Corrinoid adenosyltransferase

Overview
NameCorrinoid adenosyltransferase
Smed IDSMED30028448
Length (bp)1388
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Corrinoid adenosyltransferase (SMED30028448) t-SNE clustered cells

Violin plots show distribution of expression levels for Corrinoid adenosyltransferase (SMED30028448) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Corrinoid adenosyltransferase (SMED30028448) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Corrinoid adenosyltransferase (SMED30028448) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30028448

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30028448 dd_Smed_v4_42398_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Corrinoid adenosyltransferase vs. Ensembl Human
Match: MMAB (metabolism of cobalamin associated B [Source:HGNC Symbol;Acc:HGNC:19331])

HSP 1 Score: 151.754 bits (382), Expect = 2.365e-42
Identity = 87/189 (46.03%), Postives = 111/189 (58.73%), Query Frame = 3
Query:   93 KIYTRTGDKGKSSLYTGERRNKDDCVFAALGDVDELSCHLGDARFEIKRAKVNFLINIDKHLFDIQCNLQDVGTSVAVPFDKRNESIQNKIGFNHSHTELLEKLIDEMTGTLPVLKNFILPCSESKISSKLHLSRAVCRRCERSLNHSNLENQIEPSVLTYINRLSDYLFTAARYSSNQLGYQDSVYIK 659
            KIYT+TGDKG SS +TGERR KDD VF A+G  DELS  +G A   +      F   + K    IQC LQDVG+++A P     E+      F       LE+ ID+ T  LP L  FILP S  KISS LH  RAVCRR ER +       + + +V  ++NRLSDYLFT ARY++ + G Q+ +Y+K
Sbjct:   57 KIYTKTGDKGFSSTFTGERRPKDDQVFEAVGTTDELSSAIGFALELVTEKGHTFAEELQK----IQCTLQDVGSALATPCSSAREAHLKYTTFKAGPILELEQWIDKYTSQLPPLTAFILP-SGGKISSALHFCRAVCRRAERRVVPLVQMGETDANVAKFLNRLSDYLFTLARYAAMKEGNQEKIYMK 240          
BLAST of Corrinoid adenosyltransferase vs. Ensembl Human
Match: MMAB (metabolism of cobalamin associated B [Source:HGNC Symbol;Acc:HGNC:19331])

HSP 1 Score: 104.375 bits (259), Expect = 2.163e-25
Identity = 57/130 (43.85%), Postives = 76/130 (58.46%), Query Frame = 3
Query:  270 KHLFDIQCNLQDVGTSVAVPFDKRNESIQNKIGFNHSHTELLEKLIDEMTGTLPVLKNFILPCSESKISSKLHLSRAVCRRCERSLNHSNLENQIEPSVLTYINRLSDYLFTAARYSSNQLGYQDSVYIK 659
            + L  IQC LQDVG+++A P     E+      F       LE+ ID+ T  LP L  FILP S  KISS LH  RAVCRR ER +       + + +V  ++NRLSDYLFT ARY++ + G Q+ +Y+K
Sbjct:   60 EELQKIQCTLQDVGSALATPCSSAREAHLKYTTFKAGPILELEQWIDKYTSQLPPLTAFILP-SGGKISSALHFCRAVCRRAERRVVPLVQMGETDANVAKFLNRLSDYLFTLARYAAMKEGNQEKIYMK 188          
BLAST of Corrinoid adenosyltransferase vs. Ensembl Human
Match: MMAB (metabolism of cobalamin associated B [Source:HGNC Symbol;Acc:HGNC:19331])

HSP 1 Score: 94.7449 bits (234), Expect = 3.182e-22
Identity = 55/121 (45.45%), Postives = 67/121 (55.37%), Query Frame = 3
Query:   93 KIYTRTGDKGKSSLYTGERRNKDDCVFAALGDVDELSCHLGDARFEIKRAKVNFLINIDKHLFDIQCNLQDVGTSVAVPFDKRNESIQNKIGFNHSHTELLEKLIDEMTGTLPVLKNFILP 455
            KIYT+TGDKG SS +TGERR KDD VF A+G  DELS  +G A   +      F   + K    IQC LQDVG+++A P     E+      F       LE+ ID+ T  LP L  FILP
Sbjct:   57 KIYTKTGDKGFSSTFTGERRPKDDQVFEAVGTTDELSSAIGFALELVTEKGHTFAEELQK----IQCTLQDVGSALATPCSSAREAHLKYTTFKAGPILELEQWIDKYTSQLPPLTAFILP 173          
BLAST of Corrinoid adenosyltransferase vs. Ensembl Human
Match: MMAB (metabolism of cobalamin associated B [Source:HGNC Symbol;Acc:HGNC:19331])

HSP 1 Score: 94.7449 bits (234), Expect = 3.182e-22
Identity = 55/121 (45.45%), Postives = 67/121 (55.37%), Query Frame = 3
Query:   93 KIYTRTGDKGKSSLYTGERRNKDDCVFAALGDVDELSCHLGDARFEIKRAKVNFLINIDKHLFDIQCNLQDVGTSVAVPFDKRNESIQNKIGFNHSHTELLEKLIDEMTGTLPVLKNFILP 455
            KIYT+TGDKG SS +TGERR KDD VF A+G  DELS  +G A   +      F   + K    IQC LQDVG+++A P     E+      F       LE+ ID+ T  LP L  FILP
Sbjct:   57 KIYTKTGDKGFSSTFTGERRPKDDQVFEAVGTTDELSSAIGFALELVTEKGHTFAEELQK----IQCTLQDVGSALATPCSSAREAHLKYTTFKAGPILELEQWIDKYTSQLPPLTAFILP 173          
BLAST of Corrinoid adenosyltransferase vs. Ensembl Human
Match: MMAB (metabolism of cobalamin associated B [Source:HGNC Symbol;Acc:HGNC:19331])

HSP 1 Score: 58.9214 bits (141), Expect = 1.964e-10
Identity = 28/41 (68.29%), Postives = 32/41 (78.05%), Query Frame = 3
Query:   93 KIYTRTGDKGKSSLYTGERRNKDDCVFAALGDVDELSCHLG 215
            KIYT+TGDKG SS +TGERR KDD VF A+G  DELS  +G
Sbjct:   57 KIYTKTGDKGFSSTFTGERRPKDDQVFEAVGTTDELSSAIG 97          
BLAST of Corrinoid adenosyltransferase vs. Ensembl Celegans
Match: mmab-1 (MethylMalonic Aciduria type B homolog [Source:UniProtKB/TrEMBL;Acc:Q18218])

HSP 1 Score: 114.005 bits (284), Expect = 3.884e-29
Identity = 66/171 (38.60%), Postives = 91/171 (53.22%), Query Frame = 3
Query:  108 TGDKGKSSLYTGERRNKDDCVFAALGDVDELSCHLGDARFEIKRAKVNFLINIDKHLFDIQCNLQDVGTSVAVPFDKRNESIQNKIGFNHSHTELLEKLIDEMTGTLPVLKNFILPCSESKISSKLHLSRAVCRRCERSLNHSNLENQIEPSVLTYINRLSDYLFTAARYS 620
            TGD G+SSLY  ERR KDD  F ALG  DELS  LG      +      + ++ + L  +QC LQDVG  +A P    +E  Q K  F+ +  E +   ID     LP ++ FIL       S++L  SRA+CRR ERS+     +  ++P  L ++NR+SD LF   R +
Sbjct:   16 TGDSGQSSLYNNERRWKDDDTFNALGATDELSSFLGVCGASAQND--GSMSDVVETLTRLQCCLQDVGAHLATPPKNSSERKQKKTAFDIAMVEWINAEIDRYGDALPAIRQFIL-SGGGMTSAQLQYSRAICRRAERSIVPLMRDEDVDPMALKFLNRMSDLLFVLGRTA 183          
BLAST of Corrinoid adenosyltransferase vs. Ensembl Zebrafish
Match: mmab (metabolism of cobalamin associated B [Source:ZFIN;Acc:ZDB-GENE-060526-232])

HSP 1 Score: 158.303 bits (399), Expect = 3.293e-45
Identity = 88/190 (46.32%), Postives = 117/190 (61.58%), Query Frame = 3
Query:   93 KIYTRTGDKGKSSLYTGERRNKDDCVFAALGDVDELSCHLGDARFEIKRAKVNFLINIDKHLFDIQCNLQDVGTSVAVPFDKRNESIQNKIGFNHSHTELLEKLIDEMTGTLPVLKNFILPCSESKISSKLHLSRAVCRRCERSLNHSNLENQIEPSVLTYINRLSDYLFTAARYSSNQLGYQDSVYIKQ 662
            KIYT+TGDKG SS +TGERR K+D +F ALG  DELS  +G AR     +  +F   ++K    +QC LQDVG+++A P     ES   K  F+      LEK ID  T  LP L +FILP S  K S+ LH++RAVCRR ER +       + +P V  Y+NRLSDYLFT ARY++ + G  +++Y +Q
Sbjct:   48 KIYTKTGDKGFSSTFTGERRPKEDHIFDALGTTDELSSAIGLAREFCIDSGHSFTDQLEK----VQCVLQDVGSNIATPRSSARESHITKTKFSSQSVSELEKWIDSFTEELPPLTSFILP-SGGKSSAALHVARAVCRRAERCVAPVVRSGETDPEVAKYLNRLSDYLFTVARYAAMKDGNAETIYKRQ 232          
BLAST of Corrinoid adenosyltransferase vs. Ensembl Xenopus
Match: MMAB (metabolism of cobalamin associated B [Source:NCBI gene;Acc:100496049])

HSP 1 Score: 160.614 bits (405), Expect = 2.742e-46
Identity = 89/189 (47.09%), Postives = 119/189 (62.96%), Query Frame = 3
Query:   93 KIYTRTGDKGKSSLYTGERRNKDDCVFAALGDVDELSCHLGDARFEIKRAKVNFLINIDKHLFDIQCNLQDVGTSVAVPFDKRNESIQNKIGFNHSHTELLEKLIDEMTGTLPVLKNFILPCSESKISSKLHLSRAVCRRCERSLNHSNLENQIEPSVLTYINRLSDYLFTAARYSSNQLGYQDSVYIK 659
            KIYT+TGDKG SS YTGERR KDD +F ALGD DEL+  +G AR     A   F+  ++K    IQC LQDVG+++A P     ES + +  F+    + LE+ ID+ T  LP L NFILP S  K S+ LH++RAVCRR ER +       + + +V  Y+NRLSD LFT ARY++   G +++VY +
Sbjct:   22 KIYTKTGDKGFSSTYTGERRPKDDLLFEALGDTDELNSAIGLAREFSLDANHIFVPELEK----IQCMLQDVGSNIATPLSSARESHKVRTSFSAEPVQELEQWIDKYTSQLPPLTNFILP-SGGKTSAALHVARAVCRRAERKVFKVIQAGEADQNVGKYLNRLSDCLFTLARYAAQAEGRKETVYTR 205          
BLAST of Corrinoid adenosyltransferase vs. Ensembl Xenopus
Match: MMAB (metabolism of cobalamin associated B [Source:NCBI gene;Acc:100496049])

HSP 1 Score: 160.229 bits (404), Expect = 9.397e-46
Identity = 89/189 (47.09%), Postives = 119/189 (62.96%), Query Frame = 3
Query:   93 KIYTRTGDKGKSSLYTGERRNKDDCVFAALGDVDELSCHLGDARFEIKRAKVNFLINIDKHLFDIQCNLQDVGTSVAVPFDKRNESIQNKIGFNHSHTELLEKLIDEMTGTLPVLKNFILPCSESKISSKLHLSRAVCRRCERSLNHSNLENQIEPSVLTYINRLSDYLFTAARYSSNQLGYQDSVYIK 659
            KIYT+TGDKG SS YTGERR KDD +F ALGD DEL+  +G AR     A   F+  ++K    IQC LQDVG+++A P     ES + +  F+    + LE+ ID+ T  LP L NFILP S  K S+ LH++RAVCRR ER +       + + +V  Y+NRLSD LFT ARY++   G +++VY +
Sbjct:   45 KIYTKTGDKGFSSTYTGERRPKDDLLFEALGDTDELNSAIGLAREFSLDANHIFVPELEK----IQCMLQDVGSNIATPLSSARESHKVRTSFSAEPVQELEQWIDKYTSQLPPLTNFILP-SGGKTSAALHVARAVCRRAERKVFKVIQAGEADQNVGKYLNRLSDCLFTLARYAAQAEGRKETVYTR 228          
BLAST of Corrinoid adenosyltransferase vs. Ensembl Mouse
Match: Mmab (methylmalonic aciduria (cobalamin deficiency) cblB type homolog (human) [Source:MGI Symbol;Acc:MGI:1924947])

HSP 1 Score: 151.754 bits (382), Expect = 1.456e-42
Identity = 87/194 (44.85%), Postives = 113/194 (58.25%), Query Frame = 3
Query:   93 KIYTRTGDKGKSSLYTGERRNKDDCVFAALGDVDELSCHLGDARFEIKRAKVNFLINIDKHLF-----DIQCNLQDVGTSVAVPFDKRNESIQNKIGFNHSHTELLEKLIDEMTGTLPVLKNFILPCSESKISSKLHLSRAVCRRCERSLNHSNLENQIEPSVLTYINRLSDYLFTAARYSSNQLGYQDSVYIK 659
            KIYT+TGDKG SS +TGERR KDD VF A+G  DELS  +G   F ++      L+    H+F      IQC LQDVG+++A P     E+      F       LE+ ID+ +  LP LK FILP S  K SS LH  RAVCRR ER +       + + +V  ++NRLSDYLFT ARY++ + G Q+ +Y K
Sbjct:   51 KIYTKTGDKGFSSTFTGERRPKDDQVFEAVGTTDELSSAIG---FAME------LVTEKGHMFAEELQKIQCMLQDVGSALATPRSSAREAHLKHTAFQEGPVLELERWIDKYSSQLPPLKAFILP-SGGKSSSALHFCRAVCRRAERRVVPLVQMGETDANVAKFLNRLSDYLFTVARYAAMKEGSQEKIYKK 234          
BLAST of Corrinoid adenosyltransferase vs. Ensembl Mouse
Match: Mmab (methylmalonic aciduria (cobalamin deficiency) cblB type homolog (human) [Source:MGI Symbol;Acc:MGI:1924947])

HSP 1 Score: 120.939 bits (302), Expect = 6.513e-31
Identity = 73/169 (43.20%), Postives = 94/169 (55.62%), Query Frame = 3
Query:   93 KIYTRTGDKGKSSLYTGERRNKDDCVFAALGDVDELSCHLGDARFEIKRAKVNFLINIDKHLF-----DIQCNLQDVGTSVAVPFDKRNESIQNKIGFNHSHTELLEKLIDEMTGTLPVLKNFILPCSESKISSKLHLSRAVCRRCERSLNHSNLENQIEPSVLTYINR 584
            KIYT+TGDKG SS +TGERR KDD VF A+G  DELS  +G   F ++      L+    H+F      IQC LQDVG+++A P     E+      F       LE+ ID+ +  LP LK FILP S  K SS LH  RAVCRR ER +       + + +V  ++NR
Sbjct:   51 KIYTKTGDKGFSSTFTGERRPKDDQVFEAVGTTDELSSAIG---FAME------LVTEKGHMFAEELQKIQCMLQDVGSALATPRSSAREAHLKHTAFQEGPVLELERWIDKYSSQLPPLKAFILP-SGGKSSSALHFCRAVCRRAERRVVPLVQMGETDANVAKFLNR 209          
BLAST of Corrinoid adenosyltransferase vs. Ensembl Mouse
Match: Mmab (methylmalonic aciduria (cobalamin deficiency) cblB type homolog (human) [Source:MGI Symbol;Acc:MGI:1924947])

HSP 1 Score: 93.5893 bits (231), Expect = 7.951e-22
Identity = 66/189 (34.92%), Postives = 86/189 (45.50%), Query Frame = 3
Query:   93 KIYTRTGDKGKSSLYTGERRNKDDCVFAALGDVDELSCHLGDARFEIKRAKVNFLINIDKHLFDIQCNLQDVGTSVAVPFDKRNESIQNKIGFNHSHTELLEKLIDEMTGTLPVLKNFILPCSESKISSKLHLSRAVCRRCERSLNHSNLENQIEPSVLTYINRLSDYLFTAARYSSNQLGYQDSVYIK 659
            KIYT+TGDKG SS +TGERR KDD VF A+G  DELS  +G   F ++      L+    H+F                                   E L+K                   S  K SS LH  RAVCRR ER +       + + +V  ++NRLSDYLFT ARY++ + G Q+ +Y K
Sbjct:   51 KIYTKTGDKGFSSTFTGERRPKDDQVFEAVGTTDELSSAIG---FAME------LVTEKGHMF----------------------------------AEELQK-------------------SGGKSSSALHFCRAVCRRAERRVVPLVQMGETDANVAKFLNRLSDYLFTVARYAAMKEGSQEKIYKK 177          
BLAST of Corrinoid adenosyltransferase vs. UniProt/SwissProt
Match: sp|Q9D273|MMAB_MOUSE (Corrinoid adenosyltransferase OS=Mus musculus OX=10090 GN=Mmab PE=1 SV=1)

HSP 1 Score: 151.754 bits (382), Expect = 1.019e-41
Identity = 87/194 (44.85%), Postives = 113/194 (58.25%), Query Frame = 3
Query:   93 KIYTRTGDKGKSSLYTGERRNKDDCVFAALGDVDELSCHLGDARFEIKRAKVNFLINIDKHLF-----DIQCNLQDVGTSVAVPFDKRNESIQNKIGFNHSHTELLEKLIDEMTGTLPVLKNFILPCSESKISSKLHLSRAVCRRCERSLNHSNLENQIEPSVLTYINRLSDYLFTAARYSSNQLGYQDSVYIK 659
            KIYT+TGDKG SS +TGERR KDD VF A+G  DELS  +G   F ++      L+    H+F      IQC LQDVG+++A P     E+      F       LE+ ID+ +  LP LK FILP S  K SS LH  RAVCRR ER +       + + +V  ++NRLSDYLFT ARY++ + G Q+ +Y K
Sbjct:   51 KIYTKTGDKGFSSTFTGERRPKDDQVFEAVGTTDELSSAIG---FAME------LVTEKGHMFAEELQKIQCMLQDVGSALATPRSSAREAHLKHTAFQEGPVLELERWIDKYSSQLPPLKAFILP-SGGKSSSALHFCRAVCRRAERRVVPLVQMGETDANVAKFLNRLSDYLFTVARYAAMKEGSQEKIYKK 234          
BLAST of Corrinoid adenosyltransferase vs. UniProt/SwissProt
Match: sp|Q96EY8|MMAB_HUMAN (Corrinoid adenosyltransferase OS=Homo sapiens OX=9606 GN=MMAB PE=1 SV=1)

HSP 1 Score: 151.754 bits (382), Expect = 1.136e-41
Identity = 87/189 (46.03%), Postives = 111/189 (58.73%), Query Frame = 3
Query:   93 KIYTRTGDKGKSSLYTGERRNKDDCVFAALGDVDELSCHLGDARFEIKRAKVNFLINIDKHLFDIQCNLQDVGTSVAVPFDKRNESIQNKIGFNHSHTELLEKLIDEMTGTLPVLKNFILPCSESKISSKLHLSRAVCRRCERSLNHSNLENQIEPSVLTYINRLSDYLFTAARYSSNQLGYQDSVYIK 659
            KIYT+TGDKG SS +TGERR KDD VF A+G  DELS  +G A   +      F   + K    IQC LQDVG+++A P     E+      F       LE+ ID+ T  LP L  FILP S  KISS LH  RAVCRR ER +       + + +V  ++NRLSDYLFT ARY++ + G Q+ +Y+K
Sbjct:   57 KIYTKTGDKGFSSTFTGERRPKDDQVFEAVGTTDELSSAIGFALELVTEKGHTFAEELQK----IQCTLQDVGSALATPCSSAREAHLKYTTFKAGPILELEQWIDKYTSQLPPLTAFILP-SGGKISSALHFCRAVCRRAERRVVPLVQMGETDANVAKFLNRLSDYLFTLARYAAMKEGNQEKIYMK 240          
BLAST of Corrinoid adenosyltransferase vs. UniProt/SwissProt
Match: sp|Q58D49|MMAB_BOVIN (Corrinoid adenosyltransferase OS=Bos taurus OX=9913 GN=MMAB PE=2 SV=1)

HSP 1 Score: 146.747 bits (369), Expect = 8.594e-40
Identity = 85/189 (44.97%), Postives = 112/189 (59.26%), Query Frame = 3
Query:   93 KIYTRTGDKGKSSLYTGERRNKDDCVFAALGDVDELSCHLGDARFEIKRAKVNFLINIDKHLFDIQCNLQDVGTSVAVPFDKRNESIQNKIGFNHSHTELLEKLIDEMTGTLPVLKNFILPCSESKISSKLHLSRAVCRRCERSLNHSNLENQIEPSVLTYINRLSDYLFTAARYSSNQLGYQDSVYIK 659
            KIYT+TGDKG SS +TGERR+KDD VF A+G  DELS  +G A   I      F+  + K    IQC+LQDVG+++A P     E+      F       LE+ ID+ +  LP L  FILP S  K SS LH  RAVCRR ER +       + + +V+ ++NRLSDYLFT ARY++ + G  + +Y K
Sbjct:   51 KIYTKTGDKGFSSTFTGERRSKDDQVFEAVGTTDELSSAIGFAMELIAEKGHPFVEELQK----IQCSLQDVGSALATPRSSAREAHLKHATFEAGPILELEQWIDKYSRQLPPLTAFILP-SGGKSSSALHFCRAVCRRAERRVVPLVQTGETDANVVKFLNRLSDYLFTLARYTAMKEGNPEKIYKK 234          
BLAST of Corrinoid adenosyltransferase vs. UniProt/SwissProt
Match: sp|O34899|PDUO_BACSU (Corrinoid adenosyltransferase OS=Bacillus subtilis (strain 168) OX=224308 GN=yvqK PE=1 SV=2)

HSP 1 Score: 100.908 bits (250), Expect = 1.456e-23
Identity = 67/187 (35.83%), Postives = 97/187 (51.87%), Query Frame = 3
Query:   93 KIYTRTGDKGKSSLYTGERRNKDDCVFAALGDVDELSCHLGDARFEIKRAKVNFLINIDKHLFDIQCNLQDVGTSVAVPFDKRNESIQNKIGFNHSHTELLEKLIDEMTGTLPVLKNFILPCSESKISSKLHLSRAVCRRCERSLNHSNLENQIEPSVLTYINRLSDYLFTAARYSSNQLGYQDSVY 653
            K+YT+TGDKG++ L  G R +KD     + G +DEL+  +G A  E+   +  F  ++   L  IQ  L D G  +A+  ++++  +             LE  ID  T   P LK FILP   SK +S LH++R + RR ER +       +I  +VL Y+NRLSDY F AAR  + + G  D  Y
Sbjct:    2 KLYTKTGDKGQTGLVGG-RTDKDSLRVESYGTIDELNSFIGLALAELS-GQPGFE-DLTAELLTIQHELFDCGGDLAIVTERKDYKL------TEESVSFLETRIDAYTAEAPELKKFILPGG-SKCASLLHIARTITRRAERRVVALMKSEEIHETVLRYLNRLSDYFFAAARVVNARSGIGDVEY 178          
BLAST of Corrinoid adenosyltransferase vs. UniProt/SwissProt
Match: sp|Q1LJ80|ATR_CUPMC (Cobalamin adenosyltransferase OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) OX=266264 GN=cobO PE=1 SV=1)

HSP 1 Score: 93.2041 bits (230), Expect = 7.042e-21
Identity = 61/194 (31.44%), Postives = 94/194 (48.45%), Query Frame = 3
Query:   90 SKIYTRTGDKGKSSLYTGERRNKDDCVFAALGDVDELSCHLGDARFEIKRAKVNFLINIDKHLFDIQCNLQDVGTSVAVPFDKRNESIQNKIGFNHSHTELLEKLIDEMT---GTLPVLKNFILPCSESKISSKLHLSRAVCRRCERSLNHSNLENQIEPSVLTYINRLSDYLFTAARYSSNQLGYQDSVYIKQ 662
            SKI TRTGD G + L  G R  K+     A+GDVDEL+ H+G     +   + +   ++   L  IQ +L D+G  +++P            G+       + +L D +      LP L  FILP   S+ +++ H+ R VCRR ER+L        +  +   Y+NRLSD LF  AR  +   G  D ++ ++
Sbjct:    6 SKIATRTGDAGTTGLGDGSRVGKNSLRIVAIGDVDELNSHIG-----LLLTEPDLPEDVRAALLHIQHDLFDLGGELSIP------------GYTLLKAPQVAQLDDWLAHYNAALPRLAEFILPGG-SRPAAQAHICRTVCRRAERALVELGAAEALNEAPRQYLNRLSDLLFVLARVLNRAGGGSDVLWQRE 181          
BLAST of Corrinoid adenosyltransferase vs. TrEMBL
Match: A0A2P6UZS3 (Corrinoid adenosyltransferase OS=Micractinium conductrix OX=554055 GN=C2E20_8973 PE=3 SV=1)

HSP 1 Score: 176.792 bits (447), Expect = 1.938e-49
Identity = 91/191 (47.64%), Postives = 122/191 (63.87%), Query Frame = 3
Query:   93 KIYTRTGDKGKSSLYTGERRNKDDCVFAALGDVDELSCHLGDARFEIKRAKVNFLINIDKHLFDIQCNLQDVGTSVAVPFDKRNESIQNKIGFNHSHTELLEKLIDEMTGTLPVLKNFILPCSESKISSKLHLSRAVCRRCERSLNHSNLENQIEPSVLTYINRLSDYLFTAARYSSNQLGYQDSVYIKQT 665
            KIYTRTGD G SSLY+GERR KDD VFAALGDVDE++  +G AR   ++        +   L +IQ  L DVG++VA P    +E    +  F+  HT+ LE+ ID MTG LP L  FILP S    S+ LH++R+VCRR ER++         + +V  Y+NRLSDYLFTAARY++ + G  ++V++K T
Sbjct:    2 KIYTRTGDGGASSLYSGERRPKDDAVFAALGDVDEVNSVIGLAREHARQVDP----GLAGQLEEIQSRLFDVGSAVATPLPSSSEHKLQRTVFSTRHTQQLEQWIDGMTGQLPPLTQFILP-SGGLASASLHMARSVCRRAERAVVPLTRGGTTDAAVAVYLNRLSDYLFTAARYAALKAGEPETVWVKAT 187          
BLAST of Corrinoid adenosyltransferase vs. TrEMBL
Match: A0A0K2U3P5 (Corrinoid adenosyltransferase OS=Lepeophtheirus salmonis OX=72036 GN=mmab PE=3 SV=1)

HSP 1 Score: 177.178 bits (448), Expect = 9.314e-49
Identity = 91/191 (47.64%), Postives = 122/191 (63.87%), Query Frame = 3
Query:   87 YSKIYTRTGDKGKSSLYTGERRNKDDCVFAALGDVDELSCHLGDARFEIKRAKVNFLINIDKHLFDIQCNLQDVGTSVAVPFDKRNESIQNKIGFNHSHTELLEKLIDEMTGTLPVLKNFILPCSESKISSKLHLSRAVCRRCERSLNHSNLENQIEPSVLTYINRLSDYLFTAARYSSNQLGYQDSVYIK 659
            Y +IYTRTGDKG SSLYTGERR K D +F ALG  DELS H+G A          +L N+++    IQC LQD+G+++A P     ++   K  FN  HT+ LE+ IDE +  LP LKNFILP    K S+ LH++R+VCRR ER +    LE Q+E   L Y+NRLSD+LFT AR+++     Q+++Y +
Sbjct:   41 YPRIYTRTGDKGTSSLYTGERREKSDVIFEALGTTDELSSHIGLAYAYAAENGHPYLDNLER----IQCLLQDIGSTIATPKSSARDTHLKKTEFNPEHTQELEEWIDEYSKNLPPLKNFILPGG-GKTSASLHIARSVCRRSERRVTPLVLEGQMEGEALKYLNRLSDFLFTIARFAARLDKMQETIYTQ 226          
BLAST of Corrinoid adenosyltransferase vs. TrEMBL
Match: E1Z3N3 (Corrinoid adenosyltransferase OS=Chlorella variabilis OX=554065 GN=CHLNCDRAFT_49309 PE=3 SV=1)

HSP 1 Score: 174.096 bits (440), Expect = 2.717e-48
Identity = 88/189 (46.56%), Postives = 123/189 (65.08%), Query Frame = 3
Query:   93 KIYTRTGDKGKSSLYTGERRNKDDCVFAALGDVDELSCHLGDARFEIKRAKVNFLINIDKHLFDIQCNLQDVGTSVAVPFDKRNESIQNKIGFNHSHTELLEKLIDEMTGTLPVLKNFILPCSESKISSKLHLSRAVCRRCERSLNHSNLENQIEPSVLTYINRLSDYLFTAARYSSNQLGYQDSVYIK 659
            KIYT+TGD G SSLY+GERR KDD VFAALGDVDE++  LG AR   +  ++   + + + L  IQ  L DVG++VA P    ++    ++ F+ +H   LE+ IDEM   LP L  FILP S    ++ LH+SR+VCRR ER++     +   E +V  Y+NRLSDYLFTAARY++ + G  ++V++K
Sbjct:    2 KIYTKTGDGGASSLYSGERRPKDDAVFAALGDVDEVNSTLGLAREHAR--QLAGAMRLAQQLEVIQSRLFDVGSAVATPRPTSSDHKLQRVAFSEAHAAQLERWIDEMMEELPPLTQFILP-SGGLAAAALHMSRSVCRRAERAVVPLVRDQATEAAVAIYLNRLSDYLFTAARYAALKAGEPETVWVK 187          
BLAST of Corrinoid adenosyltransferase vs. TrEMBL
Match: A0A077WVK5 (Corrinoid adenosyltransferase OS=Lichtheimia ramosa OX=688394 GN=LRAMOSA03924 PE=3 SV=1)

HSP 1 Score: 173.711 bits (439), Expect = 2.825e-48
Identity = 92/187 (49.20%), Postives = 121/187 (64.71%), Query Frame = 3
Query:   93 KIYTRTGDKGKSSLYTGERRNKDDCVFAALGDVDELSCHLGDARFEIKRAKVNFLINIDKHLFDIQCNLQDVGTSVAVPFDKRNESIQNKIGFNHSHTELLEKLIDEMTGTLPVLKNFILPCSESKISSKLHLSRAVCRRCERSLNHSNLENQIEPSVLTYINRLSDYLFTAARYSSNQLGYQDSVY 653
            KIYT+TGDKG SSLY GERRNKDD +F ALG  DEL+ H+G A   I+  +   L  + K L +IQC +QD+G +VA P ++ NE    K  F   H E LEK ID+MT  LP L  FILP S  + S+ LH++R VCRR ER +     ++  + +V  Y+NRLSDYLFTAARY++ + G  + +Y
Sbjct:    2 KIYTKTGDKGTSSLYNGERRNKDDEIFEALGTTDELTSHIGLA---IEYCEELKLETVCKQLEEIQCRMQDIGANVATPRERSNERKLGKTIFESHHAEQLEKWIDDMTSELPKLTKFILP-SGGRASATLHVARTVCRRAERRVQPLARDHLCDETVAIYLNRLSDYLFTAARYAAMKQGKPEIIY 184          
BLAST of Corrinoid adenosyltransferase vs. TrEMBL
Match: A0A2V0P016 (Corrinoid adenosyltransferase OS=Raphidocelis subcapitata OX=307507 GN=Rsub_04859 PE=3 SV=1)

HSP 1 Score: 174.096 bits (440), Expect = 3.977e-48
Identity = 90/189 (47.62%), Postives = 123/189 (65.08%), Query Frame = 3
Query:   93 KIYTRTGDKGKSSLYTGERRNKDDCVFAALGDVDELSCHLGDARFEIKRAKVNFLINIDKHLFDIQCNLQDVGTSVAVPFDKRNESIQNKIGFNHSHTELLEKLIDEMTGTLPVLKNFILPCSESKISSKLHLSRAVCRRCERSLNHSNLENQIEPSVLTYINRLSDYLFTAARYSSNQLGYQDSVYIK 659
            KIYT+TGD G ++LYTGERR K+D VFAALGDVDEL+C LG AR E    +++  +     L  +Q  L DVG++VA P    +E    ++ F+ + T  LE  ID M   LP L+NFILP S  + +S LHLSRAVCRR ER++       ++ P V  ++NRLSDYLF AAR+++ + G +++VY K
Sbjct:    9 KIYTKTGDAGSAALYTGERRPKEDAVFAALGDVDELNCALGAAR-EFCAPELHGALAA--QLAHLQSRLLDVGSAVATPAGAASERQLARVQFDAAETVRLEAWIDSMDEQLPPLRNFILP-SGGRAASLLHLSRAVCRRAERAVAPLARAGEVRPEVGAFLNRLSDYLFQAARWAAMKEGREETVYKK 193          
BLAST of Corrinoid adenosyltransferase vs. Ensembl Cavefish
Match: ENSAMXT00000035499.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001885.1:112013:118396:-1 gene:ENSAMXG00000031442.1 transcript:ENSAMXT00000035499.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 153.295 bits (386), Expect = 1.414e-43
Identity = 88/187 (47.06%), Postives = 113/187 (60.43%), Query Frame = 3
Query:   93 KIYTRTGDKGKSSLYTGERRNKDDCVFAALGDVDELSCHLGDARFEIKRAKVNFLINIDKHLFDIQCNLQDVGTSVAVPFDKRNESIQNKIGFNHSHTELLEKLIDEMTGTLPVLKNFILPCSESKISSKLHLSRAVCRRCERSLNHSNLENQIEPSVLTYINRLSDYLFTAARYSSNQLGYQDSVY 653
            KIYT+TGDKG SS +TGERR K+D +F ALG  DELS  +G AR        +F   +DK    IQC LQDVG+++A P     +S   +  F+      LE  ID  T  LP L NFILP S  K S+ LH++RAVCRR ER +       + +P V  Y+NRLSDYLFT ARY++ + G  +S+Y
Sbjct:   26 KIYTKTGDKGFSSTFTGERRPKEDHIFEALGTTDELSSAVGLAREFCLEKGHSFTDQLDK----IQCVLQDVGSNIATPRSSARDSHIKRTKFSSQPVLELESWIDSYTAELPPLTNFILP-SGGKSSAALHVARAVCRRAERCVAPIIRSGEADPDVGKYLNRLSDYLFTLARYAALKEGNNESIY 207          
BLAST of Corrinoid adenosyltransferase vs. Ensembl Cavefish
Match: ENSAMXT00000041359.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001885.1:77195:118396:-1 gene:ENSAMXG00000031442.1 transcript:ENSAMXT00000041359.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 153.295 bits (386), Expect = 1.414e-43
Identity = 88/187 (47.06%), Postives = 113/187 (60.43%), Query Frame = 3
Query:   93 KIYTRTGDKGKSSLYTGERRNKDDCVFAALGDVDELSCHLGDARFEIKRAKVNFLINIDKHLFDIQCNLQDVGTSVAVPFDKRNESIQNKIGFNHSHTELLEKLIDEMTGTLPVLKNFILPCSESKISSKLHLSRAVCRRCERSLNHSNLENQIEPSVLTYINRLSDYLFTAARYSSNQLGYQDSVY 653
            KIYT+TGDKG SS +TGERR K+D +F ALG  DELS  +G AR        +F   +DK    IQC LQDVG+++A P     +S   +  F+      LE  ID  T  LP L NFILP S  K S+ LH++RAVCRR ER +       + +P V  Y+NRLSDYLFT ARY++ + G  +S+Y
Sbjct:   26 KIYTKTGDKGFSSTFTGERRPKEDHIFEALGTTDELSSAVGLAREFCLEKGHSFTDQLDK----IQCVLQDVGSNIATPRSSARDSHIKRTKFSSQPVLELESWIDSYTAELPPLTNFILP-SGGKSSAALHVARAVCRRAERCVAPIIRSGEADPDVGKYLNRLSDYLFTLARYAALKEGNNESIY 207          
BLAST of Corrinoid adenosyltransferase vs. Ensembl Cavefish
Match: mmab (metabolism of cobalamin associated B [Source:ZFIN;Acc:ZDB-GENE-060526-232])

HSP 1 Score: 76.2554 bits (186), Expect = 9.397e-16
Identity = 54/143 (37.76%), Postives = 69/143 (48.25%), Query Frame = 3
Query:   93 KIYTRTGDKGKSSLYTGERRNKDDCVFAALGDVDELSCHLGDARFEIKRAKVNFLINIDKHLFDIQCNLQDVGTSVAVPFDKRNESIQNKIGFNHSHTELLEKLIDEMTGTLPVLKNFILPCSESKISSKLHLSRAVCRRCER 521
            KIYT+TGDK   +L TGER +                           +   +F   +DK    IQC LQDVG+++A P     +S  +   F+      LE  ID  T  LP L NFILP S  K S+ LH++RAVCRR ER
Sbjct:   47 KIYTKTGDK---ALSTGERSSA-------------------------WKKGHSFTDQLDK----IQCVLQDVGSNIATPRSSARDSHISTTKFSSQPVLELESWIDSYTAELPPLTNFILP-SGGKSSAALHVARAVCRRAER 156          
BLAST of Corrinoid adenosyltransferase vs. Ensembl Cavefish
Match: ENSAMXT00000057266.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000967.1:11070:13967:1 gene:ENSAMXG00000039660.1 transcript:ENSAMXT00000057266.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 52.373 bits (124), Expect = 1.459e-7
Identity = 24/38 (63.16%), Postives = 29/38 (76.32%), Query Frame = 3
Query:  102 TRTGDKGKSSLYTGERRNKDDCVFAALGDVDELSCHLG 215
            T+TGDKG SS +TGERR K+D +F ALG  DELS  +G
Sbjct:    1 TKTGDKGFSSTFTGERRPKEDHIFEALGTTDELSSAVG 38          
BLAST of Corrinoid adenosyltransferase vs. Ensembl Sea Lamprey
Match: mmab (metabolism of cobalamin associated B [Source:ZFIN;Acc:ZDB-GENE-060526-232])

HSP 1 Score: 150.984 bits (380), Expect = 1.375e-43
Identity = 85/195 (43.59%), Postives = 116/195 (59.49%), Query Frame = 3
Query:   78 KVNYSKIYTRTGDKGKSSLYTGERRNKDDCVFAALGDVDELSCHLGDARFEIKRAKVNFLINIDKHLFDIQCNLQDVGTSVAVPFDKRNESIQNKIGFNHSHTELLEKLIDEMTGTLPVLKNFILPCSESKISSKLHLSRAVCRRCERSLNHSNLENQIEPSVLTYINRLSDYLFTAARYSSNQLGYQDSVYIKQ 662
            + N  +IYT+TGD G SS +TGERR KDD VF ALG VDELS  LG A    +  + +F     + L  IQC LQDVG++VA P     ++   +  F+ S    LE  ID  T  LP L NFILP S  + ++ LH++R+ CRR ER +       + + SV  Y+NRLSDYLFT AR+++ + G  + VY ++
Sbjct:    8 RSNLPRIYTKTGDAGMSSTFTGERRTKDDAVFEALGTVDELSSALGFACELCQEGQHSFC----EQLLQIQCVLQDVGSNVATPRSSARDAHLQRTKFDESVVAELEGWIDGYTSQLPPLTNFILP-SGGRCAAALHVARSTCRRAERRVVVLVRAGEADASVGKYLNRLSDYLFTLARFAAMKDGRPEQVYRRR 197          
BLAST of Corrinoid adenosyltransferase vs. Ensembl Nematostella
Match: EDO47502 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLY1])

HSP 1 Score: 105.916 bits (263), Expect = 1.593e-27
Identity = 57/126 (45.24%), Postives = 80/126 (63.49%), Query Frame = 3
Query:  285 IQCNLQDVGTSVAVPFDKRNESIQNKIG---FNHSHTELLEKLIDEMTGTLPVLKNFILPCSESKISSKLHLSRAVCRRCERSLNHSNLENQIEPSVLTYINRLSDYLFTAARYSSNQLGYQDSVY 653
            +QC LQDVG+++A P   R  S Q+KI    F+  H  +LE+ IDE    LP L NFILP S  K SS LH++R VCRR ER +        ++P+V  ++NRLSD+LFTAAR+++   G ++ +Y
Sbjct:    1 MQCILQDVGSNIATP---RETSRQDKIKRTEFSEMHVPILERWIDEYHNQLPALTNFILP-SGGKASSLLHVARTVCRRAERRVVPLVTSGSVDPNVGKFLNRLSDFLFTAARFAAKTEGREEKIY 122          
BLAST of Corrinoid adenosyltransferase vs. Ensembl Nematostella
Match: EDO27035 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TAD4])

HSP 1 Score: 104.375 bits (259), Expect = 2.033e-26
Identity = 71/180 (39.44%), Postives = 95/180 (52.78%), Query Frame = 3
Query:   93 KIYTRTGDKGKSSLYTGERRNKDDCVFAALGDVDELSCHLGDARFEIKRAKVNFLINIDKHLFDIQCNLQDVGTSVAVPFDKRNESIQ------NKIGFNHSHTELLEKLIDEMTGTLPVLKNFILPCSESKISSKLHLSRAVCRRCERSLNHSNLENQIEPSVLTYINRLSDYLFTAAR 614
            KIYT+TGDKG ++L+ G R  K      + G VDEL+ ++G     I+  K++   N  K L  IQ  L  +G  +A P +K  E+++      N    N +  E LE  ID M  TLP + NFILP     +S   H++R VCRR ER     +    I   VL Y+NRLSDYLF  AR
Sbjct:    2 KIYTKTGDKGTTALFGGTRVPKHHLRIESYGTVDELNSYIG----LIRDQKIDS--NTLKALIKIQNELFTLGAMLATPPEK--ETLKSGKERLNIPKINTASVEWLELEIDTMNSTLPPMTNFILPGGNQTVSF-CHIARCVCRRAERLATALHENETINSDVLRYLNRLSDYLFVLAR 172          
BLAST of Corrinoid adenosyltransferase vs. Ensembl Nematostella
Match: EDO26690 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TBB7])

HSP 1 Score: 99.3673 bits (246), Expect = 2.142e-24
Identity = 65/190 (34.21%), Postives = 96/190 (50.53%), Query Frame = 3
Query:   90 SKIYTRTGDKGKSSLYTGERRNKDDCVFAALGDVDELSCHLGDARFEI--KRAKVNFLINIDKHLFDIQCNLQDVGTSVAVPFDKRNESIQNKIGFNHSHTELLEKLIDEMTGTLPVLKNFILPCSESKISSKLHLSRAVCRRCERSLNHSNLENQIEPSVLTYINRLSDYLFTAARYSSNQLGYQDSVY 653
            SKIYTRTGD G++ L  G R  KD     A+G+VD L+ H+G    E+  ++A+   L  + + L   Q  L D+G  +A+P         +         E LE  ID     +  L+NFILP   S++ ++ H+ R++ R  ER   H N    I    L Y+NRLSD LF AAR  + + G  + ++
Sbjct:    6 SKIYTRTGDAGETGLADGRRVTKDHPRVDAMGEVDTLNSHIGLLLAELAEQQAQWPGLTEVIEVLAPCQHRLFDLGGELAMP---------DYQALQAPEIERLEAAIDRWNEEVGPLENFILPGG-SRLIAQAHVCRSLARSAERRCQHLNAVEPIRGVGLAYVNRLSDLLFVAARLIAKRQGIVEVLW 185          
BLAST of Corrinoid adenosyltransferase vs. Ensembl Medaka
Match: mmab (metabolism of cobalamin associated B [Source:NCBI gene;Acc:101170348])

HSP 1 Score: 154.066 bits (388), Expect = 1.411e-43
Identity = 88/188 (46.81%), Postives = 116/188 (61.70%), Query Frame = 3
Query:   93 KIYTRTGDKGKSSLYTGERRNKDDCVFAALGDVDELSCHLGDAR-FEIKRAKVNFLINIDKHLFDIQCNLQDVGTSVAVPFDKRNESIQNKIGFNHSHTELLEKLIDEMTGTLPVLKNFILPCSESKISSKLHLSRAVCRRCERSLNHSNLENQIEPSVLTYINRLSDYLFTAARYSSNQLGYQDSVY 653
            KIYT+TGDKG SS +TGERR K+D +F ALG+ DELS  +G AR F +++    F+  +DK    IQC LQDVG+++A P     +S   K  F       LE  ID  T  LP L NFILP S  K S+ LHL+R VCRR ERS+       + +  V  ++NRLSDYLFT ARY++ + G ++ +Y
Sbjct:   51 KIYTKTGDKGFSSTFTGERRPKEDHIFEALGNTDELSSAIGLAREFCLEKGHT-FIHQLDK----IQCILQDVGSNIATPRSSARDSHIKKTKFTSQPIADLETWIDNFTNELPPLTNFILP-SGGKSSAALHLARTVCRRAERSVAPIVRSGEADQDVAKFLNRLSDYLFTVARYAAMKEGNEEKIY 232          
BLAST of Corrinoid adenosyltransferase vs. Planmine SMEST
Match: SMESG000062983.1 (SMESG000062983.1)

HSP 1 Score: 444.506 bits (1142), Expect = 2.967e-157
Identity = 214/214 (100.00%), Postives = 214/214 (100.00%), Query Frame = 3
Query:   24 MKMNFYFSFCKPYIFHLCKVNYSKIYTRTGDKGKSSLYTGERRNKDDCVFAALGDVDELSCHLGDARFEIKRAKVNFLINIDKHLFDIQCNLQDVGTSVAVPFDKRNESIQNKIGFNHSHTELLEKLIDEMTGTLPVLKNFILPCSESKISSKLHLSRAVCRRCERSLNHSNLENQIEPSVLTYINRLSDYLFTAARYSSNQLGYQDSVYIKQT 665
            MKMNFYFSFCKPYIFHLCKVNYSKIYTRTGDKGKSSLYTGERRNKDDCVFAALGDVDELSCHLGDARFEIKRAKVNFLINIDKHLFDIQCNLQDVGTSVAVPFDKRNESIQNKIGFNHSHTELLEKLIDEMTGTLPVLKNFILPCSESKISSKLHLSRAVCRRCERSLNHSNLENQIEPSVLTYINRLSDYLFTAARYSSNQLGYQDSVYIKQT
Sbjct:    1 MKMNFYFSFCKPYIFHLCKVNYSKIYTRTGDKGKSSLYTGERRNKDDCVFAALGDVDELSCHLGDARFEIKRAKVNFLINIDKHLFDIQCNLQDVGTSVAVPFDKRNESIQNKIGFNHSHTELLEKLIDEMTGTLPVLKNFILPCSESKISSKLHLSRAVCRRCERSLNHSNLENQIEPSVLTYINRLSDYLFTAARYSSNQLGYQDSVYIKQT 214          
BLAST of Corrinoid adenosyltransferase vs. Planmine SMEST
Match: SMESG000062983.1 (SMESG000062983.1)

HSP 1 Score: 160.999 bits (406), Expect = 4.166e-53
Identity = 74/76 (97.37%), Postives = 76/76 (100.00%), Query Frame = 3
Query:   24 MKMNFYFSFCKPYIFHLCKVNYSKIYTRTGDKGKSSLYTGERRNKDDCVFAALGDVDELSCHLGDARFEIKRAKVN 251
            MKMNFYFSFCKPYIFHLCKVNYSKIYTRTGDKGKSSLYTGERRNKDDCVFAALGDVDELSCHLGDARFEIKRAK++
Sbjct:    1 MKMNFYFSFCKPYIFHLCKVNYSKIYTRTGDKGKSSLYTGERRNKDDCVFAALGDVDELSCHLGDARFEIKRAKMS 76          

HSP 2 Score: 67.3958 bits (163), Expect = 4.166e-53
Identity = 33/34 (97.06%), Postives = 34/34 (100.00%), Query Frame = 1
Query:  301 KMSARLLQFHLIKETNRYKTKLDLITLIRNYLKN 402
            KMSARLLQFHLIKETNRYKTKLDLITLIRNYLK+
Sbjct:   74 KMSARLLQFHLIKETNRYKTKLDLITLIRNYLKS 107          
BLAST of Corrinoid adenosyltransferase vs. Planmine SMEST
Match: SMESG000062983.1 (SMESG000062983.1)

HSP 1 Score: 156.762 bits (395), Expect = 7.481e-52
Identity = 72/74 (97.30%), Postives = 74/74 (100.00%), Query Frame = 3
Query:   30 MNFYFSFCKPYIFHLCKVNYSKIYTRTGDKGKSSLYTGERRNKDDCVFAALGDVDELSCHLGDARFEIKRAKVN 251
            MNFYFSFCKPYIFHLCKVNYSKIYTRTGDKGKSSLYTGERRNKDDCVFAALGDVDELSCHLGDARFEIKRAK++
Sbjct:    1 MNFYFSFCKPYIFHLCKVNYSKIYTRTGDKGKSSLYTGERRNKDDCVFAALGDVDELSCHLGDARFEIKRAKMS 74          

HSP 2 Score: 67.3958 bits (163), Expect = 7.481e-52
Identity = 33/34 (97.06%), Postives = 34/34 (100.00%), Query Frame = 1
Query:  301 KMSARLLQFHLIKETNRYKTKLDLITLIRNYLKN 402
            KMSARLLQFHLIKETNRYKTKLDLITLIRNYLK+
Sbjct:   72 KMSARLLQFHLIKETNRYKTKLDLITLIRNYLKS 105          
The following BLAST results are available for this feature:
BLAST of Corrinoid adenosyltransferase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MMAB2.365e-4246.03metabolism of cobalamin associated B [Source:HGNC ... [more]
MMAB2.163e-2543.85metabolism of cobalamin associated B [Source:HGNC ... [more]
MMAB3.182e-2245.45metabolism of cobalamin associated B [Source:HGNC ... [more]
MMAB3.182e-2245.45metabolism of cobalamin associated B [Source:HGNC ... [more]
MMAB1.964e-1068.29metabolism of cobalamin associated B [Source:HGNC ... [more]
back to top
BLAST of Corrinoid adenosyltransferase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mmab-13.884e-2938.60MethylMalonic Aciduria type B homolog [Source:Uni... [more]
back to top
BLAST of Corrinoid adenosyltransferase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Corrinoid adenosyltransferase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mmab3.293e-4546.32metabolism of cobalamin associated B [Source:ZFIN;... [more]
back to top
BLAST of Corrinoid adenosyltransferase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
MMAB2.742e-4647.09metabolism of cobalamin associated B [Source:NCBI ... [more]
MMAB9.397e-4647.09metabolism of cobalamin associated B [Source:NCBI ... [more]
back to top
BLAST of Corrinoid adenosyltransferase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Mmab1.456e-4244.85methylmalonic aciduria (cobalamin deficiency) cblB... [more]
Mmab6.513e-3143.20methylmalonic aciduria (cobalamin deficiency) cblB... [more]
Mmab7.951e-2234.92methylmalonic aciduria (cobalamin deficiency) cblB... [more]
back to top
BLAST of Corrinoid adenosyltransferase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9D273|MMAB_MOUSE1.019e-4144.85Corrinoid adenosyltransferase OS=Mus musculus OX=1... [more]
sp|Q96EY8|MMAB_HUMAN1.136e-4146.03Corrinoid adenosyltransferase OS=Homo sapiens OX=9... [more]
sp|Q58D49|MMAB_BOVIN8.594e-4044.97Corrinoid adenosyltransferase OS=Bos taurus OX=991... [more]
sp|O34899|PDUO_BACSU1.456e-2335.83Corrinoid adenosyltransferase OS=Bacillus subtilis... [more]
sp|Q1LJ80|ATR_CUPMC7.042e-2131.44Cobalamin adenosyltransferase OS=Cupriavidus metal... [more]
back to top
BLAST of Corrinoid adenosyltransferase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2P6UZS31.938e-4947.64Corrinoid adenosyltransferase OS=Micractinium cond... [more]
A0A0K2U3P59.314e-4947.64Corrinoid adenosyltransferase OS=Lepeophtheirus sa... [more]
E1Z3N32.717e-4846.56Corrinoid adenosyltransferase OS=Chlorella variabi... [more]
A0A077WVK52.825e-4849.20Corrinoid adenosyltransferase OS=Lichtheimia ramos... [more]
A0A2V0P0163.977e-4847.62Corrinoid adenosyltransferase OS=Raphidocelis subc... [more]
back to top
BLAST of Corrinoid adenosyltransferase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSAMXT00000035499.11.414e-4347.06pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000041359.11.414e-4347.06pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
mmab9.397e-1637.76metabolism of cobalamin associated B [Source:ZFIN;... [more]
ENSAMXT00000057266.11.459e-763.16pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of Corrinoid adenosyltransferase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mmab1.375e-4343.59metabolism of cobalamin associated B [Source:ZFIN;... [more]
back to top
BLAST of Corrinoid adenosyltransferase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Corrinoid adenosyltransferase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO475021.593e-2745.24Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO270352.033e-2639.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO266902.142e-2434.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Corrinoid adenosyltransferase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mmab1.411e-4346.81metabolism of cobalamin associated B [Source:NCBI ... [more]
back to top
BLAST of Corrinoid adenosyltransferase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000062983.12.967e-157100.00SMESG000062983.1[more]
SMESG000062983.14.166e-5397.37SMESG000062983.1[more]
SMESG000062983.17.481e-5297.30SMESG000062983.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30028448 ID=SMED30028448|Name=Corrinoid adenosyltransferase|organism=Schmidtea mediterranea sexual|type=transcript|length=1388bp
TATAAATCTTATATGTTTCAGAAATGAAAATGAATTTTTATTTTTCCTTT
TGTAAACCATACATATTTCACTTATGTAAAGTAAATTATTCTAAAATATA
TACACGAACTGGCGATAAAGGCAAATCTAGTCTTTATACCGGTGAAAGGC
GAAACAAAGATGACTGTGTTTTTGCTGCTCTTGGGGATGTTGATGAATTG
TCTTGTCATTTAGGTGATGCGCGATTTGAAATCAAACGTGCAAAAGTAAA
TTTTCTGATCAATATCGATAAACATTTATTTGATATCCAATGCAATTTAC
AAGATGTCGGCACGTCTGTTGCAGTTCCATTTGATAAAAGAAACGAATCG
ATACAAAACAAAATTGGATTTAATCACTCTCATACGGAATTACTTGAAAA
ATTGATCGATGAAATGACAGGAACTTTACCAGTTTTAAAAAATTTCATTT
TGCCCTGTAGTGAATCGAAAATTAGTTCTAAACTACATTTAAGTAGAGCT
GTTTGCCGTCGATGCGAAAGATCATTGAATCATTCAAATTTGGAAAATCA
AATTGAACCTTCCGTGTTGACATATATTAATAGATTAAGTGATTATTTAT
TTACTGCAGCACGTTATAGTTCTAATCAATTAGGTTACCAAGATTCCGTT
TATATTAAGCAAACGTAATGATTGAAGTCAATCTTCGATATGGAATTCAT
AGATGTGATTGGCTGGTTTTGTAGGTTGTTATTAATTTTGAGTATGATTG
GCTAATTGTTGATTTTTTTTGGTATTAATTTGGAAAAATTTCTAATGTTA
AAGTTTCTTAACCACTTAACGCACGTTTTTTACAAAAAGCAAAAATAAAT
CATTTTTTTAAAATTAACATCTCTGCTTCTTCATAAATTTATTACACTGC
CCGAGATATTATCGTTAGTGAATCTTAAACAAAACTTTATATTTCGTATA
CCCGAGTCTCTCTCGGGCATGCACAAATTTGCCAGTAACACTTACCCGAG
TTACGCTCGGGCATGTGCGCTAAATGGTTAATAAACAAAATGTGAGCTAC
CGATTTTGTAAAGTTCAAATTTAAAACTTTCTCACGTTTATTTCGGAGAT
ACTATTGATAGTTTATCAGAATGCATTTAATTTCACTGCTAATTTTGTTT
CATTGAATCTTTAGAATATTGTGAAACCTGATATTTAATATAAATTTTAA
TTGCTACCCGATTTCCAGTTTTCACAAAGATTTGGTGACGCGATGATGAT
GAGATTCCTATACGCTTATAAAATGCCAAATATATAATTATTATATAGGT
TGAAGCTGTGCTTAAATCAAAAATATTAATTGGACTTACATAAAAAAAAA
TAATTTTACTACAGTAAATATATGTTTAAATAGATCGG
back to top

protein sequence of SMED30028448-orf-1

>SMED30028448-orf-1 ID=SMED30028448-orf-1|Name=SMED30028448-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=215bp
MKMNFYFSFCKPYIFHLCKVNYSKIYTRTGDKGKSSLYTGERRNKDDCVF
AALGDVDELSCHLGDARFEIKRAKVNFLINIDKHLFDIQCNLQDVGTSVA
VPFDKRNESIQNKIGFNHSHTELLEKLIDEMTGTLPVLKNFILPCSESKI
SSKLHLSRAVCRRCERSLNHSNLENQIEPSVLTYINRLSDYLFTAARYSS
NQLGYQDSVYIKQT*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0000166nucleotide binding
GO:0005524ATP binding
GO:0008817cob(I)yrinic acid a,c-diamide adenosyltransferase activity
GO:0016740transferase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036451CblAdoTrfase-like_sf
IPR016030CblAdoTrfase-like
IPR029499PduO-typ
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR016030Cobalamin adenosyltransferase-likePFAMPF01923Cob_adeno_transcoord: 28..201
e-value: 1.4E-48
score: 165.1
IPR036451Cobalamin adenosyltransferase-like superfamilyGENE3DG3DSA:1.20.1200.10coord: 37..217
e-value: 1.5E-53
score: 182.9
IPR036451Cobalamin adenosyltransferase-like superfamilySUPERFAMILYSSF89028Cobalamin adenosyltransferase-likecoord: 27..214
IPR029499ATP:cob(I)alamin adenosyltransferase, PduO-typeTIGRFAMTIGR00636TIGR00636coord: 29..213
e-value: 1.6E-39
score: 133.3
IPR029499ATP:cob(I)alamin adenosyltransferase, PduO-typePANTHERPTHR122131,3-PROPANEDIOL DEHYDROGENASE-RELATEDcoord: 23..214
NoneNo IPR availablePANTHERPTHR12213:SF0COB(I)YRINIC ACID A,C-DIAMIDE ADENOSYLTRANSFERASE, MITOCHONDRIALcoord: 23..214
NoneNo IPR availablePRODOMPD007457coord: 34..215
e-value: 2.0E-32
score: 346.0