKEDAVREAQKELEALIQNLENVVEDYMLVDPKHHRHFVIRRGQVLREIAEEYGGVMVSFPRSGT--QSDKVTLKGAKDCVEAAKKRIQEIIEDLEAQVTVECAIPQKFHRSVMGPKGSRIQQITRDYNVQIKFPDRE------ENPVHSVEPSIQENGD-------EAGEGREAKETDPGSPRRCDIIIISGRKEKCEAAKEALEALVPVTIEVEVPFDLHRYIIGQKGSGIRKMMDEFEVNIHVPAPELQSDTIAITGLAANLDRAKAGLLDRVKELQAEQEDRALRSFKLSVTVDPKYHPKIIGRKGAVITQIRLEHEVNIQFPDKDDGNQPQDQITITGYEKNTEAARDAILKIVGELEQMVSEDVPLDHRVHARIIGARGKAIRKIMDEFKVDIRFPQSGAPD--PNCVTVTGLPENVEEAIDHILNLEEEYLADVVDSEALQVYMKPPAHEESRAPSK-------GFVVRDAPWTSNSSEKAPDMSSSEEFPSFGA 1255          
BLAST of High density lipoprotein binding protein (Vigilin) vs. UniProt/SwissProt
Match: sp|Q00341|VIGLN_HUMAN (Vigilin OS=Homo sapiens OX=9606 GN=HDLBP PE=1 SV=2)

HSP 1 Score: 869.766 bits (2246), Expect = 0.000e+0
Identity = 518/1246 (41.57%), Postives = 774/1246 (62.12%), Query Frame = 3
Query:  243 YDDQFPPLP-------TCNTPKIVQNSKPRIGQTKTSHVTQTLTVPLAERRFSNREANNSVKNDAQKKICQTVAQKCGVSIELNSGNKDQNLMVFISGPQDNVSNAKRILTKEXXXXXXXXMKVPKEYHKFILGRNGASLREIESGSNTNVTIPRSIENNDIITIFGTKEGIDKARAEINQIVAERSKLATERITIPKRFYPFINGSNNSKIYKIREMTNAKXXXXXXXXXXXXXXXXGEKDGVYQALEIIQKIYEDTKKCSSSLNLPIPKSQHCYVIGAKGSGIAEIFERTGVSIEMPSQDSDDDTIVLYGPNEFLAPALSMVIQKSESMIRVNIEAPNWLHRFIIGKQGSNLNKLMEKYEHVFINFPENSDLIVIEGPKDDVNELKGQITHKIAELKSTMAITEIQVDPRFHRHIIGRSGANIQRMQEEYKVQIRMPGNNAVGTSGWTIRIEGDPEGVKLAKTEIESMSVKLENEKTKDVILDHKYHNQLIGAQGSRVKELRNQYPDVIIMFPDLSSKSDIVQLRGPRQQVDQVAVKLNKFIQEVIENNYTKDVKIFKQYHKNIIGKGGVNIRKIREEMNIRIDFPDEHSDSDKIRLTGKKENVEEAAKRIEAMQAELISIKEDTISIPQRLHISLIGTRGKLIKCIQQECGGVQIQFPASDSNSDIIKIRGPESDVDKAXXXXXXXXXXXXXXXHQDSVSAKSEFHKFLIGRKGAQLAEFRKRHAVMLIFPDSEDTNKDTIQIIGAKEAVQKAKEELEVTIKSLENEIEKYITIDTKWHKHFFKKRQAVMEEISREFGGVRIFFPKQDAVENIDQVRVIGPKGCVEAAVVRIEDIIENLEAQTSLSVFIEQKHHRNLITRNMMEIKSIQSNYDVTIKFPNRDLSSKPGENGME--EIHLNGNGDVNIETMEEVDSTLESEQNNPANWVTISGRKENCESAEDALLELVPITEDVPLANEFHRNFIGQKGQGINTFSTKHNVVVNIPPANKCSDFISIKGPRVNIIDAKAGLDELITMWENEKQDRIARNYENHVTVPIVFHRNIIGQRGANIEIFRTKFNVSIQIPDQ---NSKSEEITIRGYEEDVKKAEEELISMVEKWKAQVKEELHIPRDVHPQLIGTRGIALRKLRDQFKVEINFPNRNVDDEKAHLVEVIGDKENVDKCCDILVERANELLNEWEERNQVREVKNLIKDRENINSSSNIKEKGP--GFLLTGAPW----QQRVPDASSNVDFPKIDA 3926
            Y D FPPLP       +   P     +K R    K S +TQ   VPL ER++ +    N      Q KIC  + Q+ G  +EL S  KDQ L + +SG  D V  A++ +   LQTQ    + +PKE+H+F++G+NG  L+++E  + T + IPR  + ++ I I GTKEGI+KAR E+  I AE+ K A ER+ + K F+PFI G  N  + +I + T  +INIPPPSV   EI+ +GEK+ + QA+  I+KIYE+ KK ++++ + + KSQH YVIG KG+ + EI ERTGVS+E+P  DS  +T++L G  E L  AL+ V  K+ S    ++ AP+WLHRFIIGK+G NL K+ ++   V I F E  D I +EGP +DVN  + QI   + +L + M   EI +D +FHRH+IG+SGANI R++++YKV +R+P ++        IRIEGDP+GV+ AK E+  ++ ++ENE+TKD+I++ ++H  +IG +G R++E+R+++P+VII FPD + KSDIVQLRGP+ +V++    + K + +++EN+Y+  V IFKQ+HKNIIGKGG NI+KIREE N +ID P E+S+S+ I +TGK+ N E A  RI ++Q +L +I E  +SIP +LH SLIGT+G+LI+ I +ECGGV I FP   S SD + IRGP SDV+KAKKQLL L+E+    S    + AK E+HKFLIG+ G ++ + R      +IFP +ED ++D I IIG ++AV++A++ELE  I++L+N +E  + +D K H+HF  +R  V+ EI+ E+GGV + FP+       D+V + G K CVEAA  RI++IIE+LEAQ +L   I QK HR+++      I+ I  ++ V IKFP+R+      EN +   E  +  NGD   E  E  D    S +    + + ISGRKE CE+A++AL  LVP+T +V +  + HR  IGQKG GI     +  V +++P     SD I+I G   N+  AKAGL E +   + E++DR  R+++  VTV   +H  IIG++GA I   R + +V+IQ PD+   N   ++ITI GYE++ + A + ++ +V + +  V E++ +   VH ++IG RG A+RK+ D+FKV+I FP     D   + V V G  ENV++  D ++    E L +  +   ++           +   ++ + K P  GF++  APW     ++ PD SS+ +FP   A
Sbjct:   40 YKDAFPPLPEKAACLESAQEPSGAWGNKIR--PIKASVITQVFHVPLEERKYKDM---NQFGEGEQAKICLEIMQRTGAHLEL-SLAKDQGLSIMVSGKLDAVMKARKDIVARLQTQASATVAIPKEHHRFVIGKNGEKLQDLELKTATKIQIPRPDDPSNQIKITGTKEGIEKARHEVLLISAEQDKRAVERLEVEKAFHPFIAGPYNRLVGEIMQETGTRINIPPPSVNRTEIVFTGEKEQLAQAVARIKKIYEEKKKKTTTIAVEVKKSQHKYVIGPKGNSLQEILERTGVSVEIPPSDSISETVILRGEPEKLGQALTEVYAKANSFTVSSVAAPSWLHRFIIGKKGQNLAKITQQMPKVHIEFTEGEDKITLEGPTEDVNVAQEQIEGMVKDLINRMDYVEINIDHKFHRHLIGKSGANINRIKDQYKVSVRIPPDSEKSN---LIRIEGDPQGVQQAKRELLELASRMENERTKDLIIEQRFHRTIIGQKGERIREIRDKFPEVIINFPDPAQKSDIVQLRGPKNEVEKCTKYMQKMVADLVENSYSISVPIFKQFHKNIIGKGGANIKKIREESNTKIDLPAENSNSETIIITGKRANCEAARSRILSIQKDLANIAEVEVSIPAKLHNSLIGTKGRLIRSIMEECGGVHIHFPVEGSGSDTVVIRGPSSDVEKAKKQLLHLAEEKQTKSFTVDIRAKPEYHKFLIGKGGGKIRKVRDSTGARVIFPAAEDKDQDLITIIGKEDAVREAQKELEALIQNLDNVVEDSMLVDPKHHRHFVIRRGQVLREIAEEYGGVMVSFPRSGT--QSDKVTLKGAKDCVEAAKKRIQEIIEDLEAQVTLECAIPQKFHRSVMGPKGSRIQQITRDFSVQIKFPDRE------ENAVHSTEPVVQENGDEAGEGREAKDCDPGSPRR--CDIIIISGRKEKCEAAKEALEALVPVTIEVEVPFDLHRYVIGQKGSGIRKMMDEFEVNIHVPAPELQSDIIAITGLAANLDRAKAGLLERVKELQAEQEDRALRSFKLSVTVDPKYHPKIIGRKGAVITQIRLEHDVNIQFPDKDDGNQPQDQITITGYEKNTEAARDAILRIVGELEQMVSEDVPLDHRVHARIIGARGKAIRKIMDEFKVDIRFPQSGAPD--PNCVTVTGLPENVEEAIDHILNLEEEYLADVVDSEALQVY---------MKPPAHEEAKAPSRGFVVRDAPWTASSSEKAPDMSSSEEFPSFGA 1255          
BLAST of High density lipoprotein binding protein (Vigilin) vs. UniProt/SwissProt
Match: sp|Q9Z1A6|VIGLN_RAT (Vigilin OS=Rattus norvegicus OX=10116 GN=Hdlbp PE=1 SV=1)

HSP 1 Score: 863.218 bits (2229), Expect = 0.000e+0
Identity = 512/1251 (40.93%), Postives = 775/1251 (61.95%), Query Frame = 3
Query:  243 YDDQFPPLP-------TCNTPKIVQNSKPRIGQTKTSHVTQTLTVPLAERRFSNREANNSVKNDAQKKICQTVAQKCGVSIELNSGNKDQNLMVFISGPQDNVSNAKRILTKEXXXXXXXXMKVPKEYHKFILGRNGASLREIESGSNTNVTIPRSIENNDIITIFGTKEGIDKARAEINQIVAERSKLATERITIPKRFYPFINGSNNSKIYKIREMTNAKXXXXXXXXXXXXXXXXGEKDGVYQALEIIQKIYEDTKKCSSSLNLPIPKSQHCYVIGAKGSGIAEIFERTGVSIEMPSQDSDDDTIVLYGPNEFLAPALSMVIQKSESMIRVNIEAPNWLHRFIIGKQGSNLNKLMEKYEHVFINFPENSDLIVIEGPKDDVNELKGQITHKIAELKSTMAITEIQVDPRFHRHIIGRSGANIQRMQEEYKVQIRMPGNNAVGTSGWTIRIEGDPEGVKLAKTEIESMSVKLENEKTKDVILDHKYHNQLIGAQGSRVKELRNQYPDVIIMFPDLSSKSDIVQLRGPRQQVDQVAVKLNKFIQEVIENNYTKDVKIFKQYHKNIIGKGGVNIRKIREEMNIRIDFPDEHSDSDKIRLTGKKENVEEAAKRIEAMQAELISIKEDTISIPQRLHISLIGTRGKLIKCIQQECGGVQIQFPASDSNSDIIKIRGPESDVDKAXXXXXXXXXXXXXXXHQDSVSAKSEFHKFLIGRKGAQLAEFRKRHAVMLIFPDSEDTNKDTIQIIGAKEAVQKAKEELEVTIKSLENEIEKYITIDTKWHKHFFKKRQAVMEEISREFGGVRIFFPKQDAVENIDQVRVIGPKGCVEAAVVRIEDIIENLEAQTSLSVFIEQKHHRNLITRNMMEIKSIQSNYDVTIKFPNRDLSSKPGENGMEEIH--LNGNGDVNIETMEEVDSTLESEQNNPA-----NWVTISGRKENCESAEDALLELVPITEDVPLANEFHRNFIGQKGQGINTFSTKHNVVVNIPPANKCSDFISIKGPRVNIIDAKAGLDELITMWENEKQDRIARNYENHVTVPIVFHRNIIGQRGANIEIFRTKFNVSIQIPDQ---NSKSEEITIRGYEEDVKKAEEELISMVEKWKAQVKEELHIPRDVHPQLIGTRGIALRKLRDQFKVEINFPNRNVDDEKAHLVEVIGDKENVDKCCDILVERANELLNEWEERNQVREVKNLIKDRENINSSSNIKEKGP--GFLLTGAPW----QQRVPDASSNVDFPKIDA 3926
            Y D FPPLP       +   P    ++K R    K S +TQ   VPL ER++ +    N      Q KIC  + Q+ G  +EL S  KDQ L + +SG  D V  A++ +   LQTQ    + +PKE+H+F++G+NG  L+++E  + T + IPR  + ++ I I GTKEGI+KAR E+  I AE+ K A +R+ + K F+PFI G  N  + +I + T  +INIPPPSV   EI+ +GEK+ + QA+  I+KIYE+ KK ++++ + + KSQH YVIG KG+ + EI ERTGVS+E+P  DS  +T++L G  E L  AL+ V  K+ S    ++ AP+WLHRFIIGK+G NL K+  +   V I F E  D I +EGP +DVN  + QI   + +L + M   EI +D +FHRH+IG+SGANI R++++YKV +R+P ++        IRIEGDP+GV+ AK E+  ++ ++ENE+TKD+I++ ++H  +IG +G R++E+R+++P+VII FPD + KS+IVQLRGP+ +V++    + K + +++EN+Y+  V IFKQ+HKNIIGKGG NI+KIREE N +ID P E+S+S+ I +TGK+ N E A  RI ++Q +L +I E  +SIP +LH SLIGT+G+LI+ I +ECGGV I FP   S SD + IRGP SDV+KAKKQLL L+E+    S    + AK E+HKFLIG+ G ++ + R      +IFP +ED ++D I IIG ++AV++A++ELE  I++L+N +E Y+ +D + H+HF  +R  V+ EI+ E+GGV + FP+       D+V + G K CVEAA  RI++IIE+LEAQ +L   I QK HR+++      I+ I  +Y+V IKFP+R+      EN +  +   +  NGD       E     E+++ +P      + + ISGRKE CE+A++AL  LVP+T +V +  + HR  IGQKG GI     +  V +++P     S  I+I G   N+  AKAGL + +   + E++DR  R+++  VTV   +H  IIG +GA I   R + +V+IQ PD+   N   ++ITI GYE++ + A + ++ +V + +  V E++ +   VH ++IG RG A+RK+ D+FKV+I FP     D   + V V G  ENV++  D ++    E L +  +   ++           +   ++ + K P  GF++  APW     ++ PD SS+ + P   A
Sbjct:   40 YKDAFPPLPEKAACLESAQEPAGAWSNKIR--PIKASVITQVFHVPLEERKYKDM---NQFGEGEQAKICLEIMQRTGAHLEL-SLAKDQGLSIMVSGKLDAVMKARKDIVARLQTQASATVPIPKEHHRFVIGKNGEKLQDLELKTATKIQIPRPDDPSNQIKITGTKEGIEKARHEVLLISAEQDKRAVKRLEVEKAFHPFIAGPYNRLVGEIMQETGTRINIPPPSVNRTEIVFTGEKEQLAQAVARIKKIYEEKKKKTTTIAVEVKKSQHKYVIGPKGNSLQEILERTGVSVEIPPSDSISETVILRGEPEKLGQALTEVYAKANSFTVSSVSAPSWLHRFIIGKKGQNLAKITHQMPKVHIEFTEGEDKITLEGPTEDVNVAQEQIEGMVKDLINRMDYVEINIDHKFHRHLIGKSGANINRIKDQYKVSVRIPPDSEKSN---LIRIEGDPQGVQQAKRELLELASRMENERTKDLIIEQRFHRTIIGQKGERIREIRDKFPEVIINFPDPAQKSEIVQLRGPKNEVEKCTKYMQKMVADLVENSYSISVPIFKQFHKNIIGKGGANIKKIREESNTKIDLPAENSNSETIVITGKRANCEAARSRILSIQKDLANIAEVEVSIPAKLHNSLIGTKGRLIRSIMEECGGVHIHFPVEGSGSDTVVIRGPSSDVEKAKKQLLHLAEEKQTKSFTVDIRAKPEYHKFLIGKGGGKIRKVRDSTGARIIFPAAEDKDQDLITIIGKEDAVREAQKELEALIQNLDNVVEDYMLVDPRHHRHFVIRRGQVLREIAEEYGGVMVSFPRSGT--QSDKVTLKGAKDCVEAAKKRIQEIIEDLEAQVTLECAIPQKFHRSVMGPKGSRIQQITRDYNVQIKFPDRE------ENPVHSVEPSIQENGD-------EAGEGREAKETDPGSPRRCDIIVISGRKEKCEAAKEALEALVPVTIEVEVPFDLHRYIIGQKGSGIRKMMDEFEVNIHVPAPELQSHTIAITGLAANLDRAKAGLLDRVKELQAEQEDRALRSFKLSVTVDPKYHPKIIGGKGAVITQIRLEHDVNIQFPDKDDGNQPQDQITITGYEKNTEAARDAILKIVGELEQMVSEDVPLDHRVHARIIGARGKAIRKIMDEFKVDIRFPQSGAPD--PNCVTVTGLPENVEEAIDHILNLEEEYLADVVDSEALQVY---------MKPPAHEESKAPSKGFVVRDAPWTSNSSEKAPDMSSSEEIPTFGA 1255          
BLAST of High density lipoprotein binding protein (Vigilin) vs. UniProt/SwissProt
Match: sp|Q5R439|VIGLN_PONAB (Vigilin OS=Pongo abelii OX=9601 GN=HDLBP PE=2 SV=1)

HSP 1 Score: 855.899 bits (2210), Expect = 0.000e+0
Identity = 518/1244 (41.64%), Postives = 774/1244 (62.22%), Query Frame = 3
Query:  243 YDDQFPPLP-------TCNTPKIVQNSKPRIGQTKTSHVTQTLTVPLAERRFSNREANNSVKNDAQKKICQTVAQKCGVSIELNSGNKDQNLMVFISGPQDNVSNAKRILTKEXXXXXXXXMKVPKEYHKFILGRNGASLREIESGSNTNVTIPRSIENNDIITIFGTKEGIDKARAEINQIVAERSKLATERITIPKRFYPFINGSNNSKIYKIREMTNAKXXXXXXXXXXXXXXXXGEKDGVYQALEIIQKIYEDTKKCSSSLNLPIPKSQHCYVIGAKGSGIAEIFERTGVSIEMPSQDSDDDTIVLYGPNEFLAPALSMVIQKSESMIRVNIEAPNWLHRFIIGKQGSNLNKLMEKYEHVFINFPENSDLIVIEGPKDDVNELKGQITHKIAELKSTMAITEIQVDPRFHRHIIGRSGANIQRMQEEYKVQIRMPGNNAVGTSGWTIRIEGDPEGVKLAKTEIESMSVKLENEKTKDVILDHKYHNQLIGAQGSRVKELRNQYPDVIIMFPDLSSKSDIVQLRGPRQQVDQVAVKLNKFIQEVIENNYTKDVKIFKQYHKNIIGKGGVNIRKIREEMNIRIDFPDEHSDSDKIRLTGKKENVEEAAKRIEAMQAELISIKEDTISIPQRLHISLIGTRGKLIKCIQQECGGVQIQFPASDSNSDIIKIRGPESDVDKAXXXXXXXXXXXXXXXHQDSVSAKSEFHKFLIGRKGAQLAEFRKRHAVMLIFPDSEDTNKDTIQIIGAKEAVQKAKEELEVTIKSLENEIEKYITIDTKWHKHFFKKRQAVMEEISREFGGVRIFFPKQDAVENIDQVRVIGPKGCVEAAVVRIEDIIENLEAQTSLSVFIEQKHHRNLITRNMMEIKSIQSNYDVTIKFPNRDLSSKPGENGME--EIHLNGNGDVNIETMEEVDSTLESEQNNPANWVTISGRKENCESAEDALLELVPITEDVPLANEFHRNFIGQKGQGINTFSTKHNVVVNIPPANKCSDFISIKGPRVNIIDAKAGLDELITMWENEKQDRIARNYENHVTVPIVFHRNIIGQRGANIEIFRTKFNVSIQIPDQ---NSKSEEITIRGYEEDVKKAEEELISMVEKWKAQVKEELHIPRDVHPQLIGTRGIALRKLRDQFKVEINFPNRNVDDEKAHLVEVIGDKENVDKCCDILVERANELLNEWEERNQVREVKNLIKDRENINSSSNIKEKGPGFLLTGAPW----QQRVPDASSNVDFPKIDA 3926
            Y D FPPLP       +   P     +K R    K S +TQ   VPL ER++ +    N      Q KIC  + Q+ G  +EL S  KDQ L + +SG  D V  A++ +   LQTQ    + +PKE+H+F++G+NG  L+++E  + T + IPR  + ++ I I GTKEGI+KAR E+  I AE+ + A ER+ + K F+PFI G  N  + +I + T  +INIPPPSV   EI+ +GEK+ + QA+  I+KIYE+ KK ++++ + + KSQH YVIG KG+ + EI ERTGVS+E+P  DS  +T++L G  E L  AL+ V  K+ S    ++ AP+WLHRFIIGK+G NL K+ ++   V I F E  D I +EGP +DV+  +  I   + +L + M   EI +D +FHRH+IG+SGANI R++++YKV +R+P ++        IRIEGDP+GV+ AK E+  ++ ++ENE+TKD+I++ ++H  +IG +G R++E+R+++P+VII FPD + KSDIVQLRGP+ +V++    + K + +++EN+Y+  V IFKQ+HKNIIGKGG NI+KIREE N +ID P E+S+S+ I +TGK+ N E A  RI ++Q +L +I E  +SIP +LH SLIGT+G+LI+ I +ECGGV I FP   S SD + IRGP SDV+KAKKQLL L+E+    S    + AK E+HKFLIG+ G ++ + R      +IFP +ED ++D I IIG ++AV++A++ELE  I++L+N +E  + +D K H+HF  +R  V+ EI+ E+GGV + FP+       D+V + G KGCVEAA  RI++IIE+LEAQ +L   I QK HR+++      I+ I  ++ V IKFP+R+      EN +   E  +  NGD   E  E  DS   S +    + + ISGRKE CE+A++AL  LVP+T +V +  + HR  IGQKG GI     +  V +++P     SD I+I G   N+  AKAGL E +   + E++DR  R+++  VTV   +H  IIG++GA I   R + +V+IQ PD+   N   ++ITI GYE++ + A + ++ +V + +  V E++ +   VH ++IG RG A+RK+ D+FKV+I FP     D   + V V G  ENV++  D ++    E L +  + ++  +V       E   + S       GF++  APW     ++ PD SS+ +FP   A
Sbjct:   40 YKDAFPPLPEKAACLESAQEPAGAWGNKIR--PIKASVITQVFHVPLEERKYKDM---NQFGEGEQAKICLEIMQRTGAHLEL-SLAKDQGLSIMVSGKLDAVMKARKDIVARLQTQASATVAIPKEHHRFVIGKNGEKLQDLELKTATKIQIPRPDDPSNQIKITGTKEGIEKARHEVLLISAEQDERAVERLEVEKAFHPFIAGPYNRLVGEIMQETGTRINIPPPSVNRTEIVFTGEKEQLAQAVARIKKIYEEKKKKTTTIAVEVKKSQHKYVIGPKGNSLQEILERTGVSVEIPPSDSISETVILRGEPEKLGQALTEVYAKANSFTVSSVAAPSWLHRFIIGKKGQNLAKITQQMPKVHIEFTEGEDKITLEGPTEDVSVTQEHIEGMVKDLINRMDYVEINIDHKFHRHLIGKSGANINRIKDQYKVSVRIPPDSEKSN---LIRIEGDPQGVQQAKRELLELASRMENERTKDLIIEQRFHRTIIGQKGERIREIRDKFPEVIINFPDPAQKSDIVQLRGPKNEVEKCTKYMQKMVADLVENSYSISVPIFKQFHKNIIGKGGANIKKIREESNTKIDLPAENSNSETIIITGKRANCEAARSRILSIQKDLANIAEVEVSIPAKLHNSLIGTKGRLIRSIMEECGGVHIHFPVEGSGSDTVVIRGPSSDVEKAKKQLLHLAEEKQTKSFTVDIRAKPEYHKFLIGKGGGKIRKVRDSTGARVIFPAAEDKDQDLITIIGKEDAVREAQKELEALIQNLDNVVEDSMLVDPKHHRHFVIRRGQVLREIAEEYGGVMVSFPRSGT--QSDKVTLKGAKGCVEAAKKRIQEIIEDLEAQVTLECAIPQKFHRSVMGPKGSRIQQITRDFSVQIKFPDRE------ENPVHSTEPAVQENGDEAGEGREAKDSDPGSPRR--CDIIIISGRKEKCEAAKEALEALVPVTVEVEVPFDLHRYVIGQKGSGIRKMMDEFEVNIHVPAPELQSDIIAITGLAANLDRAKAGLLERVKELQAEQEDRALRSFKLSVTVDPKYHPKIIGRKGAVITQIRLEHDVNIQFPDKGDGNQPQDQITITGYEKNTEAARDAILRIVGELEQMVSEDVPLDHRVHARIIGARGKAIRKIMDEFKVDIRFPQSGAPD--PNCVTVTGLPENVEEAIDHILNLEEEYLADVVD-SEALQVYMKPPVHEEAKAPSR------GFVVRDAPWAASSSEKAPDMSSSEEFPSFGA 1255          
BLAST of High density lipoprotein binding protein (Vigilin) vs. UniProt/SwissProt
Match: sp|P81021|VIGLN_CHICK (Vigilin OS=Gallus gallus OX=9031 GN=HDLBP PE=2 SV=1)

HSP 1 Score: 815.453 bits (2105), Expect = 0.000e+0
Identity = 494/1247 (39.62%), Postives = 756/1247 (60.63%), Query Frame = 3
Query:  243 YDDQFPPLPTCNTPKIVQNSKP-----RIGQTKTSHVTQTLTVPLAERRFSNREANNSVKNDAQKKICQTVAQKCGVSIELNSGNKDQNLMVFISGPQDNVSNAKRILTKEXXXXXXXXMKVPKEYHKFILGRNGASLREIESGSNTNVTIPRSIENNDIITIFGTKEGIDKARAEINQIVAERSKLATERITIPKRFYPFINGSNNSKIYKIREMTNAKXXXXXXXXXXXXXXXXGEKDGVYQALEIIQKIYEDTKKCSSSLNLPIPKSQHCYVIGAKGSGIAEIFERTGVSIEMPSQDSDDDTIVLYGPNEFLAPALSMVIQKSESMIRVNIEAPNWLHRFIIGKQGSNLNKLMEKYEHVFINFPENSDLIVIEGPKDDVNELKGQITHKIAELKSTMAITEIQVDPRFHRHIIGRSGANIQRMQEEYKVQIRMPGNNAVGTSGWTIRIEGDPEGVKLAKTEIESMSVKLENEKTKDVILDHKYHNQLIGAQGSRVKELRNQYPDVIIMFPDLSSKSDIVQLRGPRQQVDQVAVKLNKFIQEVIENNYTKDVKIFKQYHKNIIGKGGVNIRKIREEMNIRIDFPDEHSDSDKIRLT-GKKENVEEAAKRIEAMQAELISIKEDTISIPQRLHISLIGTRGKLIKCIQQECGGVQIQFPASDSNSDIIKIRGPESDVDKAXXXXXXXXXXXXXXXHQDSVSAKSEFHKFLIGRKGAQLAEFRKRHAVMLIFPDSEDTNKDTIQIIGAKEAVQKAKEELEVTIKSLENEIEKYITIDTKWHKHFFKKRQAVMEEISREFGGVRIFFPKQDAVENIDQVRVIGPKGCVEAAVVRIEDIIENLEAQTSLSVFIEQKHHRNLITRNMMEIKSIQSNYDVTIKFPNRDLSSKP-GENGMEEIHLNGNGDVNIETMEEVDSTLESEQNNP--ANWVTISGRKENCESAEDALLELVPITEDVPLANEFHRNFIGQKGQGINTFSTKHNVVVNIP-PANKCSDFISIKGPRVNIIDAKAGLDELITMWENEKQDRIARNYENHVTVPIVFHRNIIGQRGANIEIFRTKFNVSIQIPDQNSKSE---EITIRGYEEDVKKAEEELISMVEKWKAQVKEELHIPRDVHPQLIGTRGIALRKLRDQFKVEINFPNRNVDDEKAHLVEVIGDKENVDKCCDILVERANELLNEWEERNQVREVKNLIKDRENINSSSNIKEKGP--GFLLTGAPW----QQRVPDASSNVDFPKIDA 3926
            Y + FPPLP    P +    +P     +I   K S +TQ   VPL ER++ +    N      Q KIC  + QK G  +EL S  KDQ L + +SG  + V  A++ +   LQTQ    + +PKE+H+F++G+NG  L+++E  + T + IPR  + ++ I I GTKEGI+KAR EI  I AE+ K A ER+ + K ++PFI G  N  + ++ + T  +INIPPPSV   EI+ +GEK+ + QA+  ++KIYE+ KK ++++ + + KSQH YVIG KG+ + EI E+TGVS+E+P  DS  +T++L G  E L  AL+ V  K+ S    ++ AP+WLHRFIIG  G NL K+ ++   + I F E  D I  EGP +DVN  + QI   + +L +     EI VD +FHRH+IG++GANI R+++ YKV +R+P +N        IRIEGDP+GV+ AK E+  ++ ++ENE+TKD+I++ K+H  +IG +G R++E+R ++P+VII FPD + KSDIVQLRGP+ +V++    + K + +++EN+++  V IFKQ+HKNIIGKGG NI+KIREE N +ID P     + +  L+ G+++ V+    RI A+Q EL +I E  +SIP +LH SLIG +G+ I+ I +ECGGV I FP   S S  + IR       K +      +E+    S+   + AK E+HKFLIG+ G  + + R      +IFP SED +++ I I+G +EAV++A++ELE  IK+L+N +E  + +D K H+HF  +R  V+ EI+ E+GGV +  P     ++ D+V + G K CVEAA  RI++IIE+LEAQ ++   I QK HR+++      I+ I  +Y V IKFP+R+ +  P  E  ++E         N E   E     +++ ++P   + + ISGR+E CE+A++AL  LVP+T +V +  + HR  IGQKG GI     +  V + +P P  + SD I+I G   N+  AKAGL E +   + E++DR  R+++  VTV   +H  IIG++GA I   RT+  V+IQ PD++ +S+   +ITI GYE++ + A + ++ +V + +  V E++ +   VH ++IG RG A+RK+ D+FKV+I FP     D   + V V G  ENV++  D ++    E L +  + N+  +V         +  SS+ + K P  GF++  AP      ++ PD SS+ DFP   A
Sbjct:   40 YKEAFPPLPE-KAPCLEAAQEPSGPWSKIRPIKASVITQVFHVPLEERKYKDM---NQFGEGEQAKICLDIMQKTGAHLEL-SLAKDQGLSIMVSGKLEAVMKARKEIVARLQTQASATVAIPKEHHRFVIGKNGEKLQDLELKTATKIQIPRPDDPSNQIKITGTKEGIEKARHEILLISAEQDKRAVERLDVEKVYHPFIAGPYNKLVSELMQDTGTRINIPPPSVNKTEIVFTGEKEQLAQAVARVKKIYEEKKKKTTTIAVEVKKSQHKYVIGRKGNSLQEILEKTGVSVEIPPTDSSSETVILRGEPEKLGQALTEVYAKANSFTVSSVSAPSWLHRFIIGLFGQNLAKITQQMPKIHIEFTEGEDKITSEGPTEDVNVAQEQIEVMVKDLINRTDYAEINVDHKFHRHLIGKNGANINRIKDLYKVSVRIPPDNEKSN---LIRIEGDPQGVQQAKKELLELASRMENERTKDLIIEQKFHRTIIGQKGERIREIREKFPEVIINFPDPAHKSDIVQLRGPKNEVEKCTKYMQKMVADLVENSFSISVPIFKQFHKNIIGKGGANIKKIREESNTKIDLPGREQATQRQLLSQGREQTVKLLRHRILAIQKELANITEVEVSIPSKLHNSLIGAKGRFIRSIMEECGGVHIHFPTEGSGSATVTIRAQPRTWRKPRSSCCTWAEEKQTKSYTVDLRAKPEYHKFLIGKGGGNIRKVRDNTGARIIFPTSEDKDQELITIMGTEEAVKEAQKELEALIKNLDNVVEDSMVVDPKHHRHFVIRRGQVLREIADEYGGVMVRLPTVSGTQS-DKVTLKGAKDCVEAAKKRIQEIIEDLEAQVTIECTIPQKFHRSIMGPKGSRIQQITRDYGVQIKFPDREENPAPVAEPALQE---------NGEEGGEGKDGKDADPSSPRKCDIIIISGRREKCEAAKEALQALVPVTIEVEVPFDLHRYIIGQKGSGIRKMMDEFEVNIQVPAPELQSSDIITITGLAANLDRAKAGLLERVKELQAEQEDRALRSFKLTVTVDPKYHPKIIGRKGAVITQIRTEHEVNIQFPDKDDESQAQDQITITGYEKNAEAARDAIMKIVGELEQMVSEDVTLDHRVHARIIGARGKAIRKIMDEFKVDIRFPQSGAPD--PNCVTVTGLPENVEEAIDHILNLEEEYLADVVD-NEAMQV--------YMKPSSHEESKVPSKGFVVRDAPCGTVNNEKAPDMSSSEDFPSFGA 1257          
BLAST of High density lipoprotein binding protein (Vigilin) vs. TrEMBL
Match: A0A1S3I7W9 (vigilin OS=Lingula unguis OX=7574 GN=LOC106161524 PE=4 SV=1)

HSP 1 Score: 931.398 bits (2406), Expect = 0.000e+0
Identity = 515/1237 (41.63%), Postives = 789/1237 (63.78%), Query Frame = 3
Query:  243 YDDQFPPLPTCNTPKI-VQNSKPRIGQ--------TKTSHVTQTLTVPLAERRFSNREANNSVKNDAQKKICQTVAQKCGVSIELNSGNKDQNLMVFISGPQDNVSNAKRILTKEXXXXXXXXMKVPKEYHKFILGRNGASLREIESGSNTNVTIPRSIENNDIITIFGTKEGIDKARAEINQIVAERSKLATERITIPKRFYPFINGSNNSKIYKIREMTNAKXXXXXXXXXXXXXXXXGEKDGVYQALEIIQKIYEDTKKCSSSLNLPIPKSQHCYVIGAKGSGIAEIFERTGVSIEMPSQDSDDDTIVLYGPNEFLAPALSMVIQKSESMIRVNIEAPNWLHRFIIGKQGSNLNKLMEKYEHVFINFPENSDLIVIEGPKDDVNELKGQITHKIAELKSTMAITEIQVDPRFHRHIIGRSGANIQRMQEEYKVQIRMPGNNAVGTSGWTIRIEGDPEGVKLAKTEIESMSVKLENEKTKDVILDHKYHNQLIGAQGSRVKELRNQYPDVIIMFPDLSSKSDIVQLRGPRQQVDQVAVKLNKFIQEVIENNYTKDVKIFKQYHKNIIGKGGVNIRKIREEMNIRIDFPDEHSDSDKIRLTGKKENVEEAAKRIEAMQAELISIKEDTISIPQRLHISLIGTRGKLIKCIQQECGGVQIQFPASDSNSDIIKIRGPESDVDKAXXXXXXXXXXXXXXXHQDSVSAKSEFHKFLIGRKGAQLAEFRKRHAVMLIFPDSEDTNKDTIQIIGAKEAVQKAKEELEVTIKSLENEIEKYITIDTKWHKHFFKKRQAVMEEISREFGGVRIFFPKQDAVENIDQVRVIGPKGCVEAAVVRIEDIIENLEAQTSLSVFIEQKHHRNLITRNMMEIKSIQSNYDVTIKFPNRDLSSKPGEN-GMEEIHLNGNGDVNIETMEEVDSTLESEQNNPA--NWVTISGRKENCESAEDALLELVPITEDVPLANEFHRNFIGQKGQGINTFSTKHNVVVNIPPANKCSDFISIKGPRVNIIDAKAGLDELITMWENEKQDRIARNYENHVTVPIVFHRNIIGQRGANIEIFRTKFNVSIQIPDQNSKSEE-ITIRGYEEDVKKAEEELISMVEKWKAQVKEELHIPRDVHPQLIGTRGIALRKLRDQFKVEINFPNRNVDDEKAHLVEVIGDKENVDKCCDILVERANELLNEWEERNQVREVKNLIKDRENINSSSNIKEKGPGFLLTGAPWQQRVPDASSNVDFP 3914
            Y + FPPL    +P+     S P   Q         +TS  TQ   VPL ERRF     +   +   Q KIC+ + QK GV+IE+ S  KDQ+L V I+G  +NV  A+R++  +LQTQ  + MK+P+E+H+FILG++G  L+E+E  + T +TIPR  EN+D+I I GTKEGIDKAR E+  I  E++KLA ER+ I K ++PFI G NN+ + ++++ T A+I++PPPSV  +EI++SGEK+GV++A   I KIYE+ K+   ++++ + KSQH YVIG +   + EI + TGVS+E+P  DS  +TI L G  + L PAL+MV  K+ S++   + AP WLHRFIIG+QG+ + K+ +    V I F E  D IVIEGP D+V + +  +     +L++ MA  E+ V+ ++H+HIIG++GANI R++ +  V IR+P ++        IRIEGDP+GV+ AK E+  M  K+ENE++KD++++ ++H  +IGA+G ++KE+R+++  V I FPD   KS+IV LRGP+  V++    L +  QE+I  NY  +V IFKQ+HKNIIGKGG  I+KIREE + RID P E SDSD I +TGK++NVE A  +IEA+Q EL +IKE TI IP + H S+IG +G+LI+ I ++CGGV ++FP     SD + +RGP+ DV+KAKK+LL L+++         + AK +FHKFLIGR GA + + R+     +IFP S+D +++TI IIG +E+V  AK ELE  IK LEN +E  I++D K+H+HF  +R  V+  I+ ++GGV + FP+       D+V + G K C+E A  RI +I+  LE+Q ++   I Q++HR ++      ++ +  +++V IKFP+R  ++  G+  G  +  +NG+ DVN +T  +     E +Q+ P   + + I+G+KE+CE+A++AL+ LVPITE+V +  +FHR  IGQ+G+ +     + +V ++IPPA+  SD + + GPR N+  A  GL+  +   E EK+DR  +N+   V V   +H  IIG+RGA I   R  F+V+IQ PD+ S++++ ITI GYE+  K+A++E++ +V +    + EE+++   VH ++IG +G  +RK+ D +KV+I FP R+ D++   LV + G ++NV    D L     E L +  +R  +R+  +  K  +    S   +  GPGF +  APW ++ P+  S  DFP
Sbjct:   28 YYEAFPPLSEGESPRAGASASTPAAAQWGPTNKMMLRTSTTTQVFRVPLEERRFQEINEHGFGEAGEQAKICKDIMQKTGVAIEM-SLAKDQSLTVVITGKIENVMKARRMVVNQLQTQANVTMKIPREHHRFILGKSGKKLQELELNTTTKITIPRPEENSDVIRIVGTKEGIDKARHELQLITDEQAKLAFERLPIAKIYHPFICGPNNALMKELQDKTGARIHVPPPSVMKDEIVVSGEKEGVHEAKATIMKIYEEKKRKCQTVSVEVRKSQHKYVIGPRAGALNEILQATGVSVEVPPLDSPSETITLRGEQDKLGPALTMVYSKANSVVIAEVVAPAWLHRFIIGRQGATIRKITQDLPKVHIEFTEGQDKIVIEGPPDEVEQAQKALGEITQDLQTRMAYAELDVNQKYHKHIIGKNGANITRIKNDTGVAIRIPSDS---EGSRIIRIEGDPKGVEKAKAELMEMVEKMENERSKDIMIEQRFHRTIIGAKGDKIKEVRDKFNQVQITFPDPGKKSNIVTLRGPKNDVEKCYKYLQQMHQELIAVNYQAEVHIFKQFHKNIIGKGGATIKKIREETDTRIDLPSEASDSDVIVITGKRQNVETAKAKIEAIQKELANIKEITIEIPHKHHNSIIGAKGRLIRSIMEDCGGVIVRFPPEGGKSDKVVLRGPKDDVEKAKKELLALADERQTHGFTAEIKAKPDFHKFLIGRNGANIRKVRESTGARVIFPTSKDADQETISIIGTEESVSTAKTELEAMIKELENVVEGEISVDPKYHRHFVARRGEVLHTIAADYGGVSVSFPRSGM--KSDKVVLKGAKDCIEGAKKRIAEIVAELESQVTIECVIPQQYHRTVMGTKGSRVQEVTKDHNVGIKFPDRPQANGAGDGKGNAKPQVNGDVDVNGDTHVDGAGDAEHDQDKPKKQDIILITGKKEDCEAAKEALMALVPITEEVNVPFDFHRFIIGQRGRDVRKMMEEFDVNISIPPADNRSDIVKVTGPRANVARAVEGLNARVEELEKEKEDRALKNFSLEVRVDPAYHPKIIGRRGAVISKIRDAFDVNIQFPDKGSENQDVITITGYEKSAKEAKDEIMKLVGELDNMITEEVNLDHRVHSRIIGQKGRQVRKIMDDYKVDIKFP-RSSDNDNPDLVVITGMEDNVLDAKDYLQNLEEEYLQDVLDRESMRQYMHPSKQEQ----SHPKQNHGPGFQVRDAPWDKQAPNMESTEDFP 1253          
BLAST of High density lipoprotein binding protein (Vigilin) vs. TrEMBL
Match: R7UX93 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_157303 PE=4 SV=1)

HSP 1 Score: 908.286 bits (2346), Expect = 0.000e+0
Identity = 520/1250 (41.60%), Postives = 768/1250 (61.44%), Query Frame = 3
Query:  243 YDDQFPPLPT------------CNTPKIVQNSKPRIGQTK----TSHVTQTLTVPLAERRFSN-REANNSVKNDAQKKICQTVAQKCGVSIELNSGNKDQNLMVFISGPQDNVSNAKRILTKEXXXXXXXXMKVPKEYHKFILGRNGASLREIESGSNTNVTIPRSIENNDIITIFGTKEGIDKARAEINQIVAERSKLATERITIPKRFYPFINGSNNSKIYKIREMTNAKXXXXXXXXXXXXXXXXGEKDGVYQALEIIQKIYEDTKKCSSSLNLPIPKSQHCYVIGAKGSGIAEIFERTGVSIEMPSQDSDDDTIVLYGPNEFLAPALSMVIQKSESMIRVNIEAPNWLHRFIIGKQGSNLNKLMEKYEHVFINFPENSDLIVIEGPKDDVNELKGQITHKIAELKSTMAITEIQVDPRFHRHIIGRSGANIQRMQEEYKVQIRMPGNNAVGTSGWTIRIEGDPEGVKLAKTEIESMSVKLENEKTKDVILDHKYHNQLIGAQGSRVKELRNQYPDVIIMFPDLSSKSDIVQLRGPRQQVDQVAVKLNKFIQEVIENNYTKDVKIFKQYHKNIIGKGGVNIRKIREEMNIRIDFPDEHSDSDKIRLTGKKENVEEAAKRIEAMQAELISIKEDTISIPQRLHISLIGTRGKLIKCIQQECGGVQIQFPASDSNSDIIKIRGPESDVDKAXXXXXXXXXXXXXXXHQDSVSAKSEFHKFLIGRKGAQLAEFRKRHAVMLIFPDSEDTNKDTIQIIGAKEAVQKAKEELEVTIKSLENEIEKYITIDTKWHKHFFKKRQAVMEEISREFGGVRIFFPKQDAVENIDQVRVIGPKGCVEAAVVRIEDIIENLEAQTSLSVFIEQKHHRNLITRNMMEIKSIQSNYDVTIKFPNRDLSSKPGENGMEEIH----LNGNGDVNIETMEEVDSTLESEQNNPANWVTISGRKENCESAEDALLELVPITEDVPLANEFHRNFIGQKGQGINTFSTKHNVVVNIPPANKCSDFISIKGPRVNIIDAKAGLDELITMWENEKQDRIARNYENHVTVPIVFHRNIIGQRGANIEIFRTKFNVSIQIPDQNSKSEE-ITIRGYEEDVKKAEEELISMVEKWKAQVKEELHIPRDVHPQLIGTRGIALRKLRDQFKVEINFPNRNVDDEKAHLVEVIGDKENVDKCCDILVERANELLNEWEERNQVREVKNLIKDRENINSSSNIKEKGPGFLLTGAPWQQRVPDASSNVDFPKIDA 3926
            Y + FPPL T              +P   QN+ P  G +K    +S+ TQ   VPL ERR+    E     K   Q  IC  +  K GV+IE+ S  KDQ+L V I+G  +NV  A++ + ++LQTQ   Q+K+PKE+H+++LG  G  L ++E  + + ++IPR  EN+D++TI GT++GI++AR EI  I  E++KLA ER++IPK ++ FING  N       E T A+I++PPP V   E+++SGEK+GV+  +  I KIYE+ ++   ++++ + KSQH YVIG +GS + EI   TGV++E+P  DS  +TI L G  E L PAL+MV  K+ S++  +++AP WLHRFIIGK+G+ + K+ + +  V I F E  D I +EGP  +V + +  +   I +L S MA  E+ VDP++HRHIIG++GAN+ R++ E  V IR+P +    +    IRIEG PEGV  AK E+  M  K+ENEK++D+I+D ++H  LIGAQG R++E+R+++  V+I FPD   KSD+V LRGPR  VD+    L +   E++ENNY  +V IFKQ+HKNIIGKGG NIRKIR+E + RID P E + SD I +TGKKENVE A + IE +Q EL +IKE +I IP + H S+IG +G+LI+ I +ECGGV I+FP   S SD + IRGP  DV+KA+KQL+EL+ +     H   + AK  +HKFLIGR G  + E R R    +IFP S D +++TI I+G +E+V +AK ELE  IK L+N +E  I +D K H++F  +R  V+ +I+ E+GGV + FP+       D+V + G K CVE A  RI +I+ +L++Q S+   I QK HR ++      ++ I   ++V +KFP+R   S+P    +E       +NG+       +E   S L++        + I+G++ NC  A DALL LVPITE++ +  +FHR  IGQ+G+ +      ++V ++IPPA   S+ + I GP  N+  AK  +DE +   ENE++DR  RN++  + V   +H  IIG+RGA I   R    V+IQ P++NS+S++ ITI GYE + + A+ +++ +V+     + EE+ +   VHP+LIG RG A+RK+ D +KV+I FP    D+    LV + G ++NV  C D L+    E + +  E N++ +       RE+ N   N    G GF++  APW    PD SS  DFP + A
Sbjct:   30 YAEAFPPLRTPVAEPTNGERADTTSP---QNNTP-WGASKMSVRSSNTTQVFCVPLEERRYKEMTEQQFGKKGGQQVSICSDIMAKTGVAIEM-SMAKDQSLTVVITGKVENVMKARKFVVQQLQTQAHDQVKIPKEHHRYLLGPKGKKLADLELKTASKISIPRLEENSDMVTITGTRDGIERARHEIQLISDEQAKLAFERLSIPKEYHVFINGPENINTKTWMEQTGARISVPPPFVMKNEVVVSGEKEGVHICVNNINKIYEEKRRTCQTVSVEVRKSQHKYVIGPRGSNLDEILSNTGVAVEVPPLDSTSETITLRGEQEKLGPALTMVYSKANSVVIKDVKAPTWLHRFIIGKKGATVRKITQDFPKVHIEFTEGEDKISVEGPPSEVEQARVALEAIINDLLSRMAFVELNVDPKYHRHIIGKAGANVVRIKNETGVSIRVPADTDQSS---IIRIEGSPEGVARAKQELMEMVNKMENEKSRDIIIDQRFHRTLIGAQGGRIREIRDRFNQVVITFPDQGRKSDVVTLRGPRNDVDKCHRYLQQASAEMLENNYCSEVHIFKQFHKNIIGKGGANIRKIRDETDTRIDLPSESNTSDVIAITGKKENVENAKRMIEDIQKELANIKEVSIDIPHKFHNSIIGAKGRLIRSIMEECGGVIIRFPPEGSTSDKVIIRGPTDDVEKARKQLVELANERKESGHTVEIQAKPAYHKFLIGRGGTNIREVRDRTGARIIFPTSGDQDQETITILGKQESVDQAKAELEARIKDLDNVVEMEINVDPKHHRYFVARRGGVLRQIADEYGGVTVSFPRSGVAS--DRVVLKGSKDCVEGARNRILEIVADLDSQVSIECVIPQKFHRTVMGSKGYRVQEITREFEVGVKFPDR--PSEPDAAAVEAEAETPLVNGDAAAPTAPVENGTSKLDT--------IIITGKEANCNQARDALLALVPITEEMMVPFDFHRFVIGQRGKDVRKMMDDYDVNISIPPAEDQSNMVKITGPAANVERAKVAMDERVKQLENEREDRELRNFKLELHVEPAYHPKIIGRRGAVISKIRDAHEVNIQFPEKNSESQDLITITGYESNAEAAKIDILKIVQDLDDMITEEVTLDTRVHPRLIGQRGRAIRKVMDDYKVDIKFPRPESDN--PELVMITGSEDNVLDCKDHLLNLEEEYMQDVSE-NEMMQQYLRPASRED-NGQRNRSGHGHGFMVRNAPWSAAAPDTSSTADFPGLGA 1255          
BLAST of High density lipoprotein binding protein (Vigilin) vs. TrEMBL
Match: A0A401SU17 (Uncharacterized protein OS=Chiloscyllium punctatum OX=137246 GN=chiPu_0012343 PE=4 SV=1)

HSP 1 Score: 900.968 bits (2327), Expect = 0.000e+0
Identity = 517/1241 (41.66%), Postives = 792/1241 (63.82%), Query Frame = 3
Query:  231 LVLQYDDQFPPLPTCNTPKIVQNSKP-----RIGQTKTSHVTQTLTVPLAERRFSNREANNSVKNDAQKKICQTVAQKCGVSIELNSGNKDQNLMVFISGPQDNVSNAKRILTKEXXXXXXXXMKVPKEYHKFILGRNGASLREIESGSNTNVTIPRSIENNDIITIFGTKEGIDKARAEINQIVAERSKLATERITIPKRFYPFINGSNNSKIYKIREMTNAKXXXXXXXXXXXXXXXXGEKDGVYQALEIIQKIYEDTKKCSSSLNLPIPKSQHCYVIGAKGSGIAEIFERTGVSIEMPSQDSDDDTIVLYGPNEFLAPALSMVIQKSESMIRVNIEAPNWLHRFIIGKQGSNLNKLMEKYEHVFINFPENSDLIVIEGPKDDVNELKGQITHKIAELKSTMAITEIQVDPRFHRHIIGRSGANIQRMQEEYKVQIRMPGNNAVGTSGWTIRIEGDPEGVKLAKTEIESMSVKLENEKTKDVILDHKYHNQLIGAQGSRVKELRNQYPDVIIMFPDLSSKSDIVQLRGPRQQVDQVAVKLNKFIQEVIENNYTKDVKIFKQYHKNIIGKGGVNIRKIREEMNIRIDFPDEHSDSDKIRLTGKKENVEEAAKRIEAMQAELISIKEDTISIPQRLHISLIGTRGKLIKCIQQECGGVQIQFPASDSNSDIIKIRGPESDVDKAXXXXXXXXXXXXXXXHQDSVSAKSEFHKFLIGRKGAQLAEFRKRHAVMLIFPDSEDTNKDTIQIIGAKEAVQKAKEELEVTIKSLENEIEKYITIDTKWHKHFFKKRQAVMEEISREFGGVRIFFPKQDAVENIDQVRVIGPKGCVEAAVVRIEDIIENLEAQTSLSVFIEQKHHRNLITRNMMEIKSIQSNYDVTIKFPNRDLSSKPGENGMEEIHLNGNGDVNIETMEEVDSTLESEQNNPANWVTISGRKENCESAEDALLELVPITEDVPLANEFHRNFIGQKGQGINTFSTKHNVVVNIPPANKCSDFISIKGPRVNIIDAKAGLDELITMWENEKQDRIARNYENHVTVPIVFHRNIIGQRGANIEIFRTKFNVSIQIPDQNSKSE-EITIRGYEEDVKKAEEELISMVEKWKAQVKEELHIPRDVHPQLIGTRGIALRKLRDQFKVEINFPNRNVDDEKAHLVEVIGDKENVDKCCDILVERANELLNEWEERNQVREVKNLIKDRENINSSSNIKEKGPGFLLTGAPW---QQRVPDASSNVDFPKIDA 3926
            LV  Y + FPPLP   TP     ++P     +I   K+S +TQ   VPL ER++  +E     + D Q KIC  + QK G  IEL S  KDQ L + +SG  + V  A++ +  +LQTQ    + +PKE+H+F++G++G  L+E+E  + T + IPR  + ++ I I GTKEGI+KAR EI  I AE+ K A ERI I K ++PFI G  N    ++ + T  +INIPPPSV   EI+I+GEK+ V QA+  I++IYED KK ++++ + + KSQH YVIG KG+ + EI ERTGVS+E+P  DS+ +T++L G  + L  AL+ V  K+ S    ++ AP+WLHRFIIGK+G NL+++ ++   V+I F +  D I +EGP  +V +++ QI   + +L + M  TE+ VDP+FHRH+IG++G NI R++++YKV +R+P +N        IRIEGDP+GV+ AK E+  ++ ++ENE++KD+I++H++H  +IG +G +VKE+R+++P+V+I FPD S KSDIVQLRGP+ +V++ A  L K + E++EN+Y+  V IFKQ+HKNIIGKGG NI+KIREE N +ID P E+S+S+ I +TGKK N E A  RI A+Q EL +I E  + IP +LH SLIG +G+ ++ I +ECGGV I FP   S SD + IRG   +VDKAKKQLL L+E+  + ++   + AK E+HKFLIGR GA + + R      +IFP ++D +++ I I+G +EAV++A++ELEV I +L+N IE  +T+D K H++F  +R  V+ EI+ E+GGV + FP+       D+V + G K CVEAA  R+++IIE+LEAQ ++   I QK HR ++    + ++ I  +++V IKFP R+      EN   E  ++ NG+ + E +++VD  +  +     + + ISGRKE CE+A DALL LVP+T +V +  + HR  IGQKG GI     ++ V + +PP  + SD I I G   ++  A+ GL+E +   + E++DR  R+++  +TV   +H  IIG++GA I   R   +V++Q PD+N +++ +ITI GYE++ + A+E ++ +V + +  + E++ +   VH ++IG RG A+RK+ + FKV+I FP    +D     V V G  +NVD+  D L+    E +++  E      ++  +K    ++     K    GF++  APW    ++ PD SS+ DFP   A
Sbjct:   36 LVPTYKEAFPPLPEKATPGET-TTEPSGAWTKIRPLKSSLITQVFHVPLEERKY--KEITQFGEGD-QAKICLDIMQKTGAHIEL-SLAKDQGLSIMVSGKLEAVMKARKEIVAKLQTQASATVAIPKEHHRFVIGKSGEKLQELELKTATKIQIPRPEDPSNQIKITGTKEGIEKARHEILLISAEQDKRAVERINIEKVYHPFIAGPFNKTAGEMMQETGTRINIPPPSVLKNEIVITGEKEQVAQAVSRIKRIYEDKKKKTTTIAVEVKKSQHKYVIGPKGNSLQEILERTGVSVEIPPSDSNSETVILRGEPDKLGQALTEVYAKANSFTVASVNAPSWLHRFIIGKKGQNLSRITQQMPKVYIEFTDGEDKICLEGPTKEVKQVQEQIESVVQDLVNRMDYTELTVDPKFHRHLIGKNGTNINRIKDQYKVLVRIPPDNEKSN---LIRIEGDPQGVQDAKKELLELASRMENERSKDLIIEHRFHRTIIGQKGEKVKEIRDKFPEVVINFPDPSQKSDIVQLRGPKNEVEKCAKFLQKIVAELVENSYSVSVPIFKQFHKNIIGKGGANIKKIREETNTKIDLPAENSNSEMIVITGKKSNCEVARSRILAIQKELANITEVEVCIPAKLHNSLIGAKGRFVRSIMEECGGVHIHFPTEGSGSDTVTIRGSTEEVDKAKKQLLHLAEEKQIKNYTSELRAKPEYHKFLIGRGGANIRKVRDNTGARIIFPTADDKDQELITIVGTEEAVKEAQKELEVLINNLDNVIEDAMTVDPKHHRYFVIRRGQVLREIADEYGGVMVSFPRTGT--QSDKVTLKGAKDCVEAAKKRMQEIIEDLEAQVTIECIISQKFHRMVMGAKGLNVQQITKDHNVQIKFPERE------ENQAVEQQVHENGETDGE-VKDVDLAVPRKN----DIIIISGRKERCEAARDALLALVPVTIEVEVPFDLHRYIIGQKGSGIRKMMEEYEVNIAVPPPEEQSDIIKITGLASHLDRARQGLNERVKELQMEQEDRALRSFKLTITVDPRYHPKIIGRKGAVITQIRMDHDVNVQFPDKNDENQDQITITGYEKNTETAKEAIMKIVSELEEMISEDITLNHKVHARIIGARGKAIRKIMEDFKVDIRFPPSGAED--LDCVTVTGLPDNVDEAIDHLLNLEEEYMSDVVENEA---MQAYMKPASRVDEP---KTTSKGFVVRDAPWTSSTEKAPDMSSSEDFPSFGA 1247          
BLAST of High density lipoprotein binding protein (Vigilin) vs. TrEMBL
Match: H9G856 (Uncharacterized protein OS=Anolis carolinensis OX=28377 GN=LOC100558432 PE=4 SV=2)

HSP 1 Score: 898.656 bits (2321), Expect = 0.000e+0
Identity = 523/1236 (42.31%), Postives = 778/1236 (62.94%), Query Frame = 3
Query:  243 YDDQFPPLPTCNTP----KIVQNSKPRIGQTKTSHVTQTLTVPLAERRFSNREANNSVKNDAQKKICQTVAQKCGVSIELNSGNKDQNLMVFISGPQDNVSNAKRILTKEXXXXXXXXMKVPKEYHKFILGRNGASLREIESGSNTNVTIPRSIENNDIITIFGTKEGIDKARAEINQIVAERSKLATERITIPKRFYPFINGSNNSKIYKIREMTNAKXXXXXXXXXXXXXXXXGEKDGVYQALEIIQKIYEDTKKCSSSLNLPIPKSQHCYVIGAKGSGIAEIFERTGVSIEMPSQDSDDDTIVLYGPNEFLAPALSMVIQKSESMIRVNIEAPNWLHRFIIGKQGSNLNKLMEKYEHVFINFPENSDLIVIEGPKDDVNELKGQITHKIAELKSTMAITEIQVDPRFHRHIIGRSGANIQRMQEEYKVQIRMPGNNAVGTSGWTIRIEGDPEGVKLAKTEIESMSVKLENEKTKDVILDHKYHNQLIGAQGSRVKELRNQYPDVIIMFPDLSSKSDIVQLRGPRQQVDQVAVKLNKFIQEVIENNYTKDVKIFKQYHKNIIGKGGVNIRKIREEMNIRIDFPDEHSDSDKIRLTGKKENVEEAAKRIEAMQAELISIKEDTISIPQRLHISLIGTRGKLIKCIQQECGGVQIQFPASDSNSDIIKIRGPESDVDKAXXXXXXXXXXXXXXXHQDSVSAKSEFHKFLIGRKGAQLAEFRKRHAVMLIFPDSEDTNKDTIQIIGAKEAVQKAKEELEVTIKSLENEIEKYITIDTKWHKHFFKKRQAVMEEISREFGGVRIFFPKQDAVENIDQVRVIGPKGCVEAAVVRIEDIIENLEAQTSLSVFIEQKHHRNLITRNMMEIKSIQSNYDVTIKFPNRDLSSKPGENGMEEIHLNGNGDVNIETMEEVDSTLESEQNNPANWVTISGRKENCESAEDALLELVPITEDVPLANEFHRNFIGQKGQGINTFSTKHNVVVNIPPANKCSDFISIKGPRVNIIDAKAGLDELITMWENEKQDRIARNYENHVTVPIVFHRNIIGQRGANIEIFRTKFNVSIQIPDQNSKSEE-ITIRGYEEDVKKAEEELISMVEKWKAQVKEELHIPRDVHPQLIGTRGIALRKLRDQFKVEINFPNRNVDDEKAHLVEVIGDKENVDKCCDILVERANELLNEWEERNQVREVKNLIKDRENINSSSNIKE--KGP--GFLLTGAPWQQ---RVPDASSNVDFP 3914
            Y + FPPLP    P      +     +I   K+S +TQ   VPL ERR+ +   N+      + K+C  + QK G  IEL S  KDQ L + ++G  D+V  A++ +   LQTQ    + +PKE+H+F++G+NG  L+E+E  + T + IPR  + ++ I I GTKEGI+KAR EI  I AE+ K A ER+ + K F+PFI G+ N  + +I + T A+INIPPPSV  +EIII+GEK+ V QAL  I+KIYED K+ ++++++ + KSQH Y+IG KG+ + EI + TGVS+EMP  +S  +TI+L G  + L PAL+ V  K++S++   + AP WLHRFIIGK+G N+ ++ ++   V I F +  + I +EGP ++V   + QI   I +L   M  TE+ +D RFHRH+IG++GANI R++E++KV +R+P +N        IRIEGDP+GV+LA+ E+  M+ ++ENE+TKD+I++ ++H  +IG +G ++KE+R+++P+VII FPD S KSDIVQLRGP+ +V++ A  L K I E+IEN+++  V IFKQ+HKNIIGKGG NI+KIREE N +ID P E+S+S+ I +TGKK N E A  RI A+Q EL +IKE  +SIP +LH SLIG +G+L++ I +ECGGV I FP+  S SD + IRGP  +V+KAK+QLL+L+E+  + +H   + AK E+HKFLIGR GA + + R R    +IFP +ED +++ I I+G +E+V++A+ ELE  I++L+N IE ++ +D K+H+HF  +R  V+ EI+ E+GGV + FP+       D+V + G K CVEAA  RI +II +LEAQ  L   I Q+ HR ++     +++ I  ++DV IKFP RD      +N   E     NGDV+     E+DS          + + ISGRKE CE+A  ALL LVPIT DV +  + HR  IGQKG GI     ++ V +++P   + SD I I G   N+  A+AGL E +   + E++DR  R ++  V+V   +H  IIG++GA I   R   +V+IQ PD+  ++++ ITI GYE++ + A + ++ +V   +  V E++ +   VH ++IG RG A+RKL ++F+V+I FP     D     V V G  ENVD   D ++    E + +  E   +            +   S ++E  +GP  GF++  APW     + PD SS  +FP
Sbjct:   38 YLEAFPPLPEKGAPGEKSSELTGVWNKIRPIKSSVITQVFHVPLEERRYKD---NSQFGEGDEAKVCVDIMQKTGAHIEL-SLAKDQGLSIMVTGKLDSVMKARKEIVARLQTQASATVTIPKEHHRFVIGKNGEKLQELELKTATKINIPRPEDPSNQIKITGTKEGIEKARHEILLISAEQDKRAVERVNLEKAFHPFIAGAFNKVVQEIMQDTGARINIPPPSVNKDEIIITGEKEPVSQALLRIRKIYEDKKRKTTTISVEVKKSQHKYIIGPKGNTLQEILDATGVSVEMPPLESSSETIILRGEPDKLGPALTQVYAKAKSVMVAEVTAPAWLHRFIIGKKGQNIGRITQQLPKVHIEFTDGDEKITLEGPTEEVELAQAQIQEIIRDLLGRMDYTEVLIDQRFHRHLIGKNGANINRIKEQHKVSVRIPPDNEKSN---LIRIEGDPQGVQLARKELLEMAARMENERTKDLIIEQRFHRTIIGQKGEKIKEIRDKFPEVIINFPDPSQKSDIVQLRGPKNEVEKCAKYLQKVIAELIENSFSIPVPIFKQFHKNIIGKGGANIKKIREETNTKIDLPTENSNSEVILITGKKVNCEGARDRILAIQRELANIKEVDVSIPAKLHNSLIGAKGRLVRSIMEECGGVHIHFPSEGSGSDKVTIRGPGEEVEKAKRQLLQLAEEKQINNHSVELHAKPEYHKFLIGRGGANIRKVRDRTGARIIFPTAEDKDQELITIVGKEESVRQAQYELENLIRNLDNVIEDWMLVDPKYHRHFVARRGHVLREIAEEYGGVTVSFPRTGV--QSDRVTLKGAKDCVEAAKKRILEIISDLEAQVVLECIIPQRFHRVVMGAKGYKVQQITRDHDVLIKFPERD------DNSGLEAQSQENGDVS----PELDSVPRK-----CDIILISGRKEKCEAARSALLALVPITMDVDVPFDLHRYIIGQKGAGIRKMMEEYEVNISVPQPEQQSDIIKITGLVPNVERARAGLLERVKELQAEQEDRALRGFKLMVSVEPKYHPKIIGKKGAVISQIRKDHDVTIQFPDKGDENQDLITITGYEKNAEGARDAILKIVADLEEMVSEDIRLDHRVHARIIGGRGKAIRKLMEEFRVDIRFPQPGSSD--PDRVTVTGLPENVDDAIDHMLNLEEEYMMDVVETETMAAY---------MKPPSRLEEEPRGPAKGFVVRDAPWNASGNKAPDMSSAEEFP 1238          
BLAST of High density lipoprotein binding protein (Vigilin) vs. TrEMBL
Match: Q402G0 (High density lipoprotein-binding protein vigilin OS=Anguilla japonica OX=7937 GN=hdlbp PE=2 SV=1)

HSP 1 Score: 897.886 bits (2319), Expect = 0.000e+0
Identity = 511/1237 (41.31%), Postives = 782/1237 (63.22%), Query Frame = 3
Query:  243 YDDQFPPLP-TCNTPKIVQNS----KPRIGQTKTSHVTQTLTVPLAERRFSNREANNSVKNDAQKKICQTVAQKCGVSIELNSGNKDQNLMVFISGPQDNVSNAKRILTKEXXXXXXXXMKVPKEYHKFILGRNGASLREIESGSNTNVTIPRSIENNDIITIFGTKEGIDKARAEINQIVAERSKLATERITIPKRFYPFINGSNNSKIYKIREMTNAKXXXXXXXXXXXXXXXXGEKDGVYQALEIIQKIYEDTKKCSSSLNLPIPKSQHCYVIGAKGSGIAEIFERTGVSIEMPSQDSDDDTIVLYGPNEFLAPALSMVIQKSESMIRVNIEAPNWLHRFIIGKQGSNLNKLMEKYEHVFINFPENSDLIVIEGPKDDVNELKGQITHKIAELKSTMAITEIQVDPRFHRHIIGRSGANIQRMQEEYKVQIRMPGNNAVGTSGWTIRIEGDPEGVKLAKTEIESMSVKLENEKTKDVILDHKYHNQLIGAQGSRVKELRNQYPDVIIMFPDLSSKSDIVQLRGPRQQVDQVAVKLNKFIQEVIENNYTKDVKIFKQYHKNIIGKGGVNIRKIREEMNIRIDFPDEHSDSDKIRLTGKKENVEEAAKRIEAMQAELISIKEDTISIPQRLHISLIGTRGKLIKCIQQECGGVQIQFPASDSNSDIIKIRGPESDVDKAXXXXXXXXXXXXXXXHQDSVSAKSEFHKFLIGRKGAQLAEFRKRHAVMLIFPDSEDTNKDTIQIIGAKEAVQKAKEELEVTIKSLENEIEKYITIDTKWHKHFFKKRQAVMEEISREFGGVRIFFPKQDAVENIDQVRVIGPKGCVEAAVVRIEDIIENLEAQTSLSVFIEQKHHRNLITRNMMEIKSIQSNYDVTIKFPNRDLSSKPGENGMEEIHLNGNGDVNIETMEEVDSTLESEQNNPANWVTISGRKENCESAEDALLELVPITEDVPLANEFHRNFIGQKGQGINTFSTKHNVVVNIPPANKCSDFISIKGPRVNIIDAKAGLDELITMWENEKQDRIARNYENHVTVPIVFHRNIIGQRGANIEIFRTKFNVSIQIPDQNSKSE-EITIRGYEEDVKKAEEELISMVEKWKAQVKEELHIPRDVHPQLIGTRGIALRKLRDQFKVEINFPNRNVDDEKAHLVEVIGDKENVDKCCDILVERANELLNEWEERNQVREVKNLIKDRENINS-SSNIKEKGPGFLLTGAPW--QQRVPDASSNVDFPKIDA 3926
            Y D FPPLP    +P+ VQ S      ++   K S VTQ   VPL ER++  ++ N   + D Q KIC  + QK G  +EL S  KDQ L + +SG  D V  A++ +   LQTQ    + +PKE+H+F++ +NG  L+E+E  + T + IPR  + +++I I GTKEG++KAR EI  I AE+ K A ER++I K ++PFI G+ N  + ++ + T  +IN+PPPSV   EI+I+GEK+ V QA+ +I+KIYE+ KK S+++ + + KSQH YVIG KG+ + EI E+TGVS+E+P  DS  +T++L G  + L  AL+ V  K+ S    ++ AP+WLHRFIIGK+G NL K+ ++   V I F E  D I +EGP  D+  ++ QI   + +L S M  TEI VDP+FHRH+IG+ GANI R+++++KV +R+P +N        IRIEGDP+GV+ AK E+  ++ ++ENE+TKD+I++ ++H  +IG +G ++KE+R+++P+VII FPD + KSDIVQLRGPR +V++ +  + K + E++EN+++  V IFKQ+H+NIIGKGG NI+KIREE N +ID P E+S+S+ I +TGKK N E A  RI A+Q EL +I E  +SIP +LH SLIG++G+ ++ I +ECGGV I FP+  S  D + IRGP  DV+KA+ QLL L+E+    SH   + AK E+HKFLIG+ G  + + R      +IFP +ED +++ I ++G +EAV+ A +ELE  IKSL+N +E +IT+D K H++F  +R  V+ +I  E+GGV + FP+  +    D+V + G K CVEAA  R++DIIE+L+AQ ++   I QK HR+++      I+ I  +++V IKFP+R+ +    +    E  +  NG  N E  E  D  +  +     + + + GRKE CE+A +AL  LVP+T +V ++ E HR  IGQKG GI     ++ V + +P     SD ISI G   ++  AK GL E +   + E++DR  R+++  +TV   +H  IIG++GA I   R + +V+IQ P++N +++ +ITI GYE++   A   + ++V++ +  V E++ +   VH ++IG RG  +RK+ D+FKV++ FP     D   ++V V G  E VD+  D L+    E + +  E N+ ++    +K R      + + K    GF++  APW   ++ PD SS+ +FP   A
Sbjct:   43 YKDAFPPLPEKAVSPEGVQESDNAWASKLRPLKASIVTQVFHVPLEERKY--KDINQFGEGD-QAKICVDIMQKTGAHLEL-SMAKDQGLSIMVSGKMDAVMKARKEIVSRLQTQATATVAIPKEHHRFVISKNGEKLQELELKTATKIQIPRPDDPSNLIKISGTKEGLEKARHEILLISAEQDKRAVERVSIDKVYHPFITGAYNKVVGEMMQETGTRINVPPPSVNKTEIVITGEKEQVAQAVVMIRKIYEEKKKSSTTIAVEVKKSQHKYVIGPKGNTLQEILEKTGVSVEIPPSDSSSETVILRGEPDRLGQALTEVYAKANSFTVSSVSAPSWLHRFIIGKKGQNLAKITQQMPKVHIEFTEGEDRITLEGPTKDMQLVQSQIEAIVTDLVSRMDYTEISVDPKFHRHLIGKGGANINRIKDQHKVSVRIPPDNEKSN---LIRIEGDPQGVQEAKKELLELASRMENERTKDLIIEQRFHRAIIGRKGEKIKEVRDKFPEVIINFPDPAQKSDIVQLRGPRTEVEKCSKFMQKMVAEMVENSFSVSVPIFKQFHRNIIGKGGANIKKIREETNTKIDLPAENSNSEMIVITGKKANCEAAKNRILAIQKELANITEMEVSIPSKLHNSLIGSKGRFVRSIMEECGGVHIHFPSEGSGIDTVTIRGPAEDVEKARNQLLSLAEEKQTKSHTAELRAKPEYHKFLIGKGGGNIRKVRDSTGARIIFPTAEDKDQELITVVGTEEAVRDAAKELEGLIKSLDNVVEDFITVDPKHHRYFVARRGQVLRDIGEEYGGVMVSFPR--SASQSDKVTLKGAKECVEAAKKRMQDIIEDLDAQVTMECVIPQKFHRSIMGPKGSRIQQITRDHNVQIKFPDREDT----QGSSTEPVVQENGVTNGEVKEPADPDVPKK----CDTIVLLGRKERCEAAVEALKALVPVTIEVEVSYELHRYIIGQKGSGIRKMMDEYEVNIQVPAPELQSDIISITGLANHLDRAKEGLLERVKELQAEQEDRALRSFKLTITVDPKYHPKIIGRKGAIITQIRNEHDVNIQFPEKNDENQDQITITGYEQNTTAARAAIQTIVDELEEMVSEDITLDSRVHARIIGARGKGIRKIIDEFKVDLKFPQSGAAD--PNMVTVTGRPELVDEAIDHLLNLEEEYMGDVVE-NESKQA--YVKPRGGAAPFAEDHKGTSKGFVVRDAPWAASEKAPDMSSSEEFPSFGA 1257          
BLAST of High density lipoprotein binding protein (Vigilin) vs. Ensembl Cavefish
Match: hdlbpa (high density lipoprotein binding protein a [Source:ZFIN;Acc:ZDB-GENE-030131-2032])

HSP 1 Score: 872.463 bits (2253), Expect = 0.000e+0
Identity = 492/1180 (41.69%), Postives = 752/1180 (63.73%), Query Frame = 3
Query:  417 QKKICQTVAQKCGVSIELNSGNKDQNLMVFISGPQDNVSNAKRILTKEXXXXXXXXMKVPKEYHKFILGRNGASLREIESGSNTNVTIPRSIENNDIITIFGTKEGIDKARAEINQIVAERSKLATERITIPKRFYPFINGSNNSKIYKIREMTNAKXXXXXXXXXXXXXXXXGEKDGVYQALEIIQKIYEDTKKCSSSLNLPIPKSQHCYVIGAKGSGIAEIFERTGVSIEMPSQDSDDDTIVLYGPNEFLAPALSMVIQKSESMIRVNIEAPNWLHRFIIGKQGSNLNKLMEKYEHVFINFPENSDLIVIEGPKDDVNELKGQITHKIAELKSTMAITEIQVDPRFHRHIIGRSGANIQRMQEEYKVQIRMPGNNAVGTSGWTIRIEGDPEGVKLAKTEIESMSVKLENEKTKDVILDHKYHNQLIGAQGSRVKELRNQYPDVIIMFPDLSSKSDIVQLRGPRQQVDQVAVKLNKFIQEVIENNYTKDVKIFKQYHKNIIGKGGVNIRKIREEMNIRIDFPDEHSDSDKIRLTGKKENVEEAAKRIEAMQAELISIKEDTISIPQRLHISLIGTRGKLIKCIQQECGGVQIQFPASDSNSDIIKIRGPESDVDKAXXXXXXXXXXXXXXXHQDSVSAKSEFHKFLIGRKGAQLAEFRKRHAVMLIFPDSEDTNKDTIQIIGAKEAVQKAKEELEVTIKSLENEIEKYITIDTKWHKHFFKKRQAVMEEISREFGGVRIFFPKQDAVENIDQVRVIGPKGCVEAAVVRIEDIIENLEAQTSLSVFIEQKHHRNLITRNMMEIKSIQSNYDVTIKFPNR-DLSSKPGENGMEEIHLNGNGDVNIETMEEVDSTLESEQNNPANWVTISGRKENCESAEDALLELVPITEDVPLANEFHRNFIGQKGQGINTFSTKHNVVVNIPPANKCSDFISIKGPRVNIIDAKAGLDELITMWENEKQDRIARNYENHVTVPIVFHRNIIGQRGANIEIFRTKFNVSIQIPDQNSKSE-EITIRGYEEDVKKAEEELISMVEKWKAQVKEELHIPRDVHPQLIGTRGIALRKLRDQFKVEINFPNRNVDDEKAHLVEVIGDKENVDKCCDILVERANELLNEWEERNQVREVKN-----LIKDRENINSSSNIKEKGP--GFLLTGAPWQ-QRVPDASSNVDFPKIDA 3926
            Q K+C  +  K G  +EL S  KDQ L + +SG  D V  A++ +   LQTQ    + +PKE+H+F++G+NG  L+E+E  + T + IPR  ++++ I I GTKEG++KA+ EI  I AE+ K A ER+ I K ++PFI G+ +  + ++ + T A+IN+PPPS+   EI+I+GEK+ V  A+ +I+K+YE+ K+ ++++ + + KSQH YVIG KG+ + EI +RTGVS+E+P  DS  +T++L G  + L  AL+ V  K+ S    ++ AP+WLHRFIIGK+G NL K+ ++   V I F E  D I +EGP  DV  ++ QI   + +L S M   EI VDP+FHRH+IG+ GANI R++++YKV +R+P +N        IRIEGDP+GV+ AK E+  ++ ++ENE+TKD+I++ ++H  +IG +G ++KE+R+++P+VII FPD + KSDIVQLRGPR +V++ A  + K + E++EN+++  V IFKQ+HKNIIGKGG NI+KIREE N +ID P E+S+S+ I +TGKK N E A  RI A+Q EL +I E  +SIP +LH SLIG++G+ ++ I +ECGGV I FP   S  D + IRGP  +V+KA+KQLL L+E+    SH   + AK E+HKFLIG+ G  + + R      +IFP +ED +++ I +IG +EAV +A++ELE  IKSL+N +E  + +D K H++F  +R  V+ +++ E+GGV + FP+  +    D+V + G K CVEAA  R+ +IIE+L+AQ ++   I QK HR+++      I+ I  +++V IKFP R D  + P E  ++E     NG+ N +  E VD     +     + + +SGRKE CE+A +AL  LVP+T +V +  E HR  IGQKG GI     +  V + +P  +  SD ISI G   ++  AK GL E +   + E++DR  R+++  +TV   +H  IIG++GA I   RT+ +V+IQ P++N +++ +ITI GYE++   A + + ++V++ +  + E++ +   VH ++IG RG  +RK+ D+FKV++ FP     D   +LV V G  E VD+  D        LLN  EE      V N      +K     ++SS+ + +GP  GF++  APW   + PD SS+ DFP   A
Sbjct:    9 QAKVCVDIMHKTGAHLEL-SMAKDQGLSIMVSGKLDAVMKARKEIVSRLQTQASATVAIPKEHHRFVIGKNGEKLQELELKTATKIQIPRPEDSSNHIKISGTKEGLEKAKHEILLISAEQDKRAVERVNIDKVYHPFITGAYSKLVGEMMQETGARINVPPPSINKTEIVITGEKEQVALAVTLIKKVYEEKKRNATTIAVEVKKSQHKYVIGPKGNTLQEILDRTGVSVEIPPPDSSSETVILRGEPDRLGQALTEVYAKANSYTVSSVSAPSWLHRFIIGKKGQNLAKITQQMPKVHIEFTEGEDKITLEGPTKDVQMVQSQIEAIVTDLVSRMDYAEISVDPKFHRHLIGKGGANINRIKDQYKVSVRIPPDN---EKSNLIRIEGDPQGVQEAKKELLELASRMENERTKDMIIEQRFHRAIIGQKGEKIKEIRDKFPEVIINFPDPAQKSDIVQLRGPRTEVEKCAKFMQKMVAEMVENSFSVSVPIFKQFHKNIIGKGGANIKKIREETNTKIDLPAENSNSEMIIITGKKVNCEAARNRILAIQKELANITEVEVSIPSKLHNSLIGSKGRFVRSIMEECGGVHIHFPTEGSGIDAVTIRGPAEEVEKARKQLLSLAEEKQTKSHTAELRAKPEYHKFLIGKGGGNIRKVRDSTGARIIFPTAEDKDQELITVIGTEEAVAEAQKELEALIKSLDNVVEDNMLVDPKHHRYFVARRGQVLRDLADEYGGVMVSFPRTGS--QSDKVTLKGAKDCVEAAKKRMLEIIEDLDAQVTMECVIPQKFHRSIMGPKGARIQQITRDHNVQIKFPEREDQQAAPAEAPVQE-----NGEANGDVKEPVDPAAPKK----CDVIVLSGRKERCEAAVEALKALVPVTIEVEVPFELHRYIIGQKGSGIRKMMDEFEVNIQVPAPDLQSDIISITGLSTHLDRAKEGLLERVKELQAEQEDRALRSFKLTITVDPKYHPKIIGRKGAIITTIRTEHDVNIQFPEKNDENQDQITITGYEQNAMSARDAIQAIVDELEEMISEDITLDSRVHARIIGARGKGIRKIMDEFKVDLRFPQSGAAD--PNLVTVTGRPEMVDEAID-------HLLN-LEEEYMADVVGNESKMAYMKPSGTASASSDHEPRGPSKGFVVREAPWATDKAPDMSSSEDFPSFGA 1163          

HSP 2 Score: 211.846 bits (538), Expect = 4.270e-55
Identity = 261/987 (26.44%), Postives = 453/987 (45.90%), Query Frame = 3
Query: 1056 GAKGSGIAEIFERTGVSIEMPSQDSDDDTIVLYGPNEFLAPALSMVIQKSESMIRVNIEAPNWLHRFIIGKQGSNLNKL-MEKYEHVFINFPEN-SDLIVIEGPKDDVNELKGQITHKIAELKSTMAITEIQVDPRFHRHIIGRSGANIQRMQEEYKVQIRMPGNNAVGTSGWTIRIEGDPEGVKLAKTEIESM-SVKLENEKTKDVILDHKYHNQLIGAQGSRVKELRNQYPDVIIMFPDLSSKSDIVQLRGPRQQVDQVAVKLNKFIQEVIENNYT-KDVKIFKQYHKNIIGKGGVNIRKIREEM-NIRIDFPDEHSDSDKIRLTGKKENVEEAAKRIEAMQAELIS-IKEDTISIPQRLHISLIGTRGKLIKCIQQECGGVQIQFPASDSNSDIIKIRGPESDVDKAXXXXXXXXXXXXXXXHQDSVSAKSEFHKFLIGRKGAQLAEFRKRHAVMLI-FPDSEDTNKDTIQIIGAKEAVQKAKEELEVTIKSL-ENEIEKYITIDTKWHKHFFKKRQAVMEEISREFGGVRIFFPKQDAVENIDQVRVIGPKGCVEAAVVRIEDIIENLEAQTSLSVFIEQKHHRNLITRNMMEIKSIQ--------------SNYD-VTIKFP-----------------------NRDLSSKPGENGMEEIH--LNGNGDVNIETMEEVDST-----LESEQNNPANWVTISGRKENCESAEDALLELVP----ITEDVPLAN-EFHRNFIGQKGQGINTFSTKH-NVVVNIPPANKCSDFISIKGPRVNIIDAKAGLDELITMWENEKQDRIARNYENHVTVPIVFHRNIIGQRGANIEIFRTKFNVSIQIP---DQNSKSEEITIRGYEE---DVKKA-----------------EEELISMVEKWKA--QVKEELHIPRDVHPQLIGTRGIALRKLRDQFKVEINFPNRNVDDEKAHLVEVIGDKENVDKCCDILVERANELLNEWEER 3764
            G +     +I  +TG  +E+        +I++ G  + +  A   ++ + ++     +  P   HRF+IGK G  L +L ++    + I  PE+ S+ I I G K+ + + K +I    AE +   A+  + +D  +H  I G     +  M +E   +I +P  +   T    I I G+ E V LA T I+ +   K  N  T  V +    H  +IG +G+ ++E+ ++   V +  P   S S+ V LRG   + D++   L +   +   N+YT   V      H+ IIGK G N+ KI ++M  + I+F +     DKI L G  ++V+    +IEA+  +L+S +    IS+  + H  LIG  G  I  I+ +   V ++ P  +  S++I+I G    V +AKK+LLEL+ +      +D +  +  FH+ +IG+KG ++ E R +   ++I FPD    + D +Q+ G +  V+K  + ++  +  + EN     + I  ++HK+   K  A +++I RE    +I  P +++  N + + + G K   EAA  RI  I + L   T + V I  K H +LI      ++SI               S  D VTI+ P                         +L +KP      E H  L G G  NI  +   DST       + ++     +T+ G +E    A+  L  L+     + ED  L + + HR F+ ++GQ +   + ++  V+V+ P     SD +++KG +  +  AK  + E+I        + +         +P  FHR+I+G +GA I+      NV I+ P   DQ +   E  ++   E   DVK+                  +E   + VE  KA   V  E+ +P ++H  +IG +G  +RK+ D+F+V I  P     D ++ ++ + G   ++D+  + L+ER  EL  E E+R
Sbjct:    7 GDQAKVCVDIMHKTGAHLELSMAKDQGLSIMVSGKLDAVMKARKEIVSRLQTQASATVAIPKEHHRFVIGKNGEKLQELELKTATKIQIPRPEDSSNHIKISGTKEGLEKAKHEILLISAE-QDKRAVERVNIDKVYHPFITGAYSKLVGEMMQETGARINVPPPSINKTE---IVITGEKEQVALAVTLIKKVYEEKKRNATTIAVEVKKSQHKYVIGPKGNTLQEILDRT-GVSVEIPPPDSSSETVILRG---EPDRLGQALTEVYAKA--NSYTVSSVSAPSWLHRFIIGKKGQNLAKITQQMPKVHIEFTE---GEDKITLEGPTKDVQMVQSQIEAIVTDLVSRMDYAEISVDPKFHRHLIGKGGANINRIKDQY-KVSVRIPPDNEKSNLIRIEGDPQGVQEAKKELLELASRMENERTKDMI-IEQRFHRAIIGQKGEKIKEIRDKFPEVIINFPDPAQKS-DIVQLRGPRTEVEKCAKFMQKMVAEMVENSFSVSVPIFKQFHKNIIGKGGANIKKI-REETNTKIDLPAENS--NSEMIIITGKKVNCEAARNRILAIQKELANITEVEVSIPSKLHNSLIGSKGRFVRSIMEECGGVHIHFPTEGSGIDAVTIRGPAEEVEKARKQLLSLAEEKQTKSHTAELRAKP------EYHKFLIGKGGGNIRKVR--DSTGARIIFPTAEDKDQELITVIGTEEAVAEAQKELEALIKSLDNVVEDNMLVDPKHHRYFVARRGQVLRDLADEYGGVMVSFPRTGSQSDKVTLKGAKDCVEAAKKRMLEII--------EDLDAQVTMECVIPQKFHRSIMGPKGARIQQITRDHNVQIKFPEREDQQAAPAEAPVQENGEANGDVKEPVDPAAPKKCDVIVLSGRKERCEAAVEALKALVPVTIEVEVPFELHRYIIGQKGSGIRKMMDEFEVNIQVP---APDLQSDIISITGLSTHLDRAKEGLLERVKELQAEQEDR 955          
BLAST of High density lipoprotein binding protein (Vigilin) vs. Ensembl Cavefish
Match: hdlbpb (high density lipoprotein binding protein b [Source:ZFIN;Acc:ZDB-GENE-030131-6822])

HSP 1 Score: 696.041 bits (1795), Expect = 0.000e+0
Identity = 462/1239 (37.29%), Postives = 713/1239 (57.55%), Query Frame = 3
Query:  243 YDDQFPPLPTCNTPKIVQNSKP-----RIGQTKTSHVTQTLTVPLAERRFSNREANNSVKNDAQKKICQTVAQKCGVSIELNSGNKDQNLMVFISGPQDNVSNAKRILTKEXXXXXXXXMKVPKEYHKFILGRNGASLREIESGSNTNVTIPRSIENNDIITIFGTKEGIDKARAEINQIVAERSKLATERITIPKRFYPFINGSNNSKIYKIREMTNAKXXXXXXXXXXXXXXXXGEKDGVYQALEIIQKIYEDTKKCSSSLNLPIPKSQHCYVIGAKGSGIAEIFERTGVSIEMPSQDSDDDTIVLYGPNEFLAPALSMVIQKSES-MIRV-NIEAPNWLHRFIIGKQGSNLNKLMEKY-EHVFINFPENSDLIVIEGPKDDVNELKGQITHKIAELKSTMAITEIQVDPRFHRHIIGRSGANIQRMQEEYKVQIRMPGNNAVGTSGWTIRIEGDPEGVKLAKTEIESMSVKLENEKTKDVILDHKYHNQLIGAQGSRVKELRNQYPDVIIMFPDLSSKSDIVQLRGPRQQVDQVAVKLNKFIQEVIENNYTKDVKIFKQYHKNIIGKGGVNIRKIREEMNIRIDFPDEHSDSDKIRLTGKKENVEEAAKRIEAMQAELISIKEDTISIPQRLHISLIGTRGKLIKCIQQECGGVQIQFPASDSNSDIIKIRGPESDVDKAXXXXXXXXXXXXXXXHQDSVSAKSEFHKFLIGRKGAQLAEFRKRHAVMLIFPDSEDTNKDTIQIIGAKEAVQKAKEELEVTIKSLENEIEKYITIDTKWHKHFFKKRQAVMEEISREFGGVRIFFPKQDAVENIDQVRVIGPKGCVEAAVVRIEDIIENLEAQTSLSVFIEQKHHRNLITRNMMEIKSIQSNYDVTIKFPNRDLSSKPGENGMEEIHLNGNGDVNIETMEEVDSTLESEQNNPANWVTISGRKENCESAEDALLELVPITEDVPLANEFHRNFIGQKGQGINTFSTKHNVVVNIPPANKCSDFISIKGPRVNIIDAKAGLDELITMWENEKQDRIARNYENHVTVPIVFHRNIIGQRGANIEIFRTKFNVSIQIPDQNSKSEE-ITIRGYEEDVKKAEEELISMVEKWKAQVKEELHIPRDVHPQLIGTRGIALRKLRDQFKVEINFPNRNVDDEKAHLVEVIGDKENVDKCCDILVERANE-LLNEWEERNQVREVKNLIKDRENINSSSNIKEKGP--GFLLTGAPWQQ---RVPDASSNVDFP 3914
            Y + FPPLP    P   ++ +P     +I   K S +TQ   VPL ERR+ +   N+      + K+C  + QK G  IEL S  KDQ L + ++G  D+V  A++ +   LQTQ    + +PKE+H+F++G+NG  L+E+E  + T + IPR  + +  I I GTKEGI+KAR EI  I AE+ K A ER+++ K F+PFI G+ N  + ++ + T A+I+IPPPS+  +EI+I+GEK+ V  A+  I+ IYE+ K+ ++++++ + KSQH Y++G KG+ + EI E TGVS+EMP  DS  +TI+L G  + L PAL+ V  K+   M+ V NI       RF I K      +L   + E V I F +  + I +EGP ++V + + QI   I +L + M  TEI +D RFHRH+IG++GANI R++E+YKV +R+P ++        +RIEGDP+GV+LA+ E+  M+ ++ENE+TKD+I++ ++H  +IG +G ++KE+R+++P+VII FPD S KSDIVQLRGP+ +V++ A  L K + E++E++Y+  V IFKQ+HKNIIGKGG NI+K R   N +ID P E+SDS+ I ++GKK N E A +RI  +Q +L ++KE  ++IP +LH SLIG++G L++ + +ECGGV I FPA  S  D + IRGP  +V++A++QLL+L+E+  + +    ++AK E+HKFLI                                    +EAV+ A++ELE  IK+L  +      I T  ++H  K+ Q ++ E S      R++            +RV+    CV              E+Q ++ V + Q+ HR ++      I+ I    +V IKFP R+ S+     GM E+    NG  + E  + V            + +T++GR E CE A  ALL LVP+T DV +  + HR  IGQKG GI     ++ V + IP  ++ SD I I G   ++  A+  L + +   + E++DR  R+Y+  ++V   +H  IIG++GA I   R   +V++Q PD+  + ++ I I GYE +V++A+  +  MV   +  V +++ +   VH ++IG RG A+RKL ++FKV+I FP    +D     V V G  ENVDK  D L+    E +L   E       +K     R       + + +GP  GF++  APW     + PD SS  DFP
Sbjct:   38 YLEAFPPLPDKGAPGD-RSGEPAGAWSKIRPIKASVITQVFHVPLEERRYKD---NSQFGEGEEAKVCLDIMQKTGAHIEL-SLAKDQGLSIMVTGKLDSVMKARKEIVARLQTQASATVIMPKEHHRFVIGKNGEKLQELELKTATKIAIPRPDDPSANIRITGTKEGIEKARHEILLISAEQDKRAVERLSLEKAFHPFIAGAYNRLVQELSQETGARISIPPPSLLKDEIVITGEKEAVAMAIARIRAIYEEKKRKTTTISVEVKKSQHKYIVGPKGNTLQEIMESTGVSVEMPPLDSGSETIILRGEPDKLGPALTQVYAKARCFMLTVCNI-------RFTIIK----YTQLFSDWSEQVHIEFTDGEERISLEGPTEEVEQAQSQIQEIIKDLVARMDYTEINIDQRFHRHLIGKNGANINRIKEQYKVSVRIPQDS---DRCGLVRIEGDPQGVQLARRELVDMAQRMENERTKDLIIEQRFHRTIIGQKGEKIKEVRDKFPEVIINFPDQSQKSDIVQLRGPKNEVEKCAKFLQKLLVELVESSYSISVPIFKQFHKNIIGKGGANIKKKRP--NTKIDLPTENSDSEMIVISGKKCNCEAARERILTIQRDLANLKETEVTIPAKLHNSLIGSKGCLVRSVMEECGGVHIHFPAEGSGVDKVTIRGPAGEVERARRQLLQLAEEKQVNNFSIELNAKPEYHKFLI------------------------------------EEAVRLAQKELETLIKNLVLQPITDTDIFTIHNQHILKQIQFLINEYSI-IQWNRLYI-----------LRVL----CVFVQ-----------ESQVTVEVVVPQRFHRAVMGPKGCRIQQITREQEVLIKFPEREESA-----GMSEVCPVENGSPSPEAGDAVPRR--------CDVITVTGRVEKCELARIALLALVPVTVDVEVPYDLHRYIIGQKGTGIRKMMEEYEVNIWIPQPDQQSDVIKITGQEASVERARQALLDRVKELQAEQEDRALRSYKLTLSVDPKYHPKIIGRKGAVISQIRKDHDVNVQFPDKGDEQQDLIVIWGYERNVEEAKAAIEQMVAALQEMVSDDVRLDHRVHARIIGARGKAIRKLMEEFKVDIRFPQPGSEDPDK--VTVTGLPENVDKAIDHLLNLEEEYMLTVTETETLAAYMKP--PSRVVGMGGGDEESRGPAKGFVVRDAPWNASGGKAPDMSSAEDFP 1175          
BLAST of High density lipoprotein binding protein (Vigilin) vs. Ensembl Cavefish
Match: bicc2 (protein bicaudal C homolog 1-like [Source:NCBI gene;Acc:103039934])

HSP 1 Score: 55.8398 bits (133), Expect = 3.554e-7
Identity = 62/264 (23.48%), Postives = 119/264 (45.08%), Query Frame = 3
Query: 1773 SSKSDIVQLRGPRQQVDQVAVKLNKFIQEVIENNYTKDVKIFKQYHKNIIGKGGVNIRKIREEMNIRIDFPDE--HS----DSDKIRLTGKKENVEEAAKRIEAMQAELISIKEDTISIPQRLHISLIGTRGK-LIKCIQQECGGVQIQF---PASDSNSDIIK-IRGPESDVDKAXX---------XXXXXXXXXXXXXHQDSVSAKSEFHKFLIGRKGAQLAEFRKRHAVMLIFPD-SEDTNKDTIQIIGAKEAVQKAKEEL 2501
            S K   V++ G +  V +   K+ + ++  + N  T  + +    H ++IGKGG NI+K+ E+ +  I FPD   HS     S+++ + G  E VE A K I  +Q  ++     T  +P  L   ++   G  LI+ + Q   GV + F   P    ++ +++ ++G  + V KA           +   ++     +     +   S+ H FL+G+ GA       +    ++ PD +   +  ++ I G  + V  A+++L
Sbjct:  129 SKKDPHVKVEGKKDDVLEAKRKILELLEAKV-NKVTLKMDVTHTEHSHVIGKGGGNIKKVMEDTSCHIHFPDSNRHSATGEKSNQVSIAGPVEGVESARKHIRDLQPLVL-----TFDLPLTLVGGVVTDAGSPLIQHVAQAF-GVSVTFRTQPKLYCSTCVVRGLQGNCAAVKKATCVLMELLLGREAAAVAGVTGGVMVSTQLDVTSQQHLFLLGQNGANFLSVMHQTHTQIVLPDLTAPQHTPSLLIQGTADGVCLARQQL 385          

HSP 2 Score: 51.6026 bits (122), Expect = 7.931e-6
Identity = 57/235 (24.26%), Postives = 98/235 (41.70%), Query Frame = 3
Query: 1344 IVIEGPKDDVNELKGQITHKIAELKSTMAITEIQVDPRFHRHIIGRSGANIQRMQEEYKVQIRMPGNN---AVGTSGWTIRIEGDPEGVKLAKTEIESMSVKLENEKTKDVILDHKYHNQLIGA----QGSRVKELRNQYPDVIIMF---PDLSSKSDIVQ-LRGPRQQVDQVAVKLNKFI---QEVIENNYTKDV------KIFKQYHKNIIGKGGVNIRKIREEMNIRIDFPD 1988
            + +EG KDDV E K +I  ++ E K      ++ V    H H+IG+ G NI+++ E+    I  P +N   A G     + I G  EGV+ A+  I  +         + ++L       L+G      GS + +   Q   V + F   P L   + +V+ L+G    V +    L + +   +       T  V       +  Q H  ++G+ G N   +  + + +I  PD
Sbjct:  135 VKVEGKKDDVLEAKRKIL-ELLEAKVNKVTLKMDVTHTEHSHVIGKGGGNIKKVMEDTSCHIHFPDSNRHSATGEKSNQVSIAGPVEGVESARKHIRDL---------QPLVLTFDLPLTLVGGVVTDAGSPLIQHVAQAFGVSVTFRTQPKLYCSTCVVRGLQGNCAAVKKATCVLMELLLGREAAAVAGVTGGVMVSTQLDVTSQQHLFLLGQNGANFLSVMHQTHTQIVLPD 359          
BLAST of High density lipoprotein binding protein (Vigilin) vs. Ensembl Cavefish
Match: bicc1b (BicC family RNA binding protein 1 [Source:NCBI gene;Acc:103032919])

HSP 1 Score: 55.4546 bits (132), Expect = 5.294e-7
Identity = 54/235 (22.98%), Postives = 105/235 (44.68%), Query Frame = 3
Query:  936 GEKDGVYQALEIIQKIYEDTKKCSSSLNLPIPKSQHCYVIGAKGSGIAEIFERTGVSIEMPSQDSDDDTIVLYGPNEFLAPALSMVIQKSESMIRVNIEAPNWLHRFIIGKQGSNLNKLMEKYEHVFINFPENSDLI----VIEGPKDDVNELKGQ----ITHKIAELKSTMAI-TEIQVDPRFHRHIIGRSGANIQRMQEEYKVQIRMPGNNAVGTSGWTIRIEGDPEGVKLAK 1613
            G++D V +A E I  +  DTK    +L + +  ++H +VIG  G+ I ++ E TG  I  P  + ++        N+ L P + M        +  +  +P   H              + +  ++ + F + S L     V+ G +++V  +K      + H    L S + + T++ + P+ H  ++GR+G+NI+ + +    Q+  P  N       T+ I+G  + V LA+
Sbjct:  111 GKRDNVKEAKEKIMSVL-DTKSNRVTLKMDVSHTEHSHVIGKGGNNIKKVMEDTGCHIHFPDSNRNNQA---EKSNQELLPLVLMFELPVIVQLNPDPSSPAIQH--------------ISQTYNISVAFKQRSRLYGATGVVRGSQNNVAAVKRGTAVLLEHLAGSLASAITVSTQLDIAPQHHLSMMGRNGSNIKHIMQRTGAQVHFPDPNCPQKKS-TVYIQGSIDSVCLAR 326          
BLAST of High density lipoprotein binding protein (Vigilin) vs. Ensembl Cavefish
Match: bicc2 (protein bicaudal C homolog 1-like [Source:NCBI gene;Acc:103039934])

HSP 1 Score: 55.0694 bits (131), Expect = 6.488e-7
Identity = 62/264 (23.48%), Postives = 120/264 (45.45%), Query Frame = 3
Query: 1773 SSKSDIVQLRGPRQQVDQVAVKLNKFIQEVIENNYTKDVKIFKQYHKNIIGKGGVNIRKIREEMNIRIDFPDE--HS----DSDKIRLTGKKENVEEAAKRIEAMQAELISIKEDTISIPQRLHISLIGTRGK-LIKCIQQECGGVQIQF---PASDSNSDIIK-IRGPESDVDKAX---------XXXXXXXXXXXXXXHQDSVSAKSEFHKFLIGRKGAQLAEFRKRHAVMLIFPD-SEDTNKDTIQIIGAKEAVQKAKEEL 2501
            S K   V++ G +  V +   K+ + ++  + N  T  + +    H ++IGKGG NI+K+ E+ +  I FPD   HS     S+++ + G  E VE A K I  +Q  ++     T  +P  L   ++   G  LI+ + Q   GV + F   P    ++ +++ ++G  + V KA          ++   ++     +     +   S+ H FL+G+ GA       +    ++ PD +   +  ++ I G  + V  A+++L
Sbjct:  135 SKKDPHVKVEGKKDDVLEAKRKILELLEAKV-NKVTLKMDVTHTEHSHVIGKGGGNIKKVMEDTSCHIHFPDSNRHSATGEKSNQVSIAGPVEGVESARKHIRDLQPLVL-----TFDLPLTLVGGVVTDAGSPLIQHVAQAF-GVSVTFRTQPKLYCSTCVVRGLQGNCAAVKKATCVLMELLLGREAAAVAGVTGGVMVSTQLDVTSQQHLFLLGQNGANFLSVMHQTHTQIVLPDLTAPQHTPSLLIQGTADGVCLARQQL 391          
BLAST of High density lipoprotein binding protein (Vigilin) vs. Ensembl Sea Lamprey
Match: hdlbpb (high density lipoprotein binding protein b [Source:ZFIN;Acc:ZDB-GENE-030131-6822])

HSP 1 Score: 709.138 bits (1829), Expect = 0.000e+0
Identity = 384/877 (43.79%), Postives = 587/877 (66.93%), Query Frame = 3
Query:  243 YDDQFPPLPTCN---TPKIVQNSKPRIGQTKTSHVTQTLTVPLAERRFSNREANNSVKNDAQKKICQTVAQKCGVSIELNSGNKDQNLMVFISGPQDNVSNAKRILTKEXXXXXXXXMKVPKEYHKFILGRNGASLREIESGSNTNVTIPRSIENNDIITIFGTKEGIDKARAEINQIVAERSKLATERITIPKRFYPFINGSNNSKIYKIREMTNAKXXXXXXXXXXXXXXXXGEKDGVYQALEIIQKIYEDTKKCSSSLNLPIPKSQHCYVIGAKGSGIAEIFERTGVSIEMPSQDSDDDTIVLYGPNEFLAPALSMVIQKSESMIRVNIEAPNWLHRFIIGKQGSNLNKLMEKYEHVFINFPENSDLIVIEGPKDDVNELKGQITHKIAELKSTMAITEIQVDPRFHRHIIGRSGANIQRMQEEYKVQIRMPGNNAVGTSGWTIRIEGDPEGVKLAKTEIESMSVKLENEKTKDVILDHKYHNQLIGAQGSRVKELRNQYPDVIIMFPDLSSKSDIVQLRGPRQQVDQVAVKLNKFIQEVIENNYTKDVKIFKQYHKNIIGKGGVNIRKIREEMNIRIDFPDEHSDSDKIRLTGKKENVEEAAKRIEAMQAELISIKEDTISIPQRLHISLIGTRGKLIKCIQQECGGVQIQFPASDSNSDIIKIRGPESDVDKAXXXXXXXXXXXXXXXHQDSVSAKSEFHKFLIGRKGAQLAEFRKRHAVMLIFPDSEDTNKDTIQIIGAKEAVQKAKEELEVTIKSLENEIEKYITIDTKWHKHFFKKRQAVMEEISREFGGVRIFFPKQDAVENIDQVRVIGPKGCVEAAVVRIEDIIENLEAQTSLSVFIEQKHHRNLITRNMMEIKSIQSNYDVTIKF 2864
            Y + FPPLP  N    P     +  +I   ++S +TQ   VPL ER+F         +   Q KIC  + QK G  IEL S  KDQ L + ++G  + V  A++ +  +LQTQ    + +PKE+H++I+GRNG  L+++E  + T + IPR  + ++ I I GTKEGI+KAR EI    AE+ K A ERI+I K F+PFI+G ++  + ++ + T A++NIPPPSV  +EI+I+GEK+ V QA   I+ IYE+ K+ ++++++ + KSQH Y+IG +G+ + EI + TGVS+EMPS +S+ +TI+L G  E L PAL+ V  K+ S+  +++ AP WLHRFIIGK+G N++++ +    V I F +  D I IEGP ++V++ + Q+   I +L   M  TEI VD +FHRH+IG+SG+NI R+++ YKV +R+P ++        IRIEGDP+GV LA  E+  M+ ++ENE+TKD+I++HK H  +IG +G R+KE+R ++ +VII FPD + KSDIVQLRGP+ +V++ A  + K + E+IENNY+  V IFKQ+HKNIIGKGG NI+KIREE N +ID P E+S+S+ I +TGKK + E A +++ A+Q EL +IKE  ++IP +LH SLIG +G+L++ I +ECGGV I FP+  S SD + IRGP+ +VD+A KQL++L+E+  + S    V AK E+H+FLIGR GA + + R +    ++FP S+D +++ I IIG ++AV+ A++EL   IK+L++ +E  +T+D K H+HF  +R  V+ +++ E+GGV +  P+       D+V + G K CVE A  RI +I+++LE+Q ++   I QK+HR ++     +++ +  +YDV IKF
Sbjct:   40 YFEAFPPLPEKNQADVPTAPLGAWNKIRPLRSSVITQVFHVPLEERKFKEMNQTQFGEGGEQGKICLDIMQKTGAHIEL-SLAKDQGLSIMVTGKHEFVMKARKEIVAKLQTQATAMVAIPKEHHRYIIGRNGEKLQDLELRTATKIQIPRPDDTSNQIKITGTKEGIEKARHEIQLTSAEQDKRAVERISIDKVFHPFISGPHSRIVTEMMQETGARVNIPPPSVNKDEIVITGEKEAVAQAAARIRDIYEEKKRKTTTISVEVKKSQHKYIIGPRGNTLQEILDLTGVSVEMPSVESNSETIILRGEQEKLGPALTQVYAKASSVACMDVYAPAWLHRFIIGKKGQNISRISQNLPKVHIEFTDGEDKITIEGPTEEVHQAQAQMEEIIKDLCGRMDFTEITVDQKFHRHLIGKSGSNINRIKDLYKVLVRIPPDH---DKNNLIRIEGDPQGVHLAAKELLEMATRMENERTKDLIIEHKLHRAIIGQKGERIKEVREKFLEVIINFPDPAQKSDIVQLRGPKNEVEKCAKFMAKLVAELIENNYSISVPIFKQFHKNIIGKGGANIKKIREETNTKIDLPTENSNSEMIVITGKKAHCEAAREKVLAIQKELANIKEADVTIPAKLHNSLIGAKGRLVRAIMEECGGVHIHFPSEGSGSDKVTIRGPQPEVDRACKQLMQLAEEKQVNSFTIEVRAKPEYHRFLIGRGGANIRKVRDKTGARIVFPASDDKDQELITIIGKEDAVKDAEKELTALIKNLDDVVEDSMTVDVKHHRHFVARRCQVLRDLADEYGGVTVSLPRTGV--KSDKVVLKGAKECVEGAKKRILEIVDDLESQVTIECVIAQKYHRTVMGAKGSKVQQVTKDYDVQIKF 910          

HSP 2 Score: 245.358 bits (625), Expect = 2.819e-67
Identity = 194/686 (28.28%), Postives = 361/686 (52.62%), Query Frame = 3
Query:  423 KICQTVAQKCG--VSIELNSGNKDQNLMVFISGPQDNVSNA----KRILTKEXXXXXXXXMKVPKEYHKFILGRNGASLREIESGSNTNVTIPRSIENNDIITIFGTKEGIDKARAEINQIVAERSKLATERITIPKRFYPFINGSNNSKIYKIREMTNAKXXXXXXXXXXXXXXXXGEKDGVYQALEIIQKIYEDTKKCSSSLNLPIPKSQHCYVIGAKGSGIAEIFERTGVSIEMPSQDSDDDTIVLYG--------PNEFLAPALSMVIQKSESMIRVNIEAPNWLHRFIIGKQGSNLNKLMEKYEHVFINFP---ENSDLIVIEGPKDDVNELKGQITHKIAELKSTMAITEIQVDPRFHRHIIGRSGANIQRMQEEYKVQIRMPGNNAVGTSGWTIRIEGDPEGVKLAKTEIESMSVKLENEKTKDVILDHKYHNQLIGAQGSRVKELRNQYPDVIIMFPDLSSKSDIVQLRGPRQQVDQVAVKLNKFIQEVIENNYTKDVKIFKQYHKNIIGKGGVNIRKIREEMNIRIDFP-DEHSDSDKIRLTGKKENVEEAAKRIEAMQAELISIKEDTISIPQRLHISLIGTRGKLIKCIQQECGGVQIQFPASDSNSDIIKIRGPESDVDKAXXXXXXXXXXXXXXXHQDSVSAKSEFHKFLIGRKGAQLAEFRKRHAVMLIFPD 2426
            +I   + Q+ G  V+I   S NKD+   + I+G ++ V+ A    + I  ++ +  T + ++V K  HK+I+G  G +L+EI   +  +V +P    N++ I + G +E +  A   + Q+ A+ S +A   +  P   + FI G     I +I +  N        +   ++I I G  + V+QA   +++I +D         + + +  H ++IG  GS I  I +   V + +P     ++ I + G          E L  A  M  ++++ +I   IE  + LHR IIG++G  + ++ EK+  V INFP   + SD++ + GPK++V +    +   +AEL        + +  +FH++IIG+ GANI++++EE   +I +P  N   ++   I I G     + A+ ++ ++  +L N K  DV +  K HN LIGA+G  V+ +  +   V I FP   S SD V +RGP+ +VD+   +L +  +E   N++T +V+   +YH+ +IG+GG NIRK+R++   RI FP  +  D + I + GK++ V++A K + A+   L  + ED++++  + H   +  R ++++ +  E GGV +  P +   SD + ++G +  V+ AKK++LE+ +        + V A+ ++H+ ++G KG+++ +  K + V + F D
Sbjct:  244 RIVTEMMQETGARVNIPPPSVNKDE---IVITGEKEAVAQAAARIRDIYEEKKRKTTTISVEVKKSQHKYIIGPRGNTLQEILDLTGVSVEMPSVESNSETIILRGEQEKLGPA---LTQVYAKASSVACMDVYAPAWLHRFIIGKKGQNISRISQ--NLPKVHIEFTDGEDKITIEGPTEEVHQAQAQMEEIIKDLCGRMDFTEITVDQKFHRHLIGKSGSNINRIKDLYKVLVRIPPDHDKNNLIRIEGDPQGVHLAAKELLEMATRMENERTKDLI---IE--HKLHRAIIGQKGERIKEVREKFLEVIINFPDPAQKSDIVQLRGPKNEVEKCAKFMAKLVAELIENNYSISVPIFKQFHKNIIGKGGANIKKIREETNTKIDLPTEN---SNSEMIVITGKKAHCEAAREKVLAIQKELANIKEADVTIPAKLHNSLIGAKGRLVRAIMEECGGVHIHFPSEGSGSDKVTIRGPQPEVDRACKQLMQLAEEKQVNSFTIEVRAKPEYHRFLIGRGGANIRKVRDKTGARIVFPASDDKDQELITIIGKEDAVKDAEKELTALIKNLDDVVEDSMTVDVKHHRHFVARRCQVLRDLADEYGGVTVSLPRTGVKSDKVVLKGAKECVEGAKKRILEIVDDLESQVTIECVIAQ-KYHRTVMGAKGSKVQQVTKDYDVQIKFKD 912          

HSP 3 Score: 221.861 bits (564), Expect = 1.199e-59
Identity = 215/838 (25.66%), Postives = 389/838 (46.42%), Query Frame = 3
Query: 1263 GKQGSNLNKLMEKY-EHVFINFPENSDL-IVIEGPKDDVNELKGQITHKIAELKSTMAITEIQVDPRFHRHIIGRSGANIQRMQEEYKVQIRMPGNNAVGTSGWTIRIEGDPEGVKLAKTEIESMSVKLENEKTKDVILDHKYHNQLIGAQGSRVKELRNQYPDVIIMFPDLSSKSDIVQLRGPRQQVDQVAVKLNKFIQEVIENNYTKDVKIFKQYHKNIIGKGGVNIRKIREEMNIRIDFPDEHSDSDKIRLTGKKENVEEAAKRIEAMQAELISIKEDTISIPQRLHISLIGTRGKLIKCIQQECGGVQIQFPASDSNSDIIKIRGPESDVDKAXXXXXXXXXXXXXXXHQDSVSAKSEFHKFLIGRKGAQLAEFRKRHAVMLIFPDSEDTNKDTIQIIGAKEAVQKAKEELEVTIKSLENEIEKYITIDTKWHKHFFKKRQAVMEEISREFGGVRIFFPKQDAVENIDQVRVIGPKGCVEAAVVRIEDIIENL-EAQTSLSVFIEQKHHRNLITRNMMEIKSIQSNYDVTIKFPNRDLSSKPGENGMEEIHLNGNGDVNIETMEEVDSTLESEQNNPANWVTISGRKENCESAEDALL----ELVPITE-DVPLANEFHRNFIGQKGQGINTFSTK-HNVVVNIPPANKCSDFISIKGPRVNIIDAKAGLDELITMWENEKQDRIARNYENHVTVPIVFHRNIIGQRGANIEIFRTKFNVSIQIPDQNSKSEE-ITIRGYEEDVKKAEEELISMVEKWKAQVKEELHIPRDVHPQLIGTRGIALRKLRDQF-KVEINFPNRNVDDEKAHLVEVIGDKENVDKCCDILVERANEL 3743
            G+QG     +M+K   H+ ++  ++  L I++ G  + V + + +I  K+     T A   + +    HR+IIGR+G  +Q ++     +I++P  +        I+I G  EG++ A+ EI+  S + +    + + +D  +H  + G     V E+  +    + + P   +K +IV + G ++ V Q A ++    +E      T  V++ K  HK IIG  G  +++I +   + ++ P   S+S+ I L G++E +  A  ++ A  + +  +    +  P  LH  +IG +G+ I  I Q    V I+F       D I I GP  +V +A+ Q+ E+ +          ++   +FH+ LIG+ G+ +   +  + V++  P   D N + I+I G  + V  A +EL      +ENE  K + I+ K H+    ++   ++E+  +F  V I FP  D  +  D V++ GPK  VE     +  ++  L E   S+SV I ++ H+N+I +    IK I+   +  I  P                                       +N+ +  + I+G+K +CE+A + +L    EL  I E DV +  + H + IG KG+ +     +   V ++ P     SD ++I+GP+  +  A     +L+ + E EKQ     ++   V     +HR +IG+ GANI   R K    I  P  + K +E ITI G E+ VK AE+EL ++++     V++ + +    H   +  R   LR L D++  V ++ P   V  +K   V + G KE V+     ++E  ++L
Sbjct:   99 GEQGKICLDIMQKTGAHIELSLAKDQGLSIMVTGKHEFVMKARKEIVAKL----QTQATAMVAIPKEHHRYIIGRNGEKLQDLELRTATKIQIPRPDDTSNQ---IKITGTKEGIEKARHEIQLTSAEQDKRAVERISIDKVFHPFISGPHSRIVTEMMQETGARVNIPPPSVNKDEIV-ITGEKEAVAQAAARIRDIYEEKKRKTTTISVEVKKSQHKYIIGPRGNTLQEILDLTGVSVEMPSVESNSETIILRGEQEKLGPALTQVYAKASSVACMD---VYAPAWLHRFIIGKKGQNISRISQNLPKVHIEF---TDGEDKITIEGPTEEVHQAQAQMEEIIKDLCGRMDFTEITVDQKFHRHLIGKSGSNINRIKDLYKVLVRIPPDHDKN-NLIRIEGDPQGVHLAAKELLEMATRMENERTKDLIIEHKLHRAIIGQKGERIKEVREKFLEVIINFP--DPAQKSDIVQLRGPKNEVEKCAKFMAKLVAELIENNYSISVPIFKQFHKNIIGKGGANIKKIREETNTKIDLPT--------------------------------------ENSNSEMIVITGKKAHCEAAREKVLAIQKELANIKEADVTIPAKLHNSLIGAKGRLVRAIMEECGGVHIHFPSEGSGSDKVTIRGPQPEVDRA---CKQLMQLAE-EKQ---VNSFTIEVRAKPEYHRFLIGRGGANIRKVRDKTGARIVFPASDDKDQELITIIGKEDAVKDAEKELTALIKNLDDVVEDSMTVDVKHHRHFVARRCQVLRDLADEYGGVTVSLPRTGVKSDK---VVLKGAKECVEGAKKRILEIVDDL 871          
BLAST of High density lipoprotein binding protein (Vigilin) vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000279.1 (pep scaffold:Pmarinus_7.0:GL479126:30633:36553:-1 gene:ENSPMAG00000000249.1 transcript:ENSPMAT00000000279.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 162.155 bits (409), Expect = 2.843e-44
Identity = 100/284 (35.21%), Postives = 155/284 (54.58%), Query Frame = 3
Query: 3099 EFHRNFIGQKGQGINTFSTKHNVVVNIPPANKCSDFISIKGPRVNIIDAKAGLDELITMWENEKQDRIARNYENHVTVPIVFHRNIIGQRGANIEIFRTKFNVSIQIPDQNSKSE-----EITIRGYEEDVKKAEEELISMVEKWKAQVKEELHIPRDVHPQLIGTRGIALRKLRDQFKVEINFPNRNVDDEKAHLVEVIGDKENVDKCCDILVERANELLNEWEERNQVREVKNLIKDRENINSSSNIKEKGPGFLLTGAPWQQ---RVPDASSNVDFPKIDA 3926
            +FHR  IGQKG GI     ++ V + IPP++  SD I + G   N   AKAGL         E++DR  R ++  V+V   +H  IIG++GA I   R  ++V+IQ P+++ +++      ITI GYE + + A E ++ +V +++  V  ++ + R VH +LIG RG A+RK+ D++KVEI+FP    DD    LV V G  ENVD   D L+    E L +  E     E ++ +K   ++ +    K    GF++  APW Q   + PD +S+ +FP   A
Sbjct:   16 DFHRYIIGQKGTGIRKMMEEYEVNIAIPPSDMQSDVIKVTGLLPNAERAKAGLLSRAKELLAEQEDRALRGFKLTVSVDSKYHPKIIGRKGAVISQIRKDYDVNIQFPEKDGENQILPQDAITITGYERNAESAREAILKIVGEFEEMVNRDVTLDRRVHSRLIGARGKAIRKIMDEYKVEIHFPQPTSDD--PDLVTVTGLPENVDNAVDYLLNLEEEYLMDVVESE---EAQSYVKPSRHVEAP---KAPAKGFVVRDAPWDQSASQAPDMTSSEEFPSFGA 291          

HSP 2 Score: 89.7373 bits (221), Expect = 1.825e-19
Identity = 66/223 (29.60%), Postives = 112/223 (50.22%), Query Frame = 3
Query: 1458 FHRHIIGRSGANIQRMQEEYKVQIRMPGNNAVGTSGWTIRIEGDPEGVKLAKTEIESMSVKLENEKTK--------DVILDHKYHNQLIGAQGSRVKELRNQYPDVIIMFPDLSSKS-----DIVQLRGPRQQVDQVAVKLNKFIQEVIENNYTKDVKIFKQYHKNIIGKGGVNIRKIREEMNIRIDFPDEHSDS-DKIRLTGKKENVEEAAKRIEAMQAELI 2084
            FHR+IIG+ G  I++M EEY+V I +P ++        I++ G     + AK  + S + +L  E+           V +D KYH ++IG +G+ + ++R  Y DV I FP+   ++     D + + G  +  +     + K + E  E    +DV + ++ H  +IG  G  IRKI +E  + I FP   SD  D + +TG  ENV+ A   +  ++ E +
Sbjct:   17 FHRYIIGQKGTGIRKMMEEYEVNIAIPPSDMQSD---VIKVTGLLPNAERAKAGLLSRAKELLAEQEDRALRGFKLTVSVDSKYHPKIIGRKGAVISQIRKDY-DVNIQFPEKDGENQILPQDAITITGYERNAESAREAILKIVGE-FEEMVNRDVTLDRRVHSRLIGARGKAIRKIMDEYKVEIHFPQPTSDDPDLVTVTGLPENVDNAVDYLLNLEEEYL 234          

HSP 3 Score: 86.2705 bits (212), Expect = 2.283e-18
Identity = 68/228 (29.82%), Postives = 118/228 (51.75%), Query Frame = 3
Query: 1245 LHRFIIGKQGSNLNKLMEKYEHVFINFPEN---SDLIVIEGPKDDVNELKGQITHKIAELKS--------TMAITEIQVDPRFHRHIIGRSGANIQRMQEEYKVQIRMP---GNNAVGTSGWTIRIEGDPEGVKLAKTEIESMSVKLENEKTKDVILDHKYHNQLIGAQGSRVKELRNQYPDVIIMFPDLSSKS-DIVQLRGPRQQVDQVAVKL----NKFIQEVIEN 1871
             HR+IIG++G+ + K+ME+YE V I  P +   SD+I + G   +    K  +  +  EL +           +T + VD ++H  IIGR GA I +++++Y V I+ P   G N +      I I G     + A+  I  +  + E    +DV LD + H++LIGA+G  ++++ ++Y  V I FP  +S   D+V + G  + VD     L     +++ +V+E+
Sbjct:   17 FHRYIIGQKGTGIRKMMEEYE-VNIAIPPSDMQSDVIKVTGLLPNAERAKAGLLSRAKELLAEQEDRALRGFKLT-VSVDSKYHPKIIGRKGAVISQIRKDYDVNIQFPEKDGENQILPQD-AITITGYERNAESAREAILKIVGEFEEMVNRDVTLDRRVHSRLIGARGKAIRKIMDEY-KVEIHFPQPTSDDPDLVTVTGLPENVDNAVDYLLNLEEEYLMDVVES 240          

HSP 4 Score: 79.337 bits (194), Expect = 4.795e-16
Identity = 61/212 (28.77%), Postives = 104/212 (49.06%), Query Frame = 3
Query: 1905 YHKNIIGKGGVNIRKIREEMNIRIDFPDEHSDSDKIRLTGKKENVEEAAKRIEAMQAELISIKED--------TISIPQRLHISLIGTRGKLIKCIQQECGGVQIQFPASDSNS-----DIIKIRGPESDVDKAXXXXXXXXXXXXXXXHQDSVSAKSEFHKFLIGRKGAQLAEFRKRHAVMLIFPDSEDTNKDTIQIIGAKEAVQKAKEEL 2501
            +H+ IIG+ G  IRK+ EE  + I  P     SD I++TG   N E A   + +   EL++ +ED        T+S+  + H  +IG +G +I  I+++   V IQFP  D  +     D I I G E + + A++ +L++  +   + ++D V+     H  LIG +G  + +    + V + FP     + D + + G  E V  A + L
Sbjct:   17 FHRYIIGQKGTGIRKMMEEYEVNIAIPPSDMQSDVIKVTGLLPNAERAKAGLLSRAKELLAEQEDRALRGFKLTVSVDSKYHPKIIGRKGAVISQIRKDY-DVNIQFPEKDGENQILPQDAITITGYERNAESAREAILKIVGEFEEMVNRD-VTLDRRVHSRLIGARGKAIRKIMDEYKVEIHFPQPTSDDPDLVTVTGLPENVDNAVDYL 226          

HSP 5 Score: 74.3294 bits (181), Expect = 2.910e-14
Identity = 65/228 (28.51%), Postives = 106/228 (46.49%), Query Frame = 3
Query: 2121 LHISLIGTRGKLIKCIQQECGGVQIQFPASDSNSDIIKIRG--PESDVDKAXXXXXXXXXXXXXXXH-----QDSVSAKSEFHKFLIGRKGAQLAEFRKRHAVMLIFPDSEDTN----KDTIQIIGAKEAVQKAKEELEVTIKSLENEIEKYITIDTKWHKHFFKKRQAVMEEISREFGGVRIFFPKQDAVENIDQVRVIGPKGCVEAAVVRIEDIIENLEAQTSLSV 2771
             H  +IG +G  I+ + +E   V I  P SD  SD+IK+ G  P ++  KA                     + +VS  S++H  +IGRKGA +++ RK + V + FP+ +  N    +D I I G +   + A+E +   +   E  + + +T+D + H      R   + +I  E+  V I FP Q   ++ D V V G    V+ AV    D + NLE +  + V
Sbjct:   17 FHRYIIGQKGTGIRKMMEEYE-VNIAIPPSDMQSDVIKVTGLLPNAERAKAGLLSRAKELLAEQEDRALRGFKLTVSVDSKYHPKIIGRKGAVISQIRKDYDVNIQFPEKDGENQILPQDAITITGYERNAESAREAILKIVGEFEEMVNRDVTLDRRVHSRLIGARGKAIRKIMDEY-KVEIHFP-QPTSDDPDLVTVTGLPENVDNAV----DYLLNLEEEYLMDV 237          

HSP 6 Score: 71.633 bits (174), Expect = 1.930e-13
Identity = 62/229 (27.07%), Postives = 108/229 (47.16%), Query Frame = 3
Query: 1041 HCYVIGAKGSGIAEIFERTGVSIEMPSQDSDDDTIVLYG--PNE------FLAPALSMVIQKSESMIR---VNIEAPNWLHRFIIGKQGSNLNKLMEKYEHVFINFPENS--------DLIVIEGPKDDVNELKGQITHKIAELKSTMAITEIQVDPRFHRHIIGRSGANIQRMQEEYKVQIRMPGNNAVGTSGWTIRIEGDPEGVKLAKTEIESMSVKLENEKTKDVI 1670
            H Y+IG KG+GI ++ E   V+I +P  D   D I + G  PN        L+ A  ++ ++ +  +R   + +   +  H  IIG++G+ ++++ + Y+ V I FPE          D I I G + +    +  I   + E +  M   ++ +D R H  +IG  G  I+++ +EYKV+I  P   +       + + G PE V  A   +    + LE E   DV+
Sbjct:   18 HRYIIGQKGTGIRKMMEEYEVNIAIPPSDMQSDVIKVTGLLPNAERAKAGLLSRAKELLAEQEDRALRGFKLTVSVDSKYHPKIIGRKGAVISQIRKDYD-VNIQFPEKDGENQILPQDAITITGYERNAESAREAILKIVGEFEE-MVNRDVTLDRRVHSRLIGARGKAIRKIMDEYKVEIHFPQPTSDDPD--LVTVTGLPENVDNAVDYL----LNLEEEYLMDVV 238          

HSP 7 Score: 64.6994 bits (156), Expect = 3.711e-11
Identity = 54/204 (26.47%), Postives = 90/204 (44.12%), Query Frame = 3
Query: 2763 LSVFIEQKHHRNLITRNMMEIKSIQSNYDVTIKFPNRDLSSKPGENGMEEIHLNGNGDVNIETMEEVDSTLESEQNNPANWVTISGRKENCESAEDALLELVP-----ITEDVPLANEFHRNFIGQKGQGINTFSTKHNVVVNIP-PANKCSDFISIKGPRVNIIDAKAGLDELITMWENEKQDRI----ARNY---ENHVTVP 3335
            L+V ++ K+H  +I R    I  I+ +YDV I+FP +D     GEN                            Q  P + +TI+G + N ESA +A+L++V      +  DV L    H   IG +G+ I     ++ V ++ P P +   D +++ G   N+ +A   +D L+ + E    D +    A++Y     HV  P
Sbjct:   89 LTVSVDSKYHPKIIGRKGAVISQIRKDYDVNIQFPEKD-----GEN----------------------------QILPQDAITITGYERNAESAREAILKIVGEFEEMVNRDVTLDRRVHSRLIGARGKAIRKIMDEYKVEIHFPQPTSDDPDLVTVTGLPENVDNA---VDYLLNLEEEYLMDVVESEEAQSYVKPSRHVEAP 256          

HSP 8 Score: 51.6026 bits (122), Expect = 6.320e-7
Identity = 45/196 (22.96%), Postives = 95/196 (48.47%), Query Frame = 3
Query:  600 EYHKFILGRNGASLREIESGSNTNVTIPRSIENNDIITIFGTKEGIDKARAEI----NQIVAERSKLATE----RITIPKRFYPFINGSNNSKIYKIRE-----MTNAKXXXXXXXXXXXXXXXXGEKDGVYQALEIIQKIYEDTKKCSSSLNLPIPKSQHCYVIGAKGSGIAEIFERTGVSIEMPSQDSDDDTIV 1148
            ++H++I+G+ G  +R++      N+ IP S   +D+I + G     ++A+A +     +++AE+   A       +++  +++P I G   + I +IR+     +   + +     +  + I I+G +     A E I KI  + ++  +  ++ + +  H  +IGA+G  I +I +   V I  P   SDD  +V
Sbjct:   16 DFHRYIIGQKGTGIRKMMEEYEVNIAIPPSDMQSDVIKVTGLLPNAERAKAGLLSRAKELLAEQEDRALRGFKLTVSVDSKYHPKIIGRKGAVISQIRKDYDVNIQFPEKDGENQILPQDAITITGYERNAESAREAILKIVGEFEEMVNR-DVTLDRRVHSRLIGARGKAIRKIMDEYKVEIHFPQPTSDDPDLV 210          
BLAST of High density lipoprotein binding protein (Vigilin) vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007662.1 (pep scaffold:Pmarinus_7.0:GL477618:56973:78552:1 gene:ENSPMAG00000006861.1 transcript:ENSPMAT00000007662.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 50.8322 bits (120), Expect = 2.477e-6
Identity = 78/338 (23.08%), Postives = 142/338 (42.01%), Query Frame = 3
Query: 1437 EIQVDPRFHRHIIGRSGANIQRMQEEYKVQIRM-PGNNAVGTSGWTIRIEGDPEGVKLAKTEIESMSVKLEN--------EKTKDVILDHKYHNQLIGAQGSRVKELRNQYPDVIIMFPDLSSKSDI---VQLRGPRQQVDQVAVKLNKFIQE----------VIENNYTKDVKI-FKQYHKN-IIGKGGVNIRKIREEMNIRIDF-PDEHSDSDKI-RLTGKKENVEEAA----KRIEAMQAELISIKED---------------------------TISIPQRLHISLIGTRGKLIKCIQQECGG-VQIQ---FPASDSNSDIIKIRGPESDVDKA 2267
            E+++  +    IIGR G  + R+Q E   +I++ P  +A G    T  + G PE ++ AK+ I+ +  +  N        +   ++I+       +IG  G  +++L+++    ++M  D    S +   +++ G   +V Q    + +F+++                 + VKI   ++    +IG+ G  I+K++ E  +RI F PD+ S  +++ ++ G  EN + AA    + I  MQ                                    T ++P      +IG  G+ IK I Q  G  V++Q    P +D N  I  IRG    VD A
Sbjct:    4 EMKIPDKMVGFIIGRGGEQVSRLQTETGCKIQISPVVDATGLMERTCMLMGPPEAIQHAKSLIDQIIERCRNGGPSENGADGMVEIIVPADKVGLVIGKGGETIRQLQDRAGVKMVMIQDNRQNSGVDKPLRITGDPYKVQQAKEMVIEFLRKEDHRERFGEFAGRTGGRESVKIAVPRFAVGVVIGRSGDMIKKLQNEAGVRIQFQPDDGSGPERMAQIMGVPENCQRAAMMIIELINGMQMREGPPGGMGPRGRGGRGRGFGDWSPGPPGGMQDQITYTVPAEKCGIIIGKGGETIKHISQTSGARVELQRNPPPNTDPNIRIFLIRGSPQQVDHA 341          
BLAST of High density lipoprotein binding protein (Vigilin) vs. Ensembl Yeast
Match: SCP160 (Essential RNA-binding G protein effector of mating response pathway; ligand-activated RNA-binding protein that delivers RNAs involved in polarization and perpetualizing mating signal to shmoo tip during pheromone signaling; Scp160p-mediated RNA trafficking essential for chemotropism and successful mating; mainly associated with nuclear envelope and ER, interacts in mRNA-dependent manner with translating ribosomes via multiple KH domains, similar to vertebrate vigilins [Source:SGD;Acc:S000003616])

HSP 1 Score: 140.969 bits (354), Expect = 5.258e-34
Identity = 125/448 (27.90%), Postives = 225/448 (50.22%), Query Frame = 3
Query:  948 GVYQALEIIQKIYE---DTKKCSSSLNLPIPKSQHCYVIGAKGSGIAEIFERTGVSIEMPSQD----SDDDTI--VLYGPNEFLAPA---LSMVIQKSESMIRVNIEAPNWLHRFIIGKQGSNLNKLMEKYEHVFINFPENSDLIVIEGPKDDVN----ELKGQITHKIAELKSTMAITEIQVDPRFHRHIIGRSGANIQRMQEEYKVQI----RMPGNNAVGTSGWTIRIEGDPEGVKLAKTEIESMSVKLENEKTKDVILDHKYHNQLIGAQGSRVKEL---------RNQYPDVIIMFPDLSSKSDIVQLRGPRQQVDQVAVKLNKFIQEVIENNYTKDVKIFKQYHKNIIGKGGVNIRKIREEMNIRIDFPDEHSDSDKIRLTGKKENVEEAAKRIEAMQAELISIKED-TISIPQRLHISLIGTRGKLIKCIQQECGGVQIQF 2201
            G  +A +   KI+E   ++    S + + IP +    +IG KGS + +I E+    I++P+++    S D T+   L G    L  A   L+   +K   +I   +  P   H  +IG  G+  N+L EKY +VFINFP +++++ I GP   VN    ELK  +  ++      +     +  PR    IIG++G NI  ++ EY V++    +     A  T    + I G  + +K A   +ES+  +  +  T+ + +DHKYH  ++G+ G  ++E+         RN+  D+    P+  S++  + ++GP++ V +V  ++NK +++  EN+ TK + I  +    +IG GG+  R++  E NI +  P++   S KI +TG  ENVE+A K+I     E+I    D  + +P  ++   +  RG  I+ ++ +   V ++F
Sbjct:  612 GDEKAAKAANKIFESILNSPSSKSKMTVNIPANSVARLIGNKGSNLQQIREKFACQIDIPNEENNNASKDKTVEVTLTGLEYNLTHAKKYLAAEAKKWADIITKELIVPVKFHGSLIGPHGTYRNRLQEKY-NVFINFPRDNEIVTIRGPSRGVNKAHEELKALLDFEMENGHKMVINVPAEHVPR----IIGKNGDNINDIRAEYGVEMDFLQKSTDPKAQETGEVELEITGSRQNIKDAAKRVESIVAEASDFVTEVLKIDHKYHKSIVGSGGHILREIISKAGGEEIRNKSVDI----PNADSENKDITVQGPQKFVKKVVEEINKIVKDA-ENSVTKTIDIPAERKGALIGPGGIVRRQLESEFNINLFVPNKDDPSGKITITGAPENVEKAEKKI---LNEIIRENFDREVDVPASIY-EYVSERGAFIQKLRMDL-SVNVRF 1044          

HSP 2 Score: 134.806 bits (338), Expect = 4.489e-32
Identity = 215/984 (21.85%), Postives = 411/984 (41.77%), Query Frame = 3
Query:  348 LTVPLAERRFSNREANNSVKNDAQK----------KICQTVAQKCGVSIELNSGNKDQNLMVFISGPQDNVSNAKRILTKEXXXXXXXXMKVPKEYHKFILGRNGASLREIESGSNTNVTIPRSIENNDI----------ITIFGTKEGIDKARAEINQIVAERSKLATERITIP-KRFYPFINGSNNSKIYKIREMTNAKXXXXXXXXXXXXXXXXGEKDGVYQALEIIQKIYEDTKKCSSSLN---LPIPKSQHCYVIGAKGSGIAEIFERTGVSIEMPSQDSDDDTIVLYGPNEFLAPALSMVIQKSESMIRVNIE-----------APNWLHRFIIGKQGSNLNKLMEKYEHVFINFPENSDL-------IVIEGPKDDVNELKGQITHKIAELKSTMAITEIQVDPRFHRHIIGRSGANIQRMQEEYKVQIRM----PGNNAVGTSGWT------IRIEGDPEGVKLAKTEIESMSVKLENEKTKDVILDHKYHNQLIGAQGSRVKELRNQYPDVIIMFPDLSSKSDIVQLRGPRQQVDQVAVK--------LNKFIQEVIENNYTKD---VKIFKQYHKNIIGKGGVNIRKIREEMNIRIDFPDE---HSDSDK---IRLTGKKENVEEAAKRIEAMQAELISIKEDTISIPQRLHISLIGTRGKLIKCIQQECGGVQIQFPASDSNSDIIKIRGPESDVDKAXXXXXXXXXXXXXXXHQDSVSAKSEFHKFLIGRKGAQLAEFRKRHAVMLIF------PDSEDTNKDTIQIIGAKEAVQKAKEELEVTIKSLENEIEKYITIDTKWHKHFFKKRQAVMEEISREFGGVRIF-----FPKQDAVENIDQVRVIGPKGCVEAAVVRIEDIIENLEAQTSLSVFIEQKHHRNLITRNMMEIKSIQSNYDVTIKFPNRDLSSKPGENGMEEIHLNGNGDVNIETMEEVDSTLESEQNNPANWVTISGRKENCESAEDALL 3059
            LT  L  +R  ++    +   D Q           +I Q+V +   VS+E       +  +V  SG   NV  AKR L K+L       ++VP +    I+G  G ++REI       + + + +  N            +++FG  E ++ A+A+I  IV E +K AT ++ +  +++ P+I+ S  +      E+            +S +I+I G ++        IQ      KK +S+L+   + IP S+  ++I A+     E+ E+  V +  PS   DD+ +   G  + +  A++     S+S +  +++           A N +  F    + S L  L E + +V I+ P    L       I I    D+ N++K  +  ++    + +  +E  V       + G S  +     E     ++     P +N++     T        IE     +  A   + S+  K  N +TK      +  + L     +  K          ++  D+S +   +Q++    + +Q+ V+         NK  + ++ +  +K    V I       +IG  G N+++IRE+   +ID P+E   ++  DK   + LTG + N+  A K + A   +   I    + +P + H SLIG  G     +Q++   V I FP    +++I+ IRGP   V+KA ++L  L +  +   H+  ++  +E    +IG+ G  + + R  + V + F      P +++T +  ++I G+++ ++ A + +E  +    + + + + ID K+HK        ++ EI  + GG  I       P  D+ EN D + V GP+  V+  V  I  I+++ E   + ++ I  +    LI    +  + ++S +++ +  PN+D                                      +P+  +TI+G  EN E AE  +L
Sbjct:   95 LTTGLGAKRMRSKNIQEAFTLDLQSQLSITKPELSRIVQSVKKNHDVSVESTLSKNARTFLV--SGVAANVHEAKRELVKKLTKPINAVIEVPSKCKASIIGSGGRTIREISDAYEVKINVSKEVNENSYDEDMDDTTSNVSLFGDFESVNLAKAKILAIVKEETKNATIKLVVEDEKYLPYIDVSEFASDEGDEEV------KVQFYKKSGDIVILGPREKAKATKTSIQDYL---KKLASNLDEEKVKIP-SKFQFLIDAE-----ELKEKYNVIVTFPST-PDDELVSFVGLRDKVGEAITYARSSSKSYVVESLDISKAHSKNLTHAKNLIMYFT---KYSVLKGLEESHPNVKISLPSIQSLPTAETVTIHISAKSDEANDIKA-VRKELISFVNNIPPSETLVITDLDYELFGGSIKHCLLASESSVAFVQFGDYYPNDNSILLVALTEDEDFKPSIEEIQASLNKANESLNSLRTKQNNMETKTYEFSEEVQDSLFKPSSATWK----------LIMEDISEQEGHLQIKLHTPEENQLTVRGDEKAAKAANKIFESILNSPSSKSKMTVNIPANSVARLIGNKGSNLQQIREKFACQIDIPNEENNNASKDKTVEVTLTGLEYNLTHAKKYLAAEAKKWADIITKELIVPVKFHGSLIGPHGTYRNRLQEKY-NVFINFP---RDNEIVTIRGPSRGVNKAHEELKALLDFEMENGHKMVINVPAEHVPRIIGKNGDNINDIRAEYGVEMDFLQKSTDPKAQETGEVELEITGSRQNIKDAAKRVESIVAEASDFVTEVLKIDHKYHKSIVGSGGHILREIISKAGGEEIRNKSVDIPNADS-ENKD-ITVQGPQKFVKKVVEEINKIVKDAENSVTKTIDIPAERKGALIGPGGIVRRQLESEFNINLFVPNKD--------------------------------------DPSGKITITGAPENVEKAEKKIL 1002          

HSP 3 Score: 108.612 bits (270), Expect = 4.294e-24
Identity = 199/950 (20.95%), Postives = 396/950 (41.68%), Query Frame = 3
Query:  987 EDTKKCSSSLN--LPIPKSQHCYVIGAKGSGIAEIFERTGVSIEMP--------SQDSDDDT--IVLYGPNEF--LAPALSMVIQKSES---MIRVNIEAPNWLHRFIIGKQGSNLNKLMEKYEHVFINFPENSDLIVIEGPKDDVNELKGQITHKIAELKSTMAITEIQVDPRFHRHIIGRSGANIQRMQEEYKVQIRMPG---NNAVGTSGWTIRIEGDPEGVKLAKTEIESMSVK-LENEKTKDVILDHKYHNQLIGAQGSRVKELRNQYPDVIIMFPDLSS----KSDIVQLRGPRQQVDQVAVKLNKFIQEVIENNYTKDVKIFKQYHKNIIGKGGVNIRKIREEMNIR-IDFPDEHSDSDKIRLTGKKENVEEAAKRIEAMQAELISIKED--------------TISIPQRLHISLI----GTRGKLIKCIQQECGGVQIQFPASDSNSDIIKIRGPESDVDKAXXXXXXXXXXXXXXXHQDSVSAKSEFHKFLIGRKGAQLAEFRKRHAVMLIFPDSEDTN--KDT---IQIIGAKEAVQKAKEELEVTIKSLENEIEKYITIDTKWHKHFFKKRQAVMEEISREFGGVRIFFPKQDAVENIDQVRVIGPKGCVEAAVVRIEDIIE-NLEAQTSLSVFIEQKHHRNLITRNMMEIKSIQSNYDVTIKFPNRDLSSKPGENGMEEIHLNGNGDVNIETMEEVDSTLESEQNNPANWVTISGRKENCESAEDALLELVP-----ITEDVPLANEFHRNFIGQKGQGINTFSTK------HNVVVNIPPANKCSDFISIKGPRVNIIDAKAGLDELITMWENEKQDRIARNYENHVT----VPIVFHRNIIGQRGANIEIFRTKFNVSIQIPDQNSKSEEITIRGYEEDVKKAEEELISMVEKWKAQVKEELHIPRDVHPQLIGTRGIALRKLRDQFKVEINFPN 3641
            E  KK +  +N  + +P      +IG+ G  I EI +   V I +          +D DD T  + L+G  E   LA A  + I K E+    I++ +E   +L    + +  S+     E  E V + F + S  IVI GP++     K  I   + +L S +   ++++  +F   I      + + ++E+Y V +  P    +  V   G   ++    E +  A++  +S  V+ L+  K     L H  +  +   + S +K L   +P+V I  P + S    ++  + +     + + +     + I   + N    +  +       + G G +    +  E ++  + F D + + + I L    E+ E+    IE +QA L    E               T    + +  SL      T   +++ I ++ G +QI+    + N   + +RG E    KA  ++ E    +     + +V+  +     LIG KG+ L + R++ A  +  P+ E+ N  KD    + + G +  +  AK+ L    K   + I K + +  K+H             +  ++  V I FP+ + +     V + GP   V  A   ++ +++  +E    + + +  +H   +I +N   I  I++ Y V + F  +    K  E G  E+                                I+G ++N + A   +  +V      +TE + + +++H++ +G  G  +    +K       N  V+IP A+  +  I+++GP+  +   K  ++E+         ++I ++ EN VT    +P      +IG  G       ++FN+++ +P+++  S +ITI G  E+V+KAE+++++  E  +     E+ +P  ++ + +  RG  ++KLR    V + F N
Sbjct:  169 ELVKKLTKPINAVIEVPSKCKASIIGSGGRTIREISDAYEVKINVSKEVNENSYDEDMDDTTSNVSLFGDFESVNLAKAKILAIVKEETKNATIKLVVEDEKYLPYIDVSEFASD-----EGDEEVKVQFYKKSGDIVILGPREKAKATKTSIQDYLKKLASNLDEEKVKIPSKFQFLI------DAEELKEKYNVIVTFPSTPDDELVSFVGLRDKV---GEAITYARSSSKSYVVESLDISKAHSKNLTHAKNLIMYFTKYSVLKGLEESHPNVKISLPSIQSLPTAETVTIHISAKSDEANDIKAVRKELIS-FVNNIPPSETLVITDLDYELFG-GSIKHCLLASESSVAFVQFGDYYPNDNSILLVALTED-EDFKPSIEEIQASLNKANESLNSLRTKQNNMETKTYEFSEEVQDSLFKPSSATWKLIMEDISEQEGHLQIKLHTPEENQ--LTVRGDEK-AAKAANKIFESILNSPSSKSKMTVNIPANSVARLIGNKGSNLQQIREKFACQIDIPNEENNNASKDKTVEVTLTGLEYNLTHAKKYLAAEAKKWADIITKELIVPVKFHGSLIGPHGTYRNRLQEKY-NVFINFPRDNEI-----VTIRGPSRGVNKAHEELKALLDFEMENGHKMVINVPAEHVPRIIGKNGDNINDIRAEYGVEMDFLQKSTDPKAQETGEVELE-------------------------------ITGSRQNIKDAAKRVESIVAEASDFVTEVLKIDHKYHKSIVGSGGHILREIISKAGGEEIRNKSVDIPNADSENKDITVQGPQKFV---KKVVEEI---------NKIVKDAENSVTKTIDIPAERKGALIGPGGIVRRQLESEFNINLFVPNKDDPSGKITITGAPENVEKAEKKILN--EIIRENFDREVDVPASIY-EYVSERGAFIQKLRMDLSVNVRFGN 1046          

HSP 4 Score: 87.0409 bits (214), Expect = 1.635e-17
Identity = 205/940 (21.81%), Postives = 380/940 (40.43%), Query Frame = 3
Query: 1323 FPENSDLIVIEGPKDDVNELKGQITHKIAELKSTMAITEIQVDPRFHRHIIGRSGANIQRMQEEYKVQIRMPG-------NNAVGTSGWTIRIEGDPEGVKLAKTEIESMSVKLE--NEKTKDVILDHKYHNQLIGAQGSRVKELRNQYPDVIIMFPDLSSKSDIVQLRGPRQQVDQVAVKLNKFIQEVIENNYTKDVKIFKQYHKNIIGKGGVNIRKIREEMNIRIDFPDEHSDSDKIRLTGKKENVEEAAKRIEAMQ----AELISI-KEDTISIPQRLHISLIGTRGKLIKCIQQECGGVQIQFPA-----------------SDSNSDIIKIRGPE-SDVDKAXXXXXXXXXXXXXXXHQDSVSAKSEFHKFLIGRKGAQLAEFRKRH----AVMLIFPDSEDTNKDTIQIIGAKEAVQKAKEELEVTIKSLENEIE-KYITIDTKWHKHFFKKRQA----VMEEISREFGGVRIFF--PKQDAVENIDQVRVIGPKGCVEAAVVRIEDIIENLEAQTSLSVFIEQKHHRNLITRNMMEIKSIQSNYDVTIKFPNRDLSSKPGENGMEEIHLNGNGDVNIETMEEVDSTLESEQNNPANWVTISGRKENCESAEDALLELVP-----ITEDVPLANEFHRNFIGQKGQGINTFSTKHNVVVNIPPANKCSDFISIKGPRVNIIDAKAGLDELITMWENEKQDRIARNYENHVTVPIVFHRNIIGQRGANIEIFRTKFNVSIQI------PDQNSKSE-EITIRGYEEDVKKAEEELISMVEKWKAQVKEELHIPRDVHPQLIGTRGIALRKLRDQFKVEINFPNRNVDDEKAHLVEVIGDKENVDKCCDILVERANELLNEWEERNQVREVKNLIKDREN-INSSSNIKEKGPGFLLTGAPWQQRVPDASSNVDFPKIDANGDKIAGTCLINGHSE 3974
              +N+   ++ G   +V+E K ++  K+   K   A+  I+V  +    IIG  G  I+ + + Y+V+I +         +  +  +   + + GD E V LAK +I ++ VK E  N   K V+ D KY   +       V E  +   D  +         DIV L GPR++       +  +++++  N   + VKI  ++   I      +  +++E+ N+ + FP    D + +   G ++ V EA     +       E + I K  + ++    ++ +  T+  ++K +++    V+I  P+                 SD  +DI  +R    S V+        +           S+      H  L         +F   +    +++L+    ++  K +I+ I A  ++ KA E L  ++++ +N +E K      +     FK   A    +ME+IS + G ++I    P+++      Q+ V G +   +AA    E I+ +  +++ ++V I       LI      ++ I+  +   I  PN        EN       N + D  +E                   VT++G + N   A+  L          IT+++ +  +FH + IG  G   N    K+NV +N P  N   + ++I+GP   +  A   L  L+  +E E   ++  N      VP      IIG+ G NI   R ++ V +        P      E E+ I G  +++K A + + S+V +    V E L I    H  ++G+ G  LR++  +   E    N++VD   A       D EN     DI V+   + +     +  V E+  ++KD EN +  + +I  +  G L+      +R  ++  N++      N D  +G   I G  E
Sbjct:  147 LSKNARTFLVSGVAANVHEAKRELVKKLT--KPINAV--IEVPSKCKASIIGSGGRTIREISDAYEVKINVSKEVNENSYDEDMDDTTSNVSLFGDFESVNLAKAKILAI-VKEETKNATIKLVVEDEKYLPYI------DVSEFASDEGDEEVKVQFYKKSGDIVIL-GPREKAKATKTSIQDYLKKLASNLDEEKVKIPSKFQFLI------DAEELKEKYNVIVTFPS-TPDDELVSFVGLRDKVGEAITYARSSSKSYVVESLDISKAHSKNLTHAKNLIMYFTKYSVLKGLEESHPNVKISLPSIQSLPTAETVTIHISAKSDEANDIKAVRKELISFVNNIPPSETLVITDLDYELFGGSIK-----HCLLASESSVAFVQFGDYYPNDNSILLVALTEDEDFKPSIEEIQA--SLNKANESLN-SLRTKQNNMETKTYEFSEEVQDSLFKPSSATWKLIMEDISEQEGHLQIKLHTPEEN------QLTVRGDEKAAKAANKIFESILNSPSSKSKMTVNIPANSVARLIGNKGSNLQQIREKFACQIDIPNE-------ENN------NASKDKTVE-------------------VTLTGLEYNLTHAKKYLAAEAKKWADIITKELIVPVKFHGSLIGPHGTYRNRLQEKYNVFINFPRDN---EIVTIRGPSRGVNKAHEELKALLD-FEMENGHKMVIN------VPAEHVPRIIGKNGDNINDIRAEYGVEMDFLQKSTDPKAQETGEVELEITGSRQNIKDAAKRVESIVAEASDFVTEVLKIDHKYHKSIVGSGGHILREIISKAGGE-EIRNKSVDIPNA-------DSEN----KDITVQGPQKFV-----KKVVEEINKIVKDAENSVTKTIDIPAERKGALIGPGGIVRRQLESEFNINL--FVPNKDDPSGKITITGAPE 992          

HSP 5 Score: 85.8853 bits (211), Expect = 3.503e-17
Identity = 139/579 (24.01%), Postives = 257/579 (44.39%), Query Frame = 3
Query:  450 CGVSI---ELNSGNKDQNLMVFISGPQDNVSNAKRILTKEXXXXXXXXMK---VPKEYHKFILGRNGASLREIESGSNTNVTIPRSIENNDIITIFGTKEGIDKARAEINQIVA-ERSKLATERITIPKRFYPFINGSNNSKIYKIR-------EMTNAKXXXXXXXXXXXXXXXXGEKDGVYQALEIIQKIYEDTKKCSSSLNLPIPKSQHCYVIGAKGSGIAEIFERTG------VSIEMPSQDSDDDTIVLYGPNEFLAPA---LSMVIQKSESMIRVNIEAPNWLHRFIIGKQGSNLNKLMEKYE-HVFI-NFPENSDLIVIEGPKDDVNELKGQITHKIAELKSTMAITEIQVDPRFHRHIIGRSGANIQRMQEEYKVQIRMPGNNAVGTSGWTIRIEGDPEGVKLAKTEIESMSVKLEN-EKTKDVILDHKYHNQLIGA-----QGSRVKELRNQYPDVIIMFPDLSSK---SDIVQLRGPRQQVDQVAVKLNK-FIQEVIENNYT-----KDVKIFKQYHKNIIGKGGVNIRKIREEMNIRIDFPDEHSD--SDKIRLTGKKENVEEAAKRI 2060
            C + I   E N+ +KD+ + V ++G + N+++AK+ L  E +    +  K   VP ++H  ++G +G     ++   N  +  PR   +N+I+TI G   G++KA  E+  ++  E        I +P    P I G N   I  IR       +      +         E+ I+G +  +  A + ++ I  +     + + L I    H  ++G+ G  + EI  + G       S+++P+ DS++  I + GP +F+      ++ +++ +E+ +   I+ P      +IG  G    +L  ++  ++F+ N  + S  I I G  ++V + + +I ++I  ++      E+ V    + ++  R GA IQ+++ +  V +R  GN    TS    ++   P  + L K      S + EN EKTK  I       + +GA     +G     L  +  D+  +  D   K    D       +++    AVKL K  I +     Y       D + F      I+G GG NI+KIRE  ++ I+ P   SD  +D + + G K  VE+A + +
Sbjct:  666 CQIDIPNEENNNASKDKTVEVTLTGLEYNLTHAKKYLAAEAKKWADIITKELIVPVKFHGSLIGPHGTYRNRLQEKYNVFINFPR---DNEIVTIRGPSRGVNKAHEELKALLDFEMENGHKMVINVPAEHVPRIIGKNGDNINDIRAEYGVEMDFLQKSTDPKAQETGEVELEITGSRQNIKDAAKRVESIVAEASDFVTEV-LKIDHKYHKSIVGSGGHILREIISKAGGEEIRNKSVDIPNADSENKDITVQGPQKFVKKVVEEINKIVKDAENSVTKTIDIPAERKGALIGPGGIVRRQLESEFNINLFVPNKDDPSGKITITGAPENVEKAEKKILNEI--IRENFD-REVDVPASIYEYVSER-GAFIQKLRMDLSVNVRF-GN----TSKKANKLARAPIEIPLEKV---CGSTEGENAEKTKFTI-------EEVGAPTSSEEGDITMRLTYEPIDLSSILSDGEEKEVTKDTSNDSAKKEEALDTAVKLIKERIAKAPSATYAGYVWGADTRRFNM----IVGPGGSNIKKIREAADVIINVP-RKSDKVNDVVYIRGTKAGVEKAGEMV 1216          

HSP 6 Score: 49.2914 bits (116), Expect = 4.979e-6
Identity = 125/603 (20.73%), Postives = 264/603 (43.78%), Query Frame = 3
Query:  585 MKVPKEYHKFILGRNGASLREIESGSNTNVTIPRSIENNDI-------ITIFGTKEGIDKARAEINQIVAERSKLATERITIPKRFYPFINGSNNSKIYKIREMTNAKXXXXXXXXXXXXXXXXGEKDGVYQALEIIQKIYEDTKKCSSSLNLPIPKSQHCYVIGAKGSGIAEIFERTGVSIEM-------PSQDSDDDTIVLYGPNEFLAPAL----SMVIQKSESMIRVNIEAPNWLHRFIIGKQGSNLNKLM-----EKYEHVFINFP----ENSDLIVIEGPKDDVNELKGQITHKIAELKSTMAITEIQVDPRFHRHIIGRSGANIQRMQEEYKVQIRMPGNNAVGTSGWTIRIEGDPEGVKLAKTEIESMSVKLENEKTKDVILD-HKYHNQLIGAQGSRVKELRNQYPDVIIMFPDLSSKSDIVQLRGPRQQVDQVAVKLNKFIQEVIENNYTKDVKIFKQYHKNIIGK-GGVNIRKIREEMNIRIDFPDEHSDSDKIRLTGKKENVEEAAKRIEAMQAELISIKEDTISIPQRLHIS------------LIGTRGKLIKCIQQECGGVQIQFP-ASDSNSDIIKIRGPESDVDKA 2267
            + +P      ++G  G++L++I       + IP   ENN+        +T+ G +  +  A+  +     + + + T+ + +P +F+  + G + +   +++E  N          ++E + I G   GV +A E ++ + +   +    + + +P      +IG  G  I +I    GV ++         +Q++ +  + + G  + +  A     S+V + S+ +  V ++  +  H+ I+G  G  L +++     E+  +  ++ P    EN D I ++GP+  V ++  +I   + + ++++  T I +       +IG  G   ++++ E+ + + +P  N    SG  I I G PE V+ A+ +I +  ++   ++  DV    ++Y    +  +G+ +++LR     V + F + S K++ +  R P      + + L K        N  K     ++       + G + +R   E     ID     SD ++  +T  K+   ++AK+ EA+   +  IKE     P   +              ++G  G  IK I+ E   V I  P  SD  +D++ IRG ++ V+KA
Sbjct:  639 VNIPANSVARLIGNKGSNLQQIREKFACQIDIPNE-ENNNASKDKTVEVTLTGLEYNLTHAKKYLAAEAKKWADIITKELIVPVKFHGSLIGPHGTYRNRLQEKYNV---FINFPRDNEIVTIRGPSRGVNKAHEELKALLDFEMENGHKMVINVPAEHVPRIIGKNGDNINDIRAEYGVEMDFLQKSTDPKAQETGEVELEITGSRQNIKDAAKRVESIVAEASDFVTEV-LKIDHKYHKSIVGSGGHILREIISKAGGEEIRNKSVDIPNADSENKD-ITVQGPQKFVKKVVEEINKIVKDAENSVTKT-IDIPAERKGALIGPGGIVRRQLESEFNINLFVP--NKDDPSG-KITITGAPENVEKAEKKILNEIIRENFDREVDVPASIYEY----VSERGAFIQKLRMDL-SVNVRFGNTSKKANKLA-RAP------IEIPLEKVCGSTEGENAEKTKFTIEEVGAPTSSEEGDITMRLTYEP----IDLSSILSDGEEKEVT--KDTSNDSAKKEEALDTAVKLIKERIAKAPSATYAGYVWGADTRRFNMIVGPGGSNIKKIR-EAADVIINVPRKSDKVNDVVYIRGTKAGVEKA 1212          
BLAST of High density lipoprotein binding protein (Vigilin) vs. Ensembl Nematostella
Match: EDO37476 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFJ6])

HSP 1 Score: 536.569 bits (1381), Expect = 1.405e-167
Identity = 376/1146 (32.81%), Postives = 619/1146 (54.01%), Query Frame = 3
Query:  615 ILGRNGASLREIESGSNTNVTIPRSIENNDIITIFGTKEGIDKARAEINQIVAERSKLATERITIPKRFYPFINGSNNSKIYKIREMTNAKXXXXXXXXXXXXXXXXGEKDGVYQALEIIQKIYEDTKKCSSSLNLPIPKSQHCYVIGAKGSGIAEIFERTGVSIEMPSQDSDDDTIVLYGPNEFLAPALSMVIQKSESMIR----VNIEAPNWLHRFIIGKQGSNLNKLMEKYEHVFINFP---ENSDLIVIEGPKDDVNELKGQITHKIAELKSTMAITEIQVDPRFHRHIIGRSGANIQRMQEEY-KVQIRMPGNNAVGTSGWTIRIEGDPEGVKLAKTEIESMSVKL-ENEKTKDVILDHKYHNQLIGAQGSRVKELRNQYPDVIIMFPDLSSKSDIVQLRGPRQQVDQVAVKLNKFIQEVIENNYTKDVKIFKQYHKNIIGKGGVNIRKIREEMNIRIDFPDEHSDSDKIRLTGKKENVEEAAKRIEAMQAELISIKEDTISIPQRLHISLIGTRGKLIKCIQQECGGVQIQFPASDSNSDIIKIRGPESDVDKAXXXXXXXXXXXXXXXHQDSVSAKSEFHKFLIGRKGAQLAEFRKRHAVMLIFPDSEDTNKDTIQIIGAKEAVQKAKEELEVTIKSLENEIEKYITIDTKWHKHFFKKRQAVMEEISREFGGVRIFFPKQDAVENIDQVRVIGPKGCVEAAVVRIEDIIENLEAQTSLSVFIEQKHHRNLITRNMMEIKSIQSNYDVTIKFPNRDLSSKPGENGMEEIHLNGNGDVNIETMEEVDSTLESEQNNPANWVTISGRKENCESAEDALLELVPITEDVPLANEFHRNFIGQKGQGINTFSTKHNVVVNIPPANKCSDFISIKGPRVNIIDAKAGLDELITMWENEKQDRIARNYENHVTVPIVFHRNIIGQRGANIEIFRTKFNVSIQIPDQNSKSEE---ITIRGYEEDVKKAEEELISMVEKWKAQVKEELHIPRDVHPQLIGTRGIALRKLRDQFKVEINFPNRNVDDEKAHLVEVIGDKENVDKCCDILVERANELLNEW-EERNQVREVKNLIKDRENINSSSNIKEKGPGFLLTGAPWQQR---------------VPDASSNVDFPKIDANGDKIAGTCLINGH 3968
            I+ + GAS+ E+  G + ++TI           + G  + + KAR     ++++    A   I IP+  + FI G    K  +  E++ A   I  P   S+ I I G K+GV +A   IQ I +   K +    L IPK+ H ++ G        I E+TG +I +P    + D + + G  + +A A +M+++  E   R    V+IE     H++I+G +G  +++++E    V +  P    +S+ I + G +D +    G    ++ E  +++   E+      HR IIGR G NI+++ ++  KV +             +I +EG PE V+ A+  +E+   +L  +    +  +D KYH  +IG  G+  +   ++Y  +I        + D+V LRGPR+ VD+V   L K   E++  NY  DV IFKQ+HKN+IG+GG  I+KIREE + +I+ P E SDSD I +TG K  VE A ++I A+Q EL ++ +  + IP + H S+IG +G+LI+ + ++CGGV I+FP   SNSD + IRGP+ DV+KAKKQLLEL+ +  L S+   + AK E H+FLIGR GA + + R+     ++FP ++D +K+ I IIG +EAV+ AK+EL  +IK L+N  E  + +D KWH+HF  KR  V++EI+ EFGGV + FP+     N D+V + G K CVE A  R+ +I++ LE+  ++   I Q+ HRN++      ++ + + + V IKFP+R  +        EE  +NG+G       E +D           + + I+G+KE+ E+A+  LL+LVP+TE + +  ++HR  IG KG  +     + +V ++IPPA   SD +S+ GPR N+  A   L+  +   E E +DR  R+++  V V   +H  IIG++G  I   R +++V+IQ P Q++  E    I + GY+   + A + ++ +V++ + QV  EL I   +H +LIG +G A+RKL +Q+KV+I FP +N +D     V + G +++V++  + L+    E +    EE  +   +   +      + S   +  G GF++  APW  +                PD ++ +DFP I   G+ +A    + GH
Sbjct:   88 IMAKTGASI-EVSLGKDLSLTI----------MVTGKPDTVAKAR---RLVLSQLQTQAQIEIQIPREHHKFILG-KGGKTLQTMELSTA-TKITMPRDGSDTIKIIGTKEGVDRARHEIQLISDQQAKLAFE-RLAIPKTFHPFISGPNNETANRIKEQTGAAINIPPPSVNKDELTVAGEKDGVAQAKAMILEIYEDKKRKTTTVSIEVRKSQHKYIVGPRGGTIHEILE-LTGVSVEMPPSDSDSETITLRGEQDKL----GVALTQVYEKANSVVFAEVAAPRWLHRFIIGRRGQNIRKVTQDLPKVHVEFSDEKD------SITLEGPPEQVESARESLEAFIRELIVSMAFAECNVDQKYHPHIIGKNGANGE---SRYLSLI-----HPRRHDVVSLRGPREDVDKVHAYLKKLNAELVAANYCIDVPIFKQFHKNVIGRGGTTIKKIREETDTKIELPAEGSDSDVIIITGHKAQVEAAREKILAIQNELANVTQLEVHIPSKFHNSIIGAKGRLIRSVMEDCGGVSIKFPPEGSNSDKVLIRGPKDDVEKAKKQLLELTNEKELGSYTVEIRAKPEHHRFLIGRGGASIRKVRENTGARIVFPAAKDEDKELITIIGKQEAVEAAKDELLKSIKDLDNICEGEVHVDPKWHRHFVAKRGEVLQEIAAEFGGVVVSFPRNGV--NSDRVVLKGAKECVEGARQRVMEIVQELESMVTIECVIPQEFHRNIMGAKGANVQEVTARHKVQIKFPDRSPAG-------EEPVVNGDG-------EHLDPEAPISPRK-RDIIIITGKKESAEAAKIDLLDLVPVTEQMHIPFDYHRFVIGPKGSNVRKMMDEFSVNISIPPAKDESDSVSVIGPRANVERAMKALEAKVAEIEAENEDRALRSFKMDVKVDRQYHPKIIGRKGQVITNIRKQYDVNIQFPPQDAPEESADVIGLTGYQHSCEAARDAILKIVKELEDQVSVELTIDPRIHRRLIGAKGRAVRKLMEQYKVDIRFPRQNANDP----VVISGQEQDVEEAKEQLLLLEEEYMQSVKEEIEEYDAISYYMNPPSKTSPSPPPQAGGQGFVVRDAPWNAQGGKGRPPKERDGHPPPPDTTNTMDFPSI---GNSVAPKTTVWGH 1173          

HSP 2 Score: 476.093 bits (1224), Expect = 3.058e-145
Identity = 348/1101 (31.61%), Postives = 565/1101 (51.32%), Query Frame = 3
Query:  243 YDDQFPPLPTC-NTPKIVQNSKPR-------IGQTKTSHVTQTLTVPLAERRFS-NREANNSVKNDAQKKICQTVAQKCGVSIELNSGNKDQNLMVFISGPQDNVSNAKRILTKEXXXXXXXXMKVPKEYHKFILGRNGASLREIESGSNTNVTIPRSIENNDIITIFGTKEGIDKARAEINQIVAERSKLATERITIPKRFYPFINGSNNSKIYKIREMTNAKXXXXXXXXXXXXXXXXGEKDGVYQALEIIQKIYEDTKKCSSSLNLPIPKSQHCYVIGAKGSGIAEIFERTGVSIEMPSQDSDDDTIVLYGPNEFLAPALSMVIQKSESMIRVNIEAPNWLHRFIIGKQGSNLNKLMEKYEHVFINFPENSDLIVIEGPKDDVNELKGQITHKIAELKSTMAITEIQVDPRFHRHIIGRSGAN-------IQRMQEEYKVQIRMP---------------------------------GNNAVGTSGWTIR-----------------------IEGDPEGVKLAKTEIESMSVKLENEKTKDVILDHKYHNQLIGAQGSRVKELRNQYPDVIIMFPDLSSKSDIVQLRGPRQQVDQVAVKLNKFIQEVIENNYTKDVKIFKQYHKNIIGKGGVNIRKIREEMNIRIDFP-DEHSDSDKIRLTGKKENVEEAAKRIEAMQAELISIKEDTISIPQRLHISLIGTRGKLIKCIQQECGGVQIQFPASDSNSDIIKIRGPESDVDKAXXXXXXXXXXXXXXXHQDSVSAKSEFHKFLIGRKGAQLAEFRKRHAVMLIFPDSEDTN----------------------KDTIQIIGAKEAVQKAKEELEVTIKSLENEIEKYITIDTKWHKHFFKKRQAVMEEISREFGGVRIFFPKQDAVENIDQVRVIGPKGCVEAAVVRIEDIIENLEAQT--------SLSVFIEQKHHRNLITRNMMEIKSIQSNYDVTIKFPNRDLSSKPGENGMEEIHLNGNGDVNIETMEEVDSTLESEQNNPANWVTISGRKENCESAEDALLELVPITED-----VPLANEFHRNFIGQKGQGINTFSTKHNVVVNIPPANKCSDFISIKG 3221
            Y + FPPLP   +T +   NS P         G  +++ VTQ   VPL ERR+    EA  +  ++ Q  IC+ +  K G SIE++ G KD +L + ++G  D V+ A+R++  +LQTQ Q+++++P+E+HKFILG+ G +L+ +E  + T +T+PR  + +D I I GTKEG+D+AR EI  I  +++KLA ER+ IPK F+PFI+G NN    +I+E T A INIPPPSV  +E+ ++GEKDGV QA  +I +IYED K+ ++++++ + KSQH Y++G +G  I EI E TGVS+EMP  DSD +TI L G  + L  AL+ V +K+ S++   + AP WLHRFIIG++G N+ K+ +    V + F +  D I +EGP + V   +  +   I EL  +MA  E  VD ++H HIIG++GAN       +   +    V +R P                                   N +G  G TI+                       I G    V+ A+ +I ++  +L N    +V +  K+HN +IGA+G  ++ +      V I FP   S SD V +RGP+  V++   +L +   E    +YT +++   ++H+ +IG+GG +IRK+RE    RI FP  +  D + I + GK+E VE A   +     +L +I E  + +  + H   +  RG++++ I  E GGV + FP +  NSD + ++G +  V+ A+++++E+ ++   +   + V  + EFH+ ++G KGA + E   RH V + FPD                           +D I I G KE+ + AK +L   +   E   + +I  D  +H+     + + + ++  EF  V I  P   A +  D V VIGP+  VE A+  +E  +  +EA+          + V +++++H  +I R    I +I+  YDV I+FP +D    P E+                                A+ + ++G + +CE+A DA+L++V   ED     + +    HR  IG KG+ +     ++ V +  P  N  +D + I G
Sbjct:   16 YAEAFPPLPCAPSTDQNQANSNPAAKWRTHGTGHIRSTTVTQVFRVPLEERRYKLFHEA--TFGDERQHSICRDIMAKTGASIEVSLG-KDLSLTIMVTGKPDTVAKARRLVLSQLQTQAQIEIQIPREHHKFILGKGGKTLQTMELSTATKITMPR--DGSDTIKIIGTKEGVDRARHEIQLISDQQAKLAFERLAIPKTFHPFISGPNNETANRIKEQTGAAINIPPPSVNKDELTVAGEKDGVAQAKAMILEIYEDKKRKTTTVSIEVRKSQHKYIVGPRGGTIHEILELTGVSVEMPPSDSDSETITLRGEQDKLGVALTQVYEKANSVVFAEVAAPRWLHRFIIGRRGQNIRKVTQDLPKVHVEFSDEKDSITLEGPPEQVESARESLEAFIRELIVSMAFAECNVDQKYHPHIIGKNGANGESRYLSLIHPRRHDVVSLRGPREDVDKVHAYLKKLNAELVAANYCIDVPIFKQFHKNVIGRGGTTIKKIREETDTKIELPAEGSDSDVIIITGHKAQVEAAREKILAIQNELANVTQLEVHIPSKFHNSIIGAKGRLIRSVMEDCGGVSIKFPPEGSNSDKVLIRGPKDDVEKAKKQLLELTNEKELGSYTVEIRAKPEHHRFLIGRGGASIRKVRENTGARIVFPAAKDEDKELITIIGKQEAVEAAKDELLKSIKDLDNICEGEVHVDPKWHRHFVAKRGEVLQEIAAEFGGVVVSFPRNGVNSDRVVLKGAKECVEGARQRVMEIVQELESMVTIECVIPQ-EFHRNIMGAKGANVQEVTARHKVQIKFPDRSPAGEEPVVNGDGEHLDPEAPISPRKRDIIIITGKKESAEAAKIDLLDLVPVTE---QMHIPFD--YHRFVIGPKGSNVRKMMDEF-SVNISIPP--AKDESDSVSVIGPRANVERAMKALEAKVAEIEAENEDRALRSFKMDVKVDRQYHPKIIGRKGQVITNIRKQYDVNIQFPPQD---APEES--------------------------------ADVIGLTGYQHSCEAARDAILKIVKELEDQVSVELTIDPRIHRRLIGAKGRAVRKLMEQYKVDIRFPRQN-ANDPVVISG 1066          
BLAST of High density lipoprotein binding protein (Vigilin) vs. Ensembl Medaka
Match: hdlbpb (vigilin [Source:NCBI gene;Acc:101163851])

HSP 1 Score: 877.085 bits (2265), Expect = 0.000e+0
Identity = 518/1237 (41.88%), Postives = 779/1237 (62.97%), Query Frame = 3
Query:  243 YDDQFPPLPTCNTPKIVQNSKP------RIGQTKTSHVTQTLTVPLAERRFSNREANNSVKNDAQKKICQTVAQKCGVSIELNSGNKDQNLMVFISGPQDNVSNAKRILTKEXXXXXXXXMKVPKEYHKFILGRNGASLREIESGSNTNVTIPRSIENNDIITIFGTKEGIDKARAEINQIVAERSKLATERITIPKRFYPFINGSNNSKIYKIREMTNAKXXXXXXXXXXXXXXXXGEKDGVYQALEIIQKIYEDTKKCSSSLNLPIPKSQHCYVIGAKGSGIAEIFERTGVSIEMPSQDSDDDTIVLYGPNEFLAPALSMVIQKSESMIRVNIEAPNWLHRFIIGKQGSNLNKLMEKYEHVFINFPENSDLIVIEGPKDDVNELKGQITHKIAELKSTMAITEIQVDPRFHRHIIGRSGANIQRMQEEYKVQIRMPGNNAVGTSGWTIRIEGDPEGVKLAKTEIESMSVKLENEKTKDVILDHKYHNQLIGAQGSRVKELRNQYPDVIIMFPDLSSKSDIVQLRGPRQQVDQVAVKLNKFIQEVIENNYTKDVKIFKQYHKNIIGKGGVNIRKIREEMNIRIDFPDEHSDSDKIRLTGKKENVEEAAKRIEAMQAELISIKEDTISIPQRLHISLIGTRGKLIKCIQQECGGVQIQFPASDSNSDIIKIRGPESDVDKAXXXXXXXXXXXXXXXHQDSVSAKSEFHKFLIGRKGAQLAEFRKRHAVMLIFPDSEDTNKDTIQIIGAKEAVQKAKEELEVTIKSLENEIEKYITIDTKWHKHFFKKRQAVMEEISREFGGVRIFFPKQDAVENIDQVRVIGPKGCVEAAVVRIEDIIENLEAQTSLSVFIEQKHHRNLITRNMMEIKSIQSNYDVTIKFPNRDLSSKPGENGMEEIHLNGNGDVNIETMEEVDSTLESEQNNPANWVTISGRKENCESAEDALLELVPITEDVPLANEFHRNFIGQKGQGINTFSTKHNVVVNIPPANKCSDFISIKGPRVNIIDAKAGLDELITMWENEKQDRIARNYENHVTVPIVFHRNIIGQRGANIEIFRTKFNVSIQIPDQNSKSEE-ITIRGYEEDVKKAEEELISMVEKWKAQVKEELHIPRDVHPQLIGTRGIALRKLRDQFKVEINFPNRNVDDEKAHLVEVIGDKENVDKCCDILVERANE-LLNEWEERNQVREVKNLIKDRENINSSSNIKEKGP--GFLLTGAPWQQ---RVPDASSNVDFP 3914
            Y + FPPLP   TP   +  +P      +I   K S +TQ   VPL ERR+ +   N+      + K+C  + Q+ G  IEL S  KDQ L + ++G  D+V  A++ +   LQTQ    + +PKE+H+F++G+NG  L+E+E  + T + IPR  + +  I I GTKEGI+KAR EI  I AE+ K A ER+++ K F+PFI G++N  + ++ + T A+I+IPPPS+  +EI+I+GEK+ V  A+  I+ IYED K+ ++++++ + KSQH Y+IG KG+ + EI E TGVS+EMP  DS  +TI+L G  + L PAL+ V  K++S++ V + AP WLHRFIIGK+G N+ ++ ++   V I F +  + I +EGP ++V + + QI   I +L   M  +EI +D RFHRH+IG++GANI R++E+YKV +R+P ++        IRIEGDP+GV+LA+ E+  M  ++ENE+TKD+I++ K+H  +IG +G ++KE+R+++P+VII FPD S KSDIVQLRGP+ +V++ A  L K I E+IEN+Y+  V IFKQ+HKNIIGKGG NI+KIREE N +ID P E+S+S+ I +TGKK N E A  RI A+Q EL ++KE  ++IP +LH SLIG++G L++ I ++CGGV I FP+  S SD + IRGP  +V+KAKKQLL+L+E+  + +    + AK E+HKFLIGR GA +   R R    +IFP  +DT ++ I I+G +EAV++A+ ELE  +K+L++ +E  + +D + H+HF  +R  V+ E++ E+GGV + FP+  A  +  +V + G K CVEAA  RI++IIE+LE+Q S+ + I Q++HR ++      I+ I   ++V IKFP RD S+   E  ++E     NGDV++ET E V            + +TISGR E C+ A+ ALL LVPITEDV ++ E HR  IGQKG GI     ++ V + +P   K  D I + G   N+  AK GL E +   + E++DR  R+++  ++V   FH  IIG++GA I   R   +VSIQ PD+  + ++ I I GYE +V++A + +  +V + +  V +++H+    H ++IG RG A+RKL ++FKV+I FP    D  +   V V G  E +    D L+    E +L+  E       +K   +         +    GP  GF++  APW     + PD SS  DFP
Sbjct:   38 YLEAFPPLPEKGTPG-EKTGEPASAWGSKIRPIKASVITQVFHVPLEERRYKD---NSQFGEGEEAKVCLDIMQRTGAHIEL-SLAKDQGLSIMVTGKLDSVMKARKEIVARLQTQASATVAIPKEHHRFVIGKNGEKLQELELKTATKIAIPRPEDPSTSIRITGTKEGIEKARHEILLISAEQDKRAVERLSLEKAFHPFIAGAHNRLVQELSQETGARISIPPPSLPKDEIVITGEKEAVALAVNRIRAIYEDKKRKTTTISVEVKKSQHKYIIGPKGNTLQEILEATGVSVEMPPLDSSSETIILRGEPDKLGPALTQVYAKAKSVMVVEVSAPAWLHRFIIGKKGQNIGRITQQLPRVHIEFTDGEERISLEGPTEEVEQAQIQIQEIIKDLLVRMDYSEIIIDQRFHRHLIGKNGANINRIKEQYKVSVRIPQDSERSN---LIRIEGDPKGVQLARRELIEMVQRMENERTKDLIVEQKFHRTIIGQKGEKIKEVRDKFPEVIINFPDPSQKSDIVQLRGPKNEVEKCAKFLQKIIAELIENSYSLSVPIFKQFHKNIIGKGGANIKKIREETNTKIDLPTENSNSEMIVITGKKVNCEVARDRILAIQRELANLKETEVTIPAKLHNSLIGSKGCLVRSIMEDCGGVHIHFPSEGSGSDKVTIRGPVGEVEKAKKQLLQLAEEKQVNNFTAELQAKPEYHKFLIGRGGANIRRVRDRTGARIIFPSPDDTEQELITIVGKEEAVRQAQRELETLVKNLDDVVEDSMEVDVRHHRHFVCRRGQVLRELAEEYGGVAVSFPRTGA--SSQKVTLKGAKDCVEAAKKRIQEIIEDLESQVSVELAIPQRYHRAVMGPKGCRIQHITREHEVQIKFPERDDSAAGQEALVQE-----NGDVSLET-EFVPRK--------CDIITISGRAEKCDLAKAALLALVPITEDVEVSYELHRYIIGQKGSGIRKMMEEYEVNIWVPQPEKQLDVIKVTGLAANVERAKQGLLERVKDLQAEQEDRALRSFKVTMSVDPKFHPKIIGRKGAVISQIRKDHDVSIQFPDKGDEQQDLIVISGYERNVEEARQAIQQLVAELQEMVSQDIHLDPRTHARIIGARGKAIRKLMEEFKVDIRFPQPGSD--QPDRVTVTGLPETISSAVDHLLNLEEEYMLSVTETETLAAYMKPPSRYGGGGGIGMDDSSGGPAKGFVVRDAPWNAAGNKAPDVSSAEDFP 1248          
BLAST of High density lipoprotein binding protein (Vigilin) vs. Ensembl Medaka
Match: hdlbpa (high density lipoprotein binding protein [Source:NCBI gene;Acc:101156075])

HSP 1 Score: 874.774 bits (2259), Expect = 0.000e+0
Identity = 510/1244 (41.00%), Postives = 776/1244 (62.38%), Query Frame = 3
Query:  243 YDDQFPPLPT-CNTPKIVQ---NSKPRIGQTKTSHVTQTLTVPLAERRFSNREANNSVKNDAQKKICQTVAQKCGVSIELNSGNKDQNLMVFISGPQDNVSNAKRILTKEXXXXXXXXMKVPKEYHKFILGRNGASLREIESGSNTNVTIPRSIENNDIITIFGTKEGIDKARAEINQIVAERSKLATERITIPKRFYPFINGSNNSKIYKIREMTNAKXXXXXXXXXXXXXXXXGEKDGVYQALEIIQKIYEDTKKCSSSLNLPIPKSQHCYVIGAKGSGIAEIFERTGVSIEMPSQDSDDDTIVLYGPNEFLAPALSMVIQKSESMIRVNIEAPNWLHRFIIGKQGSNLNKLMEKYEHVFINFPENSDLIVIEGPKDDVNELKGQITHKIAELKSTMAITEIQVDPRFHRHIIGRSGANIQRMQEEYKVQIRMPGNNAVGTSGWTIRIEGDPEGVKLAKTEIESMSVKLENEKTKDVILDHKYHNQLIGAQGSRVKELRNQYPDVIIMFPDLSSKSDIVQLRGPRQQVDQVAVKLNKFIQEVIENNYTKDVKIFKQYHKNIIGKGGVNIRKIREEMNIRIDFPDEHSDSDKIRLTGKKENVEEAAKRIEAMQAELISIKEDTISIPQRLHISLIGTRGKLIKCIQQECGGVQIQFPASDSNSDIIKIRGPESDVDKAXXXXXXXXXXXXXXXHQDSVSAKSEFHKFLIGRKGAQLAEFRKRHAVMLIFPDSEDTNKDTIQIIGAKEAVQKAKEELEVTIKSLENEIEKYITIDTKWHKHFFKKRQAVMEEISREFGGVRIFFPKQDAVENIDQVRVIGPKGCVEAAVVRIEDIIENLEAQTSLSVFIEQKHHRNLITRNMMEIKSIQSNYDVTIKFPNR-DLSSKPGENGMEEIHLNGNGDVNIETMEEVDSTLESEQNNPANWVTISGRKENCESAEDALLELVPITEDVPLANEFHRNFIGQKGQGINTFSTKHNVVVNIPPANKCSDFISIKGPRVNIIDAKAGLDELITMWENEKQDRIARNYENHVTVPIVFHRNIIGQRGANIEIFRTKFNVSIQIPDQNSKSE-EITIRGYEEDVKKAEEELISMVEKWKAQVKEELHIPRDVHPQLIGTRGIALRKLRDQFKVEINFPNRNVDDEKAHLVEVIGDKENVDKCCDILVERANELLNEWEERN----QVREVKNLIKDRENINSSSNIKE-KGP--GFLLTGAPWQ---QRVPDASSNVDFPKIDA 3926
            Y D FPPLP    TP   Q   N+  +I   K+S +TQ   VPL ER++  ++ N   + D Q K+C  +  K G  +EL S  KDQ L + +SG  D V  A++ +   LQTQ    + +PKE+H+F++G+NG  L+E+E  + T + IPR  + ++ I I GTKEG++KA+ EI  I AE+ K A ER+ I K ++PFI G+ N  + ++ + T A+IN+PPPSV   EI+I+GEK+ V  A+ +I+K+YE+ KK ++++ + + KSQH YV+G KG+ + EI +RTGVS+E+P  DS  +T++L G  + L  AL+ V  K+ S    ++ AP+WLHRFIIGK+G NL K+ ++   V I F E  D I +EGP  DV  ++ QI   + +L S M   EI VDP+FHRH+IG+ G NI R++E +KV +R+P +N        IRIEGDP+GV+ AK E+  ++ ++ENE+TKD+I++ ++H  +IG +G ++KE+R+++P+VII FPD + KSDIVQLRGPR +V++ +  + K + E++EN+++  V IFKQ+H+NIIGKGG NI+KIREE N +ID P E+S+S+ I +TGKK N E A  RI A+Q EL +I E  +SIP +LH SLIG++G+L++ I +ECGGV I FP   S  D + IRGP  +V+KAK+QLL L+E+    SH   + AK E+HKFLIG+ G  + + R      +IFP  ED +++ I ++G +EAV++A++ELE  IKSL+N +E  + +D K H++F  +R  V+ +++ E+GGV + FP+       D+V + G K CVEAA  R++++IE+L+AQ ++   I QK HR+++      I+ I  +++V IKFP R D  +   E   +E     NG+ N E  E VD     E     + + ISGRKE CE+A +AL  LVP+T +V +  E HR  IGQKG GI     +  V + +P  +  SD ISI G   ++  AK GL E +   + +++DR  R+++  +TV   +H  IIG++GA I   RT+ +V+IQ P++N +++ +ITI GYE     A + + ++V++ +  V E++ +   VH ++IG RG  +RK+ D+FKV++ FP     D   ++V VIG  E+VD+  D L+    E + +  E       +R     +             E +GP  GF++  APW    ++ PD SS+ DFP   A
Sbjct:   43 YKDAFPPLPERAATPDGTQETANAWTKIRPLKSSIITQVFHVPLEERKY--KDINQFGEGD-QAKVCVDIMHKTGAHLEL-SLAKDQGLSIMVSGKLDAVMKARKEIVSRLQTQASATVAIPKEHHRFVIGKNGEKLQELELKTATKIQIPRPDDPSNQIKISGTKEGLEKAKHEILLISAEQDKRAVERVNIDKVYHPFITGAFNKMVSEMAQDTGARINVPPPSVNKTEIVITGEKEQVALAVAMIKKVYEEKKKNTTTIAVEVKKSQHKYVVGPKGNTLQEILDRTGVSVEIPPSDSSSETVILRGEPDRLGQALTEVYAKANSYTVSSVSAPSWLHRFIIGKKGQNLAKITQQMPKVHIEFTEGEDKITLEGPTKDVQMVQSQIEAIVIDLVSRMDYAEITVDPKFHRHLIGKGGVNINRIKEMHKVTVRIPPDNEKSN---LIRIEGDPQGVQEAKKELLELASRMENERTKDLIIEQRFHRAIIGQKGEKIKEVRDKFPEVIINFPDPAHKSDIVQLRGPRTEVEKCSKFMQKMVAEMVENSHSVSVPIFKQFHRNIIGKGGSNIKKIREETNTKIDLPAENSNSEMIVITGKKVNCEAARNRILAIQKELANITEMDVSIPSKLHNSLIGSKGRLVRSIMEECGGVHIHFPNEGSGVDKVTIRGPVEEVEKAKQQLLALAEEKQTKSHTAELHAKPEYHKFLIGKGGGNIRKVRDSTGARIIFPTPEDKDQELITVVGTEEAVREAQKELEELIKSLDNIVEDTMNVDPKHHRYFVARRGQVLRDLADEYGGVMVSFPR--TASQSDKVSLKGAKECVEAAKKRMQEMIEDLDAQVTMECVIPQKFHRSIMGPKGSRIQQITRDHNVQIKFPEREDPQAAHSEAPAQE-----NGEANGELKESVD----PEAPKRCDVIVISGRKERCEAAIEALKALVPVTIEVDVPFELHRYIIGQKGSGIRKMMDEFEVNIQVPGPDLQSDKISITGLASHLDRAKEGLLERVKELQADQEDRALRSFKLTITVDPKYHPKIIGRKGAIITNIRTEHDVNIQFPEKNDENQDQITITGYEHKAIAARDAIQAIVDELEEMVSEDITLDSRVHARIIGARGKGIRKIMDEFKVDLRFPQSGAAD--PNVVTVIGRPEHVDEAIDHLLNLEEEYMADVAENEAKMAHMRPSGGSVAAGGGGGGGGASDESRGPSKGFVVREAPWANPNEKAPDMSSSEDFPSFGA 1266          
BLAST of High density lipoprotein binding protein (Vigilin) vs. Ensembl Medaka
Match: hdlbpa (high density lipoprotein binding protein [Source:NCBI gene;Acc:101156075])

HSP 1 Score: 862.833 bits (2228), Expect = 0.000e+0
Identity = 502/1223 (41.05%), Postives = 765/1223 (62.55%), Query Frame = 3
Query:  243 YDDQFPPLP-TCNTPKIVQ---NSKPRIGQTKTSHVTQTLTVPLAERRFSNREANNSVKNDAQKKICQTVAQKCGVSIELNSGNKDQNLMVFISGPQDNVSNAKRILTKEXXXXXXXXMKVPKEYHKFILGRNGASLREIESGSNTNVTIPRSIENNDIITIFGTKEGIDKARAEINQIVAERSKLATERITIPKRFYPFINGSNNSKIYKIREMTNAKXXXXXXXXXXXXXXXXGEKDGVYQALEIIQKIYEDTKKCSSSLNLPIPKSQHCYVIGAKGSGIAEIFERTGVSIEMPSQDSDDDTIVLYGPNEFLAPALSMVIQKSESMIRVNIEAPNWLHRFIIGKQGSNLNKLMEKYEHVFINFPENSDLIVIEGPKDDVNELKGQITHKIAELKSTMAITEIQVDPRFHRHIIGRSGANIQRMQEEYKVQIRMPGNNAVGTSGWTIRIEGDPEGVKLAKTEIESMSVKLENEKTKDVILDHKYHNQLIGAQGSRVKELRNQYPDVIIMFPDLSSKSDIVQLRGPRQQVDQVAVKLNKFIQEVIENNYTKDVKIFKQYHKNIIGKGGVNIRKIREEMNIRIDFPDEHSDSDKIRLTGKKENVEEAAKRIEAMQAELISIKEDTISIPQRLHISLIGTRGKLIKCIQQECGGVQIQFPASDSNSDIIKIRGPESDVDKAXXXXXXXXXXXXXXXHQDSVSAKSEFHKFLIGRKGAQLAEFRKRHAVMLIFPDSEDTNKDTIQIIGAKEAVQKAKEELEVTIKSLENEIEKYITIDTKWHKHFFKKRQAVMEEISREFGGVRIFFPKQDAVENIDQVRVIGPKGCVEAAVVRIEDIIENLEAQTSLSVFIEQKHHRNLITRNMMEIKSIQSNYDVTIKFPNR-DLSSKPGENGMEEIHLNGNGDVNIETMEEVDSTLESEQNNPANWVTISGRKENCESAEDALLELVPITEDVPLANEFHRNFIGQKGQGINTFSTKHNVVVNIPPANKCSDFISIKGPRVNIIDAKAGLDELITMWENEKQDRIARNYENHVTVPIVFHRNIIGQRGANIEIFRTKFNVSIQIPDQNSKSE-EITIRGYEEDVKKAEEELISMVEKWKAQVKEELHIPRDVHPQLIGTRGIALRKLRDQFKVEINFPNRNVDDEKAHLVEVIGDKENVDKCCDILVERANELLNEWEERN----QVREVKNLIKDRENINSSSNIKE-KGP--GFLLTGAPW 3872
            Y D FPPLP    TP   Q   N+  +I   K+S +TQ   VPL ER++  ++ N   + D Q K+C  +  K G  +EL S  KDQ L + +SG  D V  A++ +   LQTQ    + +PKE+H+F++G+NG  L+E+E  + T + IPR  + ++ I I GTKEG++KA+ EI  I AE+ K A ER+ I K ++PFI G+ N  + ++ + T A+IN+PPPSV   EI+I+GEK+ V  A+ +I+K+YE+ KK ++++ + + KSQH YV+G KG+ + EI +RTGVS+E+P  DS  +T++L G  + L  AL+ V  K+ S    ++ AP+WLHRFIIGK+G NL K+ ++   V I F E  D I +EGP  DV  ++ QI   + +L S M   EI VDP+FHRH+IG+ G NI R++E +KV +R+P +N        IRIEGDP+GV+ AK E+  ++ ++ENE+TKD+I++ ++H  +IG +G ++KE+R+++P+VII FPD + KSDIVQLRGPR +V++ +  + K + E++EN+++  V IFKQ+H+NIIGKGG NI+KIREE N +ID P E+S+S+ I +TGKK N E A  RI A+Q EL +I E  +SIP +LH SLIG++G+L++ I +ECGGV I FP   S  D + IRGP  +V+KAK+QLL L+E+    SH   + AK E+HKFLIG+ G  + + R      +IFP  ED +++ I ++G +EAV++A++ELE  IKSL+N +E  + +D K H++F  +R  V+ +++ E+GGV + FP+       D+V + G K CVEAA  R++++IE+L+AQ ++   I QK HR+++      I+ I  +++V IKFP R D  +   E   +E     NG+ N E  E VD     E     + + ISGRKE CE+A +AL  LVP+T +V +  E HR  IGQKG GI     +  V + +P  +  SD ISI G   ++  AK GL E +   + +++DR  R+++  +TV   +H  IIG++GA I   RT+ +V+IQ P++N +++ +ITI GYE     A + + ++V++ +  V E++ +   VH ++IG RG  +RK+ D+FKV++ FP     D   ++V VIG  E+VD+  D L+    E + +  E       +R     +             E +GP  GF++  APW
Sbjct:   43 YKDAFPPLPERAATPDGTQETANAWTKIRPLKSSIITQVFHVPLEERKY--KDINQFGEGD-QAKVCVDIMHKTGAHLEL-SLAKDQGLSIMVSGKLDAVMKARKEIVSRLQTQASATVAIPKEHHRFVIGKNGEKLQELELKTATKIQIPRPDDPSNQIKISGTKEGLEKAKHEILLISAEQDKRAVERVNIDKVYHPFITGAFNKMVSEMAQDTGARINVPPPSVNKTEIVITGEKEQVALAVAMIKKVYEEKKKNTTTIAVEVKKSQHKYVVGPKGNTLQEILDRTGVSVEIPPSDSSSETVILRGEPDRLGQALTEVYAKANSYTVSSVSAPSWLHRFIIGKKGQNLAKITQQMPKVHIEFTEGEDKITLEGPTKDVQMVQSQIEAIVIDLVSRMDYAEITVDPKFHRHLIGKGGVNINRIKEMHKVTVRIPPDN---EKSNLIRIEGDPQGVQEAKKELLELASRMENERTKDLIIEQRFHRAIIGQKGEKIKEVRDKFPEVIINFPDPAHKSDIVQLRGPRTEVEKCSKFMQKMVAEMVENSHSVSVPIFKQFHRNIIGKGGSNIKKIREETNTKIDLPAENSNSEMIVITGKKVNCEAARNRILAIQKELANITEMDVSIPSKLHNSLIGSKGRLVRSIMEECGGVHIHFPNEGSGVDKVTIRGPVEEVEKAKQQLLALAEEKQTKSHTAELHAKPEYHKFLIGKGGGNIRKVRDSTGARIIFPTPEDKDQELITVVGTEEAVREAQKELEELIKSLDNIVEDTMNVDPKHHRYFVARRGQVLRDLADEYGGVMVSFPR--TASQSDKVSLKGAKECVEAAKKRMQEMIEDLDAQVTMECVIPQKFHRSIMGPKGSRIQQITRDHNVQIKFPEREDPQAAHSEAPAQE-----NGEANGELKESVD----PEAPKRCDVIVISGRKERCEAAIEALKALVPVTIEVDVPFELHRYIIGQKGSGIRKMMDEFEVNIQVPGPDLQSDKISITGLASHLDRAKEGLLERVKELQADQEDRALRSFKLTITVDPKYHPKIIGRKGAIITNIRTEHDVNIQFPEKNDENQDQITITGYEHKAIAARDAIQAIVDELEEMVSEDITLDSRVHARIIGARGKGIRKIMDEFKVDLRFPQSGAAD--PNVVTVIGRPEHVDEAIDHLLNLEEEYMADVAENEAKMAHMRPSGGSVAAGGGGGGGGASDESRGPSKGFVVREAPW 1245          
BLAST of High density lipoprotein binding protein (Vigilin) vs. Ensembl Medaka
Match: hdlbpb (vigilin [Source:NCBI gene;Acc:101163851])

HSP 1 Score: 860.907 bits (2223), Expect = 0.000e+0
Identity = 499/1168 (42.72%), Postives = 751/1168 (64.30%), Query Frame = 3
Query:  243 YDDQFPPLPTCNTPKIVQNSKP------RIGQTKTSHVTQTLTVPLAERRFSNREANNSVKNDAQKKICQTVAQKCGVSIELNSGNKDQNLMVFISGPQDNVSNAKRILTKEXXXXXXXXMKVPKEYHKFILGRNGASLREIESGSNTNVTIPRSIENNDIITIFGTKEGIDKARAEINQIVAERSKLATERITIPKRFYPFINGSNNSKIYKIREMTNAKXXXXXXXXXXXXXXXXGEKDGVYQALEIIQKIYEDTKKCSSSLNLPIPKSQHCYVIGAKGSGIAEIFERTGVSIEMPSQDSDDDTIVLYGPNEFLAPALSMVIQKSESMIRVNIEAPNWLHRFIIGKQGSNLNKLMEKYEHVFINFPENSDLIVIEGPKDDVNELKGQITHKIAELKSTMAITEIQVDPRFHRHIIGRSGANIQRMQEEYKVQIRMPGNNAVGTSGWTIRIEGDPEGVKLAKTEIESMSVKLENEKTKDVILDHKYHNQLIGAQGSRVKELRNQYPDVIIMFPDLSSKSDIVQLRGPRQQVDQVAVKLNKFIQEVIENNYTKDVKIFKQYHKNIIGKGGVNIRKIREEMNIRIDFPDEHSDSDKIRLTGKKENVEEAAKRIEAMQAELISIKEDTISIPQRLHISLIGTRGKLIKCIQQECGGVQIQFPASDSNSDIIKIRGPESDVDKAXXXXXXXXXXXXXXXHQDSVSAKSEFHKFLIGRKGAQLAEFRKRHAVMLIFPDSEDTNKDTIQIIGAKEAVQKAKEELEVTIKSLENEIEKYITIDTKWHKHFFKKRQAVMEEISREFGGVRIFFPKQDAVENIDQVRVIGPKGCVEAAVVRIEDIIENLEAQTSLSVFIEQKHHRNLITRNMMEIKSIQSNYDVTIKFPNRDLSSKPGENGMEEIHLNGNGDVNIETMEEVDSTLESEQNNPANWVTISGRKENCESAEDALLELVPITEDVPLANEFHRNFIGQKGQGINTFSTKHNVVVNIPPANKCSDFISIKGPRVNIIDAKAGLDELITMWENEKQDRIARNYENHVTVPIVFHRNIIGQRGANIEIFRTKFNVSIQIPDQNSKSEE-ITIRGYEEDVKKAEEELISMVEKWKAQVKEELHIPRDVHPQLIGTRGIALRKLRDQFKVEINFPNRNVDDEKAHLVEVIGDKENVDKCCDILV 3725
            Y + FPPLP   TP   +  +P      +I   K S +TQ   VPL ERR+ +   N+      + K+C  + Q+ G  IEL S  KDQ L + ++G  D+V  A++ +   LQTQ    + +PKE+H+F++G+NG  L+E+E  + T + IPR  + +  I I GTKEGI+KAR EI  I AE+ K A ER+++ K F+PFI G++N  + ++ + T A+I+IPPPS+  +EI+I+GEK+ V  A+  I+ IYED K+ ++++++ + KSQH Y+IG KG+ + EI E TGVS+EMP  DS  +TI+L G  + L PAL+ V  K++S++ V + AP WLHRFIIGK+G N+ ++ ++   V I F +  + I +EGP ++V + + QI   I +L   M  +EI +D RFHRH+IG++GANI R++E+YKV +R+P ++        IRIEGDP+GV+LA+ E+  M  ++ENE+TKD+I++ K+H  +IG +G ++KE+R+++P+VII FPD S KSDIVQLRGP+ +V++ A  L K I E+IEN+Y+  V IFKQ+HKNIIGKGG NI+KIREE N +ID P E+S+S+ I +TGKK N E A  RI A+Q EL ++KE  ++IP +LH SLIG++G L++ I ++CGGV I FP+  S SD + IRGP  +V+KAKKQLL+L+E+  + +    + AK E+HKFLIGR GA +   R R    +IFP  +DT ++ I I+G +EAV++A+ ELE  +K+L++ +E  + +D + H+HF  +R  V+ E++ E+GGV + FP+  A  +  +V + G K CVEAA  RI++IIE+LE+Q S+ + I Q++HR ++      I+ I   ++V IKFP RD S+        E  +  NGDV++ET E V            + +TISGR E C+ A+ ALL LVPITEDV ++ E HR  IGQKG GI     ++ V + +P   K  D I + G   N+  AK GL E +   + E++DR  R+++  ++V   FH  IIG++GA I   R   +VSIQ PD+  + ++ I I GYE +V++A + +  +V + +  V +++H+    H ++IG RG A+RKL ++FKV+I FP    D  +   V V G  E +    D L+
Sbjct:   30 YLEAFPPLPEKGTPG-EKTGEPASAWGSKIRPIKASVITQVFHVPLEERRYKD---NSQFGEGEEAKVCLDIMQRTGAHIEL-SLAKDQGLSIMVTGKLDSVMKARKEIVARLQTQASATVAIPKEHHRFVIGKNGEKLQELELKTATKIAIPRPEDPSTSIRITGTKEGIEKARHEILLISAEQDKRAVERLSLEKAFHPFIAGAHNRLVQELSQETGARISIPPPSLPKDEIVITGEKEAVALAVNRIRAIYEDKKRKTTTISVEVKKSQHKYIIGPKGNTLQEILEATGVSVEMPPLDSSSETIILRGEPDKLGPALTQVYAKAKSVMVVEVSAPAWLHRFIIGKKGQNIGRITQQLPRVHIEFTDGEERISLEGPTEEVEQAQIQIQEIIKDLLVRMDYSEIIIDQRFHRHLIGKNGANINRIKEQYKVSVRIPQDSERSN---LIRIEGDPKGVQLARRELIEMVQRMENERTKDLIVEQKFHRTIIGQKGEKIKEVRDKFPEVIINFPDPSQKSDIVQLRGPKNEVEKCAKFLQKIIAELIENSYSLSVPIFKQFHKNIIGKGGANIKKIREETNTKIDLPTENSNSEMIVITGKKVNCEVARDRILAIQRELANLKETEVTIPAKLHNSLIGSKGCLVRSIMEDCGGVHIHFPSEGSGSDKVTIRGPVGEVEKAKKQLLQLAEEKQVNNFTAELQAKPEYHKFLIGRGGANIRRVRDRTGARIIFPSPDDTEQELITIVGKEEAVRQAQRELETLVKNLDDVVEDSMEVDVRHHRHFVCRRGQVLRELAEEYGGVAVSFPRTGA--SSQKVTLKGAKDCVEAAKKRIQEIIEDLESQVSVELAIPQRYHRAVMGPKGCRIQHITREHEVQIKFPERDDSA--------EALVQENGDVSLET-EFVPRK--------CDIITISGRAEKCDLAKAALLALVPITEDVEVSYELHRYIIGQKGSGIRKMMEEYEVNIWVPQPEKQLDVIKVTGLAANVERAKQGLLERVKDLQAEQEDRALRSFKVTMSVDPKFHPKIIGRKGAVISQIRKDHDVSIQFPDKGDEQQDLIVISGYERNVEEARQAIQQLVAELQEMVSQDIHLDPRTHARIIGARGKAIRKLMEEFKVDIRFPQPGSD--QPDRVTVTGLPETISSAVDHLL 1168          

HSP 2 Score: 242.276 bits (617), Expect = 1.377e-64
Identity = 237/980 (24.18%), Postives = 457/980 (46.63%), Query Frame = 3
Query:  936 GEKDGVYQAL-EIIQKIYEDTKKCSSSLNLPIPKSQHCYVIGAKGSGIAEIFERTGVSIEMPSQDSDDDTIVLYGPNEFLAPALSMVI-----QKSESMIRVNIEAPNWLHRFIIGKQGSNLNKLMEKYEHVFINFPENS---DLIVIEGPKDDVNELKGQITHKIAELKSTMAITEIQVDPRFHRHIIGRSGANIQRMQEEYKVQIRMPGNNAVGTSGWTIRIEGDPEGVKLAKTEIESMSVKLENEKTKDVILDHKYHNQLIGAQGSRVKELRNQYPDVIIMFPDLSSKSDIVQLRGPRQQVDQVAVKLNKFIQEVIENNYTKDVKIFKQYHKNIIGKGGVNIRKIREEMNIRIDFPDEHSDSDKIRLTGKKENVEEAAKRIEAMQAELISIKEDTISIPQRLHISLIGTRGKLIKCIQQECGGVQIQFPASDSNSDIIKIRGPESDVDKAXXXXXXXXXXXXXXXHQDSVSAKSEFHKFLIGRKGAQLAEFRKRHAVMLIFPDSEDTNKDTIQIIGAKEAVQKAKEELEVTIKSLENEIEKYITIDTKWHKHFFKKRQAVMEEISREFGGVRIFFPKQDAVENIDQVRVIGPKGCVEAAVVRIEDIIENLEAQT-SLSVFIEQKHHRNLITRNMMEIKSIQSNYDVTIKFPNRDLSSKPGENGMEEIHLNGNGDVNIETMEEVDSTLESEQNNPANWVTISGRKENCESAEDALLELVPITEDV-----PLANEFHRNFIGQKGQGINTFSTKHN-VVVNIPPANKCSDFISIKGPRVNIIDAKAGLDELITMWENEKQDRIARNYENHVTVPIVFHRNIIGQRGANIEIFRTKFNVSIQIPDQNSKSEE---------------------ITIRGYEEDVKKAEEELISMVEKWKAQVKEELHIPRDVHPQLIGTRGIALRKLRDQFKVEINFPNRNVDDEKAHLVEVIGDKENVDKCCDILVERANELLNEWEER 3764
            G+ D V +A  EI+ ++     +  +S  + IPK  H +VIG  G  + E+  +T   I +P  +    +I + G  E +  A   ++     Q   ++ R+++E     H FI G     + +L ++     I+ P  S   D IVI G K+ V     +I     + K       ++V    H++IIG  G  +Q + E   V + MP    + +S  TI + G+P+ +  A T++ +   K ++    +V      H  +IG +G  +  +  Q P V I F D   +   + L GP ++V+Q  +++ + I++++      ++ I +++H+++IGK G NI +I+E+  + +  P +   S+ IR+ G  + V+ A + +  M   + + +   + + Q+ H ++IG +G+ IK ++ +   V I FP     SDI+++RGP+++V+K  K L ++  + +  S+  SV    +FHK +IG+ GA + + R+     +  P +E++N + I I G K   + A++ +    + L N  E  +TI  K H      +  ++  I  + GGV I FP + +    D+V + GP G VE A  ++  + E  +    +  +  + ++H+ LI R    I+ ++      I FP+ D                                 ++EQ      +TI G++E    A+  L  LV   +DV      +    HR+F+ ++GQ +   + ++  V V+ P     S  +++KG +  +  AK  + E+I   E++    +A        +P  +HR ++G +G  I+    +  V I+ P+++  +E                      ITI G  E    A+  L+++V      + E++ +  ++H  +IG +G  +RK+ ++++V I  P     +++  +++V G   NV++    L+ER  +L  E E+R
Sbjct:  121 GKLDSVMKARKEIVARL-----QTQASATVAIPKEHHRFVIGKNGEKLQELELKTATKIAIPRPEDPSTSIRITGTKEGIEKARHEILLISAEQDKRAVERLSLE--KAFHPFIAGAHNRLVQELSQET-GARISIPPPSLPKDEIVITGEKEAVALAVNRIRAIYEDKKRKTTTISVEVKKSQHKYIIGPKGNTLQEILEATGVSVEMP---PLDSSSETIILRGEPDKLGPALTQVYA---KAKSVMVVEVSAPAWLHRFIIGKKGQNIGRITQQLPRVHIEFTDGEER---ISLEGPTEEVEQAQIQIQEIIKDLLVRMDYSEIIIDQRFHRHLIGKNGANINRIKEQYKVSVRIPQDSERSNLIRIEGDPKGVQLARRELIEMVQRMENERTKDLIVEQKFHRTIIGQKGEKIKEVRDKFPEVIINFPDPSQKSDIVQLRGPKNEVEKCAKFLQKIIAELIENSYSLSVPIFKQFHKNIIGKGGANIKKIREETNTKIDLP-TENSNSEMIVITGKKVNCEVARDRILAIQRELANLKETEVTIPAKLHNSLIGSKGCLVRSIMEDCGGVHIHFPSEGS--GSDKVTIRGPVGEVEKAKKQLLQLAEEKQVNNFTAELQAKPEYHKFLIGRGGANIRRVRDRTGARIIFPSPD---------------------------------DTEQE----LITIVGKEEAVRQAQRELETLVKNLDDVVEDSMEVDVRHHRHFVCRRGQVLRELAEEYGGVAVSFPRTGASSQKVTLKGAKDCVEAAKKRIQEIIEDLESQVSVELA--------IPQRYHRAVMGPKGCRIQHITREHEVQIKFPERDDSAEALVQENGDVSLETEFVPRKCDIITISGRAEKCDLAKAALLALVP-----ITEDVEVSYELHRYIIGQKGSGIRKMMEEYEVNIWVPQ---PEKQLDVIKVTGLAANVERAKQGLLERVKDLQAEQEDR 1027          
BLAST of High density lipoprotein binding protein (Vigilin) vs. Ensembl Medaka
Match: bicc1a (BicC family RNA binding protein 1 [Source:NCBI gene;Acc:101165583])

HSP 1 Score: 52.373 bits (124), Expect = 4.530e-6
Identity = 63/257 (24.51%), Postives = 114/257 (44.36%), Query Frame = 3
Query: 1773 SSKSDIVQLRGPRQQVDQVAVKLNKFIQEVIENNYTKDVKIFKQYHKNIIGKGGVNIRKIREEMNIRIDFPDEHSD-----SDKIRLTGKKENVEEAAKRIE-----AMQAELISIKEDTISIPQRLHISL---IGTRGKLIKCIQQECGGVQIQFPASDSNSDIIKIRGPESDVDKAXXXXXXXXXXXXXXXHQDSVSAKSEFHKFLIGRKGAQLAEFRKRHAVMLIFPD-SEDTNKDTIQIIGAKEAVQKAKEEL 2501
            S K   +++ G R+ V +   ++   + +   N  T  + +    H ++IGKGG NI+++ EE    I FPD + +     S+++ + G+   VE A  +I       +  EL +I +   S P   HIS    +    K    + +  G V+     S +N++ +K RG    ++        L+    + +H D      + H F+ GR G+ +    +R    + FPD +    K T+ I G  E+V  A++ L
Sbjct:  101 SKKDPHIKVCGKRENVREAKDRIMSVL-DTKSNRVTLKMDVSHTEHSHVIGKGGNNIKRVMEETGCHIHFPDSNRNNQAEKSNQVSIAGQPGGVEAARVKIRELLPLVLSFELPAIMQADPSSPTVQHISQTYNLTVSFKPPTRLYRATGVVR----GSQNNTNAVK-RGTALLLEH---LAGSLASTISVTTHLD---IAPQHHLFMKGRNGSNIKHITQRTGAQIHFPDPNAPQKKSTVYIQGTIESVCLARQYL 345          
BLAST of High density lipoprotein binding protein (Vigilin) vs. Planmine SMEST
Match: SMESG000016436.1 (SMESG000016436.1)

HSP 1 Score: 2494.54 bits (6464), Expect = 0.000e+0
Identity = 1264/1266 (99.84%), Postives = 1266/1266 (100.00%), Query Frame = 3
Query:  177 MDMNKSENHVEESTQSPLLVLQYDDQFPPLPTCNTPKIVQNSKPRIGQTKTSHVTQTLTVPLAERRFSNREANNSVKNDAQKKICQTVAQKCGVSIELNSGNKDQNLMVFISGPQDNVSNAKRILTKEXXXXXXXXMKVPKEYHKFILGRNGASLREIESGSNTNVTIPRSIENNDIITIFGTKEGIDKARAEINQIVAERSKLATERITIPKRFYPFINGSNNSKIYKIREMTNAKXXXXXXXXXXXXXXXXGEKDGVYQALEIIQKIYEDTKKCSSSLNLPIPKSQHCYVIGAKGSGIAEIFERTGVSIEMPSQDSDDDTIVLYGPNEFLAPALSMVIQKSESMIRVNIEAPNWLHRFIIGKQGSNLNKLMEKYEHVFINFPENSDLIVIEGPKDDVNELKGQITHKIAELKSTMAITEIQVDPRFHRHIIGRSGANIQRMQEEYKVQIRMPGNNAVGTSGWTIRIEGDPEGVKLAKTEIESMSVKLENEKTKDVILDHKYHNQLIGAQGSRVKELRNQYPDVIIMFPDLSSKSDIVQLRGPRQQVDQVAVKLNKFIQEVIENNYTKDVKIFKQYHKNIIGKGGVNIRKIREEMNIRIDFPDEHSDSDKIRLTGKKENVEEAAKRIEAMQAELISIKEDTISIPQRLHISLIGTRGKLIKCIQQECGGVQIQFPASDSNSDIIKIRGPESDVDKAXXXXXXXXXXXXXXXHQDSVSAKSEFHKFLIGRKGAQLAEFRKRHAVMLIFPDSEDTNKDTIQIIGAKEAVQKAKEELEVTIKSLENEIEKYITIDTKWHKHFFKKRQAVMEEISREFGGVRIFFPKQDAVENIDQVRVIGPKGCVEAAVVRIEDIIENLEAQTSLSVFIEQKHHRNLITRNMMEIKSIQSNYDVTIKFPNRDLSSKPGENGMEEIHLNGNGDVNIETMEEVDSTLESEQNNPANWVTISGRKENCESAEDALLELVPITEDVPLANEFHRNFIGQKGQGINTFSTKHNVVVNIPPANKCSDFISIKGPRVNIIDAKAGLDELITMWENEKQDRIARNYENHVTVPIVFHRNIIGQRGANIEIFRTKFNVSIQIPDQNSKSEEITIRGYEEDVKKAEEELISMVEKWKAQVKEELHIPRDVHPQLIGTRGIALRKLRDQFKVEINFPNRNVDDEKAHLVEVIGDKENVDKCCDILVERANELLNEWEERNQVREVKNLIKDRENINSSSNIKEKGPGFLLTGAPWQQRVPDASSNVDFPKIDANGDKIAGTCLINGHSE 3974
            MDMNKSENHV+ESTQSPLLVLQYDDQFPPLPTCNTPKIVQNSKPRIGQTKTSHVTQTLTVPLAERRFSNREANNSVKNDAQKKICQTVAQKCGVSIELNSGNKDQNLMVFISGPQDNVSNAKRILTKELQTQTQLQMKVPKEYHKFILGRNGASLREIESGSNTNVTIPRSIENNDIITIFGTKEGIDKARAEINQIVAERSKLATERITIPKRFYPFINGSNNSKIYKIREMTNAKINIPPPSVESEEIIISGEKDGVYQALEIIQKIYEDTKKCSSSLNLPIPKSQHCYVIGAKGSGIAEIFERTGVSIEMPSQDSDDDTIVLYGPNEFLAPALSMVIQKSESMIRVNIEAPNWLHRFIIGKQGSNLNKLMEKYEHVFINFPENSDLIVIEGPKDDVNELKGQITHKIAELKSTMAITEIQVDPRFHRHIIGRSGANIQRMQEEYKVQIRMPGNNAVGTSGWTIRIEGDPEGVKLAKTEIESMSVKLENEKTKDVILDHKYHNQLIGAQGSRVKELRNQYPDVIIMFPDLSSKSDIVQLRGPRQQVDQVAVKLNKFIQEVIENNYTKDVKIFKQYHKNIIGKGGVNIRKIREEMNIRIDFPDEHSDSDKIRLTGKKENVEEAAKRIEAMQAELISIKEDTISIPQRLHISLIGTRGKLIKCIQQECGGVQIQFPASDSNSDIIKIRGPESDVDKAKKQLLELSEKNLLLSHQDSVSAKSEFHKFLIGRKGAQLAEFRKRHAVMLIFPDSEDTNKDTIQIIGAKEAVQKAKEELEVTIKSLENEIEKYITIDTKWHKHFFKKRQAVMEEISREFGGVRIFFPKQDAVENIDQVRVIGPKGCVEAAVVRIEDIIENLEAQTSLSVFIEQKHHRNLITRNMMEIKSIQSNYDVTIKFPNRDLSSKPGENGMEEIHLNGNGDVNIETMEEVD+TLESEQNNPANWVTISGRKENCESAEDALLELVPITEDVPLANEFHRNFIGQKGQGINTFSTKHNVVVNIPPANKCSDFISIKGPRVNIIDAKAGLDELITMWENEKQDRIARNYENHVTVPIVFHRNIIGQRGANIEIFRTKFNVSIQIPDQNSKSEEITIRGYEEDVKKAEEELISMVEKWKAQVKEELHIPRDVHPQLIGTRGIALRKLRDQFKVEINFPNRNVDDEKAHLVEVIGDKENVDKCCDILVERANELLNEWEERNQVREVKNLIKDRENINSSSNIKEKGPGFLLTGAPWQQRVPDASSNVDFPKIDANGDKIAGTCLINGHSE
Sbjct:    1 MDMNKSENHVDESTQSPLLVLQYDDQFPPLPTCNTPKIVQNSKPRIGQTKTSHVTQTLTVPLAERRFSNREANNSVKNDAQKKICQTVAQKCGVSIELNSGNKDQNLMVFISGPQDNVSNAKRILTKELQTQTQLQMKVPKEYHKFILGRNGASLREIESGSNTNVTIPRSIENNDIITIFGTKEGIDKARAEINQIVAERSKLATERITIPKRFYPFINGSNNSKIYKIREMTNAKINIPPPSVESEEIIISGEKDGVYQALEIIQKIYEDTKKCSSSLNLPIPKSQHCYVIGAKGSGIAEIFERTGVSIEMPSQDSDDDTIVLYGPNEFLAPALSMVIQKSESMIRVNIEAPNWLHRFIIGKQGSNLNKLMEKYEHVFINFPENSDLIVIEGPKDDVNELKGQITHKIAELKSTMAITEIQVDPRFHRHIIGRSGANIQRMQEEYKVQIRMPGNNAVGTSGWTIRIEGDPEGVKLAKTEIESMSVKLENEKTKDVILDHKYHNQLIGAQGSRVKELRNQYPDVIIMFPDLSSKSDIVQLRGPRQQVDQVAVKLNKFIQEVIENNYTKDVKIFKQYHKNIIGKGGVNIRKIREEMNIRIDFPDEHSDSDKIRLTGKKENVEEAAKRIEAMQAELISIKEDTISIPQRLHISLIGTRGKLIKCIQQECGGVQIQFPASDSNSDIIKIRGPESDVDKAKKQLLELSEKNLLLSHQDSVSAKSEFHKFLIGRKGAQLAEFRKRHAVMLIFPDSEDTNKDTIQIIGAKEAVQKAKEELEVTIKSLENEIEKYITIDTKWHKHFFKKRQAVMEEISREFGGVRIFFPKQDAVENIDQVRVIGPKGCVEAAVVRIEDIIENLEAQTSLSVFIEQKHHRNLITRNMMEIKSIQSNYDVTIKFPNRDLSSKPGENGMEEIHLNGNGDVNIETMEEVDTTLESEQNNPANWVTISGRKENCESAEDALLELVPITEDVPLANEFHRNFIGQKGQGINTFSTKHNVVVNIPPANKCSDFISIKGPRVNIIDAKAGLDELITMWENEKQDRIARNYENHVTVPIVFHRNIIGQRGANIEIFRTKFNVSIQIPDQNSKSEEITIRGYEEDVKKAEEELISMVEKWKAQVKEELHIPRDVHPQLIGTRGIALRKLRDQFKVEINFPNRNVDDEKAHLVEVIGDKENVDKCCDILVERANELLNEWEERNQVREVKNLIKDRENINSSSNIKEKGPGFLLTGAPWQQRVPDASSNVDFPKIDANGDKIAGTCLINGHSE 1266          
BLAST of High density lipoprotein binding protein (Vigilin) vs. Planmine SMEST
Match: SMESG000016436.1 (SMESG000016436.1)

HSP 1 Score: 2491.07 bits (6455), Expect = 0.000e+0
Identity = 1262/1264 (99.84%), Postives = 1264/1264 (100.00%), Query Frame = 3
Query:  183 MNKSENHVEESTQSPLLVLQYDDQFPPLPTCNTPKIVQNSKPRIGQTKTSHVTQTLTVPLAERRFSNREANNSVKNDAQKKICQTVAQKCGVSIELNSGNKDQNLMVFISGPQDNVSNAKRILTKEXXXXXXXXMKVPKEYHKFILGRNGASLREIESGSNTNVTIPRSIENNDIITIFGTKEGIDKARAEINQIVAERSKLATERITIPKRFYPFINGSNNSKIYKIREMTNAKXXXXXXXXXXXXXXXXGEKDGVYQALEIIQKIYEDTKKCSSSLNLPIPKSQHCYVIGAKGSGIAEIFERTGVSIEMPSQDSDDDTIVLYGPNEFLAPALSMVIQKSESMIRVNIEAPNWLHRFIIGKQGSNLNKLMEKYEHVFINFPENSDLIVIEGPKDDVNELKGQITHKIAELKSTMAITEIQVDPRFHRHIIGRSGANIQRMQEEYKVQIRMPGNNAVGTSGWTIRIEGDPEGVKLAKTEIESMSVKLENEKTKDVILDHKYHNQLIGAQGSRVKELRNQYPDVIIMFPDLSSKSDIVQLRGPRQQVDQVAVKLNKFIQEVIENNYTKDVKIFKQYHKNIIGKGGVNIRKIREEMNIRIDFPDEHSDSDKIRLTGKKENVEEAAKRIEAMQAELISIKEDTISIPQRLHISLIGTRGKLIKCIQQECGGVQIQFPASDSNSDIIKIRGPESDVDKAXXXXXXXXXXXXXXXHQDSVSAKSEFHKFLIGRKGAQLAEFRKRHAVMLIFPDSEDTNKDTIQIIGAKEAVQKAKEELEVTIKSLENEIEKYITIDTKWHKHFFKKRQAVMEEISREFGGVRIFFPKQDAVENIDQVRVIGPKGCVEAAVVRIEDIIENLEAQTSLSVFIEQKHHRNLITRNMMEIKSIQSNYDVTIKFPNRDLSSKPGENGMEEIHLNGNGDVNIETMEEVDSTLESEQNNPANWVTISGRKENCESAEDALLELVPITEDVPLANEFHRNFIGQKGQGINTFSTKHNVVVNIPPANKCSDFISIKGPRVNIIDAKAGLDELITMWENEKQDRIARNYENHVTVPIVFHRNIIGQRGANIEIFRTKFNVSIQIPDQNSKSEEITIRGYEEDVKKAEEELISMVEKWKAQVKEELHIPRDVHPQLIGTRGIALRKLRDQFKVEINFPNRNVDDEKAHLVEVIGDKENVDKCCDILVERANELLNEWEERNQVREVKNLIKDRENINSSSNIKEKGPGFLLTGAPWQQRVPDASSNVDFPKIDANGDKIAGTCLINGHSE 3974
            MNKSENHV+ESTQSPLLVLQYDDQFPPLPTCNTPKIVQNSKPRIGQTKTSHVTQTLTVPLAERRFSNREANNSVKNDAQKKICQTVAQKCGVSIELNSGNKDQNLMVFISGPQDNVSNAKRILTKELQTQTQLQMKVPKEYHKFILGRNGASLREIESGSNTNVTIPRSIENNDIITIFGTKEGIDKARAEINQIVAERSKLATERITIPKRFYPFINGSNNSKIYKIREMTNAKINIPPPSVESEEIIISGEKDGVYQALEIIQKIYEDTKKCSSSLNLPIPKSQHCYVIGAKGSGIAEIFERTGVSIEMPSQDSDDDTIVLYGPNEFLAPALSMVIQKSESMIRVNIEAPNWLHRFIIGKQGSNLNKLMEKYEHVFINFPENSDLIVIEGPKDDVNELKGQITHKIAELKSTMAITEIQVDPRFHRHIIGRSGANIQRMQEEYKVQIRMPGNNAVGTSGWTIRIEGDPEGVKLAKTEIESMSVKLENEKTKDVILDHKYHNQLIGAQGSRVKELRNQYPDVIIMFPDLSSKSDIVQLRGPRQQVDQVAVKLNKFIQEVIENNYTKDVKIFKQYHKNIIGKGGVNIRKIREEMNIRIDFPDEHSDSDKIRLTGKKENVEEAAKRIEAMQAELISIKEDTISIPQRLHISLIGTRGKLIKCIQQECGGVQIQFPASDSNSDIIKIRGPESDVDKAKKQLLELSEKNLLLSHQDSVSAKSEFHKFLIGRKGAQLAEFRKRHAVMLIFPDSEDTNKDTIQIIGAKEAVQKAKEELEVTIKSLENEIEKYITIDTKWHKHFFKKRQAVMEEISREFGGVRIFFPKQDAVENIDQVRVIGPKGCVEAAVVRIEDIIENLEAQTSLSVFIEQKHHRNLITRNMMEIKSIQSNYDVTIKFPNRDLSSKPGENGMEEIHLNGNGDVNIETMEEVD+TLESEQNNPANWVTISGRKENCESAEDALLELVPITEDVPLANEFHRNFIGQKGQGINTFSTKHNVVVNIPPANKCSDFISIKGPRVNIIDAKAGLDELITMWENEKQDRIARNYENHVTVPIVFHRNIIGQRGANIEIFRTKFNVSIQIPDQNSKSEEITIRGYEEDVKKAEEELISMVEKWKAQVKEELHIPRDVHPQLIGTRGIALRKLRDQFKVEINFPNRNVDDEKAHLVEVIGDKENVDKCCDILVERANELLNEWEERNQVREVKNLIKDRENINSSSNIKEKGPGFLLTGAPWQQRVPDASSNVDFPKIDANGDKIAGTCLINGHSE
Sbjct:    1 MNKSENHVDESTQSPLLVLQYDDQFPPLPTCNTPKIVQNSKPRIGQTKTSHVTQTLTVPLAERRFSNREANNSVKNDAQKKICQTVAQKCGVSIELNSGNKDQNLMVFISGPQDNVSNAKRILTKELQTQTQLQMKVPKEYHKFILGRNGASLREIESGSNTNVTIPRSIENNDIITIFGTKEGIDKARAEINQIVAERSKLATERITIPKRFYPFINGSNNSKIYKIREMTNAKINIPPPSVESEEIIISGEKDGVYQALEIIQKIYEDTKKCSSSLNLPIPKSQHCYVIGAKGSGIAEIFERTGVSIEMPSQDSDDDTIVLYGPNEFLAPALSMVIQKSESMIRVNIEAPNWLHRFIIGKQGSNLNKLMEKYEHVFINFPENSDLIVIEGPKDDVNELKGQITHKIAELKSTMAITEIQVDPRFHRHIIGRSGANIQRMQEEYKVQIRMPGNNAVGTSGWTIRIEGDPEGVKLAKTEIESMSVKLENEKTKDVILDHKYHNQLIGAQGSRVKELRNQYPDVIIMFPDLSSKSDIVQLRGPRQQVDQVAVKLNKFIQEVIENNYTKDVKIFKQYHKNIIGKGGVNIRKIREEMNIRIDFPDEHSDSDKIRLTGKKENVEEAAKRIEAMQAELISIKEDTISIPQRLHISLIGTRGKLIKCIQQECGGVQIQFPASDSNSDIIKIRGPESDVDKAKKQLLELSEKNLLLSHQDSVSAKSEFHKFLIGRKGAQLAEFRKRHAVMLIFPDSEDTNKDTIQIIGAKEAVQKAKEELEVTIKSLENEIEKYITIDTKWHKHFFKKRQAVMEEISREFGGVRIFFPKQDAVENIDQVRVIGPKGCVEAAVVRIEDIIENLEAQTSLSVFIEQKHHRNLITRNMMEIKSIQSNYDVTIKFPNRDLSSKPGENGMEEIHLNGNGDVNIETMEEVDTTLESEQNNPANWVTISGRKENCESAEDALLELVPITEDVPLANEFHRNFIGQKGQGINTFSTKHNVVVNIPPANKCSDFISIKGPRVNIIDAKAGLDELITMWENEKQDRIARNYENHVTVPIVFHRNIIGQRGANIEIFRTKFNVSIQIPDQNSKSEEITIRGYEEDVKKAEEELISMVEKWKAQVKEELHIPRDVHPQLIGTRGIALRKLRDQFKVEINFPNRNVDDEKAHLVEVIGDKENVDKCCDILVERANELLNEWEERNQVREVKNLIKDRENINSSSNIKEKGPGFLLTGAPWQQRVPDASSNVDFPKIDANGDKIAGTCLINGHSE 1264          
BLAST of High density lipoprotein binding protein (Vigilin) vs. Planmine SMEST
Match: SMESG000006601.1 (SMESG000006601.1)

HSP 1 Score: 581.637 bits (1498), Expect = 0.000e+0
Identity = 410/1269 (32.31%), Postives = 691/1269 (54.45%), Query Frame = 3
Query:  336 VTQTLTVPLAERRFSNREANNSVKNDAQKKICQTVAQKCGVSIELNSGNKDQNLMVFISGPQDNVSNAKRILTKEXXXXXXXXMKVPKEYHKFILGRNGASLREIESGSNTNVTIPRSIENNDIITIFGTKEGIDKARAEINQIVAERSKLATERITIPKRFYPFINGSNNSKIYKIREMTNAKXXXXXXXXXXXXXXXXGEKDGVYQALEIIQKIYEDTKKCSSSLNLPIPKSQHCYVIGAKGSGIAEIFERTGVSIEMPSQ---DSDDDTIVLYGPNEFLAPALSMVIQKSESMIRVNIEAPNWLHRFIIGKQGSNLNKLMEKYEHVFINFPENSDLIVIEGPKDDVNELKGQITHKIAELKSTMAITEIQVDPRFHRHIIGRSGANIQRMQEEYKVQIRMPGNNAVGTSGWTIRIEGDPEGVKLAKTEIESMSVKLENEKTKDVILDHKYHNQLIGAQGSRVKELRNQYPDVIIMFPDLSSKSDIVQLRGPRQQVDQVAVKLNKFIQEVIENNYTKDVKIFKQYHKNIIGKGGVNIRKIREEMNIRIDFPDEHSDSDKIRLTGKKENVEEAAKRIEAMQAELISIKEDTISIPQRLHISLIGTRGKLIKCIQQECGG-VQIQFPASDSNSDIIKIRGPESDVDKAXXXXXXXXXXXXXXXHQDSVSAKSEFHKFLIGRKGAQLAEFRKRHAVMLIFPDSEDTNKDTIQIIGAKEAVQKAKEELEVTIKSLENEIEKYITIDTKWHKHFFKKRQAVMEEISREFGGVRIFFPKQDAVENIDQVRVI---GPKGCVEAAVVRIEDIIENLEAQTSLSVFIEQKHHRNLITRNMMEIKSIQSNYDVTIKFP------------NRDLSSKPGE----NG-------------------------MEEIHLNGNGDVNI-ETMEEVDSTLE----------SEQNNPANWVTISGRKENCESAEDALLELVPITEDVPLANEFHRNFIGQKGQGINTFSTKHNVVVNIPPANKCSDFISIKGPRVNIIDAKAGLDELITMWENEKQDRIARNYENHVTVPIVFHRNIIGQRGANIEIFRTKFNVSIQIPDQNSKSEEITIRGYEEDVKKAEEELISMVEKWKAQVKEELHIPRDVHPQLIGTRGIALRKLRDQFKVEINFPNRNVDDEKAHLVEVIGDKENVDKCCDILVERANELLNEWEERNQVREVKNL-----IKDRENINSSSNIKEKGPGFLLTGAPWQQRVPD---ASSNVDFPKIDANGDKI 3941
            +T T  +P  ERR+ + E+N        KK+   +   CGV +E N    DQ+L VFISG +D V  AK+ +T+ +QTQ ++ + +PKE+H+ ++G  G+  +E+E+ ++T V+ P+  + + +I I G+K+GI+ AR  I + V E SK+  + + I KR++      +N+ ++ + E  + +++IPP SV+  EI ISG++DGV QA  I+ + Y   K     L + IPK +H Y+IG +GSGI EI ++T V +++  Q   +   +TI L GP + L PAL++V  KSES+  + I+AP WLH+FIIGK GSNL  L     ++ + F + ++ IVIEG  ++V E+   +  K+ +L+S ++  E+++DP   +HIIG  G NIQ++++E    I  P +     +   + I G P GV+  K  +      +EN K KD+I  H    QLIG QG  +KE+++++P+V I FP   + SD++ L GPR+ VDQVA  L K    ++E+N++K VKI  +YHK IIG+ G+ IR++ +  N +   P    ++D+I +TGK+++VE+A KR+  +  +  +I E  I I + LH  LIG  G  I  +++ CGG V I+FP+ D++S+ + I+G + DV KA+ +L +L E+    +++       E ++FL      +L + R+ ++V +    SE  +K  ++IIG KE V    E L+     +   + + + +      +F K  +  +  I R+    ++  P + +  N ++  ++   GP   +++A   I  II++ E   + ++ ++++  +N+   +  ++  I   Y V I+ P               +S+KPGE    NG                         M E + NG+   NI E   EV ST+           S    P   + I+G K+    A++ +++L  +  +V +  EF+   IG KG+ I    T H V + IP  N     + + G   +++ AK  + E +   E  KQ+R  RN+   + VP  +HR +IG +G  I   RTK +V I +P Q+S   EITI+G++++V+KA+ E+++ V K ++ + E L+I   +H +LIG+RG  L +L+ ++KVEI FP R  + E+A++V+V G KE+VD+C D LV+RAN +L+E  +R Q+ E K+       +  E    + +      GF +  APW     D   +SS  D   ++  GD I
Sbjct:   70 ITDTFVIPYEERRYIDSESNK------LKKLLTEICANCGVRVETNV-TPDQSLGVFISGQKDKVCEAKKYITRLVQTQFEISLDIPKEFHRSLIGNKGSLHKELENNTSTQVSFPKINDPSTLIKIKGSKDGIEHARQLIQKNVDEFSKIGRQVVEIEKRYHQLACHKSNTALHTVLERKSLRLDIPPFSVDKNEISISGDRDGVAQAASILLQTYNQMKATYQELQIEIPKEKHKYIIGPRGSGIKEILDQTSVWVDINEQRLNEGSPNTICLLGPKDNLGPALTLVFTKSESVNIIAIDAPGWLHKFIIGKSGSNLVDLSVNKPNIQLRFEDEANQIVIEGSPEEVIEVSEYLKKKVFDLQSRLSQLEMEIDPLMIKHIIGSGGVNIQKIRKETNCSINFPRD----LTKKVVTIIGTPHGVEAVKAILLKTIETIENTKKKDIIFTHTLMPQLIGQQGKGLKEIKDRFPEVRINFPPPDADSDLISLIGPRKDVDQVAAILQKKHAFLVESNFSKKVKIPFKYHKAIIGREGITIRELTKATNTKFQIPAASEENDEIVITGKQKDVEDAIKRVCNIYEKESNIIEIGIEISKNLHTILIGKGGNRINSLKESCGGRVTIRFPSPDADSNTVIIKGVKDDVLKAQVKLHDLVEEITASNYEQHFQMTLEDYEFLFMSADLKLKKLRETYSVRI----SEAEDKSHLRIIGQKENVLNTLEVLQKARSEMGPIVTETLALSINDLTYFQKSNE--LFRIGRD-NMCKLNVPNKKSKSNPNEQGILEFRGPVQNIKSAKDEIIHIIDDYENTITENLIVDERQLKNIEWYSQNQMSEISQKYQVQIQIPFYPEPVNSKTICYSHVSAKPGEKPYMNGVDSSFSEEESFKSLSPNPNHLPNDIMSEHNSNGSKYHNISEINSEVSSTISAGVALNKDPISNIKLPQYKLEITGHKDKITLAKEEIIKLFVLDLEVNVPEEFYPALIGAKGEKIKKLRTTHQVDIKIPNKNSKFTKVIVTGSSESVVAAKKEIVEFVEELERMKQEREIRNFSLALHVPAQYHRKLIGNKGETISKIRTKNSVRISVPSQDSNINEITIQGHKDNVEKAKNEVLAFVNKLESGIIEVLNIDSRIHSRLIGSRGANLDQLKKKYKVEIVFPIRGTEGEEANIVKVKGTKESVDRCADELVDRANIMLDEINDRMQLEENKSSNYESNFQPEETPEPTKSCVTHKSGFQIRNAPWDAVGNDGNWSSSASDQNLVNGGGDHI 1320          
BLAST of High density lipoprotein binding protein (Vigilin) vs. Planmine SMEST
Match: SMESG000006601.1 (SMESG000006601.1)

HSP 1 Score: 538.495 bits (1386), Expect = 8.177e-166
Identity = 379/1186 (31.96%), Postives = 644/1186 (54.30%), Query Frame = 3
Query:  585 MKVPKEYHKFILGRNGASLREIESGSNTNVTIPRSIENNDIITIFGTKEGIDKARAEINQIVAERSKLATERITIPKRFYPFINGSNNSKIYKIREMTNAKXXXXXXXXXXXXXXXXGEKDGVYQALEIIQKIYEDTKKCSSSLNLPIPKSQHCYVIGAKGSGIAEIFERTGVSIEMPSQ---DSDDDTIVLYGPNEFLAPALSMVIQKSESMIRVNIEAPNWLHRFIIGKQGSNLNKLMEKYEHVFINFPENSDLIVIEGPKDDVNELKGQITHKIAELKSTMAITEIQVDPRFHRHIIGRSGANIQRMQEEYKVQIRMPGNNAVGTSGWTIRIEGDPEGVKLAKTEIESMSVKLENEKTKDVILDHKYHNQLIGAQGSRVKELRNQYPDVIIMFPDLSSKSDIVQLRGPRQQVDQVAVKLNKFIQEVIENNYTKDVKIFKQYHKNIIGKGGVNIRKIREEMNIRIDFPDEHSDSDKIRLTGKKENVEEAAKRIEAMQAELISIKEDTISIPQRLHISLIGTRGKLIKCIQQECGG-VQIQFPASDSNSDIIKIRGPESDVDKAXXXXXXXXXXXXXXXHQDSVSAKSEFHKFLIGRKGAQLAEFRKRHAVMLIFPDSEDTNKDTIQIIGAKEAVQKAKEELEVTIKSLENEIEKYITIDTKWHKHFFKKRQAVMEEISREFGGVRIFFPKQDAVENIDQVRVI---GPKGCVEAAVVRIEDIIENLEAQTSLSVFIEQKHHRNLITRNMMEIKSIQSNYDVTIKFP------------NRDLSSKPGE----NG-------------------------MEEIHLNGNGDVNI-ETMEEVDSTLE----------SEQNNPANWVTISGRKENCESAEDALLELVPITEDVPLANEFHRNFIGQKGQGINTFSTKHNVVVNIPPANKCSDFISIKGPRVNIIDAKAGLDELITMWENEKQDRIARNYENHVTVPIVFHRNIIGQRGANIEIFRTKFNVSIQIPDQNSKSEEITIRGYEEDVKKAEEELISMVEKWKAQVKEELHIPRDVHPQLIGTRGIALRKLRDQFKVEINFPNRNVDDEKAHLVEVIGDKENVDKCCDILVERANELLNEWEERNQVREVKNL-----IKDRENINSSSNIKEKGPGFLLTGAPWQQRVPD---ASSNVDFPKIDANGDKI 3941
            + +PKE+H+ ++G  G+  +E+E+ ++T V+ P+  + + +I I G+K+GI+ AR  I + V E SK+  + + I KR++      +N+ ++ + E  + +++IPP SV+  EI ISG++DGV QA  I+ + Y   K     L + IPK +H Y+IG +GSGI EI ++T V +++  Q   +   +TI L GP + L PAL++V  KSES+  + I+AP WLH+FIIGK GSNL  L     ++ + F + ++ IVIEG  ++V E+   +  K+ +L+S ++  E+++DP   +HIIG  G NIQ++++E    I  P +     +   + I G P GV+  K  +      +EN K KD+I  H    QLIG QG  +KE+++++P+V I FP   + SD++ L GPR+ VDQVA  L K    ++E+N++K VKI  +YHK IIG+ G+ IR++ +  N +   P    ++D+I +TGK+++VE+A KR+  +  +  +I E  I I + LH  LIG  G  I  +++ CGG V I+FP+ D++S+ + I+G + DV KA+ +L +L E+    +++       E ++FL      +L + R+ ++V +    SE  +K  ++IIG KE V    E L+     +   + + + +      +F K  +  +  I R+    ++  P + +  N ++  ++   GP   +++A   I  II++ E   + ++ ++++  +N+   +  ++  I   Y V I+ P               +S+KPGE    NG                         M E + NG+   NI E   EV ST+           S    P   + I+G K+    A++ +++L  +  +V +  EF+   IG KG+ I    T H V + IP  N     + + G   +++ AK  + E +   E  KQ+R  RN+   + VP  +HR +IG +G  I   RTK +V I +P Q+S   EITI+G++++V+KA+ E+++ V K ++ + E L+I   +H +LIG+RG  L +L+ ++KVEI FP R  + E+A++V+V G KE+VD+C D LV+RAN +L+E  +R Q+ E K+       +  E    + +      GF +  APW     D   +SS  D   ++  GD I
Sbjct:  212 LDIPKEFHRSLIGNKGSLHKELENNTSTQVSFPKINDPSTLIKIKGSKDGIEHARQLIQKNVDEFSKIGRQVVEIEKRYHQLACHKSNTALHTVLERKSLRLDIPPFSVDKNEISISGDRDGVAQAASILLQTYNQMKATYQELQIEIPKEKHKYIIGPRGSGIKEILDQTSVWVDINEQRLNEGSPNTICLLGPKDNLGPALTLVFTKSESVNIIAIDAPGWLHKFIIGKSGSNLVDLSVNKPNIQLRFEDEANQIVIEGSPEEVIEVSEYLKKKVFDLQSRLSQLEMEIDPLMIKHIIGSGGVNIQKIRKETNCSINFPRD----LTKKVVTIIGTPHGVEAVKAILLKTIETIENTKKKDIIFTHTLMPQLIGQQGKGLKEIKDRFPEVRINFPPPDADSDLISLIGPRKDVDQVAAILQKKHAFLVESNFSKKVKIPFKYHKAIIGREGITIRELTKATNTKFQIPAASEENDEIVITGKQKDVEDAIKRVCNIYEKESNIIEIGIEISKNLHTILIGKGGNRINSLKESCGGRVTIRFPSPDADSNTVIIKGVKDDVLKAQVKLHDLVEEITASNYEQHFQMTLEDYEFLFMSADLKLKKLRETYSVRI----SEAEDKSHLRIIGQKENVLNTLEVLQKARSEMGPIVTETLALSINDLTYFQKSNE--LFRIGRD-NMCKLNVPNKKSKSNPNEQGILEFRGPVQNIKSAKDEIIHIIDDYENTITENLIVDERQLKNIEWYSQNQMSEISQKYQVQIQIPFYPEPVNSKTICYSHVSAKPGEKPYMNGVDSSFSEEESFKSLSPNPNHLPNDIMSEHNSNGSKYHNISEINSEVSSTISAGVALNKDPISNIKLPQYKLEITGHKDKITLAKEEIIKLFVLDLEVNVPEEFYPALIGAKGEKIKKLRTTHQVDIKIPNKNSKFTKVIVTGSSESVVAAKKEIVEFVEELERMKQEREIRNFSLALHVPAQYHRKLIGNKGETISKIRTKNSVRISVPSQDSNINEITIQGHKDNVEKAKNEVLAFVNKLESGIIEVLNIDSRIHSRLIGSRGANLDQLKKKYKVEIVFPIRGTEGEEANIVKVKGTKESVDRCADELVDRANIMLDEINDRMQLEENKSSNYESNFQPEETPEPTKSCVTHKSGFQIRNAPWDAVGNDGNWSSSASDQNLVNGGGDHI 1386          

HSP 2 Score: 199.519 bits (506), Expect = 3.607e-51
Identity = 294/1205 (24.40%), Postives = 532/1205 (44.15%), Query Frame = 3
Query:  336 VTQTLTVPLAERRFSNREANNSVKNDAQKKICQTVAQKCGVSIELNSGNKDQNLMVFISGPQDNVSNAKRILTKEXXXXXXXXMKVPKEYHKFILGRNGASLREIESGSNTNVT--IPRSIENNDIITIFG-TKEGIDKARAEINQIVAERSKLATERITIPKRFYPFINGSNNSKIYKIREMTNAKXXXXXXXXXXXXXXXXGEKDGVYQALEIIQKIYEDTKKCSSSLNLPIPKSQHCYVIGAKGSGIAEIFERTGVSIEMPSQDSDDDTIVLYGPNEFLAPALSMVIQKSESMI----RVNIEAPNWLHRFIIGKQGSNLNKLMEKYEHVFINFPE------NSDLIVIEGPKDDVNELKGQITHKIAELKSTMAITEIQVDPRFHRHIIGRSGANIQRMQ-EEYKVQIRMPGNNAVGTSGWTIRIEGDPEGVKLAKTEIESMSVKLENEKTK-DVILDHKYHNQLIGAQGSRVKELRNQYPDVIIMFP-DLSSKSDIVQLRGPRQQVDQVAVKLNKFIQEVIENNYTKDVKIFKQYHKNIIGKGGVNIRKIREEM-NIRIDFPDEHSDSDKIRLTGKKENVEEAAKRIEAMQAELI-SIKEDTISIPQRLHISLIGTRGKLIKCIQQECGGVQIQFPASDSNSDIIKIRGPESDVDKAXXXXXXXXXXXXXXXHQDSVSAKSEFHKFLIGRKGAQLAEFRKRHA--VMLIFPDSEDTNKDTIQIIGAKEAVQKAKEELEVTIKSL-ENEIEKYITIDTKWHKHFFKKRQAVMEEISREFGGVRIFFPKQDAVENIDQVRVIGPKGCVEAAVVRIED--------IIENLEAQTSLSVFIEQKHHRNLITRNMMEIKSIQSNYDVTIKFPNRDLSSKPGENGMEEIHLNGNGDVNIETMEEVDSTLESEQNNPANWVTISGRKENCESAEDALLELV-----PITEDVPLANEFHRNFIGQKGQGINTFSTKHNVVVNIP----PANK---CSDFISIK---GPRVNIIDAKAGLDELITMWENEKQDRIARNYENHVTVPIVFHRNIIGQRGANIEIFRTKFNVSIQI-------PDQNSK--SEEITIRGYEEDVKKAEEELISMVEKWKAQVKEELHIPRDVHPQLIGTRGIALRKLRDQFKVEINFPNRNVDDEKAHLVEVIGDKENVDKCCDILVERANELLNEWEERNQVREVKNL 3791
            +T T  +P  ERR+ + E+N        KK+   +   CGV +E N    DQ+L VFISG +D V  AK+ +T+ +QTQT  Q +    Y + +     A   + E+     +T  IP       II  +G  KE       E+ +I           + IPK F+  + G+  S   ++   T+ +++ P  +  S  I I G KDG+  A ++IQK  ++  K    + + I K  H        + +  + ER  + +++P    D + I + G  + +A A S+++Q    M      + IE P   H++IIG +GS + +++++   V+++  E      + + I + GPKD++    G     +     ++ I  I      H+ IIG+SG+N+  +   +  +Q+R             I IEG PE V      ++     L++  ++ ++ +D      +IG+ G  ++++R +  +  I FP DL+ K  +V + G    V+ V   L K I E IEN   KD+         +IG+ G  +++I++    +RI+FP   +DSD I L G +++V++ A  ++   A L+ S     + IP + H ++IG  G  I+ + +     + Q PA+   +D I I G + DV+ A K++  + EK   +  +  +      H  LIG+ G ++   ++     V + FP S D + +T+ I G K+ V KA+ +L   ++ +  +  E++  +  + ++  F      ++++ RE   VRI        E+   +R+IG K  V   +  ++         + E L    +   + ++ +    I R+ M            +  PN+   S P E G+ E                                   G  +N +SA+D ++ ++      ITE++ +     +N        ++  S K+ V + IP    P N    C   +S K    P +N +D+        +  E E    ++ N  NH+   I+   N  G +  NI    ++ + +I         P  N K    ++ I G+++ +  A+EE+I +       +  E+++P + +P LIG +G  ++KLR   +V+I  PN+N    K   V V G  E+V      +VE   EL    E   Q RE++N 
Sbjct:   70 ITDTFVIPYEERRYIDSESN------KLKKLLTEICANCGVRVETNV-TPDQSLGVFISGQKDKVCEAKKYITRLVQTQTNCQEEDVLTYVQHL----NALYSDFETRFEDVLTMVIPPW-----IINPYGDIKETNVIILEELPEISTNEELKFEISLDIPKEFHRSLIGNKGSLHKELENNTSTQVSFPKINDPSTLIKIKGSKDGIEHARQLIQKNVDEFSKIGRQV-VEIEKRYHQLACHKSNTALHTVLERKSLRLDIPPFSVDKNEISISGDRDGVAQAASILLQTYNQMKATYQELQIEIPKEKHKYIIGPRGSGIKEILDQTS-VWVDINEQRLNEGSPNTICLLGPKDNL----GPALTLVFTKSESVNIIAIDAPGWLHKFIIGKSGSNLVDLSVNKPNIQLRFED------EANQIVIEGSPEEVIEVSEYLKKKVFDLQSRLSQLEMEIDPLMIKHIIGSGGVNIQKIRKE-TNCSINFPRDLTKK--VVTIIGTPHGVEAVKAILLKTI-ETIENTKKKDIIFTHTLMPQLIGQQGKGLKEIKDRFPEVRINFPPPDADSDLISLIGPRKDVDQVAAILQKKHAFLVESNFSKKVKIPFKYHKAIIGREGITIRELTK-ATNTKFQIPAASEENDEIVITGKQKDVEDAIKRVCNIYEKESNII-EIGIEISKNLHTILIGKGGNRINSLKESCGGRVTIRFP-SPDADSNTVIIKGVKDDVLKAQVKLHDLVEEITASNYEQHFQMTLEDYEFLFMSADLKLKKL-RETYSVRI-----SEAEDKSHLRIIGQKENVLNTLEVLQKARSEMGPIVTETLALSINDLTYFQKSNELFRIGRDNM----------CKLNVPNKKSKSNPNEQGILEFR---------------------------------GPVQNIKSAKDEIIHIIDDYENTITENLIVDERQLKNIEWYSQNQMSEISQKYQVQIQIPFYPEPVNSKTICYSHVSAKPGEKPYMNGVDS--------SFSEEESFKSLSPN-PNHLPNDIMSEHNSNGSKYHNISEINSEVSSTISAGVALNKDPISNIKLPQYKLEITGHKDKITLAKEEIIKLF-----VLDLEVNVPEEFYPALIGAKGEKIKKLRTTHQVDIKIPNKN---SKFTKVIVTGSSESVVAAKKEIVEFVEEL----ERMKQEREIRNF 1169          

HSP 3 Score: 121.324 bits (303), Expect = 3.829e-27
Identity = 163/763 (21.36%), Postives = 327/763 (42.86%), Query Frame = 3
Query: 1623 ESMSVKLENEKTKDVILDHKYHNQLIGAQG--------SRVKELRNQYPDVIIMFPDLSSKSDIVQLRGPRQQVDQVAVKLNKFIQEVIENNYTK---DVKIFKQYHKNIIGKGGVNIRKIREEMNIRIDFPDEHSDSDKIRLTGKKENVEEAAKRIEAMQAELISIKEDTISIPQRLHISLIGTRGKLIKCIQQECGGVQIQFPASDSNSDIIKIRGPESDVDKAXXXXXXXXXXXXXXXHQDSVSAKSEFHKFLIGRKGAQLAEFRKRHAVMLIFPDSE--DTNKDTIQIIGAKEAVQKAKEELEVTIKSLENEIEKYITIDTK-W-HKHFFKKRQAVMEEISREFGGVRIFFPKQDAVENIDQVRVIG-PKGCVEAAVVRIEDIIENLEAQTSLSVFIEQKHHRNLITRNMMEIKSIQSNYDVTIKFPNRDLSSKPGENGMEEIHLNGNGDVNIETMEEVDSTLESEQNNPANWVTISGRKENCESAEDALLELVPITE-----DVPLANEFHRNFIGQKGQGINTFSTKH-NVVVNIPPANKCSDFISIKGPRVNIIDAKAGLDELITMWENEKQDRIARNYENHVTVPIVFHRNIIGQRGANIEIFRTKFNVSIQIPDQNSKSEEITIRGYEEDVKKAEEELISMVEKWKAQVKEELHIPRDVHPQLIGTRGIALRKLRDQF--KVEINFPNRNVDDEKAHLVEVIGDKENVDKCCDILVERANELLNEWEERNQVREVKNLIKDRENINSSSNIKEK 3839
            +S+ V +  +K K V    KY  +L+  Q         + V+ L   Y D    F D+ +      +  P   + +  V + + + E+  N   K    + I K++H+++IG  G   +++    + ++ FP  +  S  I++ G K+ +E A + I+    E   I    + I +R H  L   +         E   +++  P    + + I I G    V +A   LL+   +      +  +    E HK++IG +G+ + E   + +V +   +    + + +TI ++G K+ +  A     +T+   ++E    I ID   W HK    K  + + ++S     +++ F  +      +Q+ + G P+  +E +    + + +     + L + I+    +++I    + I+ I+   + +I FP RDL+ K                                       VTI G     E+ +  LL+ +   E     D+   +      IGQ+G+G+     +   V +N PP +  SD IS+ GPR ++       D++  + + +    +  N+   V +P  +H+ IIG+ G  I       N   QIP  + +++EI I G ++DV+ A + + ++ EK    ++  + I +++H  LIG  G  +  L++    +V I FP+ + D   ++ V + G K++V K       + ++L+ E    N  +  +  ++D E +  S+++K K
Sbjct:  114 QSLGVFISGQKDK-VCEAKKYITRLVQTQTNCQEEDVLTYVQHLNALYSDFETRFEDVLTMVIPPWIINPYGDIKETNVIILEELPEISTNEELKFEISLDIPKEFHRSLIGNKGSLHKELENNTSTQVSFPKINDPSTLIKIKGSKDGIEHARQLIQKNVDEFSKIGRQVVEIEKRYH-QLACHKSNTALHTVLERKSLRLDIPPFSVDKNEISISGDRDGVAQAASILLQTYNQMKATYQELQIEIPKEKHKYIIGPRGSGIKEILDQTSVWVDINEQRLNEGSPNTICLLGPKDNLGPA-----LTLVFTKSESVNIIAIDAPGWLHKFIIGKSGSNLVDLSVNKPNIQLRFEDE-----ANQIVIEGSPEEVIEVSEYLKKKVFDLQSRLSQLEMEIDPLMIKHIIGSGGVNIQKIRKETNCSINFP-RDLTKK--------------------------------------VVTIIGTPHGVEAVKAILLKTIETIENTKKKDIIFTHTLMPQLIGQQGKGLKEIKDRFPEVRINFPPPDADSDLISLIGPRKDV-------DQVAAILQKKHAFLVESNFSKKVKIPFKYHKAIIGREGITIRELTKATNTKFQIPAASEENDEIVITGKQKDVEDAIKRVCNIYEKESNIIEIGIEISKNLHTILIGKGGNRINSLKESCGGRVTIRFPSPDAD---SNTVIIKGVKDDVLKAQ----VKLHDLVEEITASNYEQHFQMTLEDYEFLFMSADLKLK 811          
BLAST of High density lipoprotein binding protein (Vigilin) vs. Planmine SMEST
Match: SMESG000018596.1 (SMESG000018596.1)

HSP 1 Score: 70.8626 bits (172), Expect = 1.831e-12
Identity = 46/134 (34.33%), Postives = 86/134 (64.18%), Query Frame = 3
Query:  585 MKVPKEYHKFILGRNGASLREIESGSNTNVTIPRSIENNDIITIFGTKEGIDKARAEINQIVAERSKLATERITIPKRFYPFINGSNNSKIYKIREMTNAKXXXXXXXXXXXXXXXXGEKDGVYQALEIIQKIY 986
            + +PKE+H+ ++G  G+  +E+E+ ++T V+ P+  + + +I I G+K+GI+ AR  I + V E SK+  + + I KR++      +N+ ++ + E  + +++IPP SV+  EI ISG++DGV QA  I+ + Y
Sbjct:  200 LDIPKEFHRSLIGNKGSLHKELENNTSTQVSFPKINDPSTLIKIKGSKDGIEHARQLIQKNVDEFSKIGRQVVEIEKRYHQLACHKSNTALHTVLERKSLRLDIPPFSVDKNEISISGDRDGVAQAASILLQTY 333          

HSP 2 Score: 51.6026 bits (122), Expect = 3.271e-6
Identity = 32/124 (25.81%), Postives = 65/124 (52.42%), Query Frame = 3
Query: 1680 KYHNQLIGAQGSRVKELRNQYPDVIIMFPDLSSKSDIVQLRGPRQQVDQVAVKLNKFIQEVIENNYTKDVKIFKQYHKNIIGKGGVNIRKIREEMNIRIDFPDEHSDSDKIRLTGKKENVEEAA 2051
            ++H  LIG +GS  KEL N      + FP ++  S +++++G +  ++     + K + E  +    + V+I K+YH+    K    +  + E  ++R+D P    D ++I ++G ++ V +AA
Sbjct:  205 EFHRSLIGNKGSLHKELENN-TSTQVSFPKINDPSTLIKIKGSKDGIEHARQLIQKNVDEFSKIG-RQVVEIEKRYHQLACHKSNTALHTVLERKSLRLDIPPFSVDKNEISISGDRDGVAQAA 326          
The following BLAST results are available for this feature:
BLAST of High density lipoprotein binding protein (Vigilin) vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HDLBP0.000e+041.57high density lipoprotein binding protein [Source:H... [more]
HDLBP0.000e+041.57high density lipoprotein binding protein [Source:H... [more]
HDLBP0.000e+041.57high density lipoprotein binding protein [Source:H... [more]
HDLBP3.733e-10538.72high density lipoprotein binding protein [Source:H... [more]
HDLBP3.138e-8141.47high density lipoprotein binding protein [Source:H... [more]
back to top
BLAST of High density lipoprotein binding protein (Vigilin) vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
vgln-10.000e+035.18ViGiLN homolog [Source:UniProtKB/TrEMBL;Acc:B3GWB... [more]
vgln-11.313e-9929.99ViGiLN homolog [Source:UniProtKB/TrEMBL;Acc:B3GWB... [more]
back to top
BLAST of High density lipoprotein binding protein (Vigilin) vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dp10.000e+038.14gene:FBgn0027835 transcript:FBtr0086681[more]
Dp10.000e+038.14gene:FBgn0027835 transcript:FBtr0345226[more]
Dp10.000e+038.14gene:FBgn0027835 transcript:FBtr0340329[more]
Dp10.000e+038.14gene:FBgn0027835 transcript:FBtr0086682[more]
Dp10.000e+038.14gene:FBgn0027835 transcript:FBtr0086680[more]
back to top
BLAST of High density lipoprotein binding protein (Vigilin) vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hdlbpa0.000e+041.56high density lipoprotein binding protein a [Source... [more]
hdlbpb0.000e+040.11high density lipoprotein binding protein b [Source... [more]
hdlbpb0.000e+040.11high density lipoprotein binding protein b [Source... [more]
hdlbpb0.000e+040.11high density lipoprotein binding protein b [Source... [more]
hdlbpa1.161e-7442.54high density lipoprotein binding protein a [Source... [more]
back to top
BLAST of High density lipoprotein binding protein (Vigilin) vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hdlbp0.000e+041.52high density lipoprotein binding protein (vigilin)... [more]
hdlbp0.000e+040.40high density lipoprotein binding protein (vigilin)... [more]
hdlbp1.463e-9939.39high density lipoprotein binding protein (vigilin)... [more]
hdlbp1.730e-8337.61high density lipoprotein binding protein (vigilin)... [more]
hdlbp9.603e-16544.04high density lipoprotein binding protein (vigilin)... [more]
back to top
BLAST of High density lipoprotein binding protein (Vigilin) vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Hdlbp0.000e+041.39high density lipoprotein (HDL) binding protein [So... [more]
Hdlbp0.000e+041.39high density lipoprotein (HDL) binding protein [So... [more]
Hdlbp1.494e-10538.53high density lipoprotein (HDL) binding protein [So... [more]
Gm3822.258e-12932.62predicted gene 382 [Source:MGI Symbol;Acc:MGI:2685... [more]
4921511C20Rik7.947e-4025.94RIKEN cDNA 4921511C20 gene [Source:MGI Symbol;Acc:... [more]
back to top
BLAST of High density lipoprotein binding protein (Vigilin) vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8VDJ3|VIGLN_MOUSE0.000e+041.39Vigilin OS=Mus musculus OX=10090 GN=Hdlbp PE=1 SV=... [more]
sp|Q00341|VIGLN_HUMAN0.000e+041.57Vigilin OS=Homo sapiens OX=9606 GN=HDLBP PE=1 SV=2[more]
sp|Q9Z1A6|VIGLN_RAT0.000e+040.93Vigilin OS=Rattus norvegicus OX=10116 GN=Hdlbp PE=... [more]
sp|Q5R439|VIGLN_PONAB0.000e+041.64Vigilin OS=Pongo abelii OX=9601 GN=HDLBP PE=2 SV=1[more]
sp|P81021|VIGLN_CHICK0.000e+039.62Vigilin OS=Gallus gallus OX=9031 GN=HDLBP PE=2 SV=... [more]
back to top
BLAST of High density lipoprotein binding protein (Vigilin) vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3I7W90.000e+041.63vigilin OS=Lingula unguis OX=7574 GN=LOC106161524 ... [more]
R7UX930.000e+041.60Uncharacterized protein OS=Capitella teleta OX=283... [more]
A0A401SU170.000e+041.66Uncharacterized protein OS=Chiloscyllium punctatum... [more]
H9G8560.000e+042.31Uncharacterized protein OS=Anolis carolinensis OX=... [more]
Q402G00.000e+041.31High density lipoprotein-binding protein vigilin O... [more]
back to top
BLAST of High density lipoprotein binding protein (Vigilin) vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hdlbpa4.270e-5541.69high density lipoprotein binding protein a [Source... [more]
hdlbpb0.000e+037.29high density lipoprotein binding protein b [Source... [more]
bicc23.554e-723.48protein bicaudal C homolog 1-like [Source:NCBI gen... [more]
bicc1b5.294e-722.98BicC family RNA binding protein 1 [Source:NCBI gen... [more]
bicc26.488e-723.48protein bicaudal C homolog 1-like [Source:NCBI gen... [more]
back to top
BLAST of High density lipoprotein binding protein (Vigilin) vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
hdlbpb2.819e-6743.79high density lipoprotein binding protein b [Source... [more]
ENSPMAT00000000279.12.843e-4435.21pep scaffold:Pmarinus_7.0:GL479126:30633:36553:-1 ... [more]
ENSPMAT00000007662.12.477e-623.08pep scaffold:Pmarinus_7.0:GL477618:56973:78552:1 g... [more]
back to top
BLAST of High density lipoprotein binding protein (Vigilin) vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
SCP1605.258e-3427.90Essential RNA-binding G protein effector of mating... [more]
back to top
BLAST of High density lipoprotein binding protein (Vigilin) vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO374761.405e-16732.81Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of High density lipoprotein binding protein (Vigilin) vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hdlbpb0.000e+041.88vigilin [Source:NCBI gene;Acc:101163851][more]
hdlbpa0.000e+041.00high density lipoprotein binding protein [Source:N... [more]
hdlbpa0.000e+041.05high density lipoprotein binding protein [Source:N... [more]
hdlbpb1.377e-6442.72vigilin [Source:NCBI gene;Acc:101163851][more]
bicc1a4.530e-624.51BicC family RNA binding protein 1 [Source:NCBI gen... [more]
back to top
BLAST of High density lipoprotein binding protein (Vigilin) vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000016436.10.000e+099.84SMESG000016436.1[more]
SMESG000016436.10.000e+099.84SMESG000016436.1[more]
SMESG000006601.10.000e+032.31SMESG000006601.1[more]
SMESG000006601.18.177e-16631.96SMESG000006601.1[more]
SMESG000018596.11.831e-1234.33SMESG000018596.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30028449 ID=SMED30028449|Name=High density lipoprotein binding protein (Vigilin)|organism=Schmidtea mediterranea sexual|type=transcript|length=4615bp
AAGTCATTTACTTTTGTAAATTAAACAACTCGACAAGTTTCACTATATTG
TAAACGTCAAAAAATAATTTTAGCACTGGATAAGTGATAGTTATTTCTTT
TAATTACAATTAATTGGTACAGTATTTTTAAACAATACTGTTAAAGGTTA
TAGGCTAAAACTAGGTCTACGTTAAAATGGATATGAATAAATCAGAAAAC
CACGTTGAAGAATCAACTCAAAGTCCACTACTTGTCTTGCAATACGATGA
TCAATTTCCACCATTGCCAACTTGCAATACGCCAAAAATTGTACAGAATT
CAAAACCTCGAATTGGTCAAACAAAAACCTCTCATGTTACTCAAACACTT
ACTGTGCCTTTAGCTGAACGTCGATTTTCCAATCGAGAAGCTAATAATTC
CGTTAAAAATGATGCTCAGAAAAAAATTTGTCAAACTGTTGCTCAAAAAT
GTGGAGTTTCAATCGAATTGAATTCGGGAAATAAAGATCAAAATTTAATG
GTTTTTATTAGTGGTCCACAAGATAATGTATCAAATGCTAAAAGAATCCT
TACCAAAGAACTACAAACTCAGACACAATTACAAATGAAAGTGCCTAAAG
AATATCATAAATTTATTTTAGGAAGAAACGGTGCTAGTCTTAGAGAAATT
GAAAGTGGCTCTAATACAAACGTTACAATACCCAGAAGTATCGAAAACAA
TGATATTATTACAATTTTCGGAACGAAAGAAGGAATTGATAAAGCACGTG
CCGAAATTAATCAAATTGTGGCTGAACGTAGCAAATTAGCAACTGAACGA
ATAACAATTCCTAAGCGATTTTATCCCTTCATCAATGGTTCAAATAACAG
CAAAATTTATAAAATTCGTGAAATGACAAATGCAAAAATTAATATTCCCC
CACCTTCTGTAGAATCGGAAGAGATCATAATTTCCGGTGAAAAAGATGGA
GTTTATCAGGCTTTAGAAATTATTCAAAAAATATATGAAGACACGAAAAA
GTGCTCATCGTCATTGAATTTACCAATTCCAAAATCGCAGCATTGCTACG
TTATCGGTGCTAAAGGTTCAGGAATCGCTGAAATTTTCGAACGAACTGGA
GTCAGTATAGAAATGCCTAGTCAGGATTCTGATGATGATACAATTGTTCT
CTACGGTCCAAATGAGTTTCTTGCCCCTGCTTTGTCAATGGTAATCCAAA
AATCTGAATCGATGATCCGTGTCAATATCGAAGCTCCGAATTGGTTACAT
CGATTCATTATTGGAAAACAGGGCTCTAATCTCAACAAATTAATGGAAAA
GTATGAACATGTTTTCATAAACTTTCCAGAAAATTCCGATTTGATTGTAA
TTGAAGGCCCCAAAGACGACGTTAATGAATTGAAAGGACAAATCACCCAC
AAAATTGCGGAATTGAAGTCAACAATGGCAATAACAGAAATTCAAGTCGA
CCCGAGATTCCATCGACATATCATCGGGCGCAGTGGCGCTAACATCCAAC
GAATGCAAGAAGAATATAAAGTTCAAATCAGAATGCCTGGAAATAACGCC
GTTGGTACAAGTGGTTGGACAATTCGAATTGAAGGCGATCCAGAAGGTGT
GAAACTGGCAAAAACAGAAATCGAGTCAATGTCAGTGAAATTGGAGAATG
AAAAAACAAAAGACGTGATTCTCGATCATAAATATCACAACCAATTGATT
GGTGCTCAAGGCAGTCGTGTGAAGGAGTTGCGAAATCAATACCCAGACGT
GATTATAATGTTCCCAGATCTTTCATCAAAAAGCGATATTGTACAATTGC
GAGGACCTCGTCAACAGGTTGATCAAGTCGCTGTCAAATTGAATAAGTTC
ATTCAGGAAGTAATTGAAAACAATTACACGAAAGATGTAAAAATCTTTAA
ACAATATCACAAAAACATCATTGGTAAAGGCGGTGTGAATATCCGTAAAA
TCCGAGAAGAAATGAACATCCGAATTGATTTCCCCGACGAACACAGCGAT
TCAGATAAAATTAGACTGACTGGTAAAAAGGAAAATGTCGAAGAAGCAGC
AAAAAGAATCGAGGCAATGCAAGCCGAATTGATAAGTATCAAGGAAGACA
CGATTTCTATTCCTCAACGATTACATATCAGCCTTATTGGAACTCGAGGA
AAACTTATCAAATGCATCCAACAGGAATGTGGAGGTGTTCAAATCCAATT
CCCAGCCAGTGATAGCAATTCTGACATCATCAAGATCCGAGGACCCGAAT
CTGATGTCGATAAAGCAAAGAAACAGTTATTGGAATTATCAGAGAAAAAC
TTGCTGCTCAGTCATCAGGATTCCGTATCGGCGAAATCAGAGTTCCATAA
GTTCCTCATAGGGAGAAAAGGTGCTCAACTCGCTGAATTCCGTAAACGAC
ACGCTGTTATGTTGATATTCCCCGACAGTGAGGACACGAATAAAGACACT
ATTCAAATAATCGGTGCTAAAGAAGCTGTTCAGAAAGCCAAAGAAGAATT
GGAAGTGACAATTAAGTCATTGGAAAATGAAATTGAAAAATATATAACAA
TCGATACCAAATGGCATAAACATTTCTTCAAGAAGCGCCAAGCTGTTATG
GAAGAAATATCGAGGGAATTCGGTGGAGTTAGAATTTTCTTTCCTAAACA
AGACGCGGTGGAAAATATTGATCAAGTTCGTGTTATCGGTCCAAAGGGCT
GTGTCGAAGCTGCGGTCGTCCGCATTGAAGATATCATAGAGAACCTTGAA
GCTCAAACTAGCCTTTCTGTGTTTATTGAACAGAAACATCATCGAAATTT
GATTACTCGTAATATGATGGAAATTAAAAGTATTCAAAGCAATTATGACG
TAACAATAAAATTCCCCAATCGAGATCTTTCTTCGAAACCCGGAGAAAAT
GGAATGGAAGAAATTCATTTGAATGGCAATGGAGATGTCAACATTGAAAC
AATGGAAGAAGTTGATAGCACTTTGGAATCGGAGCAAAACAACCCAGCCA
ATTGGGTTACGATATCTGGGCGTAAAGAAAACTGTGAATCCGCTGAAGAT
GCATTACTGGAACTAGTTCCCATTACCGAAGATGTTCCACTTGCTAACGA
ATTTCATCGTAATTTCATTGGTCAGAAAGGTCAAGGAATCAATACATTTT
CCACTAAACATAACGTTGTTGTAAATATCCCCCCGGCTAACAAATGTTCG
GATTTCATATCAATTAAAGGTCCCCGAGTCAATATAATTGACGCAAAAGC
CGGTCTTGATGAATTAATCACGATGTGGGAAAATGAAAAACAAGACAGAA
TAGCTAGGAATTATGAAAATCACGTCACTGTCCCAATTGTCTTTCATCGA
AACATAATCGGTCAACGTGGAGCGAATATCGAAATTTTCAGAACCAAATT
CAACGTGTCAATACAAATTCCCGACCAAAACAGTAAATCAGAAGAGATTA
CTATTCGTGGTTACGAAGAGGATGTGAAGAAAGCCGAAGAAGAATTGATA
TCGATGGTCGAGAAATGGAAAGCTCAAGTAAAGGAAGAATTGCACATACC
CAGAGATGTTCATCCTCAGCTAATCGGAACTCGTGGTATAGCTTTAAGGA
AATTAAGAGACCAATTCAAAGTCGAGATTAATTTTCCCAATAGAAATGTT
GACGATGAAAAGGCACATCTCGTCGAAGTTATCGGTGATAAGGAGAATGT
GGATAAATGTTGTGATATTCTAGTTGAAAGAGCAAACGAATTGTTGAATG
AATGGGAGGAACGCAATCAAGTGAGAGAGGTGAAGAATTTAATCAAAGAT
CGCGAAAATATAAATAGCTCAAGCAATATCAAAGAAAAAGGTCCAGGATT
TCTATTAACAGGAGCTCCATGGCAACAAAGAGTTCCTGATGCCTCCAGCA
ATGTTGACTTCCCAAAAATCGATGCCAACGGTGACAAAATCGCGGGAACT
TGCCTAATTAATGGTCATTCAGAATAATATTAATTTCTTGACTTTTTGAA
TTGGATTTGAATAAATTTTAATTCTGTAACTCTCATGGCATATTGATTGA
ATTTTGTGCGAGATGAATATTTTATTATTAATGCTTATCTAGTTTTAATG
TGTTTGTCTATGTTTGTTTGTGTCAGTTGATTGATTGATCAATACTGTAA
AGCATTCATGTGTTTCATTTTTTGCTTGCGGTGTGTGCAATATCGACTTG
TCCATAATTATTGCTGCTAGTCAACATTCTCATTGATTGCGATTCTTTTC
CGATGTGTCTTAATTTAGAACGTGAACGTTTGTATATTCAAGTTTCGATA
AAATATCTTATTCTCCTTCGGACAAGTGATGATATTTGTAGTGTTATTAG
AAAGAGGAGTAATTATCACTACTGGTTTTTATTAATGATATTTGGTGCTA
TTAAAATAATGGTAAAAGGACTTGATTTTAATTTGAATGAGGGTTACTTA
TTCTGAAATTTTAATGGACTTTGGCATTTTTGTGTCAATAATTGGTGATT
TTGAGCAATAATCTACTTTCGTTATGAAGAATCGAATGTAATAAATATAA
AAGCTAAATAAAATTGTAGTCTTGTTAAATAATACAGTTTTATTTTTTGG
TTAGTAAAAATTGGC
back to top

protein sequence of SMED30028449-orf-1

>SMED30028449-orf-1 ID=SMED30028449-orf-1|Name=SMED30028449-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1267bp
MDMNKSENHVEESTQSPLLVLQYDDQFPPLPTCNTPKIVQNSKPRIGQTK
TSHVTQTLTVPLAERRFSNREANNSVKNDAQKKICQTVAQKCGVSIELNS
GNKDQNLMVFISGPQDNVSNAKRILTKELQTQTQLQMKVPKEYHKFILGR
NGASLREIESGSNTNVTIPRSIENNDIITIFGTKEGIDKARAEINQIVAE
RSKLATERITIPKRFYPFINGSNNSKIYKIREMTNAKINIPPPSVESEEI
IISGEKDGVYQALEIIQKIYEDTKKCSSSLNLPIPKSQHCYVIGAKGSGI
AEIFERTGVSIEMPSQDSDDDTIVLYGPNEFLAPALSMVIQKSESMIRVN
IEAPNWLHRFIIGKQGSNLNKLMEKYEHVFINFPENSDLIVIEGPKDDVN
ELKGQITHKIAELKSTMAITEIQVDPRFHRHIIGRSGANIQRMQEEYKVQ
IRMPGNNAVGTSGWTIRIEGDPEGVKLAKTEIESMSVKLENEKTKDVILD
HKYHNQLIGAQGSRVKELRNQYPDVIIMFPDLSSKSDIVQLRGPRQQVDQ
VAVKLNKFIQEVIENNYTKDVKIFKQYHKNIIGKGGVNIRKIREEMNIRI
DFPDEHSDSDKIRLTGKKENVEEAAKRIEAMQAELISIKEDTISIPQRLH
ISLIGTRGKLIKCIQQECGGVQIQFPASDSNSDIIKIRGPESDVDKAKKQ
LLELSEKNLLLSHQDSVSAKSEFHKFLIGRKGAQLAEFRKRHAVMLIFPD
SEDTNKDTIQIIGAKEAVQKAKEELEVTIKSLENEIEKYITIDTKWHKHF
FKKRQAVMEEISREFGGVRIFFPKQDAVENIDQVRVIGPKGCVEAAVVRI
EDIIENLEAQTSLSVFIEQKHHRNLITRNMMEIKSIQSNYDVTIKFPNRD
LSSKPGENGMEEIHLNGNGDVNIETMEEVDSTLESEQNNPANWVTISGRK
ENCESAEDALLELVPITEDVPLANEFHRNFIGQKGQGINTFSTKHNVVVN
IPPANKCSDFISIKGPRVNIIDAKAGLDELITMWENEKQDRIARNYENHV
TVPIVFHRNIIGQRGANIEIFRTKFNVSIQIPDQNSKSEEITIRGYEEDV
KKAEEELISMVEKWKAQVKEELHIPRDVHPQLIGTRGIALRKLRDQFKVE
INFPNRNVDDEKAHLVEVIGDKENVDKCCDILVERANELLNEWEERNQVR
EVKNLIKDRENINSSSNIKEKGPGFLLTGAPWQQRVPDASSNVDFPKIDA
NGDKIAGTCLINGHSE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000028Category 2 cell
PLANA:0000034epidermis
PLANA:0000035Category 3 cell
PLANA:0000067goblet cell
PLANA:0000070intestinal phagocyte
PLANA:0000101muscle cell
PLANA:0000428musculature system
PLANA:0000484secretory system
PLANA:0002032epidermal cell
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR036612KH_dom_type_1_sf
IPR004087KH_dom
IPR004088KH_dom_type_1
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0003723RNA binding
GO:0098641cadherin binding involved in cell-cell adhesion
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005737cytoplasm
GO:0005829cytosol
GO:0005913cell-cell adherens junction
GO:0034364high-density lipoprotein particle
Vocabulary: biological process
TermDefinition
GO:0006629lipid metabolic process
GO:0006810transport
GO:0006869lipid transport
GO:0008202steroid metabolic process
GO:0008203cholesterol metabolic process
GO:0098609cell-cell adhesion
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 1086..1113
NoneNo IPR availableCOILSCoilCoilcoord: 765..792
NoneNo IPR availableCOILSCoilCoilcoord: 1183..1203
NoneNo IPR availableCOILSCoilCoilcoord: 187..207
NoneNo IPR availableCOILSCoilCoilcoord: 475..495
NoneNo IPR availableCOILSCoilCoilcoord: 614..641
NoneNo IPR availablePANTHERPTHR10627:SF34VIGILINcoord: 22..1197
NoneNo IPR availablePANTHERPTHR10627SCP160coord: 22..1197
NoneNo IPR availablePROSITEPS50084KH_TYPE_1coord: 1117..1182
score: 12.622
NoneNo IPR availablePROSITEPS50084KH_TYPE_1coord: 1045..1107
score: 14.152
NoneNo IPR availablePROSITEPS50084KH_TYPE_1coord: 417..482
score: 14.655
NoneNo IPR availablePROSITEPS50084KH_TYPE_1coord: 132..194
score: 16.101
NoneNo IPR availablePROSITEPS50084KH_TYPE_1coord: 965..1027
score: 9.246
NoneNo IPR availablePROSITEPS50084KH_TYPE_1coord: 492..555
score: 10.609
NoneNo IPR availablePROSITEPS50084KH_TYPE_1coord: 638..701
score: 13.355
NoneNo IPR availablePROSITEPS50084KH_TYPE_1coord: 712..775
score: 11.846
NoneNo IPR availablePROSITEPS50084KH_TYPE_1coord: 204..266
score: 13.418
NoneNo IPR availablePROSITEPS50084KH_TYPE_1coord: 277..339
score: 13.271
NoneNo IPR availablePROSITEPS50084KH_TYPE_1coord: 566..628
score: 16.521
NoneNo IPR availablePROSITEPS50084KH_TYPE_1coord: 346..406
score: 11.678
NoneNo IPR availableCDDcd02394vigilin_like_KHcoord: 967..1027
e-value: 5.0788E-10
score: 54.4401
NoneNo IPR availableCDDcd02394vigilin_like_KHcoord: 1120..1178
e-value: 2.41457E-10
score: 55.2105
NoneNo IPR availableCDDcd02394vigilin_like_KHcoord: 135..194
e-value: 1.16783E-14
score: 67.5369
NoneNo IPR availableCDDcd02394vigilin_like_KHcoord: 206..267
e-value: 1.0401E-13
score: 64.8405
NoneNo IPR availableCDDcd02394vigilin_like_KHcoord: 568..629
e-value: 1.85828E-19
score: 81.0188
NoneNo IPR availableCDDcd02394vigilin_like_KHcoord: 351..406
e-value: 6.65198E-13
score: 62.5293
NoneNo IPR availableCDDcd02394vigilin_like_KHcoord: 716..776
e-value: 8.77486E-12
score: 59.4477
NoneNo IPR availableCDDcd02394vigilin_like_KHcoord: 640..702
e-value: 3.06713E-15
score: 69.0777
NoneNo IPR availableCDDcd02394vigilin_like_KHcoord: 494..555
e-value: 2.87949E-10
score: 55.2105
NoneNo IPR availableCDDcd02394vigilin_like_KHcoord: 421..483
e-value: 1.41958E-14
score: 67.1517
NoneNo IPR availableCDDcd02394vigilin_like_KHcoord: 1049..1107
e-value: 1.65937E-16
score: 72.9297
NoneNo IPR availableCDDcd02394vigilin_like_KHcoord: 279..339
e-value: 1.7601E-9
score: 52.8993
IPR004087K Homology domainSMARTSM00322kh_6coord: 859..965
e-value: 6.1E-6
score: 35.7
coord: 1116..1187
e-value: 1.8E-9
score: 47.4
coord: 784..855
e-value: 0.17
score: 21.0
coord: 276..344
e-value: 0.0041
score: 26.3
coord: 203..271
e-value: 1.3E-12
score: 57.9
coord: 491..560
e-value: 9.4E-9
score: 45.1
coord: 1044..1112
e-value: 1.8E-12
score: 57.4
coord: 637..706
e-value: 6.5E-12
score: 55.6
coord: 966..1032
e-value: 0.0011
score: 28.2
coord: 131..199
e-value: 3.8E-14
score: 63.0
coord: 345..411
e-value: 1.1E-10
score: 51.5
coord: 711..780
e-value: 2.6E-6
score: 37.0
coord: 416..487
e-value: 1.1E-11
score: 54.9
coord: 565..633
e-value: 4.9E-16
score: 69.3
IPR036612K Homology domain, type 1 superfamilyGENE3DG3DSA:3.30.1370.10coord: 277..333
e-value: 4.7E-8
score: 34.7
IPR036612K Homology domain, type 1 superfamilyGENE3DG3DSA:3.30.1370.10coord: 334..416
e-value: 5.7E-22
score: 79.2
IPR036612K Homology domain, type 1 superfamilyGENE3DG3DSA:3.30.1370.10coord: 778..860
e-value: 9.4E-14
score: 52.9
coord: 631..710
e-value: 2.1E-24
score: 87.1
coord: 485..564
e-value: 1.8E-16
score: 61.6
IPR036612K Homology domain, type 1 superfamilyGENE3DG3DSA:3.30.1370.10coord: 132..205
e-value: 2.1E-19
score: 71.0
coord: 206..276
e-value: 8.1E-15
score: 56.3
IPR036612K Homology domain, type 1 superfamilyGENE3DG3DSA:3.30.1370.10coord: 970..1031
e-value: 4.3E-11
score: 44.2
coord: 713..777
e-value: 8.4E-14
score: 52.9
coord: 565..630
e-value: 1.1E-20
score: 74.9
coord: 417..484
e-value: 1.3E-19
score: 71.5
IPR036612K Homology domain, type 1 superfamilyGENE3DG3DSA:3.30.1370.10coord: 1116..1204
e-value: 7.2E-19
score: 69.2
IPR036612K Homology domain, type 1 superfamilyGENE3DG3DSA:3.30.1370.10coord: 1032..1115
e-value: 2.5E-21
score: 77.2
IPR036612K Homology domain, type 1 superfamilySUPERFAMILYSSF54791Eukaryotic type KH-domain (KH-domain type I)coord: 199..273
IPR036612K Homology domain, type 1 superfamilySUPERFAMILYSSF54791Eukaryotic type KH-domain (KH-domain type I)coord: 1044..1117
IPR036612K Homology domain, type 1 superfamilySUPERFAMILYSSF54791Eukaryotic type KH-domain (KH-domain type I)coord: 415..485
IPR036612K Homology domain, type 1 superfamilySUPERFAMILYSSF54791Eukaryotic type KH-domain (KH-domain type I)coord: 1110..1195
IPR036612K Homology domain, type 1 superfamilySUPERFAMILYSSF54791Eukaryotic type KH-domain (KH-domain type I)coord: 327..413
IPR036612K Homology domain, type 1 superfamilySUPERFAMILYSSF54791Eukaryotic type KH-domain (KH-domain type I)coord: 715..785
IPR036612K Homology domain, type 1 superfamilySUPERFAMILYSSF54791Eukaryotic type KH-domain (KH-domain type I)coord: 113..200
IPR036612K Homology domain, type 1 superfamilySUPERFAMILYSSF54791Eukaryotic type KH-domain (KH-domain type I)coord: 639..706
IPR036612K Homology domain, type 1 superfamilySUPERFAMILYSSF54791Eukaryotic type KH-domain (KH-domain type I)coord: 277..345
IPR036612K Homology domain, type 1 superfamilySUPERFAMILYSSF54791Eukaryotic type KH-domain (KH-domain type I)coord: 564..636
IPR036612K Homology domain, type 1 superfamilySUPERFAMILYSSF54791Eukaryotic type KH-domain (KH-domain type I)coord: 854..964
IPR036612K Homology domain, type 1 superfamilySUPERFAMILYSSF54791Eukaryotic type KH-domain (KH-domain type I)coord: 965..1037
IPR036612K Homology domain, type 1 superfamilySUPERFAMILYSSF54791Eukaryotic type KH-domain (KH-domain type I)coord: 490..587
IPR036612K Homology domain, type 1 superfamilySUPERFAMILYSSF54791Eukaryotic type KH-domain (KH-domain type I)coord: 779..857
IPR004088K Homology domain, type 1PFAMPF00013KH_1coord: 282..330
e-value: 2.3E-8
score: 33.7
coord: 135..195
e-value: 1.4E-14
score: 53.7
coord: 496..555
e-value: 3.3E-8
score: 33.2
coord: 206..267
e-value: 3.0E-12
score: 46.2
coord: 717..776
e-value: 2.0E-9
score: 37.1
coord: 1050..1107
e-value: 5.7E-11
score: 42.1
coord: 420..483
e-value: 4.6E-12
score: 45.6
coord: 571..629
e-value: 8.2E-14
score: 51.2
coord: 1120..1182
e-value: 4.3E-9
score: 36.1
coord: 350..406
e-value: 4.0E-11
score: 42.6
coord: 642..702
e-value: 2.6E-13
score: 49.6