Lysosomal alpha-glucosidase

Overview
NameLysosomal alpha-glucosidase
Smed IDSMED30028442
Uniprot Best hitLysosomal alpha-glucosidase OS=Rattus norvegicus OX=10116 GN=Gaa PE=2 SV=1 (E=0)
Length (bp)2946
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top

Expression Details

Lysosomal alpha-glucosidase is expressed during Stage 2, Stage 3, Stage 4, Stage 5 and Stage 6 in the embryonic digestive system, embryonic pharynx, embryonic gut cell and primitive gut cell

Click to see image symbols and abbreviations
Abbreviation or symbolDefinition
Ooral hemisphere
Aaboral hemisphere
Ddorsal
Vventral
Llateral
black arrowheadembryonic pharynx
red arrowheaddefinitive pharynx
black arrowsprimitive gut
yellow arrowsprimitive ectoderm cells
cyan arrowsbrain
cyan arrowheadsnerve cords
blue arrowheadseye progenitors (trail cells)
purple arrowheadseyes
scale bar100 µm

 

Mitotic activity is restricted to piwi-1+ blastomeres, which cycle asynchronously.

SPIM reconstructed S4 embryo constained with piwi-1 and LYAG-like (both in green) and H3S10p antibodies (red). LYAG-like marks the temporary embryonic pharynx and is not expressed in piwi-1+ blastomeres. Several examples of piwi-1+, H3S10p+ cells are evident.

Anatomical Expression

PAGE et. al., 2020




SMED30028442

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 12

  
PLANA TermReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
embryonic pharynxSMED30028442 SMED30028442smed_20140614PMID:28072387whole organismStage 7colorimetric in situ hybridization evidence
primitive gutSMED30028442 SMED30028442smed_20140614PMID:28072387whole organismStage 3colorimetric in situ hybridization evidence
embryonic pharynxSMED30028442 SMED30028442smed_20140614PMID:28072387whole organismStage 2colorimetric in situ hybridization evidence
embryonic gutSMED30028442 SMED30028442smed_20140614PMID:28072387whole organismStage 4colorimetric in situ hybridization evidence
primitive gutSMED30028442 SMED30028442smed_20140614PMID:28072387whole organismStage 4colorimetric in situ hybridization evidence
embryonic gutSMED30028442 SMED30028442smed_20140614PMID:28072387whole organismStage 7colorimetric in situ hybridization evidence
embryonic pharynxSMED30028442 SMED30028442smed_20140614PMID:28072387whole organismStage 4colorimetric in situ hybridization evidence
embryonic gutSMED30028442 SMED30028442smed_20140614PMID:28072387whole organismStage 5colorimetric in situ hybridization evidence
embryonic pharynxSMED30028442 SMED30028442smed_20140614PMID:28072387whole organismStage 3colorimetric in situ hybridization evidence
embryonic gutSMED30028442 SMED30028442smed_20140614PMID:28072387whole organismStage 6colorimetric in situ hybridization evidence
embryonic pharynxSMED30028442 SMED30028442smed_20140614PMID:28072387whole organismStage 6colorimetric in situ hybridization evidence
embryonic pharynxSMED30028442 SMED30028442smed_20140614PMID:28072387whole organismStage 5colorimetric in situ hybridization evidence
Homology
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Human
Match: GAA (glucosidase alpha, acid [Source:HGNC Symbol;Acc:HGNC:4065])

HSP 1 Score: 699.508 bits (1804), Expect = 0.000e+0
Identity = 359/872 (41.17%), Postives = 523/872 (59.98%), Query Frame = 3
Query:  321 QCQIANNNERLDCYPESGANQDSCIARGCCWSEPMRLSNKLQGVPLSIPYCYYPTDYSNYMIKSLRKSSRGIKAKLVRESPSYLPYEVAMLDLEVIYETKSRTRVRITDPKQKRYEVPMKLSPPDLKPPTDREYEVIIPSDGSFSIEIKRKSDDRSLF-KSFGPLLYSDQFLQISSIMSTDQIYGIGEQNRPFLHQLSNGWERIGLWARDNPIETFMNLYGAHPFYIGMPDDGKAFGVFHFNSNGQEFALQPAPAVTYRTIGGILDFFIFTGGSPEETVKQYLELVGKPMLPPYWSLGFHLSKWGYKNIEQLSEIFQRNINAGFPIGTQWSDIDYMENYKDFTVDKEKFNGLGRFVREIKQKYNSRFVAIVDPGISCTS-GNEYPPYYEGVFMDIFIKDSQTNQPIVGKVWPGETVYPDFTHPNISMYWYKQIQRFYNDVPIDGLWIDMNEPSNFYDGSKRGCQGNSKYDNPFFVPDIRDQSLISKTICSSALHYNNEKHYNLHNLYGYTESVTTNKALLKTIHGKRPFILSRSTFSGSGKYTFHWTGDNQASWDQLRNSIRQVLNFNMFGIPMTGADICGFNGNSDEELCIRWMQLGAFYPFMRNHNAINQRDQDPASWNTEAQKIMKTAISNRYAMLPLFYTLLVKSHMNGGTVMRPMSFEFFSDKVTHSIELQFMIGSSIMATPVVYPGARSVDAYFPAGVWYDFHS------GKL-----------LHSDAEGAWLTLDAPLDKINIALRGGHIVPLLDSNRNSKSNIPNKMTLYCGMAQDMSASGDLYWDDGESIDSYSRNRYSYVSFNASPEQL---LITPVYFGYDLLPVLNKIVILGFENKSITKFLLNDNDIP---FHYNPET 2861
            QC +  N+ R DC P+    Q+ C ARGCC+   +     LQG  +  P+C++P  Y +Y +++L  S  G  A L R +P++ P ++  L L+V+ ET++R    I DP  +RYEVP++      + P+   Y V   S+  F + ++R+ D R L   +  PL ++DQFLQ+S+ + +  I G+ E   P +  LS  W RI LW RD       NLYG+HPFY+ + D G A GVF  NSN  +  LQP+PA+++R+ GGILD +IF G  P+  V+QYL++VG P +PPYW LGFHL +WGY +     ++ +    A FP+  QW+D+DYM++ +DFT +K+ F      V+E+ Q    R++ IVDP IS +     Y PY EG+   +FI + +T QP++GKVWPG T +PDFT+P    +W   +  F++ VP DG+WIDMNEPSNF  GS+ GC  N++ +NP +VP +   +L + TIC+S+ H     HYNLHNLYG TE++ +++AL+K   G RPF++SRSTF+G G+Y  HWTGD  +SW+QL +S+ ++L FN+ G+P+ GAD+CGF GN+ EELC+RW QLGAFYPFMRNHN++    Q+P S++  AQ+ M+ A++ RYA+LP  YTL  ++H+ G TV RP+  EF  D  T +++ Q + G +++ TPV+  G   V  YFP G WYD  +      G L           +HS  EG W+TL APLD IN+ LR G+I+PL      +  +    M L   + +   A G+L+WDDGES++   R  Y+ V F A    +   L+     G  L   L K+ +LG             N +P   F Y+P+T
Sbjct:   81 QCDVPPNS-RFDCAPDKAITQEQCEARGCCY---IPAKQGLQGAQMGQPWCFFPPSYPSYKLENLSSSEMGYTATLTRTTPTFFPKDILTLRLDVMMETENRLHFTIKDPANRRYEVPLETPHVHSRAPSPL-YSVEF-SEEPFGVIVRRQLDGRVLLNTTVAPLFFADQFLQLSTSLPSQYITGLAEHLSPLM--LSTSWTRITLWNRDLAPTPGANLYGSHPFYLALEDGGSAHGVFLLNSNAMDVVLQPSPALSWRSTGGILDVYIFLGPEPKSVVQQYLDVVGYPFMPPYWGLGFHLCRWGYSSTAITRQVVENMTRAHFPLDVQWNDLDYMDSRRDFTFNKDGFRDFPAMVQELHQG-GRRYMMIVDPAISSSGPAGSYRPYDEGLRRGVFITN-ETGQPLIGKVWPGSTAFPDFTNPTALAWWEDMVAEFHDQVPFDGMWIDMNEPSNFIRGSEDGCP-NNELENPPYVPGVVGGTLQAATICASS-HQFLSTHYNLHNLYGLTEAIASHRALVKA-RGTRPFVISRSTFAGHGRYAGHWTGDVWSSWEQLASSVPEILQFNLLGVPLVGADVCGFLGNTSEELCVRWTQLGAFYPFMRNHNSLLSLPQEPYSFSEPAQQAMRKALTLRYALLPHLYTLFHQAHVAGETVARPLFLEFPKDSSTWTVDHQLLWGEALLITPVLQAGKAEVTGYFPLGTWYDLQTVPVEALGSLPPPPAAPREPAIHS--EGQWVTLPAPLDTINVHLRAGYIIPLQGPGLTTTESRQQPMALAVALTKGGEARGELFWDDGESLEVLERGAYTQVIFLARNNTIVNELVRVTSEGAGL--QLQKVTVLGVATAPQQVL---SNGVPVSNFTYSPDT 932          
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Human
Match: GAA (glucosidase alpha, acid [Source:HGNC Symbol;Acc:HGNC:4065])

HSP 1 Score: 699.508 bits (1804), Expect = 0.000e+0
Identity = 359/872 (41.17%), Postives = 523/872 (59.98%), Query Frame = 3
Query:  321 QCQIANNNERLDCYPESGANQDSCIARGCCWSEPMRLSNKLQGVPLSIPYCYYPTDYSNYMIKSLRKSSRGIKAKLVRESPSYLPYEVAMLDLEVIYETKSRTRVRITDPKQKRYEVPMKLSPPDLKPPTDREYEVIIPSDGSFSIEIKRKSDDRSLF-KSFGPLLYSDQFLQISSIMSTDQIYGIGEQNRPFLHQLSNGWERIGLWARDNPIETFMNLYGAHPFYIGMPDDGKAFGVFHFNSNGQEFALQPAPAVTYRTIGGILDFFIFTGGSPEETVKQYLELVGKPMLPPYWSLGFHLSKWGYKNIEQLSEIFQRNINAGFPIGTQWSDIDYMENYKDFTVDKEKFNGLGRFVREIKQKYNSRFVAIVDPGISCTS-GNEYPPYYEGVFMDIFIKDSQTNQPIVGKVWPGETVYPDFTHPNISMYWYKQIQRFYNDVPIDGLWIDMNEPSNFYDGSKRGCQGNSKYDNPFFVPDIRDQSLISKTICSSALHYNNEKHYNLHNLYGYTESVTTNKALLKTIHGKRPFILSRSTFSGSGKYTFHWTGDNQASWDQLRNSIRQVLNFNMFGIPMTGADICGFNGNSDEELCIRWMQLGAFYPFMRNHNAINQRDQDPASWNTEAQKIMKTAISNRYAMLPLFYTLLVKSHMNGGTVMRPMSFEFFSDKVTHSIELQFMIGSSIMATPVVYPGARSVDAYFPAGVWYDFHS------GKL-----------LHSDAEGAWLTLDAPLDKINIALRGGHIVPLLDSNRNSKSNIPNKMTLYCGMAQDMSASGDLYWDDGESIDSYSRNRYSYVSFNASPEQL---LITPVYFGYDLLPVLNKIVILGFENKSITKFLLNDNDIP---FHYNPET 2861
            QC +  N+ R DC P+    Q+ C ARGCC+   +     LQG  +  P+C++P  Y +Y +++L  S  G  A L R +P++ P ++  L L+V+ ET++R    I DP  +RYEVP++      + P+   Y V   S+  F + ++R+ D R L   +  PL ++DQFLQ+S+ + +  I G+ E   P +  LS  W RI LW RD       NLYG+HPFY+ + D G A GVF  NSN  +  LQP+PA+++R+ GGILD +IF G  P+  V+QYL++VG P +PPYW LGFHL +WGY +     ++ +    A FP+  QW+D+DYM++ +DFT +K+ F      V+E+ Q    R++ IVDP IS +     Y PY EG+   +FI + +T QP++GKVWPG T +PDFT+P    +W   +  F++ VP DG+WIDMNEPSNF  GS+ GC  N++ +NP +VP +   +L + TIC+S+ H     HYNLHNLYG TE++ +++AL+K   G RPF++SRSTF+G G+Y  HWTGD  +SW+QL +S+ ++L FN+ G+P+ GAD+CGF GN+ EELC+RW QLGAFYPFMRNHN++    Q+P S++  AQ+ M+ A++ RYA+LP  YTL  ++H+ G TV RP+  EF  D  T +++ Q + G +++ TPV+  G   V  YFP G WYD  +      G L           +HS  EG W+TL APLD IN+ LR G+I+PL      +  +    M L   + +   A G+L+WDDGES++   R  Y+ V F A    +   L+     G  L   L K+ +LG             N +P   F Y+P+T
Sbjct:   81 QCDVPPNS-RFDCAPDKAITQEQCEARGCCY---IPAKQGLQGAQMGQPWCFFPPSYPSYKLENLSSSEMGYTATLTRTTPTFFPKDILTLRLDVMMETENRLHFTIKDPANRRYEVPLETPHVHSRAPSPL-YSVEF-SEEPFGVIVRRQLDGRVLLNTTVAPLFFADQFLQLSTSLPSQYITGLAEHLSPLM--LSTSWTRITLWNRDLAPTPGANLYGSHPFYLALEDGGSAHGVFLLNSNAMDVVLQPSPALSWRSTGGILDVYIFLGPEPKSVVQQYLDVVGYPFMPPYWGLGFHLCRWGYSSTAITRQVVENMTRAHFPLDVQWNDLDYMDSRRDFTFNKDGFRDFPAMVQELHQG-GRRYMMIVDPAISSSGPAGSYRPYDEGLRRGVFITN-ETGQPLIGKVWPGSTAFPDFTNPTALAWWEDMVAEFHDQVPFDGMWIDMNEPSNFIRGSEDGCP-NNELENPPYVPGVVGGTLQAATICASS-HQFLSTHYNLHNLYGLTEAIASHRALVKA-RGTRPFVISRSTFAGHGRYAGHWTGDVWSSWEQLASSVPEILQFNLLGVPLVGADVCGFLGNTSEELCVRWTQLGAFYPFMRNHNSLLSLPQEPYSFSEPAQQAMRKALTLRYALLPHLYTLFHQAHVAGETVARPLFLEFPKDSSTWTVDHQLLWGEALLITPVLQAGKAEVTGYFPLGTWYDLQTVPVEALGSLPPPPAAPREPAIHS--EGQWVTLPAPLDTINVHLRAGYIIPLQGPGLTTTESRQQPMALAVALTKGGEARGELFWDDGESLEVLERGAYTQVIFLARNNTIVNELVRVTSEGAGL--QLQKVTVLGVATAPQQVL---SNGVPVSNFTYSPDT 932          
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Human
Match: MGAM (maltase-glucoamylase [Source:HGNC Symbol;Acc:HGNC:7043])

HSP 1 Score: 648.277 bits (1671), Expect = 0.000e+0
Identity = 352/861 (40.88%), Postives = 512/861 (59.47%), Query Frame = 3
Query:  312 ATAQCQIANNNERLDCYPESGANQDSCIARGCCWSEPMRLSNKLQGVPLSIPYCYYPTDYSNYMIKSLRKSSRGIKAKL--VRESPSYLPYEVAMLDLEVIYETKSRTRVRITDPKQKRYEVPMK-LSPPDLKPPTDREYEVIIPSDGSFSIEIKRKSDDRSLF-KSFGPLLYSDQFLQISSIMSTDQIYGIGEQ-NRPFLHQLSNGWERIGLWARDN-PIETFMNLYGAHPFYIGMPD-DGKAFGVFHFNSNGQEFALQPAPAVTYRTIGGILDFFIFTGGSPEETVKQYLELVGKPMLPPYWSLGFHLSKWGYKNIEQLSEIFQRNINAGFPIGTQWSDIDYMENYKDFTVDKEKFNGLGRFVREIKQKYNSRFVAIVDPGIS--CTSGNEYPPYYEGVFMDIFIKDSQTNQPIVGKVWPGETVYPDFTHPNISMYWYKQIQRFYNDVPIDGLWIDMNEPSNFYDGSKRGCQGNSKYDNPFFVPDIRDQSLISKTICSSALHYNNEKHYNLHNLYGYTESVTTNKALLKTIHGKRPFILSRSTFSGSGKYTFHWTGDNQASWDQLRNSIRQVLNFNMFGIPMTGADICGFNGNSDEELCIRWMQLGAFYPFMRNHNAINQRDQDPASWNTEAQKIMKTA--ISNRYAMLPLFYTLLVKSHMNGGTVMRPMSFEFFSDKVTHSIELQFMIGSSIMATPVVYPGARSVDAYFPAGVWYDFHSGKLLHSDAEGAWLTLDAPLDKINIALRGGHIVPLLDSNRNSKSNIPNKMTLYCGMAQDMSASGDLYWDDGESIDSYSRNRYSYVSFNASPEQLLITPVYFGYDLLPVL--NKIVILGFENKSITKFLLNDNDIPFHYNP 2855
             +A+C + N  ER++C P+    + +C  RGCCW+         QG  +S+P+CYY  ++S ++  +L  ++ G  A+L  +  SP +    V  + L   Y+T +R   ++TD    R+EVP + +            Y+V I S   FSI++ R+S++R LF  S GPLL++DQFLQ+S+ + +  +YG+GE  ++ + H ++  W+   ++ RD  P     NLYGA  F++ + D  G +FGVF  NSN  E  LQPAPA+TYRTIGGILDF++F G +PE+ V++YLEL+G+P LP YW+LGFHLS++ Y  ++ + E+ +RN  A  P   Q +DIDYM+  +DFT D   F G   FV E+      + V IVDP IS   +S   Y PY  G  M I++  S    P++G+VWPG+TV+PD+T+PN +++W K+ + F+N V  DG+WIDMNE SNF DGS  GC  N+  +NP F P I D  L  KT+C  A+ +   K Y++HNLYGY+ +V T +A       KR FIL+RSTF+GSGK+  HW GDN A+WD LR SI  VL FN+FGIPM G DICGF  ++ EELC RWMQLGAFYPF RNHN    +DQDPAS+  ++  +  +   ++ RY +LP  YTL  ++H  G TV RP+  EF+ D  T  +  QF+ G  ++ TPV+  GA  V AY P  VWYD+ +G  +    +   + ++ P DKI + LRGG+I P    N  + ++  N + L   + ++  A G+L+WD+GE+ D+ +   Y    F+ +  +L +      Y     L  N+I ILG E  S     +  N +P   +P
Sbjct:   86 VSAECPVVNELERINCIPDQPPTKATCDQRGCCWNP--------QGA-VSVPWCYYSKNHSYHVEGNLVNTNAGFTARLKNLPSSPVF-GSNVDNVLLTAEYQTSNRFHFKLTDQTNNRFEVPHEHVQSFSGNAAASLTYQVEI-SRQPFSIKVTRRSNNRVLFDSSIGPLLFADQFLQLSTRLPSTNVYGLGEHVHQQYRHDMN--WKTWPIFNRDTTPNGNGTNLYGAQTFFLCLEDASGLSFGVFLMNSNAMEVVLQPAPAITYRTIGGILDFYVFLGNTPEQVVQEYLELIGRPALPSYWALGFHLSRYEYGTLDNMREVVERNRAAQLPYDVQHADIDYMDERRDFTYDSVDFKGFPEFVNELHNN-GQKLVIIVDPAISNNSSSSKPYGPYDRGSDMKIWVNSSDGVTPLIGEVWPGQTVFPDYTNPNCAVWWTKEFELFHNQVEFDGIWIDMNEVSNFVDGSVSGCSTNN-LNNPPFTPRILDGYLFCKTLCMDAVQHWG-KQYDIHNLYGYSMAVATAEAAKTVFPNKRSFILTRSTFAGSGKFAAHWLGDNTATWDDLRWSIPGVLEFNLFGIPMVGPDICGFALDTPEELCRRWMQLGAFYPFSRNHNGQGYKDQDPASFGADSLLLNSSRHYLNIRYTLLPYLYTLFFRAHSRGDTVARPLLHEFYEDNSTWDVHQQFLWGPGLLITPVLDEGAEKVMAYVPDAVWYDYETGSQVRWRKQK--VEMELPGDKIGLHLRGGYIFPTQQPNTTTLASRKNPLGLIIALDENKEAKGELFWDNGETKDTVANKVYLLCEFSVTQNRLEVNISQSTYKDPNNLAFNEIKILGTEEPS--NVTVKHNGVPSQTSP 926          

HSP 2 Score: 600.897 bits (1548), Expect = 0.000e+0
Identity = 331/885 (37.40%), Postives = 507/885 (57.29%), Query Frame = 3
Query:  339 NNERLDCYP-ESGANQDSCIARGCCWSEPMRLSNKLQGVPLSIPYCYYPTDYSNYMIKSLRKSSRGIKAKLVRESPSYL----PYEVAMLDLEVIYETKSRTRVRITDPKQKRYEVPMKLSPPDL--KPPTDREYEVIIPSDGSFSIEIKRKSDDRSLFKS-FGPLLYSDQFLQISSIMSTDQIYGIGE-QNRPFLHQLSNGWERIGLWARDNPIETFMNLYGAHPFYIGMPDDGKAFGVFHFNSNGQEFALQPAPAVTYRTIGGILDFFIFTGGSPEETVKQYLELVGKPMLPPYWSLGFHLSKWGYKNIEQLSEIFQRNINAGFPIGTQWSDIDYMENYKDFTVDKEKFNGLGRFVREIKQKYNSRFVAIVDPGISCTSGNEYPPYYEGVFMDIFIKDSQTNQPIVGKVWP---------------------GETVYPDFTHPNISMYWYKQIQRFYND-------VPIDGLWIDMNEPSNFYDGSKR-GCQGNSKYDNPFFVPDI--RDQSLISKTICSSALHYNNE----KHYNLHNLYGYTESVTTNKALLKTIHGKRPFILSRSTFSGSGKYTFHWTGDNQASWDQLRNSIRQVLNFNMFGIPMTGADICGFNGNSDEELCIRWMQLGAFYPFMRNHNAINQRDQDPASWNTEAQKIMKTAISNRYAMLPLFYTLLVKSHMNGGTVMRPMSFEFFSDKVTHSIELQFMIGSSIMATPVVYPGARSVDAYFPAGVWYDFHSGKLLHSDAEGAWLTLDAPLDKINIALRGGHIVPLLDSNRNSKSNIPNKMTLYCGMAQDMSASGDLYWDDGESIDSYSRNRYSYVSFNASPEQLLITPVYFGYDLLPVL--NKIVILGFENKSITKFLLNDNDIPFHYNP 2855
            + E++DCYP E+GA+ ++C ARGC W      ++   GVP    +CY+  D   Y +  ++ +S G  A +  +S  Y        V  L L+V Y      + +I DP + RYEVP+ L+ P +    P  + Y+V+I  +  F IEI+RKS    ++ S      +SD F++IS+ + +  +YG GE ++R +   L   W   G+++RD P     N YG HP+Y+G+ +DG A GV   NSN  +   QP PA+TYRT GG+LDF++F G +PE   +QY EL+G+P++ PYWSLGF L ++GY+N  +++ ++   + A  P   Q+SDIDYME   DFT+   KF G    +  +K     R + I+DP IS      YP +  GV  D+FIK       + GKVWP                         +PDF   + + +W ++I+  YN+       +  DG+WIDMNEPS+F +G+   GC+ ++  ++P ++P +  RD+ L SKT+C  +     +    +HYN+HNLYG++++  T +A+ + + G+R  +++RSTF  SG++  HW GDN A+WDQL+ SI  ++ F++FGI  TGADICGF  +++ E+C+RWMQLGAFYPF RNHN I  R QDP SW+     I +  +  RY +LP  YTL+ K+H  G TV+RP+  EF SD+VT  I+ QF++G + + +PV+   AR+V AYFP   WYD+++G  +  +A G W TL APLD IN+ +RGG+I+P  +   N+  +  N + L   + ++  A G+L+WDDG++ D+ ++  Y    F+ +   L +T     Y     L  N+I ILG E  S     +  N +P   +P
Sbjct:  960 DEEKIDCYPDENGASAENCTARGCIWE-----ASNSSGVP----FCYFVNDL--YSVSDVQYNSHGATADISLKSSVYANAFPSTPVNPLRLDVTYHKNEMLQFKIYDPNKNRYEVPVPLNIPSMPSSTPEGQLYDVLIKKN-PFGIEIRRKSTGTIIWDSQLLGFTFSDMFIRISTRLPSKYLYGFGETEHRSYRRDLE--WHTWGMFSRDQPPGYKKNSYGVHPYYMGLEEDGSAHGVLLLNSNAMDVTFQPLPALTYRTTGGVLDFYVFLGPTPELVTQQYTELIGRPVMVPYWSLGFQLCRYGYQNDSEIASLYDEMVAAQIPYDVQYSDIDYMERQLDFTL-SPKFAGFPALINRMKAD-GMRVILILDPAISGNETQPYPAFTRGVEDDVFIKYPNDGDIVWGKVWPDFPDVVVNGSLDWDSQVELYRAYVAFPDFFRNSTAKWWKREIEELYNNPQNPERSLKFDGMWIDMNEPSSFVNGAVSPGCR-DASLNHPPYMPHLESRDRGLSSKTLCMESQQILPDGSLVQHYNVHNLYGWSQTRPTYEAV-QEVTGQRGVVITRSTFPSSGRWAGHWLGDNTAAWDQLKKSIIGMMEFSLFGISYTGADICGFFQDAEYEMCVRWMQLGAFYPFSRNHNTIGTRRQDPVSWDAAFVNISRNVLQTRYTLLPYLYTLMQKAHTEGVTVVRPLLHEFVSDQVTWDIDSQFLLGPAFLVSPVLERNARNVTAYFPRARWYDYYTG--VDINARGEWKTLPAPLDHINLHVRGGYILPWQEPALNTHLSRKNPLGLIIALDENKEAKGELFWDDGQTKDTVAKKVYLLCEFSVTQNHLEVTISQSTYKDPNNLAFNEIKILGMEEPS--NVTVKHNGVPSQTSP 1822          

HSP 3 Score: 591.652 bits (1524), Expect = 0.000e+0
Identity = 320/835 (38.32%), Postives = 487/835 (58.32%), Query Frame = 3
Query:  339 NNERLDCYP-ESGANQDSCIARGCCWSEPMRLSNKLQGVPLSIPYCYYPTDYSNYMIKSLRKSSRGIKAKLVRESP----SYLPYEVAMLDLEVIYETKSRTRVRITDPKQKRYEVPMKLSPPDL--KPPTDREYEVIIPSDGSFSIEIKRKSDDRSLFKS-FGPLLYSDQFLQISSIMSTDQIYGIGE-QNRPFLHQLSNGWERIGLWARDNPIETFMNLYGAHPFYIGMPDDGKAFGVFHFNSNGQEFALQPAPAVTYRTIGGILDFFIFTGGSPEETVKQYLELVGKPMLPPYWSLGFHLSKWGYKNIEQLSEIFQRNINAGFPIGTQWSDIDYMENYKDFTVDKEKFNGLGRFVREIKQKYNSRFVAIVDPGISCTSGNEYPPYYEGVFMDIFIKDSQTNQPIVGKVWP---------------------GETVYPDFTHPNISMYWYKQIQRFYND-------VPIDGLWIDMNEPSNFYDGSKR-GCQGNSKYDNPFFVP--DIRDQSLISKTICSSALHY----NNEKHYNLHNLYGYTESVTTNKALLKTIHGKRPFILSRSTFSGSGKYTFHWTGDNQASWDQLRNSIRQVLNFNMFGIPMTGADICGFNGNSDEELCIRWMQLGAFYPFMRNHNAINQRDQDPASWNTEAQKIMKTAISNRYAMLPLFYTLLVKSHMNGGTVMRPMSFEFFSDKVTHSIELQFMIGSSIMATPVVYPGARSVDAYFPAGVWYDFHSGKLLHSDAEGAWLTLDAPLDKINIALRGGHIVPLLDSNRNSKSNIPNKMTLYCGMAQDMSASGDLYWDDGESIDSYSRNRYSYVSFNAS 2711
            + E++DCYP E+G + ++C ARGC W      ++   GVP    +CY+  D   Y +  ++ +S G  A +  +S     ++    V  L L+V Y      + +I DP   RYEVP+ L+ P +    P  + Y+V+I  +  F IEI+RKS    ++ S      ++D F++IS+ + +  +YG GE ++  +   L   W   G+++RD P     N YG HP+Y+G+ +DG A GV   NSN  +   QP PA+TYRT GG+LDF++F G +PE   +QY EL+G+P++ PYWSLGF L ++GY+N  ++S ++   + A  P   Q+SDIDYME   DFT+   KF G    +  +K     R + I+DP IS      YP +  GV  D+FIK       + GKVWP                         +PDF   + + +W ++I+  YN+       +  DG+WIDMNEPS+F +G+   GC+ ++  ++P ++P  + RD+ L SKT+C  +       +  +HYN+HNLYG++++  T +A+ + + G+R  +++RSTF  SG++  HW GDN A+WDQL+ SI  ++ F++FGI  TGADICGF  +++ E+C+RWMQLGAFYPF RNHN I  R QDP SW+     I +T +  RY +LP  YTL+ K+H  G TV+RP+  EF SD+VT  I+ QF++G + + +PV+   AR+V AYFP   WYD+++G  +  +A G W TL APLD IN+ +RGG+I+P  +   N+  +    M     +  + +A G L+WDDG+SID+Y +  Y   SF+AS
Sbjct: 1856 DEEKIDCYPDENGDSAENCTARGCIWE-----ASNSSGVP----FCYFVNDL--YSVSDVQYNSHGATADISLKSSVHANAFPSTPVNPLRLDVTYHKNEMLQFKIYDPNNNRYEVPVPLNIPSVPSSTPEGQLYDVLIKKN-PFGIEIRRKSTGTIIWDSQLLGFTFNDMFIRISTRLPSKYLYGFGETEHTSYRRDLE--WHTWGMFSRDQPPGYKKNSYGVHPYYMGLEEDGSAHGVLLLNSNAMDVTFQPLPALTYRTTGGVLDFYVFLGPTPELVTQQYTELIGRPVMVPYWSLGFQLCRYGYQNDSEISSLYDEMVAAQIPYDVQYSDIDYMERQLDFTL-SPKFAGFPALINRMKAD-GMRVILILDPAISGNETQPYPAFTRGVEDDVFIKYPNDGDIVWGKVWPDFPDVVVNGSLDWDSQVELYRAYVAFPDFFRNSTAKWWKREIEELYNNPQNPERSLKFDGMWIDMNEPSSFVNGAVSPGCR-DASLNHPPYMPYLESRDRGLSSKTLCMESQQILPDGSPVQHYNVHNLYGWSQTRPTYEAV-QEVTGQRGVVITRSTFPSSGRWAGHWLGDNTAAWDQLKKSIIGMMEFSLFGISYTGADICGFFQDAEYEMCVRWMQLGAFYPFSRNHNTIGTRRQDPVSWDVAFVNISRTVLQTRYTLLPYLYTLMHKAHTEGVTVVRPLLHEFVSDQVTWDIDSQFLLGPAFLVSPVLERNARNVTAYFPRARWYDYYTG--VDINARGEWKTLPAPLDHINLHVRGGYILPWQEPALNTHLSRQKFMGFKIALDDEGTAGGWLFWDDGQSIDTYGKGLYYLASFSAS 2670          
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Human
Match: MGAM (maltase-glucoamylase [Source:HGNC Symbol;Acc:HGNC:7043])

HSP 1 Score: 647.892 bits (1670), Expect = 0.000e+0
Identity = 352/861 (40.88%), Postives = 512/861 (59.47%), Query Frame = 3
Query:  312 ATAQCQIANNNERLDCYPESGANQDSCIARGCCWSEPMRLSNKLQGVPLSIPYCYYPTDYSNYMIKSLRKSSRGIKAKL--VRESPSYLPYEVAMLDLEVIYETKSRTRVRITDPKQKRYEVPMK-LSPPDLKPPTDREYEVIIPSDGSFSIEIKRKSDDRSLF-KSFGPLLYSDQFLQISSIMSTDQIYGIGEQ-NRPFLHQLSNGWERIGLWARDN-PIETFMNLYGAHPFYIGMPD-DGKAFGVFHFNSNGQEFALQPAPAVTYRTIGGILDFFIFTGGSPEETVKQYLELVGKPMLPPYWSLGFHLSKWGYKNIEQLSEIFQRNINAGFPIGTQWSDIDYMENYKDFTVDKEKFNGLGRFVREIKQKYNSRFVAIVDPGIS--CTSGNEYPPYYEGVFMDIFIKDSQTNQPIVGKVWPGETVYPDFTHPNISMYWYKQIQRFYNDVPIDGLWIDMNEPSNFYDGSKRGCQGNSKYDNPFFVPDIRDQSLISKTICSSALHYNNEKHYNLHNLYGYTESVTTNKALLKTIHGKRPFILSRSTFSGSGKYTFHWTGDNQASWDQLRNSIRQVLNFNMFGIPMTGADICGFNGNSDEELCIRWMQLGAFYPFMRNHNAINQRDQDPASWNTEAQKIMKTA--ISNRYAMLPLFYTLLVKSHMNGGTVMRPMSFEFFSDKVTHSIELQFMIGSSIMATPVVYPGARSVDAYFPAGVWYDFHSGKLLHSDAEGAWLTLDAPLDKINIALRGGHIVPLLDSNRNSKSNIPNKMTLYCGMAQDMSASGDLYWDDGESIDSYSRNRYSYVSFNASPEQLLITPVYFGYDLLPVL--NKIVILGFENKSITKFLLNDNDIPFHYNP 2855
             +A+C + N  ER++C P+    + +C  RGCCW+         QG  +S+P+CYY  ++S ++  +L  ++ G  A+L  +  SP +    V  + L   Y+T +R   ++TD    R+EVP + +            Y+V I S   FSI++ R+S++R LF  S GPLL++DQFLQ+S+ + +  +YG+GE  ++ + H ++  W+   ++ RD  P     NLYGA  F++ + D  G +FGVF  NSN  E  LQPAPA+TYRTIGGILDF++F G +PE+ V++YLEL+G+P LP YW+LGFHLS++ Y  ++ + E+ +RN  A  P   Q +DIDYM+  +DFT D   F G   FV E+      + V IVDP IS   +S   Y PY  G  M I++  S    P++G+VWPG+TV+PD+T+PN +++W K+ + F+N V  DG+WIDMNE SNF DGS  GC  N+  +NP F P I D  L  KT+C  A+ +   K Y++HNLYGY+ +V T +A       KR FIL+RSTF+GSGK+  HW GDN A+WD LR SI  VL FN+FGIPM G DICGF  ++ EELC RWMQLGAFYPF RNHN    +DQDPAS+  ++  +  +   ++ RY +LP  YTL  ++H  G TV RP+  EF+ D  T  +  QF+ G  ++ TPV+  GA  V AY P  VWYD+ +G  +    +   + ++ P DKI + LRGG+I P    N  + ++  N + L   + ++  A G+L+WD+GE+ D+ +   Y    F+ +  +L +      Y     L  N+I ILG E  S     +  N +P   +P
Sbjct:   86 VSAECPVVNELERINCIPDQPPTKATCDQRGCCWNP--------QGA-VSVPWCYYSKNHSYHVEGNLVNTNAGFTARLKNLPSSPVF-GSNVDNVLLTAEYQTSNRFHFKLTDQTNNRFEVPHEHVQSFSGNAAASLTYQVEI-SRQPFSIKVTRRSNNRVLFDSSIGPLLFADQFLQLSTRLPSTNVYGLGEHVHQQYRHDMN--WKTWPIFNRDTTPNGNGTNLYGAQTFFLCLEDASGLSFGVFLMNSNAMEVVLQPAPAITYRTIGGILDFYVFLGNTPEQVVQEYLELIGRPALPSYWALGFHLSRYEYGTLDNMREVVERNRAAQLPYDVQHADIDYMDERRDFTYDSVDFKGFPEFVNELHNN-GQKLVIIVDPAISNNSSSSKPYGPYDRGSDMKIWVNSSDGVTPLIGEVWPGQTVFPDYTNPNCAVWWTKEFELFHNQVEFDGIWIDMNEVSNFVDGSVSGCSTNN-LNNPPFTPRILDGYLFCKTLCMDAVQHWG-KQYDIHNLYGYSMAVATAEAAKTVFPNKRSFILTRSTFAGSGKFAAHWLGDNTATWDDLRWSIPGVLEFNLFGIPMVGPDICGFALDTPEELCRRWMQLGAFYPFSRNHNGQGYKDQDPASFGADSLLLNSSRHYLNIRYTLLPYLYTLFFRAHSRGDTVARPLLHEFYEDNSTWDVHQQFLWGPGLLITPVLDEGAEKVMAYVPDAVWYDYETGSQVRWRKQK--VEMELPGDKIGLHLRGGYIFPTQQPNTTTLASRKNPLGLIIALDENKEAKGELFWDNGETKDTVANKVYLLCEFSVTQNRLEVNISQSTYKDPNNLAFNEIKILGTEEPS--NVTVKHNGVPSQTSP 926          

HSP 2 Score: 599.356 bits (1544), Expect = 0.000e+0
Identity = 323/835 (38.68%), Postives = 489/835 (58.56%), Query Frame = 3
Query:  339 NNERLDCYP-ESGANQDSCIARGCCWSEPMRLSNKLQGVPLSIPYCYYPTDYSNYMIKSLRKSSRGIKAKLVRESPSYL----PYEVAMLDLEVIYETKSRTRVRITDPKQKRYEVPMKLSPPDL--KPPTDREYEVIIPSDGSFSIEIKRKSDDRSLFKS-FGPLLYSDQFLQISSIMSTDQIYGIGE-QNRPFLHQLSNGWERIGLWARDNPIETFMNLYGAHPFYIGMPDDGKAFGVFHFNSNGQEFALQPAPAVTYRTIGGILDFFIFTGGSPEETVKQYLELVGKPMLPPYWSLGFHLSKWGYKNIEQLSEIFQRNINAGFPIGTQWSDIDYMENYKDFTVDKEKFNGLGRFVREIKQKYNSRFVAIVDPGISCTSGNEYPPYYEGVFMDIFIKDSQTNQPIVGKVWP---------------------GETVYPDFTHPNISMYWYKQIQRFYND-------VPIDGLWIDMNEPSNFYDGSKR-GCQGNSKYDNPFFVPDI--RDQSLISKTICSSALHYNNE----KHYNLHNLYGYTESVTTNKALLKTIHGKRPFILSRSTFSGSGKYTFHWTGDNQASWDQLRNSIRQVLNFNMFGIPMTGADICGFNGNSDEELCIRWMQLGAFYPFMRNHNAINQRDQDPASWNTEAQKIMKTAISNRYAMLPLFYTLLVKSHMNGGTVMRPMSFEFFSDKVTHSIELQFMIGSSIMATPVVYPGARSVDAYFPAGVWYDFHSGKLLHSDAEGAWLTLDAPLDKINIALRGGHIVPLLDSNRNSKSNIPNKMTLYCGMAQDMSASGDLYWDDGESIDSYSRNRYSYVSFNAS 2711
            + E++DCYP E+GA+ ++C ARGC W      ++   GVP    +CY+  D   Y +  ++ +S G  A +  +S  Y        V  L L+V Y      + +I DP + RYEVP+ L+ P +    P  + Y+V+I  +  F IEI+RKS    ++ S      +SD F++IS+ + +  +YG GE ++R +   L   W   G+++RD P     N YG HP+Y+G+ +DG A GV   NSN  +   QP PA+TYRT GG+LDF++F G +PE   +QY EL+G+P++ PYWSLGF L ++GY+N  +++ ++   + A  P   Q+SDIDYME   DFT+   KF G    +  +K     R + I+DP IS      YP +  GV  D+FIK       + GKVWP                         +PDF   + + +W ++I+  YN+       +  DG+WIDMNEPS+F +G+   GC+ ++  ++P ++P +  RD+ L SKT+C  +     +    +HYN+HNLYG++++  T +A+ + + G+R  +++RSTF  SG++  HW GDN A+WDQL+ SI  ++ F++FGI  TGADICGF  +++ E+C+RWMQLGAFYPF RNHN I  R QDP SW+     I +T +  RY +LP  YTL+ K+H  G TV+RP+  EF SD+VT  I+ QF++G + + +PV+   AR+V AYFP   WYD+++G  +  +A G W TL APLD IN+ +RGG+I+P  +   N+  +    M     +  + +A G L+WDDG+SID+Y +  Y   SF+AS
Sbjct:  960 DEEKIDCYPDENGASAENCTARGCIWE-----ASNSSGVP----FCYFVNDL--YSVSDVQYNSHGATADISLKSSVYANAFPSTPVNPLRLDVTYHKNEMLQFKIYDPNKNRYEVPVPLNIPSMPSSTPEGQLYDVLIKKN-PFGIEIRRKSTGTIIWDSQLLGFTFSDMFIRISTRLPSKYLYGFGETEHRSYRRDLE--WHTWGMFSRDQPPGYKKNSYGVHPYYMGLEEDGSAHGVLLLNSNAMDVTFQPLPALTYRTTGGVLDFYVFLGPTPELVTQQYTELIGRPVMVPYWSLGFQLCRYGYQNDSEIASLYDEMVAAQIPYDVQYSDIDYMERQLDFTL-SPKFAGFPALINRMKAD-GMRVILILDPAISGNETQPYPAFTRGVEDDVFIKYPNDGDIVWGKVWPDFPDVVVNGSLDWDSQVELYRAYVAFPDFFRNSTAKWWKREIEELYNNPQNPERSLKFDGMWIDMNEPSSFVNGAVSPGCR-DASLNHPPYMPHLESRDRGLSSKTLCMESQQILPDGSLVQHYNVHNLYGWSQTRPTYEAV-QEVTGQRGVVITRSTFPSSGRWAGHWLGDNTAAWDQLKKSIIGMMEFSLFGISYTGADICGFFQDAEYEMCVRWMQLGAFYPFSRNHNTIGTRRQDPVSWDVAFVNISRTVLQTRYTLLPYLYTLMHKAHTEGVTVVRPLLHEFVSDQVTWDIDSQFLLGPAFLVSPVLERNARNVTAYFPRARWYDYYTG--VDINARGEWKTLPAPLDHINLHVRGGYILPWQEPALNTHLSRQKFMGFKIALDDEGTAGGWLFWDDGQSIDTYGKGLYYLASFSAS 1774          
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Human
Match: MGAM (maltase-glucoamylase [Source:HGNC Symbol;Acc:HGNC:7043])

HSP 1 Score: 647.892 bits (1670), Expect = 0.000e+0
Identity = 352/861 (40.88%), Postives = 512/861 (59.47%), Query Frame = 3
Query:  312 ATAQCQIANNNERLDCYPESGANQDSCIARGCCWSEPMRLSNKLQGVPLSIPYCYYPTDYSNYMIKSLRKSSRGIKAKL--VRESPSYLPYEVAMLDLEVIYETKSRTRVRITDPKQKRYEVPMK-LSPPDLKPPTDREYEVIIPSDGSFSIEIKRKSDDRSLF-KSFGPLLYSDQFLQISSIMSTDQIYGIGEQ-NRPFLHQLSNGWERIGLWARDN-PIETFMNLYGAHPFYIGMPD-DGKAFGVFHFNSNGQEFALQPAPAVTYRTIGGILDFFIFTGGSPEETVKQYLELVGKPMLPPYWSLGFHLSKWGYKNIEQLSEIFQRNINAGFPIGTQWSDIDYMENYKDFTVDKEKFNGLGRFVREIKQKYNSRFVAIVDPGIS--CTSGNEYPPYYEGVFMDIFIKDSQTNQPIVGKVWPGETVYPDFTHPNISMYWYKQIQRFYNDVPIDGLWIDMNEPSNFYDGSKRGCQGNSKYDNPFFVPDIRDQSLISKTICSSALHYNNEKHYNLHNLYGYTESVTTNKALLKTIHGKRPFILSRSTFSGSGKYTFHWTGDNQASWDQLRNSIRQVLNFNMFGIPMTGADICGFNGNSDEELCIRWMQLGAFYPFMRNHNAINQRDQDPASWNTEAQKIMKTA--ISNRYAMLPLFYTLLVKSHMNGGTVMRPMSFEFFSDKVTHSIELQFMIGSSIMATPVVYPGARSVDAYFPAGVWYDFHSGKLLHSDAEGAWLTLDAPLDKINIALRGGHIVPLLDSNRNSKSNIPNKMTLYCGMAQDMSASGDLYWDDGESIDSYSRNRYSYVSFNASPEQLLITPVYFGYDLLPVL--NKIVILGFENKSITKFLLNDNDIPFHYNP 2855
             +A+C + N  ER++C P+    + +C  RGCCW+         QG  +S+P+CYY  ++S ++  +L  ++ G  A+L  +  SP +    V  + L   Y+T +R   ++TD    R+EVP + +            Y+V I S   FSI++ R+S++R LF  S GPLL++DQFLQ+S+ + +  +YG+GE  ++ + H ++  W+   ++ RD  P     NLYGA  F++ + D  G +FGVF  NSN  E  LQPAPA+TYRTIGGILDF++F G +PE+ V++YLEL+G+P LP YW+LGFHLS++ Y  ++ + E+ +RN  A  P   Q +DIDYM+  +DFT D   F G   FV E+      + V IVDP IS   +S   Y PY  G  M I++  S    P++G+VWPG+TV+PD+T+PN +++W K+ + F+N V  DG+WIDMNE SNF DGS  GC  N+  +NP F P I D  L  KT+C  A+ +   K Y++HNLYGY+ +V T +A       KR FIL+RSTF+GSGK+  HW GDN A+WD LR SI  VL FN+FGIPM G DICGF  ++ EELC RWMQLGAFYPF RNHN    +DQDPAS+  ++  +  +   ++ RY +LP  YTL  ++H  G TV RP+  EF+ D  T  +  QF+ G  ++ TPV+  GA  V AY P  VWYD+ +G  +    +   + ++ P DKI + LRGG+I P    N  + ++  N + L   + ++  A G+L+WD+GE+ D+ +   Y    F+ +  +L +      Y     L  N+I ILG E  S     +  N +P   +P
Sbjct:   86 VSAECPVVNELERINCIPDQPPTKATCDQRGCCWNP--------QGA-VSVPWCYYSKNHSYHVEGNLVNTNAGFTARLKNLPSSPVF-GSNVDNVLLTAEYQTSNRFHFKLTDQTNNRFEVPHEHVQSFSGNAAASLTYQVEI-SRQPFSIKVTRRSNNRVLFDSSIGPLLFADQFLQLSTRLPSTNVYGLGEHVHQQYRHDMN--WKTWPIFNRDTTPNGNGTNLYGAQTFFLCLEDASGLSFGVFLMNSNAMEVVLQPAPAITYRTIGGILDFYVFLGNTPEQVVQEYLELIGRPALPSYWALGFHLSRYEYGTLDNMREVVERNRAAQLPYDVQHADIDYMDERRDFTYDSVDFKGFPEFVNELHNN-GQKLVIIVDPAISNNSSSSKPYGPYDRGSDMKIWVNSSDGVTPLIGEVWPGQTVFPDYTNPNCAVWWTKEFELFHNQVEFDGIWIDMNEVSNFVDGSVSGCSTNN-LNNPPFTPRILDGYLFCKTLCMDAVQHWG-KQYDIHNLYGYSMAVATAEAAKTVFPNKRSFILTRSTFAGSGKFAAHWLGDNTATWDDLRWSIPGVLEFNLFGIPMVGPDICGFALDTPEELCRRWMQLGAFYPFSRNHNGQGYKDQDPASFGADSLLLNSSRHYLNIRYTLLPYLYTLFFRAHSRGDTVARPLLHEFYEDNSTWDVHQQFLWGPGLLITPVLDEGAEKVMAYVPDAVWYDYETGSQVRWRKQK--VEMELPGDKIGLHLRGGYIFPTQQPNTTTLASRKNPLGLIIALDENKEAKGELFWDNGETKDTVANKVYLLCEFSVTQNRLEVNISQSTYKDPNNLAFNEIKILGTEEPS--NVTVKHNGVPSQTSP 926          

HSP 2 Score: 599.356 bits (1544), Expect = 0.000e+0
Identity = 323/835 (38.68%), Postives = 489/835 (58.56%), Query Frame = 3
Query:  339 NNERLDCYP-ESGANQDSCIARGCCWSEPMRLSNKLQGVPLSIPYCYYPTDYSNYMIKSLRKSSRGIKAKLVRESPSYL----PYEVAMLDLEVIYETKSRTRVRITDPKQKRYEVPMKLSPPDL--KPPTDREYEVIIPSDGSFSIEIKRKSDDRSLFKS-FGPLLYSDQFLQISSIMSTDQIYGIGE-QNRPFLHQLSNGWERIGLWARDNPIETFMNLYGAHPFYIGMPDDGKAFGVFHFNSNGQEFALQPAPAVTYRTIGGILDFFIFTGGSPEETVKQYLELVGKPMLPPYWSLGFHLSKWGYKNIEQLSEIFQRNINAGFPIGTQWSDIDYMENYKDFTVDKEKFNGLGRFVREIKQKYNSRFVAIVDPGISCTSGNEYPPYYEGVFMDIFIKDSQTNQPIVGKVWP---------------------GETVYPDFTHPNISMYWYKQIQRFYND-------VPIDGLWIDMNEPSNFYDGSKR-GCQGNSKYDNPFFVPDI--RDQSLISKTICSSALHYNNE----KHYNLHNLYGYTESVTTNKALLKTIHGKRPFILSRSTFSGSGKYTFHWTGDNQASWDQLRNSIRQVLNFNMFGIPMTGADICGFNGNSDEELCIRWMQLGAFYPFMRNHNAINQRDQDPASWNTEAQKIMKTAISNRYAMLPLFYTLLVKSHMNGGTVMRPMSFEFFSDKVTHSIELQFMIGSSIMATPVVYPGARSVDAYFPAGVWYDFHSGKLLHSDAEGAWLTLDAPLDKINIALRGGHIVPLLDSNRNSKSNIPNKMTLYCGMAQDMSASGDLYWDDGESIDSYSRNRYSYVSFNAS 2711
            + E++DCYP E+GA+ ++C ARGC W      ++   GVP    +CY+  D   Y +  ++ +S G  A +  +S  Y        V  L L+V Y      + +I DP + RYEVP+ L+ P +    P  + Y+V+I  +  F IEI+RKS    ++ S      +SD F++IS+ + +  +YG GE ++R +   L   W   G+++RD P     N YG HP+Y+G+ +DG A GV   NSN  +   QP PA+TYRT GG+LDF++F G +PE   +QY EL+G+P++ PYWSLGF L ++GY+N  +++ ++   + A  P   Q+SDIDYME   DFT+   KF G    +  +K     R + I+DP IS      YP +  GV  D+FIK       + GKVWP                         +PDF   + + +W ++I+  YN+       +  DG+WIDMNEPS+F +G+   GC+ ++  ++P ++P +  RD+ L SKT+C  +     +    +HYN+HNLYG++++  T +A+ + + G+R  +++RSTF  SG++  HW GDN A+WDQL+ SI  ++ F++FGI  TGADICGF  +++ E+C+RWMQLGAFYPF RNHN I  R QDP SW+     I +T +  RY +LP  YTL+ K+H  G TV+RP+  EF SD+VT  I+ QF++G + + +PV+   AR+V AYFP   WYD+++G  +  +A G W TL APLD IN+ +RGG+I+P  +   N+  +    M     +  + +A G L+WDDG+SID+Y +  Y   SF+AS
Sbjct:  960 DEEKIDCYPDENGASAENCTARGCIWE-----ASNSSGVP----FCYFVNDL--YSVSDVQYNSHGATADISLKSSVYANAFPSTPVNPLRLDVTYHKNEMLQFKIYDPNKNRYEVPVPLNIPSMPSSTPEGQLYDVLIKKN-PFGIEIRRKSTGTIIWDSQLLGFTFSDMFIRISTRLPSKYLYGFGETEHRSYRRDLE--WHTWGMFSRDQPPGYKKNSYGVHPYYMGLEEDGSAHGVLLLNSNAMDVTFQPLPALTYRTTGGVLDFYVFLGPTPELVTQQYTELIGRPVMVPYWSLGFQLCRYGYQNDSEIASLYDEMVAAQIPYDVQYSDIDYMERQLDFTL-SPKFAGFPALINRMKAD-GMRVILILDPAISGNETQPYPAFTRGVEDDVFIKYPNDGDIVWGKVWPDFPDVVVNGSLDWDSQVELYRAYVAFPDFFRNSTAKWWKREIEELYNNPQNPERSLKFDGMWIDMNEPSSFVNGAVSPGCR-DASLNHPPYMPHLESRDRGLSSKTLCMESQQILPDGSLVQHYNVHNLYGWSQTRPTYEAV-QEVTGQRGVVITRSTFPSSGRWAGHWLGDNTAAWDQLKKSIIGMMEFSLFGISYTGADICGFFQDAEYEMCVRWMQLGAFYPFSRNHNTIGTRRQDPVSWDVAFVNISRTVLQTRYTLLPYLYTLMHKAHTEGVTVVRPLLHEFVSDQVTWDIDSQFLLGPAFLVSPVLERNARNVTAYFPRARWYDYYTG--VDINARGEWKTLPAPLDHINLHVRGGYILPWQEPALNTHLSRQKFMGFKIALDDEGTAGGWLFWDDGQSIDTYGKGLYYLASFSAS 1774          
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Celegans
Match: aagr-1 (Acid Alpha Glucosidase Relate [Source:UniProtKB/TrEMBL;Acc:Q19004])

HSP 1 Score: 483.411 bits (1243), Expect = 2.216e-155
Identity = 292/830 (35.18%), Postives = 438/830 (52.77%), Query Frame = 3
Query:  327 QIANNNERLDCYPESGANQDSCIARGCCWSEPMRLSNKLQGVPLSIPYCYYPTDYSNYMIKSLRKSSRGIKAKLVRESPSYLPYEVAMLDLEVIYETKSRTRVRITDPKQKRYEVPMKLSPPDLKPPTDRE----YEVIIPSDGSFSIEIKRKSDDRSLF-KSFGPLLYSDQFLQISSIMSTDQIYGIGEQNRPFLHQLSNGWERIGLWARD-----NPIETFMNLYGAHPFYIGMPDDGKAFGVFHFNSNGQEFALQPAPAVTYRTIGGILDFFIFTGGSPEETVKQYLELVGKPMLPPYWSLGFHLSKWGYKNIEQLSEIFQRNINAGFPIGTQWSDIDYMENYKDFTVDKEKFNGLGRFVREIKQKYNSRFVAIVDPGISCTSGNEYPPYYEGVFMDI-FIKDSQTNQP----------------IVGKVWPGE-TVYPDFTHP--NISMYWYKQIQRFYNDVPIDGLWIDMNEPSNFYDGS-----------KRGCQGNSKYDNPFFVPDIRDQS--------LISKTICS-SALHYNNEKHYNLHNLYGYTESVTTNKALLKTIHGKRPFILSRSTFSGSGKYTFHWTGDNQASWDQLRNSIRQVLNFNMFGIPMTGADICGFNGNSDEELCIRWMQLGAFYPFMRNHNAINQRDQDPASWNTEAQKIMKTAISNRYAMLPLFYTLLVKSHMNGGTVMRPMSFEFFSDKVTHSIELQFMIGSSIMATPVVYPGARSVDAYFPAGVWYDFHSGKLLHSDAEGAWLTLDAPLDKIN-IALRGGHIVPLLDSNRNSKSNIPNKMTLYCGMAQDMSASGDLYWDDGESI 2663
            Q  + ++R+DCYPE GA+QD+C +RGC W+E    S      P+  P+CYYPT+ S + ++S   +S  + AK         PY   +  L V Y +   T + +T     RY  P+       KP T  E        I S   FS ++ R S   +L+  S G + ++D+F+QI++ + +  IYG G+     +    + +    ++ARD         +  NLYG HPFY+ +  DGKA GVF  NSN QE    P P + YRTIGG +D   F G +PE+ V QYL+ +G P LP YW+LG+ L +WGY N++ +  +  RN   G P+   ++DIDYM +Y+DFT + + ++G   + ++I  +     + I DP +      +Y  +  G+  D  FI+ ++ +Q                 ++G VWP   T +PDF  P  N + +W  +  +F+  +P DG+WIDMNEPSNF  G+           K  C      D+   VP    Q+        L SKT+C      +     Y+  NLYG++E+  T +A+ + + GKR  ++SRSTF  SG+Y  HW GDN A W  L+ S+  V+ FNMFG+P  G+DICGFNG S+EELC+RW Q GAF PF R+HN+    DQDPA W + A    K A++ RY  LP  Y+L   +   G TV+RP+ FEF  D+ T +I  QF+ GS++M  P +Y G  SV AYFP+  WY             G +  ++APL  +  + +RGG ++P       + ++  +   L   +  + ++SGDLY+D G+ +
Sbjct:   23 QSVDVSKRVDCYPEPGASQDACQSRGCIWTEAPSSS------PVGTPWCYYPTE-SGFTVQSTGTNSFVLAAKTKN------PYGNNISPLNVKYSSNGATLL-LTIGNDDRYVPPVNFPK---KPSTSTESLKFTSGTIGSSDVFSFKVTRASTGVALWDTSIGGMQFADKFIQIATYLPSKNIYGFGDHIHKKIRHNLDRYTTWPMFARDIGPDSGSALSTQNLYGVHPFYMCIEADGKAHGVFILNSNAQEVETGPGPHLLYRTIGGRIDMAFFPGPTPEQVVNQYLQHIGFPFLPAYWALGYQLCRWGYGNLDAMKTVISRNQALGIPLDVPYADIDYMNHYEDFT-EGDNWSGFPAYTQQIHAQ-GLHLIVIFDPAVEV----DYASFQRGINADASFIEWARDDQVPHNIQDQYPMAKNTKIMLGNVWPDRNTAFPDFLDPRNNTNAWWAGEFAQFHKTLPFDGMWIDMNEPSNFDTGTYNTVEEQLASAKLSCPITGS-DSSLDVPPYPTQAVYQRNGEYLFSKTLCMLGKTAHRTRDFYDTKNLYGWSEARATYQAIPQ-VTGKRSAVISRSTFPSSGRYGGHWLGDNTARWGDLQTSVIGVMEFNMFGVPYVGSDICGFNGVSNEELCLRWHQFGAFSPFSRDHNSEGMPDQDPAVWPSVANA-AKIALTFRYYFLPFLYSLHYNAARYGHTVIRPLFFEFPKDEETLNISEQFLWGSALMIAPALYQGQTSVHAYFPSDTWYSLQPETYGQKMFSG-FNDVNAPLSSLTPVFVRGGFVLPRQSPGTTTTASRLSPFELLITVKTNAASSGDLYYDGGDDL 825          
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Celegans
Match: aagr-1 (Acid Alpha Glucosidase Relate [Source:UniProtKB/TrEMBL;Acc:Q19004])

HSP 1 Score: 483.411 bits (1243), Expect = 2.216e-155
Identity = 292/830 (35.18%), Postives = 438/830 (52.77%), Query Frame = 3
Query:  327 QIANNNERLDCYPESGANQDSCIARGCCWSEPMRLSNKLQGVPLSIPYCYYPTDYSNYMIKSLRKSSRGIKAKLVRESPSYLPYEVAMLDLEVIYETKSRTRVRITDPKQKRYEVPMKLSPPDLKPPTDRE----YEVIIPSDGSFSIEIKRKSDDRSLF-KSFGPLLYSDQFLQISSIMSTDQIYGIGEQNRPFLHQLSNGWERIGLWARD-----NPIETFMNLYGAHPFYIGMPDDGKAFGVFHFNSNGQEFALQPAPAVTYRTIGGILDFFIFTGGSPEETVKQYLELVGKPMLPPYWSLGFHLSKWGYKNIEQLSEIFQRNINAGFPIGTQWSDIDYMENYKDFTVDKEKFNGLGRFVREIKQKYNSRFVAIVDPGISCTSGNEYPPYYEGVFMDI-FIKDSQTNQP----------------IVGKVWPGE-TVYPDFTHP--NISMYWYKQIQRFYNDVPIDGLWIDMNEPSNFYDGS-----------KRGCQGNSKYDNPFFVPDIRDQS--------LISKTICS-SALHYNNEKHYNLHNLYGYTESVTTNKALLKTIHGKRPFILSRSTFSGSGKYTFHWTGDNQASWDQLRNSIRQVLNFNMFGIPMTGADICGFNGNSDEELCIRWMQLGAFYPFMRNHNAINQRDQDPASWNTEAQKIMKTAISNRYAMLPLFYTLLVKSHMNGGTVMRPMSFEFFSDKVTHSIELQFMIGSSIMATPVVYPGARSVDAYFPAGVWYDFHSGKLLHSDAEGAWLTLDAPLDKIN-IALRGGHIVPLLDSNRNSKSNIPNKMTLYCGMAQDMSASGDLYWDDGESI 2663
            Q  + ++R+DCYPE GA+QD+C +RGC W+E    S      P+  P+CYYPT+ S + ++S   +S  + AK         PY   +  L V Y +   T + +T     RY  P+       KP T  E        I S   FS ++ R S   +L+  S G + ++D+F+QI++ + +  IYG G+     +    + +    ++ARD         +  NLYG HPFY+ +  DGKA GVF  NSN QE    P P + YRTIGG +D   F G +PE+ V QYL+ +G P LP YW+LG+ L +WGY N++ +  +  RN   G P+   ++DIDYM +Y+DFT + + ++G   + ++I  +     + I DP +      +Y  +  G+  D  FI+ ++ +Q                 ++G VWP   T +PDF  P  N + +W  +  +F+  +P DG+WIDMNEPSNF  G+           K  C      D+   VP    Q+        L SKT+C      +     Y+  NLYG++E+  T +A+ + + GKR  ++SRSTF  SG+Y  HW GDN A W  L+ S+  V+ FNMFG+P  G+DICGFNG S+EELC+RW Q GAF PF R+HN+    DQDPA W + A    K A++ RY  LP  Y+L   +   G TV+RP+ FEF  D+ T +I  QF+ GS++M  P +Y G  SV AYFP+  WY             G +  ++APL  +  + +RGG ++P       + ++  +   L   +  + ++SGDLY+D G+ +
Sbjct:   23 QSVDVSKRVDCYPEPGASQDACQSRGCIWTEAPSSS------PVGTPWCYYPTE-SGFTVQSTGTNSFVLAAKTKN------PYGNNISPLNVKYSSNGATLL-LTIGNDDRYVPPVNFPK---KPSTSTESLKFTSGTIGSSDVFSFKVTRASTGVALWDTSIGGMQFADKFIQIATYLPSKNIYGFGDHIHKKIRHNLDRYTTWPMFARDIGPDSGSALSTQNLYGVHPFYMCIEADGKAHGVFILNSNAQEVETGPGPHLLYRTIGGRIDMAFFPGPTPEQVVNQYLQHIGFPFLPAYWALGYQLCRWGYGNLDAMKTVISRNQALGIPLDVPYADIDYMNHYEDFT-EGDNWSGFPAYTQQIHAQ-GLHLIVIFDPAVEV----DYASFQRGINADASFIEWARDDQVPHNIQDQYPMAKNTKIMLGNVWPDRNTAFPDFLDPRNNTNAWWAGEFAQFHKTLPFDGMWIDMNEPSNFDTGTYNTVEEQLASAKLSCPITGS-DSSLDVPPYPTQAVYQRNGEYLFSKTLCMLGKTAHRTRDFYDTKNLYGWSEARATYQAIPQ-VTGKRSAVISRSTFPSSGRYGGHWLGDNTARWGDLQTSVIGVMEFNMFGVPYVGSDICGFNGVSNEELCLRWHQFGAFSPFSRDHNSEGMPDQDPAVWPSVANA-AKIALTFRYYFLPFLYSLHYNAARYGHTVIRPLFFEFPKDEETLNISEQFLWGSALMIAPALYQGQTSVHAYFPSDTWYSLQPETYGQKMFSG-FNDVNAPLSSLTPVFVRGGFVLPRQSPGTTTTASRLSPFELLITVKTNAASSGDLYYDGGDDL 825          
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Celegans
Match: aagr-1 (Acid Alpha Glucosidase Relate [Source:UniProtKB/TrEMBL;Acc:Q19004])

HSP 1 Score: 483.411 bits (1243), Expect = 2.216e-155
Identity = 292/830 (35.18%), Postives = 438/830 (52.77%), Query Frame = 3
Query:  327 QIANNNERLDCYPESGANQDSCIARGCCWSEPMRLSNKLQGVPLSIPYCYYPTDYSNYMIKSLRKSSRGIKAKLVRESPSYLPYEVAMLDLEVIYETKSRTRVRITDPKQKRYEVPMKLSPPDLKPPTDRE----YEVIIPSDGSFSIEIKRKSDDRSLF-KSFGPLLYSDQFLQISSIMSTDQIYGIGEQNRPFLHQLSNGWERIGLWARD-----NPIETFMNLYGAHPFYIGMPDDGKAFGVFHFNSNGQEFALQPAPAVTYRTIGGILDFFIFTGGSPEETVKQYLELVGKPMLPPYWSLGFHLSKWGYKNIEQLSEIFQRNINAGFPIGTQWSDIDYMENYKDFTVDKEKFNGLGRFVREIKQKYNSRFVAIVDPGISCTSGNEYPPYYEGVFMDI-FIKDSQTNQP----------------IVGKVWPGE-TVYPDFTHP--NISMYWYKQIQRFYNDVPIDGLWIDMNEPSNFYDGS-----------KRGCQGNSKYDNPFFVPDIRDQS--------LISKTICS-SALHYNNEKHYNLHNLYGYTESVTTNKALLKTIHGKRPFILSRSTFSGSGKYTFHWTGDNQASWDQLRNSIRQVLNFNMFGIPMTGADICGFNGNSDEELCIRWMQLGAFYPFMRNHNAINQRDQDPASWNTEAQKIMKTAISNRYAMLPLFYTLLVKSHMNGGTVMRPMSFEFFSDKVTHSIELQFMIGSSIMATPVVYPGARSVDAYFPAGVWYDFHSGKLLHSDAEGAWLTLDAPLDKIN-IALRGGHIVPLLDSNRNSKSNIPNKMTLYCGMAQDMSASGDLYWDDGESI 2663
            Q  + ++R+DCYPE GA+QD+C +RGC W+E    S      P+  P+CYYPT+ S + ++S   +S  + AK         PY   +  L V Y +   T + +T     RY  P+       KP T  E        I S   FS ++ R S   +L+  S G + ++D+F+QI++ + +  IYG G+     +    + +    ++ARD         +  NLYG HPFY+ +  DGKA GVF  NSN QE    P P + YRTIGG +D   F G +PE+ V QYL+ +G P LP YW+LG+ L +WGY N++ +  +  RN   G P+   ++DIDYM +Y+DFT + + ++G   + ++I  +     + I DP +      +Y  +  G+  D  FI+ ++ +Q                 ++G VWP   T +PDF  P  N + +W  +  +F+  +P DG+WIDMNEPSNF  G+           K  C      D+   VP    Q+        L SKT+C      +     Y+  NLYG++E+  T +A+ + + GKR  ++SRSTF  SG+Y  HW GDN A W  L+ S+  V+ FNMFG+P  G+DICGFNG S+EELC+RW Q GAF PF R+HN+    DQDPA W + A    K A++ RY  LP  Y+L   +   G TV+RP+ FEF  D+ T +I  QF+ GS++M  P +Y G  SV AYFP+  WY             G +  ++APL  +  + +RGG ++P       + ++  +   L   +  + ++SGDLY+D G+ +
Sbjct:   23 QSVDVSKRVDCYPEPGASQDACQSRGCIWTEAPSSS------PVGTPWCYYPTE-SGFTVQSTGTNSFVLAAKTKN------PYGNNISPLNVKYSSNGATLL-LTIGNDDRYVPPVNFPK---KPSTSTESLKFTSGTIGSSDVFSFKVTRASTGVALWDTSIGGMQFADKFIQIATYLPSKNIYGFGDHIHKKIRHNLDRYTTWPMFARDIGPDSGSALSTQNLYGVHPFYMCIEADGKAHGVFILNSNAQEVETGPGPHLLYRTIGGRIDMAFFPGPTPEQVVNQYLQHIGFPFLPAYWALGYQLCRWGYGNLDAMKTVISRNQALGIPLDVPYADIDYMNHYEDFT-EGDNWSGFPAYTQQIHAQ-GLHLIVIFDPAVEV----DYASFQRGINADASFIEWARDDQVPHNIQDQYPMAKNTKIMLGNVWPDRNTAFPDFLDPRNNTNAWWAGEFAQFHKTLPFDGMWIDMNEPSNFDTGTYNTVEEQLASAKLSCPITGS-DSSLDVPPYPTQAVYQRNGEYLFSKTLCMLGKTAHRTRDFYDTKNLYGWSEARATYQAIPQ-VTGKRSAVISRSTFPSSGRYGGHWLGDNTARWGDLQTSVIGVMEFNMFGVPYVGSDICGFNGVSNEELCLRWHQFGAFSPFSRDHNSEGMPDQDPAVWPSVANA-AKIALTFRYYFLPFLYSLHYNAARYGHTVIRPLFFEFPKDEETLNISEQFLWGSALMIAPALYQGQTSVHAYFPSDTWYSLQPETYGQKMFSG-FNDVNAPLSSLTPVFVRGGFVLPRQSPGTTTTASRLSPFELLITVKTNAASSGDLYYDGGDDL 825          
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Celegans
Match: aagr-2 (Acid Alpha Glucosidase Relate [Source:UniProtKB/TrEMBL;Acc:Q21750])

HSP 1 Score: 460.299 bits (1183), Expect = 2.372e-146
Identity = 290/846 (34.28%), Postives = 421/846 (49.76%), Query Frame = 3
Query:  336 NNNERLDCYPESGANQDSCIARGCCWSEPMRLSNKLQGVPLSIPYCYYPTDYSNYMIKSLRKSSRGIKAKLVRESPSYLPYEVAMLDLEVIYETKSRTRV-RITDPKQKRYEVPMKLSPPDLKPPTDREYEVIIPSDGSFSIEIKRKSDDRSLF-KSFGPLLYSDQFLQISSIMSTDQIYGIGEQNRPFLHQLSNGWERIGLWARDNPIET----FMNLYGAHPFYIGMPDDGKAFGVFHFNSNGQEFALQPAPAVTYRTIGGILDFFIFTGGSPEETVKQYLELVGKPMLPPYWSLGFHLSKWGYKNIEQLSEIFQRNINAGFPIGTQWSDIDYMENYKDFTVDKEKFNGLGRFVREIKQKYNSRFVAIVDPGISCTSGNEYPPYYEGVFMDIFIKDSQTNQPI-----------------VGKVWPGETV-YPDF--THPNISMYWYKQIQRFYNDVPIDGLWIDMNEPSNFYDGSKRGCQGNSK---YDNPFFVP---------------------DIRDQSLISK-TICSSALH-YNNEKHYNLHNLYGYTESVTTNKALLKTIHGKRPFILSRSTFSGSGKYTFHWTGDNQASWDQLRNSIRQVLNFNMFGIPMTGADICGFNGNSDEELCIRWMQLGAFYPFMRNHNAINQRDQDPASWNTEAQKIMKTAISNRYAMLPLFYTLLVKSHMNGGTVMRPMSFEFFSDKVTHSIELQFMIGSSIMATPVVYPGARSVDAYFPAGVWY---DFHSGKLLHSDAEGAWLTLDAP-LDKINIALRGGHIVPLLDSNRNSKSNIPNKMTLYCGMAQDMSASGDLYWDDGESIDSYSRNRYSYVSFN 2705
            N   R DC PE   NQ +C ARGC W E     N         P+CY+  D   Y + S + S+  ++      +P            E+   TKS   V  +      RYE P+   P + +  T+        S+G FS  + R+S +R LF  S G L++SDQF+QI++ + ++ +YG GE     L      +    ++ARD P  +     +NLYG HP+Y+ +  DGKA GV   NSN QE    P P++ YRTIGG LD + F G +PE   +QYL+ +GKP LP YW+LG+ LS++GYK + ++    Q   +AG PI    +DIDYM+ YKDFT   + + G   +V+ +   +  + + I DP I  T    YP +   +  +    + +T   +                 +G VWP   V +PDF  +  N   +W  +   + + V  DG+WIDMNEPSNF          +S     D P F P                     D    + +S  T+C  A      ++ YN+ NLYG TE++ T KAL K   GKR  ++SRST+  +G+Y  HW GDN A W+ LR S+     FN+FGIP  G+D+CGF G + EELC+RW Q+GAF+ F RNHN I    QDPA W + A    K  +  RY  LP  ++L   + ++G TV+RP+ FE+ +D  T ++  +FM GS I+  PV+Y G  SV+AY P   WY   D+  G ++       + T+ AP   +I + +RG  ++P    +  + +   N   L           G LYWDDGE+I +   N Y Y  F+
Sbjct:   17 NAAPRFDCLPEPNGNQGACEARGCIWKEDDTGKNA--------PWCYF-KDGVGYNLDSQQGSTYNLRKNGGPSNP------WGADSTEIKLTTKSIGSVLNVKIGIDGRYEPPVDF-PRETQSSTESLSLSTSFSNGVFSFSVVRQSTNRKLFDTSIGGLIFSDQFIQIATYLPSENMYGWGENTHQSLRHDFTKYLTWAMFARDQPPNSGSLDTVNLYGVHPYYMILEPDGKAHGVLIINSNAQEVTTAPGPSLIYRTIGGNLDMYFFPGPTPEMVTQQYLKFIGKPFLPAYWALGYQLSRYGYKGLAEMKTRIQAVRDAGIPIDIGVADIDYMQRYKDFTT-GDDWAGFSDYVKTM-HDWGMKLILIFDPAIEAT----YPSFQRAIAANAKFIEWETKAQVQTAIQNLYPMAKDTKIMLGVVWPDNHVAFPDFLDSTNNTQNWWINEFVNYQSQVAFDGIWIDMNEPSNFGTNQDHPWYFDSDDHPNDAPLFCPTNGSSPWEMPPYKTRAVWRFGDANSGAFLSSNTLCMLAQQDGGKQRFYNVKNLYGLTEAINTQKALFKAT-GKRGAVVSRSTYPSAGRYAGHWLGDNTARWEDLRTSVIGAQEFNLFGIPYVGSDVCGFIGTTTEELCLRWQQMGAFHSFFRNHNTIGAPAQDPAVWPSVAAATKKANLF-RYQYLPYLFSLHFTASLSGATVIRPVFFEYPTDAETFNLGYEFMWGSRILVAPVIYQGTTSVNAYLPTDRWYSLFDYRYGSIMSP----GYATVPAPTTSRIPVFVRGYSVIPRQTPSITTTATRSNPFELLIAPCPLGMGEGTLYWDDGETIVN-DFNSYDYHQFD 833          
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Celegans
Match: aagr-4 (Acid Alpha Glucosidase Relate [Source:UniProtKB/TrEMBL;Acc:O17352])

HSP 1 Score: 291.197 bits (744), Expect = 4.944e-84
Identity = 189/615 (30.73%), Postives = 301/615 (48.94%), Query Frame = 3
Query:  966 MNLYGAHPFYIGMPDDGKAFGVFHFNSNGQEFALQPAPA-----------------------VTYRTIGGILDFFIFTGGSPEETVKQYLELVGKPMLPPYWSLGFHLSKWGYKNIEQLSEIFQRNINAGFPIGTQWSDIDYMENYKDFTVDKEKFNGLGRFVREIKQKYNSRFVAIVDPGISCTSGNEYPPYYEGVFMDIFIKDSQTNQPIVGKVWPGETVYPDFTHPNISMYWYKQI--QRFYNDVPIDGLWIDMNEPSNFYDGSKRGCQGNSKYDNPFFVPDIRDQSLISKTICSSALHYNNEKHYNLHNLYGYTESVTTNKAL-LKTIHGKRPFILSRSTFSGSGKYTFHWTGDNQASWDQLRNSIRQVLNFNMFGIPMTGADICGFNGNSDEELCIRWMQLGAFYPFMRNHNAINQRDQDPASWNTEAQKIMKTAISNRYAMLPLFYTLLVKSHMNGGTVMRPMSFEFFSDKVTHSIELQFMIGSSIMATPVVYPGARSVDAYFPAG--VWYDFHSGKLLHSDAEGAWLTLDAPLDKINIALRGGHIVPLLDSNR-NSKSNIPNKMTLYCGMAQDMS-ASGDLYWDDGESIDSYSRNRYSYVSFNASPEQ 2720
            M LYG+ P+ +G+    ++ G    N+      ++P  A                         + +  G++D FI  G  P +  +Q   L G   LPP ++LG+H S+W YK+ + + E+    +    P+   W DI++ +N   FT DK+ F      ++++  K N + V IVDP I   S  +Y  Y E       +KD++ +    G  WPG++ Y DF +P    +W +Q    ++        +W DMNEPS F +G                 P+I        T+   A H+   +H ++HN+YG+ +  +T + L  ++ +  RPF+LSRS F+GS +    WTGDN+A W  L+ SI  +L+ +  G+P  GAD+ GF GN DEEL +RW Q GAF PF R H+  + + ++P  +     + ++ AI  RYA LP +YTL  +    G  VMRP   EF  D+ +   + Q+M+G+ ++  PV+    + +  Y P    VWYD+ + K   S   GA + + A L+ I +  RGG I+P L   +  +K N    + LY  + Q    A+G +Y DDGES  +Y +  ++Y  F    E 
Sbjct:  244 MALYGSIPYLVGV-HQKRSVGALWLNAAETWVDIEPTTADKGGLSKEVLDADTKPRQVPQHNARFYSESGLIDVFITLGPQPNDIFRQLAALTGVTPLPPAFALGYHQSRWNYKDQKDVKEVHDGFVKHDIPLDVLWLDIEHTDNKAYFTFDKDAFGKPEDMIKDLADK-NRKLVTIVDPHIKKDS--KYYIYKEAKKNKYLVKDAK-DTIYEGNCWPGDSTYIDFINPKARKWWSEQFAFDKYKGTTKDVHIWNDMNEPSVF-NG-----------------PEI--------TMHKDAKHHGEFEHRDVHNVYGFHQHSSTFEGLKARSNNEVRPFVLSRSFFAGSQRTAAVWTGDNKADWAHLKQSIPMLLSLSTAGLPFVGADVGGFFGNPDEELLVRWYQAGAFQPFFRGHSHQDTKRREPWLFADNTTEAIRNAIKTRYAFLPYWYTLFYEHAKTGKPVMRPFWMEFIEDEPSWDEDRQWMVGNGLLVKPVLEEKVKELSIYLPGKRQVWYDWETHKARPS--PGA-VQIPAELNTIGLYHRGGTIIPKLSEVKLTTKENHEQPIILYIAVNQKGDFANGTIYLDDGESY-AYEKGDFAYWGFTFKREH 823          
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Fly
Match: GCS2alpha (gene:FBgn0027588 transcript:FBtr0070058)

HSP 1 Score: 272.322 bits (695), Expect = 4.255e-77
Identity = 202/704 (28.69%), Postives = 326/704 (46.31%), Query Frame = 3
Query:  795 KSFGPLLYSDQFLQISSIMSTDQIYGIGEQNRPFLHQLSNGWERIGLWARD---NPIETFMNLYGAHPFYIGMPDDGKAFGVFHFNSNGQEFALQ--------------------PAPAVTYRTIGGILDFFIFTGGSPEETVKQYLELVGKPMLPPYWSLGFHLSKWGYKNIEQLSEIFQRNINAGFPIGTQWSDIDYMENYKDFTVDKEKFNGLGRFVREIKQKYNSRFVAIVDPGISCTSGNEYPPYYEGVFMDIFIKDSQTNQPIVGKVWPGETVYPDFTHPNISMYWYKQ--IQRFYNDVPIDGLWIDMNEPSNFYDGSKRGCQGNSKYDNPFFVPDIRDQSLISKTICSSALHYNNEKHYNLHNLYGYTESVTTNKALLKTIHGKRPFILSRSTFSGSGKYTFHWTGDNQASWDQLRNSIRQVLNFNMFGIPMTGADICGFNGNSDEELCIRWMQLGAFYPFMRNHNAINQRDQDPASWNTEAQKIMKTAISNRYAMLPLFYTLLVKSHMNGGTVMRPMSFEFFSDKVTHSIELQFMIGSSIMATPVVYPGARSVDAYFPA-------GVWYDFHSGKLLHSDAEGAWLTLDAPLDKINIALRGGHIVPLLDSNRNSKS-NIPNKMTLYCGMAQDMSASGDLYWDDGESIDSYSRNRYSYVSFNASPEQLLITPVYFG---YDLLPVLNKIVILGFEN 2798
            K +GP   +  F    S  +   ++GI E    F+ + ++G +   L+  D     +++ M LYG+ P   G      A GV+  N+      +Q                    P PA  + +  GI+D FI  G  P +T KQY  L G   LP  ++L +H S+W Y +   ++ +  +      P+ T W DI++ +  + FT DK KF      ++ + +      V IVDP I     N Y  + +      ++K  + N    G  WPG   YPDF +P +  Y+  Q  + +F        LW DMNEPS F +G                 P+I        T     +HY N +H ++HNLYG+   + +   L +    +RPFIL+R+ F+GS +Y   WTGDN A W  L++S++  L   + G    GAD+  F GN D EL  RW Q GAF PF R H  I+ + ++P  +    +++++ A+  RY+ LPL+YT   +  + G  V+RP+  ++  DK    ++ Q ++   ++  PV+  G   VD YFPA         WYD  +           ++++     KI +  RGG IVP  +  R + +  + +  TL   + +   ASG LY DD +S  +Y + +  +V++  + +QL+ +  + G   Y  L  + +IVI G E 
Sbjct:  217 KPYGPEAVALDF----SFPAAKVLFGIPEHADSFILKSTSGTDPYRLYNLDVFEYVVDSKMALYGSVPVIYGHGAQRTA-GVYWQNAAETWVDIQTSETNVVSSLVNFVSGSQKTPPPAAHFMSESGIVDAFIMLGPKPMDTFKQYAALTGTHELPQLFALAYHQSRWNYNDERDVTSVSAKFDEYNIPMDTMWLDIEHTDGKRYFTWDKFKFPHPLAMIKNLTE-LGRHLVVIVDPHIK--RDNNYFFHRDCTDRGYYVKTREGND-YEGWCWPGAASYPDFFNPVVREYYASQYALDKFQTVTADVMLWNDMNEPSVF-NG-----------------PEI--------TAPKDLIHYGNWEHRDVHNLYGHMHLMGSFAGLQQRDPNQRPFILTRAHFAGSQRYAAIWTGDNFADWSHLQHSVKMCLTEAVAGFSFCGADVGAFFGNPDTELLERWYQTGAFLPFFRAHAHIDTKRREPWLFPERTRQVIQNAVIKRYSYLPLWYTAFYELELTGEPVIRPLLAQYPLDKEAFGVDNQLLVQDRLLVRPVMQQGVSKVDVYFPAIDDKKNGDWWYDVDT---YQRQERSGYVSVPVDDFKIPVWQRGGSIVPKKERQRRASTLMLHDPYTLIICLDRQGKASGSLYLDDEKSY-AYRQGQRIHVNYEFAHDQLVNS--FVGKPKYKTLAWIERIVIAGLEK 879          
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Fly
Match: GCS2alpha (gene:FBgn0027588 transcript:FBtr0070062)

HSP 1 Score: 272.322 bits (695), Expect = 4.255e-77
Identity = 202/704 (28.69%), Postives = 326/704 (46.31%), Query Frame = 3
Query:  795 KSFGPLLYSDQFLQISSIMSTDQIYGIGEQNRPFLHQLSNGWERIGLWARD---NPIETFMNLYGAHPFYIGMPDDGKAFGVFHFNSNGQEFALQ--------------------PAPAVTYRTIGGILDFFIFTGGSPEETVKQYLELVGKPMLPPYWSLGFHLSKWGYKNIEQLSEIFQRNINAGFPIGTQWSDIDYMENYKDFTVDKEKFNGLGRFVREIKQKYNSRFVAIVDPGISCTSGNEYPPYYEGVFMDIFIKDSQTNQPIVGKVWPGETVYPDFTHPNISMYWYKQ--IQRFYNDVPIDGLWIDMNEPSNFYDGSKRGCQGNSKYDNPFFVPDIRDQSLISKTICSSALHYNNEKHYNLHNLYGYTESVTTNKALLKTIHGKRPFILSRSTFSGSGKYTFHWTGDNQASWDQLRNSIRQVLNFNMFGIPMTGADICGFNGNSDEELCIRWMQLGAFYPFMRNHNAINQRDQDPASWNTEAQKIMKTAISNRYAMLPLFYTLLVKSHMNGGTVMRPMSFEFFSDKVTHSIELQFMIGSSIMATPVVYPGARSVDAYFPA-------GVWYDFHSGKLLHSDAEGAWLTLDAPLDKINIALRGGHIVPLLDSNRNSKS-NIPNKMTLYCGMAQDMSASGDLYWDDGESIDSYSRNRYSYVSFNASPEQLLITPVYFG---YDLLPVLNKIVILGFEN 2798
            K +GP   +  F    S  +   ++GI E    F+ + ++G +   L+  D     +++ M LYG+ P   G      A GV+  N+      +Q                    P PA  + +  GI+D FI  G  P +T KQY  L G   LP  ++L +H S+W Y +   ++ +  +      P+ T W DI++ +  + FT DK KF      ++ + +      V IVDP I     N Y  + +      ++K  + N    G  WPG   YPDF +P +  Y+  Q  + +F        LW DMNEPS F +G                 P+I        T     +HY N +H ++HNLYG+   + +   L +    +RPFIL+R+ F+GS +Y   WTGDN A W  L++S++  L   + G    GAD+  F GN D EL  RW Q GAF PF R H  I+ + ++P  +    +++++ A+  RY+ LPL+YT   +  + G  V+RP+  ++  DK    ++ Q ++   ++  PV+  G   VD YFPA         WYD  +           ++++     KI +  RGG IVP  +  R + +  + +  TL   + +   ASG LY DD +S  +Y + +  +V++  + +QL+ +  + G   Y  L  + +IVI G E 
Sbjct:  217 KPYGPEAVALDF----SFPAAKVLFGIPEHADSFILKSTSGTDPYRLYNLDVFEYVVDSKMALYGSVPVIYGHGAQRTA-GVYWQNAAETWVDIQTSETNVVSSLVNFVSGSQKTPPPAAHFMSESGIVDAFIMLGPKPMDTFKQYAALTGTHELPQLFALAYHQSRWNYNDERDVTSVSAKFDEYNIPMDTMWLDIEHTDGKRYFTWDKFKFPHPLAMIKNLTE-LGRHLVVIVDPHIK--RDNNYFFHRDCTDRGYYVKTREGND-YEGWCWPGAASYPDFFNPVVREYYASQYALDKFQTVTADVMLWNDMNEPSVF-NG-----------------PEI--------TAPKDLIHYGNWEHRDVHNLYGHMHLMGSFAGLQQRDPNQRPFILTRAHFAGSQRYAAIWTGDNFADWSHLQHSVKMCLTEAVAGFSFCGADVGAFFGNPDTELLERWYQTGAFLPFFRAHAHIDTKRREPWLFPERTRQVIQNAVIKRYSYLPLWYTAFYELELTGEPVIRPLLAQYPLDKEAFGVDNQLLVQDRLLVRPVMQQGVSKVDVYFPAIDDKKNGDWWYDVDT---YQRQERSGYVSVPVDDFKIPVWQRGGSIVPKKERQRRASTLMLHDPYTLIICLDRQGKASGSLYLDDEKSY-AYRQGQRIHVNYEFAHDQLVNS--FVGKPKYKTLAWIERIVIAGLEK 879          
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Fly
Match: GCS2alpha (gene:FBgn0027588 transcript:FBtr0070061)

HSP 1 Score: 272.322 bits (695), Expect = 4.255e-77
Identity = 202/704 (28.69%), Postives = 326/704 (46.31%), Query Frame = 3
Query:  795 KSFGPLLYSDQFLQISSIMSTDQIYGIGEQNRPFLHQLSNGWERIGLWARD---NPIETFMNLYGAHPFYIGMPDDGKAFGVFHFNSNGQEFALQ--------------------PAPAVTYRTIGGILDFFIFTGGSPEETVKQYLELVGKPMLPPYWSLGFHLSKWGYKNIEQLSEIFQRNINAGFPIGTQWSDIDYMENYKDFTVDKEKFNGLGRFVREIKQKYNSRFVAIVDPGISCTSGNEYPPYYEGVFMDIFIKDSQTNQPIVGKVWPGETVYPDFTHPNISMYWYKQ--IQRFYNDVPIDGLWIDMNEPSNFYDGSKRGCQGNSKYDNPFFVPDIRDQSLISKTICSSALHYNNEKHYNLHNLYGYTESVTTNKALLKTIHGKRPFILSRSTFSGSGKYTFHWTGDNQASWDQLRNSIRQVLNFNMFGIPMTGADICGFNGNSDEELCIRWMQLGAFYPFMRNHNAINQRDQDPASWNTEAQKIMKTAISNRYAMLPLFYTLLVKSHMNGGTVMRPMSFEFFSDKVTHSIELQFMIGSSIMATPVVYPGARSVDAYFPA-------GVWYDFHSGKLLHSDAEGAWLTLDAPLDKINIALRGGHIVPLLDSNRNSKS-NIPNKMTLYCGMAQDMSASGDLYWDDGESIDSYSRNRYSYVSFNASPEQLLITPVYFG---YDLLPVLNKIVILGFEN 2798
            K +GP   +  F    S  +   ++GI E    F+ + ++G +   L+  D     +++ M LYG+ P   G      A GV+  N+      +Q                    P PA  + +  GI+D FI  G  P +T KQY  L G   LP  ++L +H S+W Y +   ++ +  +      P+ T W DI++ +  + FT DK KF      ++ + +      V IVDP I     N Y  + +      ++K  + N    G  WPG   YPDF +P +  Y+  Q  + +F        LW DMNEPS F +G                 P+I        T     +HY N +H ++HNLYG+   + +   L +    +RPFIL+R+ F+GS +Y   WTGDN A W  L++S++  L   + G    GAD+  F GN D EL  RW Q GAF PF R H  I+ + ++P  +    +++++ A+  RY+ LPL+YT   +  + G  V+RP+  ++  DK    ++ Q ++   ++  PV+  G   VD YFPA         WYD  +           ++++     KI +  RGG IVP  +  R + +  + +  TL   + +   ASG LY DD +S  +Y + +  +V++  + +QL+ +  + G   Y  L  + +IVI G E 
Sbjct:  217 KPYGPEAVALDF----SFPAAKVLFGIPEHADSFILKSTSGTDPYRLYNLDVFEYVVDSKMALYGSVPVIYGHGAQRTA-GVYWQNAAETWVDIQTSETNVVSSLVNFVSGSQKTPPPAAHFMSESGIVDAFIMLGPKPMDTFKQYAALTGTHELPQLFALAYHQSRWNYNDERDVTSVSAKFDEYNIPMDTMWLDIEHTDGKRYFTWDKFKFPHPLAMIKNLTE-LGRHLVVIVDPHIK--RDNNYFFHRDCTDRGYYVKTREGND-YEGWCWPGAASYPDFFNPVVREYYASQYALDKFQTVTADVMLWNDMNEPSVF-NG-----------------PEI--------TAPKDLIHYGNWEHRDVHNLYGHMHLMGSFAGLQQRDPNQRPFILTRAHFAGSQRYAAIWTGDNFADWSHLQHSVKMCLTEAVAGFSFCGADVGAFFGNPDTELLERWYQTGAFLPFFRAHAHIDTKRREPWLFPERTRQVIQNAVIKRYSYLPLWYTAFYELELTGEPVIRPLLAQYPLDKEAFGVDNQLLVQDRLLVRPVMQQGVSKVDVYFPAIDDKKNGDWWYDVDT---YQRQERSGYVSVPVDDFKIPVWQRGGSIVPKKERQRRASTLMLHDPYTLIICLDRQGKASGSLYLDDEKSY-AYRQGQRIHVNYEFAHDQLVNS--FVGKPKYKTLAWIERIVIAGLEK 879          
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Fly
Match: GCS2alpha (gene:FBgn0027588 transcript:FBtr0070060)

HSP 1 Score: 272.322 bits (695), Expect = 4.255e-77
Identity = 202/704 (28.69%), Postives = 326/704 (46.31%), Query Frame = 3
Query:  795 KSFGPLLYSDQFLQISSIMSTDQIYGIGEQNRPFLHQLSNGWERIGLWARD---NPIETFMNLYGAHPFYIGMPDDGKAFGVFHFNSNGQEFALQ--------------------PAPAVTYRTIGGILDFFIFTGGSPEETVKQYLELVGKPMLPPYWSLGFHLSKWGYKNIEQLSEIFQRNINAGFPIGTQWSDIDYMENYKDFTVDKEKFNGLGRFVREIKQKYNSRFVAIVDPGISCTSGNEYPPYYEGVFMDIFIKDSQTNQPIVGKVWPGETVYPDFTHPNISMYWYKQ--IQRFYNDVPIDGLWIDMNEPSNFYDGSKRGCQGNSKYDNPFFVPDIRDQSLISKTICSSALHYNNEKHYNLHNLYGYTESVTTNKALLKTIHGKRPFILSRSTFSGSGKYTFHWTGDNQASWDQLRNSIRQVLNFNMFGIPMTGADICGFNGNSDEELCIRWMQLGAFYPFMRNHNAINQRDQDPASWNTEAQKIMKTAISNRYAMLPLFYTLLVKSHMNGGTVMRPMSFEFFSDKVTHSIELQFMIGSSIMATPVVYPGARSVDAYFPA-------GVWYDFHSGKLLHSDAEGAWLTLDAPLDKINIALRGGHIVPLLDSNRNSKS-NIPNKMTLYCGMAQDMSASGDLYWDDGESIDSYSRNRYSYVSFNASPEQLLITPVYFG---YDLLPVLNKIVILGFEN 2798
            K +GP   +  F    S  +   ++GI E    F+ + ++G +   L+  D     +++ M LYG+ P   G      A GV+  N+      +Q                    P PA  + +  GI+D FI  G  P +T KQY  L G   LP  ++L +H S+W Y +   ++ +  +      P+ T W DI++ +  + FT DK KF      ++ + +      V IVDP I     N Y  + +      ++K  + N    G  WPG   YPDF +P +  Y+  Q  + +F        LW DMNEPS F +G                 P+I        T     +HY N +H ++HNLYG+   + +   L +    +RPFIL+R+ F+GS +Y   WTGDN A W  L++S++  L   + G    GAD+  F GN D EL  RW Q GAF PF R H  I+ + ++P  +    +++++ A+  RY+ LPL+YT   +  + G  V+RP+  ++  DK    ++ Q ++   ++  PV+  G   VD YFPA         WYD  +           ++++     KI +  RGG IVP  +  R + +  + +  TL   + +   ASG LY DD +S  +Y + +  +V++  + +QL+ +  + G   Y  L  + +IVI G E 
Sbjct:  217 KPYGPEAVALDF----SFPAAKVLFGIPEHADSFILKSTSGTDPYRLYNLDVFEYVVDSKMALYGSVPVIYGHGAQRTA-GVYWQNAAETWVDIQTSETNVVSSLVNFVSGSQKTPPPAAHFMSESGIVDAFIMLGPKPMDTFKQYAALTGTHELPQLFALAYHQSRWNYNDERDVTSVSAKFDEYNIPMDTMWLDIEHTDGKRYFTWDKFKFPHPLAMIKNLTE-LGRHLVVIVDPHIK--RDNNYFFHRDCTDRGYYVKTREGND-YEGWCWPGAASYPDFFNPVVREYYASQYALDKFQTVTADVMLWNDMNEPSVF-NG-----------------PEI--------TAPKDLIHYGNWEHRDVHNLYGHMHLMGSFAGLQQRDPNQRPFILTRAHFAGSQRYAAIWTGDNFADWSHLQHSVKMCLTEAVAGFSFCGADVGAFFGNPDTELLERWYQTGAFLPFFRAHAHIDTKRREPWLFPERTRQVIQNAVIKRYSYLPLWYTAFYELELTGEPVIRPLLAQYPLDKEAFGVDNQLLVQDRLLVRPVMQQGVSKVDVYFPAIDDKKNGDWWYDVDT---YQRQERSGYVSVPVDDFKIPVWQRGGSIVPKKERQRRASTLMLHDPYTLIICLDRQGKASGSLYLDDEKSY-AYRQGQRIHVNYEFAHDQLVNS--FVGKPKYKTLAWIERIVIAGLEK 879          
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Fly
Match: GCS2alpha (gene:FBgn0027588 transcript:FBtr0070059)

HSP 1 Score: 272.322 bits (695), Expect = 4.255e-77
Identity = 202/704 (28.69%), Postives = 326/704 (46.31%), Query Frame = 3
Query:  795 KSFGPLLYSDQFLQISSIMSTDQIYGIGEQNRPFLHQLSNGWERIGLWARD---NPIETFMNLYGAHPFYIGMPDDGKAFGVFHFNSNGQEFALQ--------------------PAPAVTYRTIGGILDFFIFTGGSPEETVKQYLELVGKPMLPPYWSLGFHLSKWGYKNIEQLSEIFQRNINAGFPIGTQWSDIDYMENYKDFTVDKEKFNGLGRFVREIKQKYNSRFVAIVDPGISCTSGNEYPPYYEGVFMDIFIKDSQTNQPIVGKVWPGETVYPDFTHPNISMYWYKQ--IQRFYNDVPIDGLWIDMNEPSNFYDGSKRGCQGNSKYDNPFFVPDIRDQSLISKTICSSALHYNNEKHYNLHNLYGYTESVTTNKALLKTIHGKRPFILSRSTFSGSGKYTFHWTGDNQASWDQLRNSIRQVLNFNMFGIPMTGADICGFNGNSDEELCIRWMQLGAFYPFMRNHNAINQRDQDPASWNTEAQKIMKTAISNRYAMLPLFYTLLVKSHMNGGTVMRPMSFEFFSDKVTHSIELQFMIGSSIMATPVVYPGARSVDAYFPA-------GVWYDFHSGKLLHSDAEGAWLTLDAPLDKINIALRGGHIVPLLDSNRNSKS-NIPNKMTLYCGMAQDMSASGDLYWDDGESIDSYSRNRYSYVSFNASPEQLLITPVYFG---YDLLPVLNKIVILGFEN 2798
            K +GP   +  F    S  +   ++GI E    F+ + ++G +   L+  D     +++ M LYG+ P   G      A GV+  N+      +Q                    P PA  + +  GI+D FI  G  P +T KQY  L G   LP  ++L +H S+W Y +   ++ +  +      P+ T W DI++ +  + FT DK KF      ++ + +      V IVDP I     N Y  + +      ++K  + N    G  WPG   YPDF +P +  Y+  Q  + +F        LW DMNEPS F +G                 P+I        T     +HY N +H ++HNLYG+   + +   L +    +RPFIL+R+ F+GS +Y   WTGDN A W  L++S++  L   + G    GAD+  F GN D EL  RW Q GAF PF R H  I+ + ++P  +    +++++ A+  RY+ LPL+YT   +  + G  V+RP+  ++  DK    ++ Q ++   ++  PV+  G   VD YFPA         WYD  +           ++++     KI +  RGG IVP  +  R + +  + +  TL   + +   ASG LY DD +S  +Y + +  +V++  + +QL+ +  + G   Y  L  + +IVI G E 
Sbjct:  217 KPYGPEAVALDF----SFPAAKVLFGIPEHADSFILKSTSGTDPYRLYNLDVFEYVVDSKMALYGSVPVIYGHGAQRTA-GVYWQNAAETWVDIQTSETNVVSSLVNFVSGSQKTPPPAAHFMSESGIVDAFIMLGPKPMDTFKQYAALTGTHELPQLFALAYHQSRWNYNDERDVTSVSAKFDEYNIPMDTMWLDIEHTDGKRYFTWDKFKFPHPLAMIKNLTE-LGRHLVVIVDPHIK--RDNNYFFHRDCTDRGYYVKTREGND-YEGWCWPGAASYPDFFNPVVREYYASQYALDKFQTVTADVMLWNDMNEPSVF-NG-----------------PEI--------TAPKDLIHYGNWEHRDVHNLYGHMHLMGSFAGLQQRDPNQRPFILTRAHFAGSQRYAAIWTGDNFADWSHLQHSVKMCLTEAVAGFSFCGADVGAFFGNPDTELLERWYQTGAFLPFFRAHAHIDTKRREPWLFPERTRQVIQNAVIKRYSYLPLWYTAFYELELTGEPVIRPLLAQYPLDKEAFGVDNQLLVQDRLLVRPVMQQGVSKVDVYFPAIDDKKNGDWWYDVDT---YQRQERSGYVSVPVDDFKIPVWQRGGSIVPKKERQRRASTLMLHDPYTLIICLDRQGKASGSLYLDDEKSY-AYRQGQRIHVNYEFAHDQLVNS--FVGKPKYKTLAWIERIVIAGLEK 879          
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Zebrafish
Match: si:ch73-12o23.1 (si:ch73-12o23.1 [Source:ZFIN;Acc:ZDB-GENE-130530-749])

HSP 1 Score: 710.294 bits (1832), Expect = 0.000e+0
Identity = 361/805 (44.84%), Postives = 496/805 (61.61%), Query Frame = 3
Query:  324 CQIANNNERLDCYPESGA--NQDSCIARGCCWSEPMRLSNKLQGVPLSIPYCYYPTDYSNYMIKSLRKSSRGIKAKLVRESPSYLPYEVAMLDLEVIYETKSRTRVRITDPKQKRYEVPMKLSPPDLKPPTDREYEVIIPSDGSFSIEIKRKSDDRSLFK-SFGPLLYSDQFLQISSIMSTDQIYGIGEQNRPFLHQLSNGWERIGLWARDNPIETFMNLYGAHPFYIGMPDDGKAFGVFHFNSNGQEFALQPAPAVTYRTIGGILDFFIFTGGSPEETVKQYLELVGKPMLPPYWSLGFHLSKWGYKNIEQLSEIFQRNINAGFPIGTQWSDIDYMENYKDFTVDKEKFNGLGRFVREIKQKYNSRFVAIVDPGISCTSG-NEYPPYYEGVFMDIFIKDSQTNQPIVGKVWPGETVYPDFTHPNISMYWYKQIQRFYNDVPIDGLWIDMNEPSNFYDGSKRGCQGNSKYDNPFFVPDIRDQSLISKTICSSALHYNNEKHYNLHNLYGYTESVTTNKALLKTIHGKRPFILSRSTFSGSGKYTFHWTGDNQASWDQLRNSIRQVLNFNMFGIPMTGADICGFNGNSDEELCIRWMQLGAFYPFMRNHNAINQRDQDPASWNTEAQKIMKTAISNRYAMLPLFYTLLVKSHMNGGTVMRPMSFEFFSDKVTHSIELQFMIGSSIMATPVVYPGARSVDAYFPAGVWYDFHSGKLLHSDAEGAWLTLDAPLDKINIALRGGHIVPLLDSNRNSKSNIPNKMTLYCGMAQDMSASGDLYWDDGESIDSYSRNRYSYVSFNASPEQLL 2726
            C       R DCYPE      +D C AR CC+ +  R +   Q     +P+C+Y  DY +Y + S+  +  G   KL+R   +Y P ++  L LEV++E   R RV+ITDP +KRYEVP+ + P   K  ++  Y V    +  F + +KR      L   S  PL Y+DQFLQ+SS + T  IYG+GE    FLH +   W  + +WARD P     NLYG HPFY+ M  DG A G F  NSN  +  LQPAPAVT+R IGGILDF+IF G  P   + QYL++VGKP +P YW+LG+HL +WGYK   +   + +   N G P   QW+DIDYM+   DFT D   F+ L   V+++ Q+++  +V I+DPGIS +     Y P+ EG    IFI DS  +  ++GKVWPG T +PDF++P+   +WY+ +QRF+N VP DG+WIDMNEPSNF+DGS  GC  N + +NP + P I   +L  KT+C+SA       HYN+H+LYG  E+  T  AL + I  KRPFI+SRSTF   GKY+ HW GDN++ W  L  SI  +L FN+ GIP+ GADICGF G++ EELC+RW QLGAFYPF RNHN+I+++DQ+P +++  A+  MK AI  RY++ P  YTL   +H++G TV  P+ F+F +D+ T+ I+ QF+ G S++ TPV+  G   V  YFP G+WYDFH+G  L S  E   + L+AP DKIN+ LR G ++P    N     +    + L   +++D  A GDLYWDDGE+IDSY  N+Y+Y+ F      ++
Sbjct:  101 CSQVPEGWRFDCYPERNVVVTEDMCHARNCCFIQSSRGNVSAQN---GVPWCFYTPDYPSYELMSIVDTEMGKVGKLLRNKKTYYPKDIDALQLEVLFEEDHRLRVKITDPTEKRYEVPIDV-PVVHKRASNPSYTVDFIKE-PFGLIVKRTQTGAVLLNTSIAPLFYADQFLQMSSSLPTRFIYGLGEHRSNFLHDVQ--WNTLTMWARDVPPMELTNLYGVHPFYLSMESDGNAHGFFMLNSNAMDVVLQPAPAVTWRMIGGILDFYIFLGPDPSSVIGQYLDVVGKPAMPIYWALGYHLCRWGYKTSNKTWSVVKEMRNYGIPQDVQWNDIDYMDRSLDFTYDPSGFSTLPDLVKDL-QRHDQHYVMILDPGISNSQPPGSYWPFDEGKKKGIFINDSNGDI-LIGKVWPGLTAFPDFSNPDTHEWWYQNLQRFHNKVPFDGVWIDMNEPSNFFDGSLNGCPDN-ELENPPYTPGILGGTLKGKTVCASARQ-KISVHYNIHSLYGLMEAQATESAL-RRITKKRPFIISRSTFPSQGKYSGHWLGDNRSQWKDLATSIPGMLTFNILGIPLIGADICGFGGSTTEELCVRWTQLGAFYPFTRNHNSIDEQDQEPTAFSPAARTAMKEAILLRYSLFPHLYTLFHHAHVSGHTVATPLLFQFPTDEKTYGIDKQFLWGKSLLVTPVLDAGRDYVVGYFPKGLWYDFHTGNSLISSGEE--IKLEAPADKINLHLREGSVIPTQRPNTTLWVSSGQPLHLIVSLSEDGRAKGDLYWDDGETIDSYESNQYAYIYFTVEQNTMM 891          
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Zebrafish
Match: CABZ01079192.1 (sucrase-isomaltase (alpha-glucosidase) [Source:NCBI gene;Acc:100148922])

HSP 1 Score: 537.724 bits (1384), Expect = 8.698e-172
Identity = 317/888 (35.70%), Postives = 498/888 (56.08%), Query Frame = 3
Query:  345 ERLDCYPESGANQDSCIARGCCWSEPMRLSNKLQGVPLSIPYCYYPTDYSNYMIKSLRKSSRGIKAKLVRESPSYLPYE------VAMLDLEVIYETKSRTRVRITDPKQKRYEVPMKLSPPDLKPPTDREYEVIIPSDGSFSIEIKRKSDDRSLFKSFGP-LLYSDQFLQISSIMSTDQIYGIGEQNRP-FLHQLSNGWERIGLWARDNPIETFMNLYGAHPFYIGMPDDGKAFGVFHFNSNGQE-FALQPAPAVTYRTIGGILDFFIFTGGSPEETVKQYLE-LVGKPMLPPYWSLGFHLSKWGYKNIEQLSEIFQRNINAGFPIGTQWSDIDYMENYKDFTVDKEKFNGLGRFVREIKQKYNSRFVAIVDPGISC--TSGNEYPPYYEGVFMDIFIK--DSQTNQPIVGKVWPGE---------------------TVYPDFTHPNISMYWYKQIQRFYNDV-PIDGLWIDMNEPSNFYDGSKRG-CQGNSKYDNPFFVPDI--RDQSLISKTICSSALHY----NNEKHYNLHNLYGYTESVTTNKALLKTIHGKRPFILSRSTFSGSGKYTFHWTGDNQASWDQLRNSIRQVLNFNMFGIPMTGADICGFNGNSDEELCIRWMQLGAFYPFMRNHNAINQRDQDPASWNTEAQKIMKTAISNRYAMLPLFYTLLVKSHMNGGTVMRPMSFEFFSDKVTHSIELQFMIGSSIMATPVVYPGARSVDAYFPAGVWYDFHSGKLLHSDAEGAWLTLDAPLDKINIALRGGHIVPLLDSNRNSKSNIPNKMTLYCGMAQDMSASGDLYWDDGESIDSYSRNRYSYVSFNASPEQLL-ITPVYFGYDLLPVLNKIVILGFENKSITKFLL-----NDNDIPFHYNPET 2861
            ER+DCYPE GA +  C  RGC W          +G+PL++P CYY  ++  Y   ++ ++  GI A L  E  +  P +      +  L +E+ +  +   R +I DP++ RYEVP+ L+ P+  P    +   +  ++  F I + RK     +F S  P  ++SDQF+QIS+ + T+ +YG GE   P + H L+  +   GL+A+D P    +N YG HPFY+GM    KA G+   NSN    F + P   + +R +  +L  ++F   +    +K Y + L+G+P+LP YWSLGF L ++GY N  +++++++    A  P   Q++DIDYME   DFT+DK  F GL   V  ++ +   RF+ I+DP I+   T+G+ Y  +  G+  D+FIK   + +N  + GKVWP                         +PDF     + +W  QI+ +Y++V   DGLWIDMNEP++F  G+  G C G+   +NP ++P +  +++ L  KT+C ++          +HY++HNLYG + +  T  AL  T  GKR  I++RST+  SG++  HW GDN ++WDQL  SI  ++ F++FG+  TGADICGF   + +E+C+RWMQLGAFYPF RNHN IN   QDP +W  E   + +  ++ RY +LP  YTL+ ++H  G TV+RPM  EF +D+ T  I+ QF+ GS+++ TP +  G   V  Y P   WYD+H+ +++  + +G ++ +D PLDKIN+ +RG +I+P  +  RN++ +  N M L   +     A+G+L+WDDGE ID+    +Y Y  F+AS   L  +          P+L ++ +LG  + S+T+  +     +   + F Y PET
Sbjct:  436 ERIDCYPEEGATKAECEGRGCIWEHS-------KGIPLAVPMCYYSENHG-YKASNVVENMYGITADL--EINTAFPSQRSQSPDINKLRVEITFHDEICLRWKIYDPEKARYEVPVPLNLPNPPPLWGEQTYKVEINEEPFGIRVIRKDTSEVIFDSVLPGFIFSDQFIQISTRLPTEYVYGFGETEHPSYKHDLN--FHTYGLFAKDQPPGYKLNSYGIHPFYMGMEKSKKAHGILLLNSNAMGIFTVLPFTFLFWRNVFLLLLMYVFINNTESLFMKTYNDMLIGRPVLPAYWSLGFQLCRYGYANDSEIADLYRDMRAAEIPYDVQYADIDYMERQMDFTLDKTNFLGLPALVDRMRGE-GMRFIFILDPAIAANETTGS-YAAFDSGIEKDVFIKWPPALSNDIVWGKVWPDYPNITVDNSLDWDTQVELFRSFVAFPDFFKNGTAEWWADQIKDYYDNVMKFDGLWIDMNEPASFVHGTVGGKCLGDPLLENPPYMPPLESKEKGLNHKTLCMNSEQILADGTRVRHYDVHNLYGLSHTKPTYDALHSTT-GKRGVIITRSTYPTSGRWAGHWLGDNYSAWDQLLKSIIGMMEFSIFGVSYTGADICGFFNPAQKEMCLRWMQLGAFYPFSRNHNTINMPRQDPVAWGPEFANMSRDVLNIRYTLLPYLYTLMYEAHTKGTTVVRPMLHEFVNDEKTWDIDRQFLWGSALLITPALEEGVTVVKGYLPKTRWYDYHTNEVV--EGQGQFVDMDTPLDKINLHVRGRYIIPYQNPERNTQLSRKNPMNLLVALDGSGYATGNLFWDDGEGIDTLKNRKYIYKQFSASRGSLSGVRETGLEEADRPLLGEVKVLGV-SSSVTEVTITVTGGSTTPLTFDYYPET 1305          

HSP 2 Score: 270.781 bits (691), Expect = 6.571e-75
Identity = 160/390 (41.03%), Postives = 223/390 (57.18%), Query Frame = 3
Query: 1656 DMNEPSNFYDGSKRGCQGNSKYDNPFFVPDIRDQSLISKTICSSALH-YNNEKHYNLHNLYGYTESVTTNKALLKTIHGKRPFILSRSTFSGSGKYTFHWTGDNQASWDQLRNSIRQVLNFNMFGIPMTGADICGFNGNSDEELCIRWMQLGAFYPFMRNHNAINQRDQDPASWNTEAQKI--MKTAISNRYAMLPLFYTLLVKSHMNGGTVMRPMSFEFFSDKVTHSIELQFMIGSSIMATPVVYPGARSVDAYFPAGVWYDFHSGKLLHSDAEGAWLTLDAPLDKINIALRGGHI-VPLLDSNRNSKSNIPNK---MTLYCGMAQDMSASGDLYWDDGESIDSYSRNRYSYVSFNASPEQLLITPVYFGYDLLPVLN--KIVILGFEN 2798
            DMNE SNF  GS +GC  N K + P F P I D  + SKT+C  A   + N  HY++H+LYGY+  + T +A  +     R  + +RS+F G GKY+ HW GDN A+W+ ++ +I  +L FN+FGIP  GADICGF  NS EELC RWMQ+GAFYPF RNHNA    DQDPAS+  ++  +   +  ++ RY +LP  YTL  K+H+NG TV+RP+  EF+SD  T  I  QFM G+ ++ TPV+ PG   V+AY P  +WYDF +   L S         +  L+  NI +   +  +    S R      P++   M L   +  + SASG+L+WDDG+S D+ S   + +  F+ +   L +     GY     L    I ILGF +
Sbjct:    1 DMNEISNFIKGSNKGCADN-KLNYPPFTPRILDDLMYSKTLCMDAKQKWGN--HYDVHSLYGYSMVLATERASKEVFGTNRSMVFTRSSFPGVGKYSGHWLGDNGANWNDIKWAIPGMLEFNLFGIPYIGADICGFFDNSTEELCRRWMQVGAFYPFSRNHNAQGYEDQDPASYGLDSLLVNTSRHYLNIRYKLLPYLYTLFYKAHVNGETVVRPLMHEFYSDSQTWDIHKQFMWGAHLLITPVLDPGVHYVEAYIPDAIWYDFEN---LKSKVNFKKFKSNVNLNVNNIKMNKKNKHLNYFPSQRMKVVCSPSRRHPMGLIIALDDNKSASGELFWDDGDSRDTVSSGNHIHYQFSVTDGSLTMHVTKNGYSDPNNLKFENITILGFSS 384          
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Zebrafish
Match: GAA (glucosidase alpha, acid [Source:HGNC Symbol;Acc:HGNC:4065])

HSP 1 Score: 347.436 bits (890), Expect = 1.221e-107
Identity = 186/456 (40.79%), Postives = 268/456 (58.77%), Query Frame = 3
Query:  321 QCQIANNNERLDCYPESGANQDSCIARGCCWSEPMRLSNKLQGVPLSIPYCYYPTDYSNYMIKSLRKSSRGIKAKLVRESPSYLPYEVAMLDLEVIYETKSRTRVRITDPKQKRYEVP-MKLSPPDLKPPTDREYEVIIPSDGSFSIEIKRKSDDRSLF-KSFGPLLYSDQFLQISSIMSTDQIYGIGEQNRPFLHQLSNGWERIGLWARDNPIETFMNLYGAHPFYIGMPDDGKAFGVFHFNSNGQEFALQPAPAVTYRTIGGILDFFIFTGGSPEETVKQYLELVGKPMLPPYWSLGFHLSKWGYKNIEQLSEIFQRNINAGFPIGTQWSDIDYMENYKDFTVDKEKFNGLGRFVREIKQKYNSRFVAIVDPGISCTS-GNEYPPYYEGVFMDIFIKDSQTNQPIVGKVWPGETVYPDFTHPNISMYWYKQIQRFYNDVPIDGLWIDMNEPSNF 1679
            QC IA    R+DC  +   ++  C +RGCC+  P+  S  L+G P    +C+Y   Y  Y +  +  + RG +A L R +PSYLP ++  L L+V+ ET+ R  + + DP   RYEVP +K      K   +  Y+V    +  F   ++RKS+ R L   + GPLL++DQ+LQ+S+ +++  + G+GE   P    L   W  + LW RD       NLYG+HPF++    DG+A GVF  NSN  E  +QPAPA+T+ TIGGILDFFIF G SP+  ++QY E++G PM+PPYWSLGFHL +WGY +      + Q    A  P+  QW+D+DY +  + FT D ++F  L + V +  Q    ++V I+DPGIS  S    Y P+ +G+   +FI +S T Q ++GKVWPG T +PDFT+P    +W   I+ FYN VP+DGLWI     S+F
Sbjct:   64 QCGIAVE-RRIDCARDRSLSRAECESRGCCY-LPLPQSG-LRGPP----WCFYTVFYPGYKMGPMLPTERGHRAILTRSAPSYLPRDIHTLQLDVMAETQDRLHLTLKDPTSPRYEVPFVKSQSKGHKSMENPLYDVDFQPE-PFGFSVRRKSNGRVLLNTTIGPLLFADQYLQLSTSLASSTVSGLGEHYTPITLDLD--WSSVSLWNRDMAPHRSANLYGSHPFFLVQEGDGQAHGVFLLNSNAMEVFMQPAPALTWVTIGGILDFFIFLGPSPQSVIQQYQEVIGYPMMPPYWSLGFHLCRWGYTSTNITRTVVQLMRQAKIPLDVQWNDLDYADQRRVFTFDPQRFGDLPQMVEDFHQ-LGMKYVLILDPGISSASPPGSYKPFDDGLKKGVFINNS-TGQILIGKVWPGPTAFPDFTNPTTQDWWMDWIKDFYNKVPVDGLWIVSIHSSSF 507          
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Zebrafish
Match: gaa (glucosidase, alpha; acid (Pompe disease, glycogen storage disease type II) [Source:ZFIN;Acc:ZDB-GENE-070212-2])

HSP 1 Score: 329.717 bits (844), Expect = 3.786e-103
Identity = 175/423 (41.37%), Postives = 255/423 (60.28%), Query Frame = 3
Query: 1659 MNEPSNFYDGSKRGCQGNSKYDNPFFVPDIRDQSLISKTICSSALHYNNEKHYNLHNLYGYTESVTTNKALLKTIHGKRPFILSRSTFSGSGKYTFHWTGDNQASWDQLRNSIRQVLNFNMFGIPMTGADICGFNGNSDEELCIRWMQLGAFYPFMRNHNAINQRDQDPASWNTEAQKIMKTAISNRYAMLPLFYTLLVKSHMNGGTVMRPMSFEFFSDKVTHSIELQFMIGSSIMATPVVYPGARSVDAYFPAGVWYDFHSGKLLHSDAEGAWLTLDAPLDKINIALRGGHIVPLLDSNRNSKSNIPNKMTLYCGMAQDMSASGDLYWDDGESIDSYSRNRYSYVSFNASPEQLLITPVYFGYDLLP-VLNKIVILGFENKSITKFLLNDNDIP-FHYNPETXXXXXXXXXXXXXXEIKIQW 2921
            MNEPSNF  GS  GC  +S+ + P + P +    L S T+C SA  Y +  HYNLHNLYG TE++ T++ALLK +   RPF+LSRS+F G G+++ HWTGD ++ W+QLR SI  VL F ++GIP+ GAD+CGF G+++EELC+RW QLGAFYPFMRNHN      Q+P  ++  AQ  M+  I+ RY++LP  YTL   +H +  TV RP+  +F +D    SI+ QF+ GSS++ +PV+  GA  V AY P G WY  H+G+  +S  +G ++   A LD I + +R   I+P       +  +  N  TL  G++    A G+L+WDDGES+D++ R  YSY+ F A    ++  P+     L   VL ++ + G +    T    N   +P F Y  +T  + ++ L   + ++I IQW
Sbjct:    1 MNEPSNFVQGSVDGCP-DSELEKPPYTPGVIGGQLNSGTLCVSAQQYLS-NHYNLHNLYGLTEAIATHRALLK-VKKTRPFVLSRSSFPGLGRFSAHWTGDVRSDWEQLRFSIPAVLLFGLYGIPLVGADVCGFGGDTNEELCVRWTQLGAFYPFMRNHNDRPNAPQEPYVFSQRAQDAMRMVINLRYSLLPFLYTLFHHAHTSASTVARPLFLQFPTDPDCRSIDRQFLWGSSLLISPVLEQGAVEVMAYLPPGTWYSLHNGQTYYS--KGQYIVFPASLDTIIVHVRERSIIPQQAPALTTAISRKNPFTLTVGLSVGNLAKGELFWDDGESLDTFERGDYSYLLFFAEESYVVSKPIKLNGSLDGLVLGEVRVFGVQTPP-TAVWANGQKVPDFSYRLDTKVLTVAGLELPMTAKITIQW 417          
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Zebrafish
Match: CABZ01088484.1 (pep chromosome:GRCz11:18:1768804:1791127:1 gene:ENSDARG00000104569.2 transcript:ENSDART00000167477.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CABZ01088484.1)

HSP 1 Score: 273.863 bits (699), Expect = 4.940e-82
Identity = 156/454 (34.36%), Postives = 245/454 (53.96%), Query Frame = 3
Query:  321 QCQIANNNERLDCYPESGANQDSCIARGCCWSEPMRLSNKLQGVPLSIPYCYYPTDYSNYMIKSLRKSSRGIKAKLVR-ESPSYLPYEVAMLDLEVIYETKSRTRVRITDPKQKRYEVPMKLSPPDLKPPTD-REYEVIIPSDGSFSIEIKRKSDDRSLF-KSFGPLLYSDQFLQISSIMSTDQIYGIGEQ-NRPFLHQLSNGWERIGLWARDNPIETFMNLYGAHPFYIGMPDDGKAFGVFHFNSNGQEFALQPAPAVTYRTIGGILDFFIFTGGSPEETVKQYLELVGKPMLPPYWSLGFHLSKWGYKNIEQLSEIFQRNINAGFPIGTQWSDIDYMENYKDFTVDKEKFNGLGRFVREIKQKYNSRFVAIVDPGISCTS--GNEYPPYYEGVFMDIFIKDSQTNQPIVGKVWPGETVYPDFTHPNISMYWYKQIQRFYNDVPIDGLWIDMN 1664
            +C      +R+DC+P+ GA+Q  C+ R CCWS P+  +N        +P+C++  ++     +     S  I+AKL R  +PS    ++  L      +T++R R +ITD KQ R+EVP +       PPT   +Y+V I     F ++I R + ++ LF  + GPL+++DQ+LQ+S+ + +  IYG+GE  ++ F H     W    ++ RD           + P  I +                    +QPAPAVT+RTIGG+LDF++  G +PE  V ++ +L+G+P +PPYWSLGF +S+W Y +++ + E+ +RN NA  P   Q++DIDYME  K FT D  KF  L  F   +  K   +++ I+DP +S        Y     G    +++ +S    P+VG+VWPGETV+PDFT+     +W  +I RF+ +V  D LWI  N
Sbjct:   37 ECPDIPLTDRVDCFPDGGASQQKCLERACCWS-PLDETN--------VPWCFFSKNHGYTADRVSNPDSTHIEAKLTRMNAPSLFGADIKDLTFHGEMQTENRFRFKITDAKQARFEVPHENVKAPANPPTGPLKYKVEI-VQKPFGVKIWRTTPEKLLFDTTIGPLVFADQYLQLSAKLPSHNIYGLGEHVHQTFRHD--TNWRTWPIFTRD-----------SFPNGISL--------------------IQPAPAVTFRTIGGVLDFYVLVGDTPEAVVDEFTKLIGRPFIPPYWSLGFQISRWDYGSLDAVKEVVERNRNASLPYDVQYTDIDYMEEKKIFTYDLVKFADLPNFADYMHDK-GQKYIVILDPAVSTGRRLNGPYDTVDRGHAAKVWVTESDGETPLVGEVWPGETVFPDFTNEACIKWWVDEISRFHKEVKHDALWIVSN 446          
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Xenopus
Match: GAA (glucosidase, alpha; acid [Source:NCBI gene;Acc:100495955])

HSP 1 Score: 706.827 bits (1823), Expect = 0.000e+0
Identity = 355/804 (44.15%), Postives = 510/804 (63.43%), Query Frame = 3
Query:  321 QCQIANNNERLDCYPESGANQDSCIARGCCWSEPMRLSNKLQGVPLSIPYCYYPTDYSNYMIKSLRKSSRGIKAKLVRESPSYLPYEVAMLDLEVIYETKSRTRVRITDPKQKRYEVPMKLSPPDLKPPTDREYEVIIPSDGSFSIEIKRKSDDRSLFKS-FGPLLYSDQFLQISSIMSTDQIYGIGEQNRPFLHQLSNGWERIGLWARDNPIETFMNLYGAHPFYIGMPDDGKAFGVFHFNSNGQEFALQPAPAVTYRTIGGILDFFIFTGGSPEETVKQYLELVGKPMLPPYWSLGFHLSKWGYKNIEQLSEIFQRNINAGFPIGTQWSDIDYMENYKDFTVDKEKFNGLGRFVREIKQKYNSRFVAIVDPGISCT-SGNEYPPYYEGVFMDIFIKDSQTNQPIVGKVWPGETVYPDFTHPNISMYWYKQIQRFYNDVPIDGLWIDMNEPSNFYDGSKRGCQGNSKYDNPFFVPDIRDQSLISKTICSSALHYNNEKHYNLHNLYGYTESVTTNKALLKTIHGKRPFILSRSTFSGSGKYTFHWTGDNQASWDQLRNSIRQVLNFNMFGIPMTGADICGFNGNSDEELCIRWMQLGAFYPFMRNHNAINQRDQDPASWNTEAQKIMKTAISNRYAMLPLFYTLLVKSHMNGGTVMRPMSFEFFSDKVTHSIELQFMIGSSIMATPVVYPGARSVDAYFPAGVWYDFHSGKLLHSDAEGAWLTLDAPLDKINIALRGGHIVPLLDSNRNSKSNIPNKMTLYCGMAQDMSASGDLYWDDGESIDSYSRNRYSYVSFNASPEQLL 2726
            QC ++ N  R DC PE   +++ C ARGCC+S      N  Q      P+C++P  Y +Y + +L ++ RG  A L R   +++P+++  L LEV++ET+SR    I DP +KRYEVP+  +P      +   ++V    D  F + I+RKS    L  +   PL+++DQFLQIS+ + +  +YG+GE        LS  W R+  W RD       NLYG+HPFY+ M + G++ GVF  NSN  +  LQ APA+T+RT GGILDF++F G  P+  ++QY +++G P +PPYWSLGFHL +WGY       ++ +   +A  P+  QW+DIDYM+  +DFT D+ +F      V+E  Q+   +++ I+DP IS + +   YPPY +G+   +FI D +  +P+VGKVWPG TV+PDFT P    +WY  ++ F++ VP DG+WIDMNEPSNF  GS  GC  N++ +NP +VP +   SL S TIC+S+  + +  HYNLHNLYG +E+V T+ AL+K +  KRPFI+SRSTF+  G Y  HWTGD  +SW+Q+  S+  +L FNMFG+PM GADICGF GN+ EELC+RW QLGAFYPFMRNHN  +   Q+P  +++EAQK +K+A+  RY +LP  YTL  K+H +G TV R +  EF +D  T +I+ Q++ G +++ TPV+  G  +V+AYFP G WY   SG  + S  +G WL L APLDKIN+ +RGG+I+P      N++ +  NK+ L   +  D  A GDL+WDDG S+ ++ R  Y++V F A+   LL
Sbjct:   43 QCSVSPN-RRFDCVPEKCVSKEECEARGCCYSPAGDKGNIGQ------PWCFFPPSYPSYKMFNLTQTDRGYNATLKRSVGTFMPHDIMTLQLEVLFETESRLHFTIKDPAKKRYEVPIP-TPQVSGKASSTLFDVQFSCD-PFGLIIRRKSSGLILLNTTVAPLIFADQFLQISTSLPSGYLYGLGEHLTAL--NLSLQWNRLTFWNRDLRPSKDSNLYGSHPFYLSMEEGGQSHGVFLLNSNAMDVLLQEAPALTWRTTGGILDFYVFLGPEPKSVIRQYQDIIGYPFMPPYWSLGFHLCRWGYSTSNCTRQVVKNMRDAKIPLDVQWNDIDYMDAMRDFTYDQNRFGDFPEMVKEFHQQ-GVKYIMILDPAISSSNTPGSYPPYDDGLKRGVFITDDE-GKPLVGKVWPGLTVFPDFTMPETFSWWYDMVKLFHDQVPFDGIWIDMNEPSNFVQGSVDGCP-NNELENPPYVPGVVGGSLRSTTICASSQQHLSS-HYNLHNLYGLSEAVATHYALVKILK-KRPFIISRSTFASHGHYAGHWTGDVVSSWEQIYYSVPAILLFNMFGVPMVGADICGFGGNTTEELCVRWSQLGAFYPFMRNHNDHDSVSQEPYVFSSEAQKAIKSALLIRYTLLPYLYTLFHKAHSSGETVARALFIEFPTDPNTWTIDRQYLWGEALLITPVLEQGKTTVNAYFPTGTWYAPESGTGIQS--KGQWLMLPAPLDKINVHIRGGYILPAQVPGMNTEESRKNKLLLVVALTPDGVARGDLFWDDGVSLGTFERQDYTHVVFLAANNILL 828          
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Xenopus
Match: GAA (glucosidase, alpha; acid [Source:NCBI gene;Acc:100495955])

HSP 1 Score: 701.049 bits (1808), Expect = 0.000e+0
Identity = 354/805 (43.98%), Postives = 510/805 (63.35%), Query Frame = 3
Query:  321 QCQIANNNERLDCYPESGANQDSCIARGCCWSEPMRLSNKLQGVPLSIPYCYYPTDYSNYMIKSLRKSSRGIKAKLVRESPSYLPYEVAMLDLEVIYETKSRTRVRITDPKQKRYEVPMKLSPPDLKPPTDREYEVIIPSDGSFSIEIKRKSDDRSLFKSFGPLLYSDQFLQISSIMSTDQIYGIGEQNRPFLHQLSNGWERIGLWARDNPIETFMNLYGAHPFYIGMPDDGKAFGVFHFNSNGQEFALQPAPAVTYRTIGGILDFFIFTGGSPEETVKQYLELVGKPMLPPYWSLGFHLSKWGYKNIEQLSEIFQRNINAGFPIGTQWSDIDYMENYKDFTVDKEKFNGLGRFVREIKQKYNSRFVAIVDPGISCT-SGNEYPPYYEGVFMDIFIKDSQTNQPIVGKVWPGETVYPDFTHPNISMYWYKQIQRFYNDVPIDGLWIDMNEPSNFYDGSKRGCQGNSKYDNPFFVPDIRDQSLISKTICSSALHYNNEKHYNLHNLYGYTESVTTNKALLKTIHGKRPFILSRSTFSGSGKYTFHWTGDNQASWDQLRNSI--RQVLNFNMFGIPMTGADICGFNGNSDEELCIRWMQLGAFYPFMRNHNAINQRDQDPASWNTEAQKIMKTAISNRYAMLPLFYTLLVKSHMNGGTVMRPMSFEFFSDKVTHSIELQFMIGSSIMATPVVYPGARSVDAYFPAGVWYDFHSGKLLHSDAEGAWLTLDAPLDKINIALRGGHIVPLLDSNRNSKSNIPNKMTLYCGMAQDMSASGDLYWDDGESIDSYSRNRYSYVSFNASPEQLL 2726
            QC ++ N  R DC PE   +++ C ARGCC+S      N  Q      P+C++P  Y +Y + +L ++ RG  A L R   +++P+++  L LEV++ET+SR    I DP +KRYEVP+  +P      +   ++V    D  F + I+RKS    L  +  PL+++DQFLQIS+ + +  +YG+GE        LS  W R+  W RD       NLYG+HPFY+ M + G++ GVF  NSN  +  LQ APA+T+RT GGILDF++F G  P+  ++QY +++G P +PPYWSLGFHL +WGY       ++ +   +A  P+  QW+DIDYM+  +DFT D+ +F      V+E  Q+   +++ I+DP IS + +   YPPY +G+   +FI D +  +P+VGKVWPG TV+PDFT P    +WY  ++ F++ VP DG+WIDMNEPSNF  GS  GC  N++ +NP +VP +   SL S TIC+S+  + +  HYNLHNLYG +E+V T+ AL+K +  KRPFI+SRSTF+  G Y  HWTGD  +SW+Q+  S+    +L FNMFG+PM GADICGF GN+ EELC+RW QLGAFYPFMRNHN  +   Q+P  +++EAQK +K+A+  RY +LP  YTL  K+H +G TV R +  EF +D  T +I+ Q++ G +++ TPV+  G  +V+AYFP G WY   SG  + S  +G WL L APLDKIN+ +RGG+I+P      N++ +  NK+ L   +  D  A GDL+WDDG S+ ++ R  Y++V F A+   L+
Sbjct:   68 QCSVSPN-RRFDCVPEKCVSKEECEARGCCYSPAGDKGNIGQ------PWCFFPPSYPSYKMFNLTQTDRGYNATLKRSVGTFMPHDIMTLQLEVLFETESRLHFTIKDPAKKRYEVPIP-TPQVSGKASSTLFDVQFSCD-PFGLIIRRKSS--GLNTTVAPLIFADQFLQISTSLPSGYLYGLGEHLTAL--NLSLQWNRLTFWNRDLRPSKDSNLYGSHPFYLSMEEGGQSHGVFLLNSNAMDVLLQEAPALTWRTTGGILDFYVFLGPEPKSVIRQYQDIIGYPFMPPYWSLGFHLCRWGYSTSNCTRQVVKNMRDAKIPLDVQWNDIDYMDAMRDFTYDQNRFGDFPEMVKEFHQQ-GVKYIMILDPAISSSNTPGSYPPYDDGLKRGVFITDDE-GKPLVGKVWPGLTVFPDFTMPETFSWWYDMVKLFHDQVPFDGIWIDMNEPSNFVQGSVDGCP-NNELENPPYVPGVVGGSLRSTTICASSQQHLS-SHYNLHNLYGLSEAVATHYALVKILK-KRPFIISRSTFASHGHYAGHWTGDVVSSWEQIYYSVPGMSILLFNMFGVPMVGADICGFGGNTTEELCVRWSQLGAFYPFMRNHNDHDSVSQEPYVFSSEAQKAIKSALLIRYTLLPYLYTLFHKAHSSGETVARALFIEFPTDPNTWTIDRQYLWGEALLITPVLEQGKTTVNAYFPTGTWYAPESGTGIQS--KGQWLMLPAPLDKINVHIRGGYILPAQVPGMNTEESRKNKLLLVVALTPDGVARGDLFWDDGVSLGTFERQDYTHVVFLAANVNLM 852          
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Xenopus
Match: GAA (glucosidase, alpha; acid [Source:NCBI gene;Acc:100495955])

HSP 1 Score: 700.664 bits (1807), Expect = 0.000e+0
Identity = 354/809 (43.76%), Postives = 508/809 (62.79%), Query Frame = 3
Query:  321 QCQIANNNERLDCYPESGANQDSCIARGCCWSEPMRLSNKLQGVPLSIPYCYYPTDYSNYMIKSLRKSSRGIKAKLVRESPSYLPYEVAMLDLEVIYETKSRTRVRITDPKQKRYEVPMKLSPPDLKPPTDREYEVIIPSDGSFSIEIKRKSDDRSLFKSFGPLLYSDQFLQISSIMSTDQIYGIGEQNRPFLHQLSNGWERIGLWARDNPIETFMNLYGAHPFYIGMPDDGKAFGVFHFNSNGQEFALQPAPAVTYRTIGGILDFFIFTGGSPEETVKQYLELVGKPMLPPYWSLGFHLSKWGYKNIEQLSEIFQRNINAGFPIGTQWSDIDYMENYKDFTVDKEKFNGLGRFVREIKQKYNSRFVAIVDPGISCT-SGNEYPPYYEGVFMDIFIKDSQTNQPIVGKVWPGETVYPDFTHPNISMYWYKQIQRFYNDVPIDGLWIDMNEPSNFYDGSKRGCQGNSKYDNPFFVPDIRDQSLISKTICSSALHYNNEKHYNLHNLYGYTESVTTNKALLKTIHGKRPFILSRSTFSGSGKYTFHWTGDNQASWDQLRNSIRQVLNFNMFGIPMTGADICGFNGNSDEELCIRWMQLGAFYPFMRNHNAINQRDQDPASWNTEAQKIMKTAISNRYAMLPLFYTLLVKSHMNGGTVMRPMSFEFFSDKVTHSIELQFMIGSSIMATPVVYPGARSVDAYFPAGVWYDFHS------GKLLHSDAEGAWLTLDAPLDKINIALRGGHIVPLLDSNRNSKSNIPNKMTLYCGMAQDMSASGDLYWDDGESIDSYSRNRYSYVSFNASPEQLL 2726
            QC ++ N  R DC PE   +++ C ARGCC+S      N  Q      P+C++P  Y +Y + +L ++ RG  A L R   +++P+++  L LEV++ET+SR    I DP +KRYEVP+  +P      +   ++V    D  F + I+RKS    L  +  PL+++DQFLQIS+ + +  +YG+GE        LS  W R+  W RD       NLYG+HPFY+ M + G++ GVF  NSN  +  LQ APA+T+RT GGILDF++F G  P+  ++QY +++G P +PPYWSLGFHL +WGY       ++ +   +A  P+  QW+DIDYM+  +DFT D+ +F      V+E  Q+   +++ I+DP IS + +   YPPY +G+   +FI D +  +P+VGKVWPG TV+PDFT P    +WY  ++ F++ VP DG+WIDMNEPSNF  GS  GC  N++ +NP +VP +   SL S TIC+S+  + +  HYNLHNLYG +E+V T+ AL+K +  KRPFI+SRSTF+  G Y  HWTGD  +SW+Q+  S+  +L FNMFG+PM GADICGF GN+ EELC+RW QLGAFYPFMRNHN  +   Q+P  +++EAQK +K+A+  RY +LP  YTL  K+H +G TV R +  EF +D  T +I+ Q++ G +++ TPV+  G  +V+AYFP G WY   S       K      +G WL L APLDKIN+ +RGG+I+P      N++ +  NK+ L   +  D  A GDL+WDDG S+ ++ R  Y++V F A+   LL
Sbjct:   43 QCSVSPN-RRFDCVPEKCVSKEECEARGCCYSPAGDKGNIGQ------PWCFFPPSYPSYKMFNLTQTDRGYNATLKRSVGTFMPHDIMTLQLEVLFETESRLHFTIKDPAKKRYEVPIP-TPQVSGKASSTLFDVQFSCD-PFGLIIRRKSS--GLNTTVAPLIFADQFLQISTSLPSGYLYGLGEHLTAL--NLSLQWNRLTFWNRDLRPSVNSNLYGSHPFYLSMEEGGQSHGVFLLNSNAMDVLLQEAPALTWRTTGGILDFYVFLGPEPKSVIRQYQDIIGYPFMPPYWSLGFHLCRWGYSTSNCTRQVVKNMRDAKIPLDVQWNDIDYMDAMRDFTYDQNRFGDFPEMVKEFHQQ-GVKYIMILDPAISSSNTPGSYPPYDDGLKRGVFITDDE-GKPLVGKVWPGLTVFPDFTMPETFSWWYDMVKLFHDQVPFDGIWIDMNEPSNFVQGSVDGCP-NNELENPPYVPGVVGGSLRSTTICASSQQHLSS-HYNLHNLYGLSEAVATHYALVKILK-KRPFIISRSTFASHGHYAGHWTGDVVSSWEQIYYSVPAILLFNMFGVPMVGADICGFGGNTTEELCVRWSQLGAFYPFMRNHNDHDSVSQEPYVFSSEAQKAIKSALLIRYTLLPYLYTLFHKAHSSGETVARALFIEFPTDPNTWTIDRQYLWGEALLITPVLEQGKTTVNAYFPTGTWYAPESVSTPNPPKKSEKKHKGQWLMLPAPLDKINVHIRGGYILPAQVPGMNTEESRKNKLLLVVALTPDGVARGDLFWDDGVSLGTFERQDYTHVVFLAANNILL 833          
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Xenopus
Match: GAA (glucosidase, alpha; acid [Source:NCBI gene;Acc:100495955])

HSP 1 Score: 699.508 bits (1804), Expect = 0.000e+0
Identity = 352/805 (43.73%), Postives = 510/805 (63.35%), Query Frame = 3
Query:  321 QCQIANNNERLDCYPESGANQDSCIARGCCWSEPMRLSNKLQGVPLSIPYCYYPTDYSNYMIKSLRKSSRGIKAKLVRESPSYLPYEVAMLDLEVIYETKSRTRVRITDPKQKRYEVPMKLSPPDLKPPTDREYEVIIPSDGSFSIEIKRKSDDRSLFKSFGPLLYSDQFLQISSIMSTDQIYGIGEQNRPFLHQLSNGWERIGLWARDNPIETFMNLYGAHPFYIGMPDDGKAFGVFHFNSNGQEFALQPAPAVTYRTIGGILDFFIFTGGSPEETVKQYLELVGKPMLPPYWSLGFHLSKWGYKNIEQLSEIFQRNINAGFPIGTQWSDIDYMENYKDFTVDKEKFNGLGRFVREIKQKYNSRFVAIVDPGISCT-SGNEYPPYYEGVFMDIFIKDSQTNQPIVGKVWPGETVYPDFTHPNISMYWYKQIQRFYNDVPIDGLWIDMNEPSNFYDGSKRGCQGNSKYDNPFFVPDIRDQSLISKTICSSALHYNNEKHYNLHNLYGYTESVTTNKALLKTIHGKRPFILSRSTFSGSGKYTFHWTGDNQASWDQLRNSI--RQVLNFNMFGIPMTGADICGFNGNSDEELCIRWMQLGAFYPFMRNHNAINQRDQDPASWNTEAQKIMKTAISNRYAMLPLFYTLLVKSHMNGGTVMRPMSFEFFSDKVTHSIELQFMIGSSIMATPVVYPGARSVDAYFPAGVWYDFHSGKLLHSDAEGAWLTLDAPLDKINIALRGGHIVPLLDSNRNSKSNIPNKMTLYCGMAQDMSASGDLYWDDGESIDSYSRNRYSYVSFNASPEQLL 2726
            QC ++ N  R DC PE   +++ C ARGCC+S      N  Q      P+C++P  Y +Y + +L ++ RG  A L R   +++P+++  L LEV++ET+SR    I DP +KRYEVP+  +P      +   ++V    D  F + I+RKS    L  +  PL+++DQFLQIS+ + +  +YG+GE        LS  W R+  W RD       NLYG+HPFY+ M + G++ GVF  NSN  +  LQ APA+T+RT GGILDF++F G  P+  ++QY +++G P +PPYWSLGFHL +WGY       ++ +   +A  P+  QW+DIDYM+  +DFT D+ +F      V+E  Q+   +++ I+DP IS + +   YPPY +G+   +FI D +  +P+VGKVWPG TV+PDFT P    +WY  ++ F++ VP DG+WIDMNEPSNF  GS  GC  N++ +NP +VP +   SL S TIC+S+  + +  HYNLHNLYG +E+V T+ AL+K +  KRPFI+SRSTF+  G Y  HWTGD  +SW+Q+  S+    +L FNMFG+PM GADICGF GN+ EELC+RW QLGAFYPFMRNHN  +   Q+P  +++EAQK +K+A+  RY +LP  YTL  K+H +G TV R +  EF +D  T +I+ Q++ G +++ TPV+  G  +V+AYFP G WY   S ++    ++G WL L APLDKIN+ +RGG+I+P      N++ +  NK+ L   +  D  A GDL+WDDG S+ ++ R  Y++V F A+   L+
Sbjct:   46 QCSVSPN-RRFDCVPEKCVSKEECEARGCCYSPAGDKGNIGQ------PWCFFPPSYPSYKMFNLTQTDRGYNATLKRSVGTFMPHDIMTLQLEVLFETESRLHFTIKDPAKKRYEVPIP-TPQVSGKASSTLFDVQFSCD-PFGLIIRRKSS--GLNTTVAPLIFADQFLQISTSLPSGYLYGLGEHLTAL--NLSLQWNRLTFWNRDLRPSKDSNLYGSHPFYLSMEEGGQSHGVFLLNSNAMDVLLQEAPALTWRTTGGILDFYVFLGPEPKSVIRQYQDIIGYPFMPPYWSLGFHLCRWGYSTSNCTRQVVKNMRDAKIPLDVQWNDIDYMDAMRDFTYDQNRFGDFPEMVKEFHQQ-GVKYIMILDPAISSSNTPGSYPPYDDGLKRGVFITDDE-GKPLVGKVWPGLTVFPDFTMPETFSWWYDMVKLFHDQVPFDGIWIDMNEPSNFVQGSVDGCP-NNELENPPYVPGVVGGSLRSTTICASSQQHLS-SHYNLHNLYGLSEAVATHYALVKILK-KRPFIISRSTFASHGHYAGHWTGDVVSSWEQIYYSVPGMSILLFNMFGVPMVGADICGFGGNTTEELCVRWSQLGAFYPFMRNHNDHDSVSQEPYVFSSEAQKAIKSALLIRYTLLPYLYTLFHKAHSSGETVARALFIEFPTDPNTWTIDRQYLWGEALLITPVLEQGKTTVNAYFPTGTWYAPESVRI---QSKGQWLMLPAPLDKINVHIRGGYILPAQVPGMNTEESRKNKLLLVVALTPDGVARGDLFWDDGVSLGTFERQDYTHVVFLAANVNLM 829          
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Xenopus
Match: GAA (glucosidase, alpha; acid [Source:NCBI gene;Acc:100495955])

HSP 1 Score: 697.967 bits (1800), Expect = 0.000e+0
Identity = 354/811 (43.65%), Postives = 511/811 (63.01%), Query Frame = 3
Query:  321 QCQIANNNERLDCYPESGANQDSCIARGCCWSEPMRLSNKLQGVPLSIPYCYYPTDYSNYMIKSLRKSSRGIKAKLVRESPSYLPYEVAMLDLEVIYETKSRTRVRITDPKQKRYEVPMKLSPPDLKPPTDREYEVIIPSDGSFSIEIKRKSDDRSLFKSFGPLLYSDQFLQISSIMSTDQIYGIGEQNRPFLHQLSNGWERIGLWARDNPIETFMNLYGAHPFYIGMPDDGKAFGVFHFNSNGQEFALQPAPAVTYRTIGGILDFFIFTGGSPEETVKQYLELVGKPMLPPYWSLGFHLSKWGYKNIEQLSEIFQRNINAGFPIGTQWSDIDYMENYKDFTVDKEKFNGLGRFVREIKQKYNSRFVAIVDPGISCT-SGNEYPPYYEGVFMDIFIKDSQTNQPIVGKVWPGETVYPDFTHPNISMYWYKQIQRFYNDVPIDGLWIDMNEPSNFYDGSKRGCQGNSKYDNPFFVPDIRDQSLISKTICSSALHYNNEKHYNLHNLYGYTESVTTNKALLKTIHGKRPFILSRSTFSGSGKYTFHWTGDNQASWDQLRNSIRQVLNFNMFGIPMTGADICGFNGNSDEELCIRWMQLGAFYPFMRNHNAINQRDQDPASWNTEAQKIMKTAISNRYAMLPLFYTLLVKSHMNGGTVMRPMSFEFFSDKVTHSIELQFMIGSSIMATPVVYPGARSVDAYFPAGVWYDFHS------GKLLHS--DAEGAWLTLDAPLDKINIALRGGHIVPLLDSNRNSKSNIPNKMTLYCGMAQDMSASGDLYWDDGESIDSYSRNRYSYVSFNASPEQLL 2726
            QC ++ N  R DC PE   +++ C ARGCC+S      N  Q      P+C++P  Y +Y + +L ++ RG  A L R   +++P+++  L LEV++ET+SR    I DP +KRYEVP+  +P      +   ++V    D  F + I+RKS    L  +  PL+++DQFLQIS+ + +  +YG+GE        LS  W R+  W RD       NLYG+HPFY+ M + G++ GVF  NSN  +  LQ APA+T+RT GGILDF++F G  P+  ++QY +++G P +PPYWSLGFHL +WGY       ++ +   +A  P+  QW+DIDYM+  +DFT D+ +F      V+E  Q+   +++ I+DP IS + +   YPPY +G+   +FI D +  +P+VGKVWPG TV+PDFT P    +WY  ++ F++ VP DG+WIDMNEPSNF  GS  GC  N++ +NP +VP +   SL S TIC+S+  + +  HYNLHNLYG +E+V T+ AL+K +  KRPFI+SRSTF+  G Y  HWTGD  +SW+Q+  S+  +L FNMFG+PM GADICGF GN+ EELC+RW QLGAFYPFMRNHN  +   Q+P  +++EAQK +K+A+  RY +LP  YTL  K+H +G TV R +  EF +D  T +I+ Q++ G +++ TPV+  G  +V+AYFP G WY   S      G +  +   ++G WL L APLDKIN+ +RGG+I+P      N++ +  NK+ L   +  D  A GDL+WDDG S+ ++ R  Y++V F A+   LL
Sbjct:   33 QCSVSPN-RRFDCVPEKCVSKEECEARGCCYSPAGDKGNIGQ------PWCFFPPSYPSYKMFNLTQTDRGYNATLKRSVGTFMPHDIMTLQLEVLFETESRLHFTIKDPAKKRYEVPIP-TPQVSGKASSTLFDVQFSCD-PFGLIIRRKSS--GLNTTVAPLIFADQFLQISTSLPSGYLYGLGEHLTAL--NLSLQWNRLTFWNRDLRPSVNSNLYGSHPFYLSMEEGGQSHGVFLLNSNAMDVLLQEAPALTWRTTGGILDFYVFLGPEPKSVIRQYQDIIGYPFMPPYWSLGFHLCRWGYSTSNCTRQVVKNMRDAKIPLDVQWNDIDYMDAMRDFTYDQNRFGDFPEMVKEFHQQ-GVKYIMILDPAISSSNTPGSYPPYDDGLKRGVFITDDE-GKPLVGKVWPGLTVFPDFTMPETFSWWYDMVKLFHDQVPFDGIWIDMNEPSNFVQGSVDGCP-NNELENPPYVPGVVGGSLRSTTICASSQQHLSS-HYNLHNLYGLSEAVATHYALVKILK-KRPFIISRSTFASHGHYAGHWTGDVVSSWEQIYYSVPAILLFNMFGVPMVGADICGFGGNTTEELCVRWSQLGAFYPFMRNHNDHDSVSQEPYVFSSEAQKAIKSALLIRYTLLPYLYTLFHKAHSSGETVARALFIEFPTDPNTWTIDRQYLWGEALLITPVLEQGKTTVNAYFPTGTWYAPESVPFWIMGSIPGTGIQSKGQWLMLPAPLDKINVHIRGGYILPAQVPGMNTEESRKNKLLLVVALTPDGVARGDLFWDDGVSLGTFERQDYTHVVFLAANNILL 825          
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Mouse
Match: Gaa (glucosidase, alpha, acid [Source:MGI Symbol;Acc:MGI:95609])

HSP 1 Score: 716.457 bits (1848), Expect = 0.000e+0
Identity = 364/873 (41.70%), Postives = 524/873 (60.02%), Query Frame = 3
Query:  312 ATAQCQIANNNERLDCYPESGANQDSCIARGCCWSEPMRLSNKLQGVPLSIPYCYYPTDYSNYMIKSLRKSSRGIKAKLVRESPSYLPYEVAMLDLEVIYETKSRTRVRITDPKQKRYEVPMKLSPPDLKPPTDREYEVIIPSDGSFSIEIKRKSDDRSLF-KSFGPLLYSDQFLQISSIMSTDQIYGIGEQNRPFLHQLSNGWERIGLWARDNPIETFMNLYGAHPFYIGMPDDGKAFGVFHFNSNGQEFALQPAPAVTYRTIGGILDFFIFTGGSPEETVKQYLELVGKPMLPPYWSLGFHLSKWGYKNIEQLSEIFQRNINAGFPIGTQWSDIDYMENYKDFTVDKEKFNGLGRFVREIKQKYNSRFVAIVDPGISCTS-GNEYPPYYEGVFMDIFIKDSQTNQPIVGKVWPGETVYPDFTHPNISMYWYKQIQRFYNDVPIDGLWIDMNEPSNFYDGSKRGCQGNSKYDNPFFVPDIRDQSLISKTICSSALHYNNEKHYNLHNLYGYTESVTTNKALLKTIHGKRPFILSRSTFSGSGKYTFHWTGDNQASWDQLRNSIRQVLNFNMFGIPMTGADICGFNGNSDEELCIRWMQLGAFYPFMRNHNAINQRDQDPASWNTEAQKIMKTAISNRYAMLPLFYTLLVKSHMNGGTVMRPMSFEFFSDKVTHSIELQFMIGSSIMATPVVYPGARSVDAYFPAGVWYDFHS------GKLLHS----------DAEGAWLTLDAPLDKINIALRGGHIVPLLDSNRNSKSNIPNKMTLYCGMAQDMSASGDLYWDDGESIDSYSRNRYSYVSFNASPEQL---LITPVYFGYDLLPVLNKIVILGFENKSITKFLLNDNDIP---FHYNPE 2858
            A  QC +  ++ R DC P+ G +Q+ C ARGCC+    ++  + Q   +  P+C++P  Y +Y +++L  +  G  A L R SP++ P +V  L LEV+ ET SR   +I DP  KRYEVP++ +P  L       Y V   S+  F + ++RK   R L   +  PL ++DQFLQ+S+ + +  I G+GE   P +  LS  W RI LW RD P     NLYG+HPFY+ + D G A GVF  NSN  +  LQP+PA+T+R+ GGILD ++F G  P+  V+QYL++VG P +PPYW LGFHL +WGY +   + ++ +      FP+  QW+D+DYM+  +DFT +++ F      VRE+ Q    R++ IVDP IS       Y PY EG+   +FI + +T QP++GKVWPG T +PDFT+P    +W   +  F+  VP DG+W+DMNEPSNF  GS++GC  N++ +NP +VP +    L + TIC+S+ H     HYNLHNLYG TE++ +++AL+KT  G RPF++SRSTFSG G+Y  HWTGD ++SW+ L  S+  +L FN+ G+P+ GADICGF G++ EELC+RW QLGAFYPFMRNHN +N   Q+P  ++  AQ+ M+ A + RYA+LP  YTL  ++H+ G TV RP+  EF  D  T S++ Q + G +++ TPV+ PG   V  YFP G WY+         G L              ++G WLTL+APLD IN+ LR G+I+PL   +  +  +    M L   +     A G+L+WDDGES+    R  Y+ V+F+A    +   L+     G +L   L ++ +LG      T+ L   N IP   F Y+P+
Sbjct:   78 APTQCDVPPSS-RFDCAPDKGISQEQCEARGCCYVPAGQVLKEPQ---IGQPWCFFPPSYPSYRLENLSSTESGYTATLTRTSPTFFPKDVLTLQLEVLMETDSRLHFKIKDPASKRYEVPLE-TPRVLSQAPSPLYSVEF-SEEPFGVIVRRKLGGRVLLNTTVAPLFFADQFLQLSTSLPSQHITGLGEHLSPLM--LSTDWARITLWNRDTPPSQGTNLYGSHPFYLALEDGGLAHGVFLLNSNAMDVILQPSPALTWRSTGGILDVYVFLGPEPKSVVQQYLDVVGYPFMPPYWGLGFHLCRWGYSSTAIVRQVVENMTRTHFPLDVQWNDLDYMDARRDFTFNQDSFADFPDMVRELHQD-GRRYMMIVDPAISSAGPAGSYRPYDEGLRRGVFITN-ETGQPLIGKVWPGTTAFPDFTNPETLDWWQDMVSEFHAQVPFDGMWLDMNEPSNFVRGSQQGCP-NNELENPPYVPGVVGGILQAATICASS-HQFLSTHYNLHNLYGLTEAIASSRALVKT-RGTRPFVISRSTFSGHGRYAGHWTGDVRSSWEHLAYSVPDILQFNLLGVPLVGADICGFIGDTSEELCVRWTQLGAFYPFMRNHNDLNSVPQEPYRFSETAQQAMRKAFALRYALLPYLYTLFHRAHVRGDTVARPLFLEFPEDPSTWSVDRQLLWGPALLITPVLEPGKTEVTGYFPKGTWYNMQMVSVDSLGTLPSPSSASSFRSAVQSKGQWLTLEAPLDTINVHLREGYIIPLQGPSLTTTESRKQPMALAVALTASGEADGELFWDDGESLAVLERGAYTLVTFSAKNNTIVNKLVRVTKEGAEL--QLREVTVLGVATAP-TQVL--SNGIPVSNFTYSPD 932          
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Mouse
Match: Gaa (glucosidase, alpha, acid [Source:MGI Symbol;Acc:MGI:95609])

HSP 1 Score: 716.457 bits (1848), Expect = 0.000e+0
Identity = 364/873 (41.70%), Postives = 524/873 (60.02%), Query Frame = 3
Query:  312 ATAQCQIANNNERLDCYPESGANQDSCIARGCCWSEPMRLSNKLQGVPLSIPYCYYPTDYSNYMIKSLRKSSRGIKAKLVRESPSYLPYEVAMLDLEVIYETKSRTRVRITDPKQKRYEVPMKLSPPDLKPPTDREYEVIIPSDGSFSIEIKRKSDDRSLF-KSFGPLLYSDQFLQISSIMSTDQIYGIGEQNRPFLHQLSNGWERIGLWARDNPIETFMNLYGAHPFYIGMPDDGKAFGVFHFNSNGQEFALQPAPAVTYRTIGGILDFFIFTGGSPEETVKQYLELVGKPMLPPYWSLGFHLSKWGYKNIEQLSEIFQRNINAGFPIGTQWSDIDYMENYKDFTVDKEKFNGLGRFVREIKQKYNSRFVAIVDPGISCTS-GNEYPPYYEGVFMDIFIKDSQTNQPIVGKVWPGETVYPDFTHPNISMYWYKQIQRFYNDVPIDGLWIDMNEPSNFYDGSKRGCQGNSKYDNPFFVPDIRDQSLISKTICSSALHYNNEKHYNLHNLYGYTESVTTNKALLKTIHGKRPFILSRSTFSGSGKYTFHWTGDNQASWDQLRNSIRQVLNFNMFGIPMTGADICGFNGNSDEELCIRWMQLGAFYPFMRNHNAINQRDQDPASWNTEAQKIMKTAISNRYAMLPLFYTLLVKSHMNGGTVMRPMSFEFFSDKVTHSIELQFMIGSSIMATPVVYPGARSVDAYFPAGVWYDFHS------GKLLHS----------DAEGAWLTLDAPLDKINIALRGGHIVPLLDSNRNSKSNIPNKMTLYCGMAQDMSASGDLYWDDGESIDSYSRNRYSYVSFNASPEQL---LITPVYFGYDLLPVLNKIVILGFENKSITKFLLNDNDIP---FHYNPE 2858
            A  QC +  ++ R DC P+ G +Q+ C ARGCC+    ++  + Q   +  P+C++P  Y +Y +++L  +  G  A L R SP++ P +V  L LEV+ ET SR   +I DP  KRYEVP++ +P  L       Y V   S+  F + ++RK   R L   +  PL ++DQFLQ+S+ + +  I G+GE   P +  LS  W RI LW RD P     NLYG+HPFY+ + D G A GVF  NSN  +  LQP+PA+T+R+ GGILD ++F G  P+  V+QYL++VG P +PPYW LGFHL +WGY +   + ++ +      FP+  QW+D+DYM+  +DFT +++ F      VRE+ Q    R++ IVDP IS       Y PY EG+   +FI + +T QP++GKVWPG T +PDFT+P    +W   +  F+  VP DG+W+DMNEPSNF  GS++GC  N++ +NP +VP +    L + TIC+S+ H     HYNLHNLYG TE++ +++AL+KT  G RPF++SRSTFSG G+Y  HWTGD ++SW+ L  S+  +L FN+ G+P+ GADICGF G++ EELC+RW QLGAFYPFMRNHN +N   Q+P  ++  AQ+ M+ A + RYA+LP  YTL  ++H+ G TV RP+  EF  D  T S++ Q + G +++ TPV+ PG   V  YFP G WY+         G L              ++G WLTL+APLD IN+ LR G+I+PL   +  +  +    M L   +     A G+L+WDDGES+    R  Y+ V+F+A    +   L+     G +L   L ++ +LG      T+ L   N IP   F Y+P+
Sbjct:   78 APTQCDVPPSS-RFDCAPDKGISQEQCEARGCCYVPAGQVLKEPQ---IGQPWCFFPPSYPSYRLENLSSTESGYTATLTRTSPTFFPKDVLTLQLEVLMETDSRLHFKIKDPASKRYEVPLE-TPRVLSQAPSPLYSVEF-SEEPFGVIVRRKLGGRVLLNTTVAPLFFADQFLQLSTSLPSQHITGLGEHLSPLM--LSTDWARITLWNRDTPPSQGTNLYGSHPFYLALEDGGLAHGVFLLNSNAMDVILQPSPALTWRSTGGILDVYVFLGPEPKSVVQQYLDVVGYPFMPPYWGLGFHLCRWGYSSTAIVRQVVENMTRTHFPLDVQWNDLDYMDARRDFTFNQDSFADFPDMVRELHQD-GRRYMMIVDPAISSAGPAGSYRPYDEGLRRGVFITN-ETGQPLIGKVWPGTTAFPDFTNPETLDWWQDMVSEFHAQVPFDGMWLDMNEPSNFVRGSQQGCP-NNELENPPYVPGVVGGILQAATICASS-HQFLSTHYNLHNLYGLTEAIASSRALVKT-RGTRPFVISRSTFSGHGRYAGHWTGDVRSSWEHLAYSVPDILQFNLLGVPLVGADICGFIGDTSEELCVRWTQLGAFYPFMRNHNDLNSVPQEPYRFSETAQQAMRKAFALRYALLPYLYTLFHRAHVRGDTVARPLFLEFPEDPSTWSVDRQLLWGPALLITPVLEPGKTEVTGYFPKGTWYNMQMVSVDSLGTLPSPSSASSFRSAVQSKGQWLTLEAPLDTINVHLREGYIIPLQGPSLTTTESRKQPMALAVALTASGEADGELFWDDGESLAVLERGAYTLVTFSAKNNTIVNKLVRVTKEGAEL--QLREVTVLGVATAP-TQVL--SNGIPVSNFTYSPD 932          
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Mouse
Match: Mgam (maltase-glucoamylase [Source:MGI Symbol;Acc:MGI:1203495])

HSP 1 Score: 643.269 bits (1658), Expect = 0.000e+0
Identity = 341/814 (41.89%), Postives = 495/814 (60.81%), Query Frame = 3
Query:  324 CQIANNNERLDCYPESGANQDSCIARGCCWSEPMRLSNKLQGVPLSIPYCYYPTDYSNYMIKSLRKSSRGIKAKLVRESPSYLPY--EVAMLDLEVIYETKSRTRVRITDPKQKRYEVPMK-LSPPDLKPPTDREYEVIIPSDGSFSIEIKRKSDDRSLF-KSFGPLLYSDQFLQISSIMSTDQIYGIGEQ-NRPFLHQLSNGWERIGLWARDN-PIETFMNLYGAHPFYIGMPDD-GKAFGVFHFNSNGQEFALQPAPAVTYRTIGGILDFFIFTGGSPEETVKQYLELVGKPMLPPYWSLGFHLSKWGYKNIEQLSEIFQRNINAGFPIGTQWSDIDYMENYKDFTVDKEKFNGLGRFVREIKQKYNSRFVAIVDPGISCTS--GNEYPPYYEGVFMDIFIKDSQTNQPIVGKVWPGETVYPDFTHPNISMYWYKQIQRFYNDVPIDGLWIDMNEPSNFYDGSKRGCQGNSKYDNPFFVPDIRDQSLISKTICSSALHYNNEKHYNLHNLYGYTESVTTNKALLKTIHGKRPFILSRSTFSGSGKYTFHWTGDNQASWDQLRNSIRQVLNFNMFGIPMTGADICGFNGNSDEELCIRWMQLGAFYPFMRNHNAINQRDQDPASW--NTEAQKIMKTAISNRYAMLPLFYTLLVKSHMNGGTVMRPMSFEFFSDKVTHSIELQFMIGSSIMATPVVYPGARSVDAYFPAGVWYDFHSGKLLHSDAEGAWLTLDAPLDKINIALRGGHIVPLLDSNRNSKSNIPNKMTLYCGMAQDMSASGDLYWDDGESIDSYSRNRYSYVSFNASPEQLLIT 2732
            C + +  ER++C P+  +N+ +C  RGCCW          QG  +S+P CYY  ++   M   +  ++ G  A L +  PS   +   +  + L   Y+T +R   ++TD  +KRYEVP + + P     P+   Y+V + S   FSI++ RKS++R LF  S GPLL+SDQFLQ S+ + +  +YG+GE  ++ + H ++  W+   +++RD  P E   NLYG   F++ + D+ G +FGVF  NSN  E  LQP PA+TYRT GGILDF++F G +PE+ V++YLEL+G+P LP YW+LGF LS++ YK+++ +  + +RN  A  P   Q +DIDYM+  KDFT D   F G   FV+E+      + V I+DP IS  S   N Y PY  G  M I++  S    P++GKVWPG TV+PD+T PN +++W K+ + F+ +V  DG+WIDMNE SNF DGS  GC  N+  + P F P + D  L SKT+C  A+ +   K Y++HNLYGY+ ++ T KA+      KR FI++RSTF+GSGK+  HW GDN A+W  L+ SI  +L FN+FGIPM GADICGF  ++ EELC RWMQLGAFYPF RNHN    +DQDPAS+  N+      +  ++ RY +LP  YTL  ++H  G TV RP+  EF+ D  T  I+ QF+ G  ++ TPV+  GA  V AY P   WYD+ +G+ L    +   + +  P DKI + LRGG+I P       ++++  N + L   + ++  A G+L+WDDGES D+ ++N Y +  F+ +   L +T
Sbjct:   65 CPVLSELERINCIPDQSSNKGTCDERGCCWDP--------QG-SISVP-CYYSRNHGYKMESDVVNTNAGFTATL-KNLPSAPVFGNSIENILLTAEYQTSNRFHFKLTDQTKKRYEVPHEHVQPFSGNAPSSLNYKVEV-SKEPFSIKVTRKSNNRVLFDSSIGPLLFSDQFLQFSTHLPSANVYGLGEHVHQQYRHNMN--WKTWPMFSRDTTPNEDGTNLYGVQTFFLCLEDNSGLSFGVFLMNSNAMEVTLQPTPAITYRTTGGILDFYVFLGNTPEQVVQEYLELIGRPALPSYWTLGFQLSRYDYKSLDNMKAVVERNRAAQLPYDVQHADIDYMDQKKDFTYDPVNFKGFPEFVKELHNN-GQKLVIILDPAISNNSFSSNPYGPYDRGSAMKIWVNSSDGISPVIGKVWPGTTVFPDYTSPNCAVWWTKEFELFHKEVEFDGIWIDMNEVSNFIDGSFSGCSQNN-LNYPPFTPKVLDGYLFSKTLCMDAVQHWG-KQYDVHNLYGYSMAIATAKAVKDVFPDKRSFIITRSTFAGSGKFAAHWLGDNTATWKDLQWSIPGMLEFNLFGIPMVGADICGFAQDTYEELCRRWMQLGAFYPFSRNHNGQGYKDQDPASFGNNSLLLNSSRHYLNIRYTLLPYLYTLFYRAHSRGDTVARPLLHEFYDDNNTWGIDRQFLWGPGLLITPVLDQGAEKVKAYVPNATWYDYETGEELGWRKQS--IEMQLPGDKIGLHLRGGYIFPTQQPATTTEASRKNPLGLIVALDENKEARGELFWDDGESKDTVAQNIYLFSEFSVTQNHLDVT 859          

HSP 2 Score: 587.8 bits (1514), Expect = 0.000e+0
Identity = 327/896 (36.50%), Postives = 503/896 (56.14%), Query Frame = 3
Query:  345 ERLDCYP-ESGANQDSCIARGCCWSEPMRLSNKLQGVPLSIPYCYYPTDYSNYMIKSLRKSSRGIKAKLVRESPSY---LPYE-VAMLDLEVIYETKSRTRVRITDPKQKRYEVPMKLSPPD--LKPPTDREYEVIIPSDGSFSIEIKRKSDDRSLFKS-FGPLLYSDQFLQISSIMSTDQIYGIGEQNRPFLHQLSNGWERIGLWARDNPIETFMNLYGAHPFYIGMPDDGKAFGVFHFNSNGQEFALQPAPAVTYRTIGGILDFFIFTGGSPEETVKQYLELVGKPMLPPYWSLGFHLSKWGYKNIEQLSEIFQRNINAGFPIGTQWSDIDYMENYKDFTVDKEKFNGLGRFVREIKQKYNSRFVAIVDPGISCTSGNEYPPYYEGVFMDIFIKDSQTNQPIVGKVWP---------------------GETVYPDFTHPNISMYWYKQIQRFYND-------VPIDGLWIDMNEPSNFYDGSKRGCQGNSKYDNPFFVP--DIRDQSLISKTICSSALHY----NNEKHYNLHNLYGYTESVTTNKALLKTIHGKRPFILSRSTFSGSGKYTFHWTGDNQASWDQLRNSIRQVLNFNMFGIPMTGADICGFNGNSDEELCIRWMQLGAFYPFMRNHNAINQRDQDPASWNTEAQKIMKTAISNRYAMLPLFYTLLVKSHMNGGTVMRPMSFEFFSDKVTHSIELQFMIGSSIMATPVVYPGARSVDAYFPAGVWYDFHSGKLLHSDAEGAWLTLDAPLDKINIALRGGHIVPLLDSNRNSKSNIPNKMTLYCGMAQDMSASGDLYWDDGESIDSYSRNRYSYVSFNASPEQLL-----------ITPVYFGYDLLPVLNKIVILGFENKSITKFLL----NDNDIPFHYNPET 2861
            ER+DCYP E GA++ +C ARGC W      SN  +G P     CY+  +   Y + +++  S G  A +  ++ +Y    P   V  L L+V Y      + +I DP   RYEVP+ L+ P   L  P  R Y+V+I  +  F I+I+RK+    ++ S      ++D F++IS+ + +  IYG GE       ++   W   G+++RD P     N YG HP+Y+G+ +DG A GV   NSN  +   QP PA+TYRTIGGILDF++F G +PE   +QY EL+G+P++ PYWSLGF L ++GY+N  +++ ++   +    P   Q+SDIDYME   DF +   KF+G    +  +K     R + I+DP IS      YP +  GV  D+FI+       + GKVWP                         +PDF   + + +W K+I+  +++       +  DGLWIDMNEPS+F +G+      ++  ++P ++P  + RD+ L SKT+C  +       +  +HY++HNLYG++++  T +A+ + + G+R  +++RSTF  SG++  HW GDN A+WDQL  SI  +++F++FGI  TG+DICGF  +++ E+C+RWMQLGAFYPF RNHN I  R QDP SWN   + I ++ +  RY +LP  YTL+ K+H  G TV+RP+  EF SD+ T +I+ QF++G + + +PV+ P AR V+AYFP   WYD++ G  +  +A G W TL+APL+ IN+ +RGG+I+P  +   N+  +    M L   +  +  A G L+WDDG+ I++   ++Y    F+ +   LL             P+Y GY        I I G  + SIT   +    N+ ++  +YN  T
Sbjct:  936 ERIDCYPDEHGASEANCSARGCIWEA----SNTTRGPP-----CYFAHEL--YSVSNVQYDSHGATADISLKASTYSNAFPSTPVNKLKLQVTYHKNEMLQFKIYDPNHSRYEVPVPLNIPSAPLSTPEGRLYDVLI-KENPFGIQIRRKTTGTVIWDSQLLGFTFNDMFIRISTRLPSTYIYGFGETEHTTF-KIDMNWHTWGMFSRDEPPGYKKNSYGVHPYYMGLEEDGNAHGVLLMNSNAMDVTFQPMPALTYRTIGGILDFYVFLGPTPEIVTQQYTELIGRPVMVPYWSLGFQLCRYGYENDTEIANLYDEMVAKQIPYDVQYSDIDYMERQLDFKLSP-KFSGFPALINRMKAN-GMRVILILDPAISGNETEPYPAFTRGVENDVFIRYPNNGSIVWGKVWPDYPNITVDPSLGWDHQVEQYRAYVAFPDFFRNSTATWWKKEIKELHSNTQDPAKSLKFDGLWIDMNEPSSFVNGAVPSGCSDATLNHPPYMPYLEARDRGLSSKTLCMESEQILPDGSRVRHYDVHNLYGWSQTRPTYEAV-QEVTGERGIVITRSTFPSSGRWGGHWLGDNTAAWDQLGKSIIGMMDFSLFGISYTGSDICGFFQDAEYEMCVRWMQLGAFYPFSRNHNTIGTRRQDPVSWNKTFEDISRSVLETRYTLLPYLYTLMYKAHTEGSTVVRPLLHEFVSDRETWNIDKQFLLGPAFLVSPVLEPNARKVEAYFPRARWYDYYKG--VDINATGEWKTLEAPLEYINLHIRGGYILPWQEPAMNTHLSRQKFMGLRAALNAEGRAEGWLFWDDGKRINT---DQYYLARFSVNQTTLLTHEKFNNYLTGTAPLYLGY--------IDIWGLSSSSITNVSISWNTNNEEVFANYNSTT 1802          
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Mouse
Match: Mgam (maltase-glucoamylase [Source:MGI Symbol;Acc:MGI:1203495])

HSP 1 Score: 643.269 bits (1658), Expect = 0.000e+0
Identity = 341/814 (41.89%), Postives = 495/814 (60.81%), Query Frame = 3
Query:  324 CQIANNNERLDCYPESGANQDSCIARGCCWSEPMRLSNKLQGVPLSIPYCYYPTDYSNYMIKSLRKSSRGIKAKLVRESPSYLPY--EVAMLDLEVIYETKSRTRVRITDPKQKRYEVPMK-LSPPDLKPPTDREYEVIIPSDGSFSIEIKRKSDDRSLF-KSFGPLLYSDQFLQISSIMSTDQIYGIGEQ-NRPFLHQLSNGWERIGLWARDN-PIETFMNLYGAHPFYIGMPDD-GKAFGVFHFNSNGQEFALQPAPAVTYRTIGGILDFFIFTGGSPEETVKQYLELVGKPMLPPYWSLGFHLSKWGYKNIEQLSEIFQRNINAGFPIGTQWSDIDYMENYKDFTVDKEKFNGLGRFVREIKQKYNSRFVAIVDPGISCTS--GNEYPPYYEGVFMDIFIKDSQTNQPIVGKVWPGETVYPDFTHPNISMYWYKQIQRFYNDVPIDGLWIDMNEPSNFYDGSKRGCQGNSKYDNPFFVPDIRDQSLISKTICSSALHYNNEKHYNLHNLYGYTESVTTNKALLKTIHGKRPFILSRSTFSGSGKYTFHWTGDNQASWDQLRNSIRQVLNFNMFGIPMTGADICGFNGNSDEELCIRWMQLGAFYPFMRNHNAINQRDQDPASW--NTEAQKIMKTAISNRYAMLPLFYTLLVKSHMNGGTVMRPMSFEFFSDKVTHSIELQFMIGSSIMATPVVYPGARSVDAYFPAGVWYDFHSGKLLHSDAEGAWLTLDAPLDKINIALRGGHIVPLLDSNRNSKSNIPNKMTLYCGMAQDMSASGDLYWDDGESIDSYSRNRYSYVSFNASPEQLLIT 2732
            C + +  ER++C P+  +N+ +C  RGCCW          QG  +S+P CYY  ++   M   +  ++ G  A L +  PS   +   +  + L   Y+T +R   ++TD  +KRYEVP + + P     P+   Y+V + S   FSI++ RKS++R LF  S GPLL+SDQFLQ S+ + +  +YG+GE  ++ + H ++  W+   +++RD  P E   NLYG   F++ + D+ G +FGVF  NSN  E  LQP PA+TYRT GGILDF++F G +PE+ V++YLEL+G+P LP YW+LGF LS++ YK+++ +  + +RN  A  P   Q +DIDYM+  KDFT D   F G   FV+E+      + V I+DP IS  S   N Y PY  G  M I++  S    P++GKVWPG TV+PD+T PN +++W K+ + F+ +V  DG+WIDMNE SNF DGS  GC  N+  + P F P + D  L SKT+C  A+ +   K Y++HNLYGY+ ++ T KA+      KR FI++RSTF+GSGK+  HW GDN A+W  L+ SI  +L FN+FGIPM GADICGF  ++ EELC RWMQLGAFYPF RNHN    +DQDPAS+  N+      +  ++ RY +LP  YTL  ++H  G TV RP+  EF+ D  T  I+ QF+ G  ++ TPV+  GA  V AY P   WYD+ +G+ L    +   + +  P DKI + LRGG+I P       ++++  N + L   + ++  A G+L+WDDGES D+ ++N Y +  F+ +   L +T
Sbjct:   65 CPVLSELERINCIPDQSSNKGTCDERGCCWDP--------QG-SISVP-CYYSRNHGYKMESDVVNTNAGFTATL-KNLPSAPVFGNSIENILLTAEYQTSNRFHFKLTDQTKKRYEVPHEHVQPFSGNAPSSLNYKVEV-SKEPFSIKVTRKSNNRVLFDSSIGPLLFSDQFLQFSTHLPSANVYGLGEHVHQQYRHNMN--WKTWPMFSRDTTPNEDGTNLYGVQTFFLCLEDNSGLSFGVFLMNSNAMEVTLQPTPAITYRTTGGILDFYVFLGNTPEQVVQEYLELIGRPALPSYWTLGFQLSRYDYKSLDNMKAVVERNRAAQLPYDVQHADIDYMDQKKDFTYDPVNFKGFPEFVKELHNN-GQKLVIILDPAISNNSFSSNPYGPYDRGSAMKIWVNSSDGISPVIGKVWPGTTVFPDYTSPNCAVWWTKEFELFHKEVEFDGIWIDMNEVSNFIDGSFSGCSQNN-LNYPPFTPKVLDGYLFSKTLCMDAVQHWG-KQYDVHNLYGYSMAIATAKAVKDVFPDKRSFIITRSTFAGSGKFAAHWLGDNTATWKDLQWSIPGMLEFNLFGIPMVGADICGFAQDTYEELCRRWMQLGAFYPFSRNHNGQGYKDQDPASFGNNSLLLNSSRHYLNIRYTLLPYLYTLFYRAHSRGDTVARPLLHEFYDDNNTWGIDRQFLWGPGLLITPVLDQGAEKVKAYVPNATWYDYETGEELGWRKQS--IEMQLPGDKIGLHLRGGYIFPTQQPATTTEASRKNPLGLIVALDENKEARGELFWDDGESKDTVAQNIYLFSEFSVTQNHLDVT 859          

HSP 2 Score: 587.8 bits (1514), Expect = 0.000e+0
Identity = 327/896 (36.50%), Postives = 503/896 (56.14%), Query Frame = 3
Query:  345 ERLDCYP-ESGANQDSCIARGCCWSEPMRLSNKLQGVPLSIPYCYYPTDYSNYMIKSLRKSSRGIKAKLVRESPSY---LPYE-VAMLDLEVIYETKSRTRVRITDPKQKRYEVPMKLSPPD--LKPPTDREYEVIIPSDGSFSIEIKRKSDDRSLFKS-FGPLLYSDQFLQISSIMSTDQIYGIGEQNRPFLHQLSNGWERIGLWARDNPIETFMNLYGAHPFYIGMPDDGKAFGVFHFNSNGQEFALQPAPAVTYRTIGGILDFFIFTGGSPEETVKQYLELVGKPMLPPYWSLGFHLSKWGYKNIEQLSEIFQRNINAGFPIGTQWSDIDYMENYKDFTVDKEKFNGLGRFVREIKQKYNSRFVAIVDPGISCTSGNEYPPYYEGVFMDIFIKDSQTNQPIVGKVWP---------------------GETVYPDFTHPNISMYWYKQIQRFYND-------VPIDGLWIDMNEPSNFYDGSKRGCQGNSKYDNPFFVP--DIRDQSLISKTICSSALHY----NNEKHYNLHNLYGYTESVTTNKALLKTIHGKRPFILSRSTFSGSGKYTFHWTGDNQASWDQLRNSIRQVLNFNMFGIPMTGADICGFNGNSDEELCIRWMQLGAFYPFMRNHNAINQRDQDPASWNTEAQKIMKTAISNRYAMLPLFYTLLVKSHMNGGTVMRPMSFEFFSDKVTHSIELQFMIGSSIMATPVVYPGARSVDAYFPAGVWYDFHSGKLLHSDAEGAWLTLDAPLDKINIALRGGHIVPLLDSNRNSKSNIPNKMTLYCGMAQDMSASGDLYWDDGESIDSYSRNRYSYVSFNASPEQLL-----------ITPVYFGYDLLPVLNKIVILGFENKSITKFLL----NDNDIPFHYNPET 2861
            ER+DCYP E GA++ +C ARGC W      SN  +G P     CY+  +   Y + +++  S G  A +  ++ +Y    P   V  L L+V Y      + +I DP   RYEVP+ L+ P   L  P  R Y+V+I  +  F I+I+RK+    ++ S      ++D F++IS+ + +  IYG GE       ++   W   G+++RD P     N YG HP+Y+G+ +DG A GV   NSN  +   QP PA+TYRTIGGILDF++F G +PE   +QY EL+G+P++ PYWSLGF L ++GY+N  +++ ++   +    P   Q+SDIDYME   DF +   KF+G    +  +K     R + I+DP IS      YP +  GV  D+FI+       + GKVWP                         +PDF   + + +W K+I+  +++       +  DGLWIDMNEPS+F +G+      ++  ++P ++P  + RD+ L SKT+C  +       +  +HY++HNLYG++++  T +A+ + + G+R  +++RSTF  SG++  HW GDN A+WDQL  SI  +++F++FGI  TG+DICGF  +++ E+C+RWMQLGAFYPF RNHN I  R QDP SWN   + I ++ +  RY +LP  YTL+ K+H  G TV+RP+  EF SD+ T +I+ QF++G + + +PV+ P AR V+AYFP   WYD++ G  +  +A G W TL+APL+ IN+ +RGG+I+P  +   N+  +    M L   +  +  A G L+WDDG+ I++   ++Y    F+ +   LL             P+Y GY        I I G  + SIT   +    N+ ++  +YN  T
Sbjct:  936 ERIDCYPDEHGASEANCSARGCIWEA----SNTTRGPP-----CYFAHEL--YSVSNVQYDSHGATADISLKASTYSNAFPSTPVNKLKLQVTYHKNEMLQFKIYDPNHSRYEVPVPLNIPSAPLSTPEGRLYDVLI-KENPFGIQIRRKTTGTVIWDSQLLGFTFNDMFIRISTRLPSTYIYGFGETEHTTF-KIDMNWHTWGMFSRDEPPGYKKNSYGVHPYYMGLEEDGNAHGVLLMNSNAMDVTFQPMPALTYRTIGGILDFYVFLGPTPEIVTQQYTELIGRPVMVPYWSLGFQLCRYGYENDTEIANLYDEMVAKQIPYDVQYSDIDYMERQLDFKLSP-KFSGFPALINRMKAN-GMRVILILDPAISGNETEPYPAFTRGVENDVFIRYPNNGSIVWGKVWPDYPNITVDPSLGWDHQVEQYRAYVAFPDFFRNSTATWWKKEIKELHSNTQDPAKSLKFDGLWIDMNEPSSFVNGAVPSGCSDATLNHPPYMPYLEARDRGLSSKTLCMESEQILPDGSRVRHYDVHNLYGWSQTRPTYEAV-QEVTGERGIVITRSTFPSSGRWGGHWLGDNTAAWDQLGKSIIGMMDFSLFGISYTGSDICGFFQDAEYEMCVRWMQLGAFYPFSRNHNTIGTRRQDPVSWNKTFEDISRSVLETRYTLLPYLYTLMYKAHTEGSTVVRPLLHEFVSDRETWNIDKQFLLGPAFLVSPVLEPNARKVEAYFPRARWYDYYKG--VDINATGEWKTLEAPLEYINLHIRGGYILPWQEPAMNTHLSRQKFMGLRAALNAEGRAEGWLFWDDGKRINT---DQYYLARFSVNQTTLLTHEKFNNYLTGTAPLYLGY--------IDIWGLSSSSITNVSISWNTNNEEVFANYNSTT 1802          
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Mouse
Match: Mgam (maltase-glucoamylase [Source:MGI Symbol;Acc:MGI:1203495])

HSP 1 Score: 642.499 bits (1656), Expect = 0.000e+0
Identity = 341/814 (41.89%), Postives = 495/814 (60.81%), Query Frame = 3
Query:  324 CQIANNNERLDCYPESGANQDSCIARGCCWSEPMRLSNKLQGVPLSIPYCYYPTDYSNYMIKSLRKSSRGIKAKLVRESPSYLPY--EVAMLDLEVIYETKSRTRVRITDPKQKRYEVPMK-LSPPDLKPPTDREYEVIIPSDGSFSIEIKRKSDDRSLF-KSFGPLLYSDQFLQISSIMSTDQIYGIGEQ-NRPFLHQLSNGWERIGLWARDN-PIETFMNLYGAHPFYIGMPDD-GKAFGVFHFNSNGQEFALQPAPAVTYRTIGGILDFFIFTGGSPEETVKQYLELVGKPMLPPYWSLGFHLSKWGYKNIEQLSEIFQRNINAGFPIGTQWSDIDYMENYKDFTVDKEKFNGLGRFVREIKQKYNSRFVAIVDPGISCTS--GNEYPPYYEGVFMDIFIKDSQTNQPIVGKVWPGETVYPDFTHPNISMYWYKQIQRFYNDVPIDGLWIDMNEPSNFYDGSKRGCQGNSKYDNPFFVPDIRDQSLISKTICSSALHYNNEKHYNLHNLYGYTESVTTNKALLKTIHGKRPFILSRSTFSGSGKYTFHWTGDNQASWDQLRNSIRQVLNFNMFGIPMTGADICGFNGNSDEELCIRWMQLGAFYPFMRNHNAINQRDQDPASW--NTEAQKIMKTAISNRYAMLPLFYTLLVKSHMNGGTVMRPMSFEFFSDKVTHSIELQFMIGSSIMATPVVYPGARSVDAYFPAGVWYDFHSGKLLHSDAEGAWLTLDAPLDKINIALRGGHIVPLLDSNRNSKSNIPNKMTLYCGMAQDMSASGDLYWDDGESIDSYSRNRYSYVSFNASPEQLLIT 2732
            C + +  ER++C P+  +N+ +C  RGCCW          QG  +S+P CYY  ++   M   +  ++ G  A L +  PS   +   +  + L   Y+T +R   ++TD  +KRYEVP + + P     P+   Y+V + S   FSI++ RKS++R LF  S GPLL+SDQFLQ S+ + +  +YG+GE  ++ + H ++  W+   +++RD  P E   NLYG   F++ + D+ G +FGVF  NSN  E  LQP PA+TYRT GGILDF++F G +PE+ V++YLEL+G+P LP YW+LGF LS++ YK+++ +  + +RN  A  P   Q +DIDYM+  KDFT D   F G   FV+E+      + V I+DP IS  S   N Y PY  G  M I++  S    P++GKVWPG TV+PD+T PN +++W K+ + F+ +V  DG+WIDMNE SNF DGS  GC  N+  + P F P + D  L SKT+C  A+ +   K Y++HNLYGY+ ++ T KA+      KR FI++RSTF+GSGK+  HW GDN A+W  L+ SI  +L FN+FGIPM GADICGF  ++ EELC RWMQLGAFYPF RNHN    +DQDPAS+  N+      +  ++ RY +LP  YTL  ++H  G TV RP+  EF+ D  T  I+ QF+ G  ++ TPV+  GA  V AY P   WYD+ +G+ L    +   + +  P DKI + LRGG+I P       ++++  N + L   + ++  A G+L+WDDGES D+ ++N Y +  F+ +   L +T
Sbjct:   65 CPVLSELERINCIPDQSSNKGTCDERGCCWDP--------QG-SISVP-CYYSRNHGYKMESDVVNTNAGFTATL-KNLPSAPVFGNSIENILLTAEYQTSNRFHFKLTDQTKKRYEVPHEHVQPFSGNAPSSLNYKVEV-SKEPFSIKVTRKSNNRVLFDSSIGPLLFSDQFLQFSTHLPSANVYGLGEHVHQQYRHNMN--WKTWPMFSRDTTPNEDGTNLYGVQTFFLCLEDNSGLSFGVFLMNSNAMEVTLQPTPAITYRTTGGILDFYVFLGNTPEQVVQEYLELIGRPALPSYWTLGFQLSRYDYKSLDNMKAVVERNRAAQLPYDVQHADIDYMDQKKDFTYDPVNFKGFPEFVKELHNN-GQKLVIILDPAISNNSFSSNPYGPYDRGSAMKIWVNSSDGISPVIGKVWPGTTVFPDYTSPNCAVWWTKEFELFHKEVEFDGIWIDMNEVSNFIDGSFSGCSQNN-LNYPPFTPKVLDGYLFSKTLCMDAVQHWG-KQYDVHNLYGYSMAIATAKAVKDVFPDKRSFIITRSTFAGSGKFAAHWLGDNTATWKDLQWSIPGMLEFNLFGIPMVGADICGFAQDTYEELCRRWMQLGAFYPFSRNHNGQGYKDQDPASFGNNSLLLNSSRHYLNIRYTLLPYLYTLFYRAHSRGDTVARPLLHEFYDDNNTWGIDRQFLWGPGLLITPVLDQGAEKVKAYVPNATWYDYETGEELGWRKQS--IEMQLPGDKIGLHLRGGYIFPTQQPATTTEASRKNPLGLIVALDENKEARGELFWDDGESKDTVAQNIYLFSEFSVTQNHLDVT 859          

HSP 2 Score: 590.112 bits (1520), Expect = 0.000e+0
Identity = 310/838 (36.99%), Postives = 487/838 (58.11%), Query Frame = 3
Query:  345 ERLDCYP-ESGANQDSCIARGCCWSEPMRLSNKLQGVPLSIPYCYYPTDYSNYMIKSLRKSSRGIKAKLVRESPSY---LPYE-VAMLDLEVIYETKSRTRVRITDPKQKRYEVPMKLSPPD--LKPPTDREYEVIIPSDGSFSIEIKRKSDDRSLFKS-FGPLLYSDQFLQISSIMSTDQIYGIGEQNRPFLHQLSNGWERIGLWARDNPIETFMNLYGAHPFYIGMPDDGKAFGVFHFNSNGQEFALQPAPAVTYRTIGGILDFFIFTGGSPEETVKQYLELVGKPMLPPYWSLGFHLSKWGYKNIEQLSEIFQRNINAGFPIGTQWSDIDYMENYKDFTVDKEKFNGLGRFVREIKQKYNSRFVAIVDPGISCTSGNEYPPYYEGVFMDIFIKDSQTNQPIVGKVWP---------------------GETVYPDFTHPNISMYWYKQIQRFYND-------VPIDGLWIDMNEPSNFYDGSKRGCQGNSKYDNPFFVPDI--RDQSLISKTICSSALHY----NNEKHYNLHNLYGYTESVTTNKALLKTIHGKRPFILSRSTFSGSGKYTFHWTGDNQASWDQLRNSIRQVLNFNMFGIPMTGADICGFNGNSDEELCIRWMQLGAFYPFMRNHNAINQRDQDPASWNTEAQKIMKTAISNRYAMLPLFYTLLVKSHMNGGTVMRPMSFEFFSDKVTHSIELQFMIGSSIMATPVVYPGARSVDAYFPAGVWYDFHSGKLLHSDAEGAWLTLDAPLDKINIALRGGHIVPLLDSNRNSKSNIPNKMTLYCGMAQDMSASGDLYWDDGESIDSYSRNRYSYVSFNASPEQLLIT 2732
            ER+DCYP E GA++ +C ARGC W      SN  +G P     CY+  +   Y + +++  S G  A +  ++ +Y    P   V  L L+V Y      + +I DP   RYEVP+ L+ P   L  P  R Y+V+I  +  F I+I+RK+    ++ S      ++D F++IS+ + +  IYG GE       ++   W   G+++RD P     N YG HP+Y+G+ +DG A GV   NSN  +   QP PA+TYRTIGGILDF++F G +PE   +QY EL+G+P++ PYWSLGF L ++GY+N  +++ ++   +    P   Q+SDIDYME   DF +   KF+G    +  +K     R + I+DP IS      YP + +GV  D+FI+       + GKVWP                         +PDF   + +++W K+I+  +++       +  DGLWIDMNEPS+F +G+      ++  ++P ++P +  RD+ L SKT+C  + H     +  +HY++H+LYG++++  T +A+ + + G+R  +++RSTF  SG++  HW GDN A+WDQL  SI  +++F++FGI  TG+DICGF  +++ E+C+RWMQLGAFYPF RNHN I  + QDP SW+   + I ++ +  RY +LP  YTL+ K+H  G TV+RP+  EF +D+ T +I+ QF++G + + +PV+ P AR+V AYFP   WYD+++G  ++S     W TL APL+ IN+ +RGG+I+P      N+  +    + L   + +   A G+L+WDDG+S D+ ++N Y +  F+ +   L +T
Sbjct:  936 ERIDCYPDEHGASEANCSARGCIWEA----SNTTRGPP-----CYFAHEL--YSVSNVQYDSHGATADISLKASTYSNAFPSTPVNKLKLQVTYHKNEMLQFKIYDPNHSRYEVPVPLNIPSAPLSTPEGRLYDVLI-KENPFGIQIRRKTTGTVIWDSQLLGFTFNDMFIRISTRLPSTYIYGFGETEHTTF-KIDMNWHTWGMFSRDEPPGYKKNSYGVHPYYMGLEEDGNAHGVLLMNSNAMDVTFQPMPALTYRTIGGILDFYVFLGPTPEIVTQQYTELIGRPVMVPYWSLGFQLCRYGYENDTEIANLYDEMVAKQIPYDVQYSDIDYMERQLDFKLSP-KFSGFPALINRMKAN-GMRVILILDPAISGNETQPYPAFTQGVENDVFIRYPNNGGIVWGKVWPDYPNITVDSSLDWDIQVERYRAYVAFPDFFRDSTALWWKKEIKELHSNSQDQAKSLKFDGLWIDMNEPSSFVNGAVPSGCSDATLNHPPYMPHVEGRDRGLSSKTLCMESEHILPDGSRVRHYDVHSLYGWSQTRPTYEAM-QEVTGERGIVITRSTFPSSGRWGGHWLGDNTAAWDQLGKSIIGMMDFSLFGISYTGSDICGFFQDAEYEMCVRWMQLGAFYPFSRNHNTIGTKRQDPVSWDKTFEDISRSVLETRYTLLPYLYTLMYKAHKEGSTVVRPLLHEFLADRETWNIDKQFLLGPAFLVSPVLEPNARNVTAYFPKAQWYDYYTGADINST---GWTTLPAPLEHINLHVRGGYILPWQQPALNTNLSRKKPLGLLIALDEKKEARGELFWDDGQSKDTVAKNIYLFSEFSVTQNHLDVT 1754          

HSP 3 Score: 589.726 bits (1519), Expect = 0.000e+0
Identity = 326/898 (36.30%), Postives = 505/898 (56.24%), Query Frame = 3
Query:  339 NNERLDCYPES-GANQDSCIARGCCWSEPMRLSNKLQGVPLSIPYCYYPTDYSNYMIKSLRKSSRGIKAKL-VRESP---SYLPYEVAMLDLEVIYETKSRTRVRITDPKQKRYEVPMKLSPPDL--KPPTDREYEVIIPSDGSFSIEIKRKSDDRSLFKS-FGPLLYSDQFLQISSIMSTDQIYGIGEQNRPFLHQLSNGWERIGLWARDNPIETFMNLYGAHPFYIGMPDDGKAFGVFHFNSNGQEFALQPAPAVTYRTIGGILDFFIFTGGSPEETVKQYLELVGKPMLPPYWSLGFHLSKWGYKNIEQLSEIFQRNINAGFPIGTQWSDIDYMENYKDFTVDKEKFNGLGRFVREIKQKYNSRFVAIVDPGISCTSGNEYPPYYEGVFMDIFIKDSQTNQPIVGKVWP---------------------GETVYPDFTHPNISMYWYKQIQRFYND-------VPIDGLWIDMNEPSNFYDGSKRGCQGNSKYDNPFFVP--DIRDQSLISKTICSSALHY----NNEKHYNLHNLYGYTESVTTNKALLKTIHGKRPFILSRSTFSGSGKYTFHWTGDNQASWDQLRNSIRQVLNFNMFGIPMTGADICGFNGNSDEELCIRWMQLGAFYPFMRNHNAINQRDQDPASWNTEAQKIMKTAISNRYAMLPLFYTLLVKSHMNGGTVMRPMSFEFFSDKVTHSIELQFMIGSSIMATPVVYPGARSVDAYFPAGVWYDFHSGKLLHSDAEGAWLTLDAPLDKINIALRGGHIVPLLDSNRNSKSNIPNKMTLYCGMAQDMSASGDLYWDDGESIDSYSRNRYSYVSFNASPEQLL-----------ITPVYFGYDLLPVLNKIVILGFENKSITKFLL----NDNDIPFHYNPET 2861
            + E++DCYP+  GA++ SC ARGC W E    SN        +P+CY+  +   Y + +++  S G  A + ++ SP   ++    V  L L+V Y      + +I DP   RYEVP+ L+ P      P  R Y+V+I  +  F IEI+RK     ++ S      +SD F++IS+ + +  IYG GE       ++   W + G+++RD P     N YG HP+Y+G+ +DG A GV   NSN  +   QP PA+TYRT GGILDF++F G +PE   +QY EL+G+P++ PYWSLGF L ++GY+N  +++ ++   ++   P   Q+SDIDYME   DF +   KF+G    +  +K     R + I+DP IS      YP +  GV  D+FI+       + GKVWP                         +PDF   + + +W K+I+  +++       +  DGLWIDMNEPS+F +G+      ++  ++P ++P  + RD+ L SKT+C  +       +  +HY++HNLYG++++  T +A+ + + G+R  +++RSTF  SG++  HW GDN A+WDQL  SI  +++F++FGI  TG+DICGF  +++ E+C+RWMQLGAFYPF RNHN I  R QDP SWN   + I ++ +  RY +LP  YTL+ K+H  G TV+RP+  EF SD+ T +I+ QF++G + + +PV+ P AR V+AYFP   WYD++ G  +  +A G W TL+APL+ IN+ +RGG+I+P  +   N+  +    M L   +  +  A G L+WDDG+ I++   ++Y    F+ +   LL             P+Y GY        I I G  + SIT   +    N+ ++  +YN  T
Sbjct: 2723 DEEKIDCYPDQHGASETSCTARGCVWEE----SNSD-----VVPFCYFVNEL--YSVSNVQYGSHGATANISLKASPYSGAFPSTPVKELQLQVTYHKNEMLQFKIYDPNHSRYEVPVPLNIPSAPSSTPESRLYDVLI-KENPFGIEIRRKGTGTVVWDSQLLGFTFSDMFIRISTRLPSTYIYGFGETEHTTF-KIDMNWNKWGMFSRDEPPGYRKNSYGVHPYYMGLEEDGNAHGVLLMNSNAMDVTFQPMPALTYRTTGGILDFYVFLGPTPEFVTQQYTELIGRPVMVPYWSLGFQLCRYGYENDSEIASLYDEMVDKKIPYDVQYSDIDYMERQLDFKLSP-KFSGFPALINRMKAN-GMRVILILDPAISGNETEPYPAFTRGVENDVFIRYPNNGSIVWGKVWPDYPNITVDPSLGWDHQVEQYRAYVAFPDFFRNSTATWWKKEIKELHSNTQDPAKSLKFDGLWIDMNEPSSFVNGAVPSGCSDATLNHPPYMPYLEARDRGLSSKTLCMESEQILPDGSRVRHYDVHNLYGWSQTRPTYEAV-QEVTGERGIVITRSTFPSSGRWGGHWLGDNTAAWDQLGKSIIGMMDFSLFGISYTGSDICGFFQDAEYEMCVRWMQLGAFYPFSRNHNTIGTRRQDPVSWNKTFEDISRSVLETRYTLLPYLYTLMYKAHTEGSTVVRPLLHEFVSDRETWNIDKQFLLGPAFLVSPVLEPNARKVEAYFPRARWYDYYKG--VDINATGEWKTLEAPLEYINLHIRGGYILPWQEPAMNTHLSRQKFMGLRAALNAEGRAEGWLFWDDGKRINT---DQYYLARFSVNQTTLLTHEKFNNYLTGTAPLYLGY--------IDIWGLSSSSITNVSISWNTNNEEVFANYNSTT 3591          

HSP 4 Score: 587.415 bits (1513), Expect = 0.000e+0
Identity = 308/821 (37.52%), Postives = 479/821 (58.34%), Query Frame = 3
Query:  345 ERLDCYP-ESGANQDSCIARGCCWSEPMRLSNKLQGVPLSIPYCYYPTDYSNYMIKSLRKSSRGIKAKLVRESPSY---LPYE-VAMLDLEVIYETKSRTRVRITDPKQKRYEVPMKLSPPDLKPPTD--REYEVIIPSDGSFSIEIKRKSDDRSLFKS-FGPLLYSDQFLQISSIMSTDQIYGIGEQNRPFLHQLSNGWERIGLWARDNPIETFMNLYGAHPFYIGMPDDGKAFGVFHFNSNGQEFALQPAPAVTYRTIGGILDFFIFTGGSPEETVKQYLELVGKPMLPPYWSLGFHLSKWGYKNIEQLSEIFQRNINAGFPIGTQWSDIDYMENYKDFTVDKEKFNGLGRFVREIKQKYNSRFVAIVDPGISCTSGNEYPPYYEGVFMDIFIKDSQTNQPIVGKVWP---------------------GETVYPDFTHPNISMYWYKQIQRFYND-------VPIDGLWIDMNEPSNFYDGSKRGCQGNSKYDNPFFVPDI--RDQSLISKTICSSALHY----NNEKHYNLHNLYGYTESVTTNKALLKTIHGKRPFILSRSTFSGSGKYTFHWTGDNQASWDQLRNSIRQVLNFNMFGIPMTGADICGFNGNSDEELCIRWMQLGAFYPFMRNHNAINQRDQDPASWNTEAQKIMKTAISNRYAMLPLFYTLLVKSHMNGGTVMRPMSFEFFSDKVTHSIELQFMIGSSIMATPVVYPGARSVDAYFPAGVWYDFHSGKLLHSDAEGAWLTLDAPLDKINIALRGGHIVPLLDSNRNSKSNIPNKMTLYCGMAQDMSASGDLYWDDGESIDSYSRN 2681
            ER+DCYP E GA++ +C ARGC W E    SN +      +P CY+  +   Y + +++  S G  A +  ++ +Y    P   V  L L+V Y      + +I DP   RYEVP+ L+ P     T+  R Y+V+I  +  F I+++RKS    ++ S      ++D F++IS+ + +  IYG GE       ++   W   G+++RD P     N YG HP+Y+G+ +DG A GV   NSN  +   QP PA+TYRT GGILDF++  G +PE   +QY EL+G+P++ PYWSLGF L ++GY+N  +++ ++   ++   P   Q+SDIDYME   DF +   KF+G    +  +K     R + I+DP IS      YP +  GV  D+FI+       + GKVWP                         +PDF   + + +W K+I+  Y +       +  DGLWIDMNEPS+F +G+      ++  ++P ++P +  RD+ L SKT+C  + H     +  +HY++H+LYG++++  T +A+ + + G+R  +++RSTF  SG++  HW GDN A+WDQL  SI  +++F++FGI  TG+DICGF  +++ E+C+RWMQLGAFYPF RNHN I  + QDP SWN   + I ++ +  RY +LP  YTL+ K+HM G TV+RP+  EF SD+ T +I+ QF++G + + +PV+ P AR++ AYFP  +WYD+++G  ++S  E  W TL APL+ IN+ +RGG+I+P      N+  +  N + L   + ++  A G+L+WDDG+S D  + N
Sbjct: 1831 ERIDCYPDEHGASEANCSARGCIWEE----SNTI-----GVPTCYFAHEL--YSVSNVQYDSHGATADISLKASTYSNAFPSTPVNKLKLQVTYHKNEMLQFKIYDPNNSRYEVPVPLNIPSAPSSTNEGRLYDVLI-KENPFGIQVRRKSTGTVIWDSQLLGFTFNDMFIRISTRLPSTYIYGFGETEHTTF-KIDMNWHTWGMFSRDEPPGYKKNSYGVHPYYMGLEEDGNAHGVLLMNSNAMDVTFQPMPALTYRTTGGILDFYVLLGPTPEIVTQQYTELIGRPVMVPYWSLGFQLCRYGYENDSEIASLYDEMVDKQIPYDVQYSDIDYMERQLDFKLSP-KFSGFPALINRMKAN-GMRVILILDPAISGNETQPYPAFTRGVENDVFIRYPNNGSIVWGKVWPDYPNITVDPSLGWDHQVEQYRAYVAFPDFFRNSTATWWKKEIEELYTNTEEPEKSLKFDGLWIDMNEPSSFVNGAVPSGCSDATLNHPPYMPHVEGRDRGLSSKTLCMESEHILPDGSRVQHYDVHSLYGWSQTRPTYEAV-QEVTGERGIVITRSTFPSSGRWGGHWLGDNTAAWDQLGKSIIGMMDFSLFGISYTGSDICGFFQDAEYEMCVRWMQLGAFYPFSRNHNTIGTKRQDPVSWNKTFEDISRSVLETRYTLLPYLYTLMYKAHMEGSTVVRPLLHEFVSDRKTWNIDKQFLLGPAFLVSPVLEPNARNISAYFPTALWYDYYTGANINSTGE--WKTLPAPLEHINLHVRGGYILPWQRPALNTHLSRKNPLGLLIALDENKEARGELFWDDGQSKDLTTNN 2633          
BLAST of Lysosomal alpha-glucosidase vs. UniProt
Match: sp|Q6P7A9|LYAG_RAT (Lysosomal alpha-glucosidase OS=Rattus norvegicus OX=10116 GN=Gaa PE=2 SV=1)

HSP 1 Score: 721.465 bits (1861), Expect = 0.000e+0
Identity = 365/871 (41.91%), Postives = 524/871 (60.16%), Query Frame = 3
Query:  318 AQCQIANNNERLDCYPESGANQDSCIARGCCWSEPMRLSNKLQGVPLSIPYCYYPTDYSNYMIKSLRKSSRGIKAKLVRESPSYLPYEVAMLDLEVIYETKSRTRVRITDPKQKRYEVPMKLSPPDLKPPTDREYEVIIPSDGSFSIEIKRKSDDRSLF-KSFGPLLYSDQFLQISSIMSTDQIYGIGEQNRPFLHQLSNGWERIGLWARDNPIETFMNLYGAHPFYIGMPDDGKAFGVFHFNSNGQEFALQPAPAVTYRTIGGILDFFIFTGGSPEETVKQYLELVGKPMLPPYWSLGFHLSKWGYKNIEQLSEIFQRNINAGFPIGTQWSDIDYMENYKDFTVDKEKFNGLGRFVREIKQKYNSRFVAIVDPGISCTS-GNEYPPYYEGVFMDIFIKDSQTNQPIVGKVWPGETVYPDFTHPNISMYWYKQIQRFYNDVPIDGLWIDMNEPSNFYDGSKRGCQGNSKYDNPFFVPDIRDQSLISKTICSSALHYNNEKHYNLHNLYGYTESVTTNKALLKTIHGKRPFILSRSTFSGSGKYTFHWTGDNQASWDQLRNSIRQVLNFNMFGIPMTGADICGFNGNSDEELCIRWMQLGAFYPFMRNHNAINQRDQDPASWNTEAQKIMKTAISNRYAMLPLFYTLLVKSHMNGGTVMRPMSFEFFSDKVTHSIELQFMIGSSIMATPVVYPGARSVDAYFPAGVWYDFH------------------SGKLLHSDAEGAWLTLDAPLDKINIALRGGHIVPLLDSNRNSKSNIPNKMTLYCGMAQDMSASGDLYWDDGESIDSYSRNRYSYVSFNASPEQLLITPVYF---GYDLLPVLNKIVILGFENKSITKFLLNDNDIP-FHYNPE 2858
             QC +  N+ R DC P+ G  Q+ C ARGCCW   +     L G  +  P+C++P  Y +Y +++L  +  G  A L R SP++ P +V  L LEV+ ET SR    I DP  KRYEVP++ +P  L       Y V   S+  F + ++RK   R L   +  PL ++DQFLQ+S+ + +  I G+GE   P +  LS  W RI LW RD      +NLYG+HPFY+ + D G A GVF  NSN  +  LQP+PA+T+R+ GGILD ++F G  P+  V+QYL++VG P +PPYW LGFHL +WGY +   + ++ +      FP+  QW+D+DYM+  +DFT +++ F      V E+ Q    R++ IVDP IS +     Y PY EG+   +FI + +T QP++GKVWPG T +PDFT+P    +W   +  F+  VP DG+WIDMNEPSNF  GS++GC  N + +NP +VP +   +L + TIC+S+ H     HYNLHNLYG TE++ +++AL+KT  G RPF++SRSTF+G G+Y  HWTGD  +SW+ L  S+ ++L FN+ G+P+ GADICGF GN+ EELC+RW QLGAFYPFMRNHN +N   Q+P  ++  AQ+ M+ A + RYA+LP  YTL   +H+ G TV RP+  EF  D  T S++ Q + G +++ TPV+ PG   V  YFP G+WY+                       ++HS  +G WLTL+APLD IN+ LR G+I+PL   +  +  +    M L   + +   ASG+L+WDDGES+    R  Y+ V+F+A    ++   V+    G +L   L ++ ILG    + T+ L N   +  F Y+P+
Sbjct:   80 TQCDVTPNS-RFDCAPDKGITQEQCEARGCCW---VPAGQVLNGPVMGQPWCFFPPSYPSYRLENLSSTESGYTATLTRTSPTFFPKDVLTLQLEVLMETDSRLHFMIKDPTSKRYEVPLE-TPRVLSQAPSPLYSVEF-SEEPFGVIVRRKLGGRVLLNTTVAPLFFADQFLQLSTSLPSQHIAGLGEHLSPLM--LSTEWTRITLWNRDVAPSQGVNLYGSHPFYLALEDGGLAHGVFLLNSNAMDVVLQPSPALTWRSTGGILDVYVFLGPEPKSVVQQYLDVVGYPFMPPYWGLGFHLCRWGYSSTAIVRQVVENMTRTHFPLDVQWNDLDYMDARRDFTFNQDGFADFPDMVHELHQG-GRRYMMIVDPAISSSGPAGSYRPYDEGLRRGVFITN-ETGQPLIGKVWPGSTAFPDFTNPETLDWWQDMVSEFHAQVPFDGMWIDMNEPSNFIRGSQQGCPDN-ELENPPYVPGVVGGALQAATICASS-HQFLSTHYNLHNLYGLTEAIASSRALVKT-RGTRPFVISRSTFAGHGRYAGHWTGDVWSSWEHLAYSVPEILQFNLLGVPLVGADICGFQGNTTEELCVRWTQLGAFYPFMRNHNDLNSLPQEPYRFSETAQQAMRKAFTLRYALLPYLYTLFHGAHVKGDTVARPLFLEFPEDPSTWSVDRQLLWGPALLITPVLEPGKTDVTGYFPKGMWYNLQMVPVETLGSLPSSSPASSFRSIVHS--KGQWLTLEAPLDTINVHLRAGYIIPLQGPSLTTTESRKQPMALAVALTESGEASGELFWDDGESLGVLERGAYTLVTFSAKNNTIVNKLVHVTKEGGEL--QLREVTILGV-TTAPTQVLSNGISVSNFTYSPD 932          
BLAST of Lysosomal alpha-glucosidase vs. UniProt
Match: sp|P70699|LYAG_MOUSE (Lysosomal alpha-glucosidase OS=Mus musculus OX=10090 GN=Gaa PE=1 SV=2)

HSP 1 Score: 716.457 bits (1848), Expect = 0.000e+0
Identity = 364/873 (41.70%), Postives = 524/873 (60.02%), Query Frame = 3
Query:  312 ATAQCQIANNNERLDCYPESGANQDSCIARGCCWSEPMRLSNKLQGVPLSIPYCYYPTDYSNYMIKSLRKSSRGIKAKLVRESPSYLPYEVAMLDLEVIYETKSRTRVRITDPKQKRYEVPMKLSPPDLKPPTDREYEVIIPSDGSFSIEIKRKSDDRSLF-KSFGPLLYSDQFLQISSIMSTDQIYGIGEQNRPFLHQLSNGWERIGLWARDNPIETFMNLYGAHPFYIGMPDDGKAFGVFHFNSNGQEFALQPAPAVTYRTIGGILDFFIFTGGSPEETVKQYLELVGKPMLPPYWSLGFHLSKWGYKNIEQLSEIFQRNINAGFPIGTQWSDIDYMENYKDFTVDKEKFNGLGRFVREIKQKYNSRFVAIVDPGISCTS-GNEYPPYYEGVFMDIFIKDSQTNQPIVGKVWPGETVYPDFTHPNISMYWYKQIQRFYNDVPIDGLWIDMNEPSNFYDGSKRGCQGNSKYDNPFFVPDIRDQSLISKTICSSALHYNNEKHYNLHNLYGYTESVTTNKALLKTIHGKRPFILSRSTFSGSGKYTFHWTGDNQASWDQLRNSIRQVLNFNMFGIPMTGADICGFNGNSDEELCIRWMQLGAFYPFMRNHNAINQRDQDPASWNTEAQKIMKTAISNRYAMLPLFYTLLVKSHMNGGTVMRPMSFEFFSDKVTHSIELQFMIGSSIMATPVVYPGARSVDAYFPAGVWYDFHS------GKLLHS----------DAEGAWLTLDAPLDKINIALRGGHIVPLLDSNRNSKSNIPNKMTLYCGMAQDMSASGDLYWDDGESIDSYSRNRYSYVSFNASPEQL---LITPVYFGYDLLPVLNKIVILGFENKSITKFLLNDNDIP---FHYNPE 2858
            A  QC +  ++ R DC P+ G +Q+ C ARGCC+    ++  + Q   +  P+C++P  Y +Y +++L  +  G  A L R SP++ P +V  L LEV+ ET SR   +I DP  KRYEVP++ +P  L       Y V   S+  F + ++RK   R L   +  PL ++DQFLQ+S+ + +  I G+GE   P +  LS  W RI LW RD P     NLYG+HPFY+ + D G A GVF  NSN  +  LQP+PA+T+R+ GGILD ++F G  P+  V+QYL++VG P +PPYW LGFHL +WGY +   + ++ +      FP+  QW+D+DYM+  +DFT +++ F      VRE+ Q    R++ IVDP IS       Y PY EG+   +FI + +T QP++GKVWPG T +PDFT+P    +W   +  F+  VP DG+W+DMNEPSNF  GS++GC  N++ +NP +VP +    L + TIC+S+ H     HYNLHNLYG TE++ +++AL+KT  G RPF++SRSTFSG G+Y  HWTGD ++SW+ L  S+  +L FN+ G+P+ GADICGF G++ EELC+RW QLGAFYPFMRNHN +N   Q+P  ++  AQ+ M+ A + RYA+LP  YTL  ++H+ G TV RP+  EF  D  T S++ Q + G +++ TPV+ PG   V  YFP G WY+         G L              ++G WLTL+APLD IN+ LR G+I+PL   +  +  +    M L   +     A G+L+WDDGES+    R  Y+ V+F+A    +   L+     G +L   L ++ +LG      T+ L   N IP   F Y+P+
Sbjct:   78 APTQCDVPPSS-RFDCAPDKGISQEQCEARGCCYVPAGQVLKEPQ---IGQPWCFFPPSYPSYRLENLSSTESGYTATLTRTSPTFFPKDVLTLQLEVLMETDSRLHFKIKDPASKRYEVPLE-TPRVLSQAPSPLYSVEF-SEEPFGVIVRRKLGGRVLLNTTVAPLFFADQFLQLSTSLPSQHITGLGEHLSPLM--LSTDWARITLWNRDTPPSQGTNLYGSHPFYLALEDGGLAHGVFLLNSNAMDVILQPSPALTWRSTGGILDVYVFLGPEPKSVVQQYLDVVGYPFMPPYWGLGFHLCRWGYSSTAIVRQVVENMTRTHFPLDVQWNDLDYMDARRDFTFNQDSFADFPDMVRELHQD-GRRYMMIVDPAISSAGPAGSYRPYDEGLRRGVFITN-ETGQPLIGKVWPGTTAFPDFTNPETLDWWQDMVSEFHAQVPFDGMWLDMNEPSNFVRGSQQGCP-NNELENPPYVPGVVGGILQAATICASS-HQFLSTHYNLHNLYGLTEAIASSRALVKT-RGTRPFVISRSTFSGHGRYAGHWTGDVRSSWEHLAYSVPDILQFNLLGVPLVGADICGFIGDTSEELCVRWTQLGAFYPFMRNHNDLNSVPQEPYRFSETAQQAMRKAFALRYALLPYLYTLFHRAHVRGDTVARPLFLEFPEDPSTWSVDRQLLWGPALLITPVLEPGKTEVTGYFPKGTWYNMQMVSVDSLGTLPSPSSASSFRSAVQSKGQWLTLEAPLDTINVHLREGYIIPLQGPSLTTTESRKQPMALAVALTASGEADGELFWDDGESLAVLERGAYTLVTFSAKNNTIVNKLVRVTKEGAEL--QLREVTVLGVATAP-TQVL--SNGIPVSNFTYSPD 932          
BLAST of Lysosomal alpha-glucosidase vs. UniProt
Match: sp|Q5R7A9|LYAG_PONAB (Lysosomal alpha-glucosidase OS=Pongo abelii OX=9601 GN=GAA PE=2 SV=1)

HSP 1 Score: 701.049 bits (1808), Expect = 0.000e+0
Identity = 357/870 (41.03%), Postives = 527/870 (60.57%), Query Frame = 3
Query:  321 QCQIANNNERLDCYPESGANQDSCIARGCCWSEPMRLSNKLQGVPLSIPYCYYPTDYSNYMIKSLRKSSRGIKAKLVRESPSYLPYEVAMLDLEVIYETKSRTRVRITDPKQKRYEVPMKLSPPDLKPPTDREYEVIIPSDGSFSIEIKRKSDDRSLF-KSFGPLLYSDQFLQISSIMSTDQIYGIGEQNRPFLHQLSNGWERIGLWARDNPIETFMNLYGAHPFYIGMPDDGKAFGVFHFNSNGQEFALQPAPAVTYRTIGGILDFFIFTGGSPEETVKQYLELVGKPMLPPYWSLGFHLSKWGYKNIEQLSEIFQRNINAGFPIGTQWSDIDYMENYKDFTVDKEKFNGLGRFVREIKQKYNSRFVAIVDPGISCTS-GNEYPPYYEGVFMDIFIKDSQTNQPIVGKVWPGETVYPDFTHPNISMYWYKQIQRFYNDVPIDGLWIDMNEPSNFYDGSKRGCQGNSKYDNPFFVPDIRDQSLISKTICSSALHYNNEKHYNLHNLYGYTESVTTNKALLKTIHGKRPFILSRSTFSGSGKYTFHWTGDNQASWDQLRNSIRQVLNFNMFGIPMTGADICGFNGNSDEELCIRWMQLGAFYPFMRNHNAINQRDQDPASWNTEAQKIMKTAISNRYAMLPLFYTLLVKSHMNGGTVMRPMSFEFFSDKVTHSIELQFMIGSSIMATPVVYPGARSVDAYFPAGVWYDFHS------GKL-----------LHSDAEGAWLTLDAPLDKINIALRGGHIVPLLDSNRNSKSNIPNKMTLYCGMAQDMSASGDLYWDDGESIDSYSRNRYSYVSFNASPEQLLITPVYFGYDLLPV-LNKIVILGFENKSITKFLLNDNDIP---FHYNPET 2861
            QC +  N+ R DC P+    ++ C ARGCC+   +     L+G  +  P+C++P  Y +Y +++L  S  G  A L R +P++ P ++  L L+V+ ET++R    I DP  +RYEVP++      + P+   Y V   S+  F + ++R+ D R L   +  PL ++DQFLQ+S+ + +  I G+ E   P +  LS  W R+ LW RD       NLYG+HPFY+ + D G A GVF  NSN  +  LQP+PA+++R+ GGILD +IF G  P+  V+QYL++VG P +PPYW LGFHL +WGY +    S++ +    A FP+  QW+D+DYM+  +DFT +K+ F      VRE+ Q    R++ IVDP IS +     Y PY EG+   +FI + +T+QP++GKVWPG T +PDFT+P    +W   +  F++ VP DG+WIDMNEPSNF  GS+ GC  N + +NP +VP +   +L + TIC+S+ H     HYNLHNLYG TE++ +++AL+K   G RPF++SRSTF+G G+Y  HWTGD  +SW+QL +S+ ++L FN+ G+P+ GAD+CGF GN+ EELC+RW QLGAFYPFMRNHN +    Q+P S++  AQ+ M+ A++ RYA+LP  YTL  ++H+ G TV RP+  EF  D  T +++ Q + G +++ TPV+  G   V  YFP G+WYD  +      G L           +HS  EG W+TL APLD IN+ LR G+I+PL      +  +    M L   + +   A G+L+WDDGES++   R  Y+ V F A    ++   V+   +   + L K+ +LG    + T   +  N +P   F Y+P+T
Sbjct:   81 QCDVPPNS-RFDCAPDKAITREQCDARGCCY---IPAKQGLRGAQMGQPWCFFPPSYPSYKLENLSSSEMGYTATLTRTTPTFFPKDILTLRLDVMMETENRLHFTIKDPANRRYEVPLETPRVHSRAPSPL-YSVEF-SEEPFGVIVRRQLDGRVLLNTTVAPLFFADQFLQLSTSLPSQYITGLAEHLSPLM--LSTSWTRVTLWNRDLAPTPGANLYGSHPFYLALEDGGSAHGVFLLNSNAMDVVLQPSPALSWRSTGGILDVYIFLGPEPKSVVRQYLDVVGYPFMPPYWGLGFHLCRWGYSSTAITSQVVENMTRAHFPLDVQWNDLDYMDARRDFTFNKDGFRDFPAMVRELHQG-GRRYMMIVDPAISSSGPAGSYRPYDEGLRRGVFITN-ETSQPLIGKVWPGSTAFPDFTNPAALAWWEDMVAEFHDQVPFDGMWIDMNEPSNFIRGSEDGCPDN-ELENPPYVPGVVGGTLQAATICASS-HQFLSTHYNLHNLYGLTEAIASHRALVKA-RGTRPFVISRSTFAGHGRYAGHWTGDVWSSWEQLASSVPEILQFNLLGVPLVGADVCGFLGNTSEELCVRWTQLGAFYPFMRNHNGLLNLPQEPYSFSEPAQQAMRKALTLRYALLPHLYTLFHQAHVAGETVARPLFLEFPKDSSTWTVDHQLLWGEALLITPVLQAGKAEVTGYFPLGIWYDLQTVPIEALGSLPPPPAAPREPAIHS--EGQWVTLPAPLDTINVHLRAGYIIPLQGPGLTTTESRQQPMALAVALTKGGEARGELFWDDGESLEVLERGAYTQVLFLARNNTIVNELVHVTSEGAGLQLQKVTVLGV---ATTPQQVLSNGVPVSNFTYSPDT 932          
BLAST of Lysosomal alpha-glucosidase vs. UniProt
Match: sp|P10253|LYAG_HUMAN (Lysosomal alpha-glucosidase OS=Homo sapiens OX=9606 GN=GAA PE=1 SV=4)

HSP 1 Score: 699.508 bits (1804), Expect = 0.000e+0
Identity = 359/872 (41.17%), Postives = 523/872 (59.98%), Query Frame = 3
Query:  321 QCQIANNNERLDCYPESGANQDSCIARGCCWSEPMRLSNKLQGVPLSIPYCYYPTDYSNYMIKSLRKSSRGIKAKLVRESPSYLPYEVAMLDLEVIYETKSRTRVRITDPKQKRYEVPMKLSPPDLKPPTDREYEVIIPSDGSFSIEIKRKSDDRSLF-KSFGPLLYSDQFLQISSIMSTDQIYGIGEQNRPFLHQLSNGWERIGLWARDNPIETFMNLYGAHPFYIGMPDDGKAFGVFHFNSNGQEFALQPAPAVTYRTIGGILDFFIFTGGSPEETVKQYLELVGKPMLPPYWSLGFHLSKWGYKNIEQLSEIFQRNINAGFPIGTQWSDIDYMENYKDFTVDKEKFNGLGRFVREIKQKYNSRFVAIVDPGISCTS-GNEYPPYYEGVFMDIFIKDSQTNQPIVGKVWPGETVYPDFTHPNISMYWYKQIQRFYNDVPIDGLWIDMNEPSNFYDGSKRGCQGNSKYDNPFFVPDIRDQSLISKTICSSALHYNNEKHYNLHNLYGYTESVTTNKALLKTIHGKRPFILSRSTFSGSGKYTFHWTGDNQASWDQLRNSIRQVLNFNMFGIPMTGADICGFNGNSDEELCIRWMQLGAFYPFMRNHNAINQRDQDPASWNTEAQKIMKTAISNRYAMLPLFYTLLVKSHMNGGTVMRPMSFEFFSDKVTHSIELQFMIGSSIMATPVVYPGARSVDAYFPAGVWYDFHS------GKL-----------LHSDAEGAWLTLDAPLDKINIALRGGHIVPLLDSNRNSKSNIPNKMTLYCGMAQDMSASGDLYWDDGESIDSYSRNRYSYVSFNASPEQL---LITPVYFGYDLLPVLNKIVILGFENKSITKFLLNDNDIP---FHYNPET 2861
            QC +  N+ R DC P+    Q+ C ARGCC+   +     LQG  +  P+C++P  Y +Y +++L  S  G  A L R +P++ P ++  L L+V+ ET++R    I DP  +RYEVP++      + P+   Y V   S+  F + ++R+ D R L   +  PL ++DQFLQ+S+ + +  I G+ E   P +  LS  W RI LW RD       NLYG+HPFY+ + D G A GVF  NSN  +  LQP+PA+++R+ GGILD +IF G  P+  V+QYL++VG P +PPYW LGFHL +WGY +     ++ +    A FP+  QW+D+DYM++ +DFT +K+ F      V+E+ Q    R++ IVDP IS +     Y PY EG+   +FI + +T QP++GKVWPG T +PDFT+P    +W   +  F++ VP DG+WIDMNEPSNF  GS+ GC  N++ +NP +VP +   +L + TIC+S+ H     HYNLHNLYG TE++ +++AL+K   G RPF++SRSTF+G G+Y  HWTGD  +SW+QL +S+ ++L FN+ G+P+ GAD+CGF GN+ EELC+RW QLGAFYPFMRNHN++    Q+P S++  AQ+ M+ A++ RYA+LP  YTL  ++H+ G TV RP+  EF  D  T +++ Q + G +++ TPV+  G   V  YFP G WYD  +      G L           +HS  EG W+TL APLD IN+ LR G+I+PL      +  +    M L   + +   A G+L+WDDGES++   R  Y+ V F A    +   L+     G  L   L K+ +LG             N +P   F Y+P+T
Sbjct:   81 QCDVPPNS-RFDCAPDKAITQEQCEARGCCY---IPAKQGLQGAQMGQPWCFFPPSYPSYKLENLSSSEMGYTATLTRTTPTFFPKDILTLRLDVMMETENRLHFTIKDPANRRYEVPLETPHVHSRAPSPL-YSVEF-SEEPFGVIVRRQLDGRVLLNTTVAPLFFADQFLQLSTSLPSQYITGLAEHLSPLM--LSTSWTRITLWNRDLAPTPGANLYGSHPFYLALEDGGSAHGVFLLNSNAMDVVLQPSPALSWRSTGGILDVYIFLGPEPKSVVQQYLDVVGYPFMPPYWGLGFHLCRWGYSSTAITRQVVENMTRAHFPLDVQWNDLDYMDSRRDFTFNKDGFRDFPAMVQELHQG-GRRYMMIVDPAISSSGPAGSYRPYDEGLRRGVFITN-ETGQPLIGKVWPGSTAFPDFTNPTALAWWEDMVAEFHDQVPFDGMWIDMNEPSNFIRGSEDGCP-NNELENPPYVPGVVGGTLQAATICASS-HQFLSTHYNLHNLYGLTEAIASHRALVKA-RGTRPFVISRSTFAGHGRYAGHWTGDVWSSWEQLASSVPEILQFNLLGVPLVGADVCGFLGNTSEELCVRWTQLGAFYPFMRNHNSLLSLPQEPYSFSEPAQQAMRKALTLRYALLPHLYTLFHQAHVAGETVARPLFLEFPKDSSTWTVDHQLLWGEALLITPVLQAGKAEVTGYFPLGTWYDLQTVPVEALGSLPPPPAAPREPAIHS--EGQWVTLPAPLDTINVHLRAGYIIPLQGPGLTTTESRQQPMALAVALTKGGEARGELFWDDGESLEVLERGAYTQVIFLARNNTIVNELVRVTSEGAGL--QLQKVTVLGVATAPQQVL---SNGVPVSNFTYSPDT 932          
BLAST of Lysosomal alpha-glucosidase vs. UniProt
Match: sp|Q9MYM4|LYAG_BOVIN (Lysosomal alpha-glucosidase OS=Bos taurus OX=9913 GN=GAA PE=2 SV=1)

HSP 1 Score: 671.003 bits (1730), Expect = 0.000e+0
Identity = 337/816 (41.30%), Postives = 489/816 (59.93%), Query Frame = 3
Query:  312 ATAQCQIANNNERLDCYPESGANQDSCIARGCCWSEPMRLSNKLQGVPLSIPYCYYPTDYSNYMIKSLRKSSRGIKAKLVRESPSYLPYEVAMLDLEVIYETKSRTRVRITDPKQKRYEVPMKLSPPDLKPPTDREYEVIIPSDGSFSIEIKRKSDDRSLF-KSFGPLLYSDQFLQISSIMSTDQIYGIGEQNRPFLHQLSNGWERIGLWARDNPIETFMNLYGAHPFYIGMPDDGKAFGVFHFNSNGQEFALQPAPAVTYRTIGGILDFFIFTGGSPEETVKQYLELVGKPMLPPYWSLGFHLSKWGYKNIEQLSEIFQRNINAGFPIGTQWSDIDYMENYKDFTVDKEKFNGLGRFVREIKQKYNSRFVAIVDPGISCTS-GNEYPPYYEGVFMDIFIKDSQTNQPIVGKVWPGETVYPDFTHPNISMYWYKQIQRFYNDVPIDGLWIDMNEPSNFYDGSKRGCQGNSKYDNPFFVPDIRDQSLISKTICSSALHYNNEKHYNLHNLYGYTESVTTNKALLKTIHGKRPFILSRSTFSGSGKYTFHWTGDNQASWDQLRNSIRQVLNFNMFGIPMTGADICGFNGNSDEELCIRWMQLGAFYPFMRNHNAINQRDQDPASWNTEAQKIMKTAISNRYAMLPLFYTLLVKSHMNGGTVMRPMSFEFFSDKVTHSIELQFMIGSSIMATPVVYPGARSVDAYFPAGVWYDFHS---------------GKLLHSDAEGAWLTLDAPLDKINIALRGGHIVPLLDSNRNSKSNIPNKMTLYCGMAQDMSASGDLYWDDGESIDSYSRNRYSYVSFNA 2708
            A  QC +  N+ R DC P+ G     C ARGCC+  P       Q   +  P+C++P  Y +Y +++L  +  G  A L R  P++ P ++  L L+++ ET+SR    I DP  +RYEVP++ +P          Y V   S+  F + ++RK D R L   +  PL ++DQFLQ+S+ + +  I G+ E     +  LS  W +I LW RD   E  +NLYG+HPFY+ + D G A GVF  NSN  +  LQP+PA+++R+ GGILD +IF G  P+  V+QYL++VG P +PPYW LGFHL +WGY       ++ +    A FP+  QW+D+DYM+  +DFT +K+ F      V+E+ Q    R++ IVDP IS +     Y PY EG+   +FI + +T QP++G+VWPG T +PDFT+P    +W   +  F+  VP DG+WIDMNEPSNF  GS  GC  NS  +NP ++P +   +L + TIC+S+ H     HY+LHNLYG TE++ +++AL+K   G RPF++SRSTF+G G+Y+ HWTGD  ++W+QL  S+ ++L FN+ G+P+ GADICGF GN+ EELC+RW QLGAFYPFMRNHNA+N + Q+P  ++  AQ+ M+ A + RY +LP  YTL  ++H+ G TV RP+  EF  D  T +++ Q + G +++ TPV+      V  YFP G WYD  +                 ++HS  +G W+TL APLD IN+ LR GHI+P+      +  +    M L   +     A G+L+WDDGES+       Y+ + F A
Sbjct:   66 APTQCDLPPNS-RFDCAPDKGITPQQCEARGCCYM-PAEWPPDAQ---MGQPWCFFPPSYPSYRLENLTTTETGYTATLTRAVPTFFPKDIMTLRLDMLMETESRLHFTIKDPANRRYEVPLE-TPRVYSQAPFTLYSVEF-SEEPFGVVVRRKLDGRVLLNTTVAPLFFADQFLQLSTSLPSQHITGLAEHLGSLM--LSTNWTKITLWNRDIAPEPNVNLYGSHPFYLVLEDGGLAHGVFLLNSNAMDVVLQPSPALSWRSTGGILDVYIFLGPEPKSVVQQYLDVVGYPFMPPYWGLGFHLCRWGYSTSAITRQVVENMTRAYFPLDVQWNDLDYMDARRDFTFNKDHFGDFPAMVQELHQG-GRRYIMIVDPAISSSGPAGTYRPYDEGLRRGVFITN-ETGQPLIGQVWPGLTAFPDFTNPETLDWWQDMVTEFHAQVPFDGMWIDMNEPSNFVRGSVDGCPDNS-LENPPYLPGVVGGTLRAATICASS-HQFLSTHYDLHNLYGLTEALASHRALVKA-RGMRPFVISRSTFAGHGRYSGHWTGDVWSNWEQLSYSVPEILLFNLLGVPLVGADICGFLGNTSEELCVRWTQLGAFYPFMRNHNALNSQPQEPYRFSETAQQAMRKAFTLRYVLLPYLYTLFHRAHVRGETVARPLFLEFPEDPSTWTVDRQLLWGEALLITPVLEAEKVEVTGYFPQGTWYDLQTVPMEAFGSLPPPAPLTSVIHS--KGQWVTLSAPLDTINVHLRAGHIIPMQGPALTTTESRKQHMALAVALTASGEAQGELFWDDGESLGVLDGGDYTQLIFLA 865          
BLAST of Lysosomal alpha-glucosidase vs. TrEMBL
Match: gnl|BL_ORD_ID|25055663 (tr|A0A1D1VXK3|A0A1D1VXK3_RAMVA P-type domain-containing protein OS=Ramazzottius varieornatus OX=947166 GN=RvY_16194-1 PE=3 SV=1)

HSP 1 Score: 768.844 bits (1984), Expect = 0.000e+0
Identity = 379/859 (44.12%), Postives = 544/859 (63.33%), Query Frame = 3
Query:  312 ATAQCQIANNNERLDCYPESGANQDSCIARGCCWSEPMRLSNKLQGVPLSIPYCYYPTDYSNYMIKSLRKSSRGIKAKLVR--ESPSYLPYEVAMLDLEVIYETKSRTRVRITDPKQKRYEVPMKLSP--PDLKPPTDREYEVIIPSDGSFSIEIKRKSDDRSLFKSF-GPLLYSDQFLQISSIMSTDQIYGIGEQ-NRPFLHQLSNGWERIGLWARDNPIETFMNLYGAHPFYIGMPDDGKAFGVFHFNSNGQEFALQPAPAVTYRTIGGILDFFIFTGGSPEETVKQYLELVGKPMLPPYWSLGFHLSKWGYKNIEQLSEIFQRNINAGFPIGTQWSDIDYMENYKDFTVDKEKFNGLGRFVREIKQKYNSRFVAIVDPGISCTSG-NEYPPYYEGVFMDIFIKDSQTNQPIVGKVWPGE-TVYPDFTHPNISMYWYKQIQRFYNDVPIDGLWIDMNEPSNFYDGSKRGCQGNSKYDNPFFVPDIRDQSLISKTICSSALHYNNEKHYNLHNLYGYTESVTTNKALLKTIHGKRPFILSRSTFSGSGKYTFHWTGDNQASWDQLRNSIRQVLNFNMFGIPMTGADICGFNGNSDEELCIRWMQLGAFYPFMRNHNAINQRDQDPASWNTEAQKIMKTAISNRYAMLPLFYTLLVKSHMNGGTVMRPMSFEFFSDKVTHSIELQFMIGSSIMATPVVYPGARSVDAYFPAGVWYDFHSGKLLHSDAEGAWLTLDAPLDKINIALRGGHIVPLLDSNRNSKSNIPNKMTLYCGMAQDMSASGDLYWDDGESIDSYSRNRYSYVSFNASPEQLLITPVYFGYDLLPVLNKIVILGFENKSITKFLLN-DNDIPFHYNPET 2861
            + A C    +++R DC P+   ++ SC+ARGCCW++   +      V L +P C+YP  Y  Y +++ ++++ G +  L R  ++    P  +  L L+VI++T  R  V+ITD  + RYEVP+ + P  P  KP T   Y+ ++  +  FS ++KRKS    L  +      + DQF+QISS++ +  IYG+GE  +  FLH ++  W++  +W  D        LYG HPFY  M +DG A GV  FNSN  +  LQP PA+TYRTIGG+LDF+ F G SP++   QY+EL+GKP +PPYW+LG+HL +WGY ++E   ++ +RN+ AG P+  QW+DIDYM+  KDFT+D  KFNG+  FV E+  K   R+V IVDPGIS       Y  Y +G+ M++F++++ ++Q I G+VW G    YPDFTHPNIS YW KQI  F   VP+DGLWIDMNEPSNF DGS  GC  +S  +NP ++P+I  ++L ++T+C +A H+    HYNLH+ YG  ++  T  ALL+    KRPF++SRSTF G G+Y+ HWTGD  +SW  L+ SI  +LNFNMFGIP  GADICGF  N+ EELC+RW QLGAFYPF RNHNA++ RDQDPA+W+  A + ++T +  RY++LP + TLL ++ ++G TV+RP+ FEF  DK T+SI+ QF+IGSS+M +PV  P    + AY P G W+DF+S K + SD  G W+ LDAPLDK+N+ LR G IVP+      +     N + L   + +   A G++YWDDGE +D   +  +S V F     +L  T V   Y  +P +  + ++G E +++ K + N   ++ F +N  T
Sbjct:  186 SNAVCSTMADDDRFDCLPQGDISEASCMARGCCWNQRSSVQMVNGTVKLGLPACFYPYKYPTYRLENYKETANGFEGTLQRSKDAKDIYPNPINSLRLQVIFDTAQRLHVKITDATKDRYEVPLPVLPGAPFSKPDTTL-YDFVVTKE-PFSFQVKRKSTGGVLVDTATNTFAFYDQFIQISSLLPSKYIYGLGEHTDAHFLHSVN--WKQFTMWTTDIYPNLETPLYGVHPFYFSMEEDGDANGVLLFNSNAMDVILQPTPAITYRTIGGVLDFYFFLGPSPQDVTSQYMELLGKPQMPPYWALGYHLCRWGYGSVENTRKVMERNLAAGIPLDAQWNDIDYMDKNKDFTIDGSKFNGITEFVNEVHAK-GLRYVVIVDPGISSAEAPGSYQAYTDGLAMNVFVQNA-SDQVIEGRVWTGNPQAYPDFTHPNISQYWLKQITDFRKVVPVDGLWIDMNEPSNFVDGSMVGCPKDSSLENPPYLPNIAGKTLNTRTLCMTAKHHAG-LHYNLHSTYGIYQAKATQAALLQVFPNKRPFVVSRSTFVGQGQYSAHWTGDESSSWSDLQTSIGDILNFNMFGIPFVGADICGFGDNATEELCLRWHQLGAFYPFSRNHNAVSNRDQDPAAWSPAATEAIRTVLLTRYSLLPYYSTLLFRASISGHTVVRPLFFEFAHDKRTYSIDAQFLIGSSVMLSPVTTPNTTKILAYLPEGRWFDFYSLKKI-SDKGGEWIELDAPLDKVNVHLREGGIVPMQKPEVTTGKTRQNPIDLVVMLDKTGKACGEVYWDDGEQMDVLQKGDFSLVQFEMKNGKLKSTVVNDKYKDVPAMGSVRVVGLE-RTVKKVVWNGGEEVDFVFNDHT 1035          
BLAST of Lysosomal alpha-glucosidase vs. TrEMBL
Match: gnl|BL_ORD_ID|17188243 (tr|A0A4Z2D8T0|A0A4Z2D8T0_SCHJA Lysosomal alpha-glucosidase OS=Schistosoma japonicum OX=6182 GN=EWB00_003283 PE=3 SV=1)

HSP 1 Score: 755.747 bits (1950), Expect = 0.000e+0
Identity = 382/871 (43.86%), Postives = 537/871 (61.65%), Query Frame = 3
Query:  312 ATAQCQIANNNERLDCYPESGANQDSCIARGCCWSEPMRLSNKLQGVPLSIPYCYYPTDYSNYMIKSLRKSSRGIKAKLVRESPSYLPYEVAMLDLEVIYETKSRTRVRITDPKQ-KRYEVPMKLSPPDLKPPTDREYEVIIPSDGSFSIEIKRKSDDRS-LFKSFGPL----LYSDQFLQISSIMSTDQIYGIGEQNRPFLHQLSNGWERIGLWARDNPIETFMNLYGAHPFYIGMPDDGKAFGVFHFNSNGQEFALQPAPAVTYRTIGGILDFFIFTGGSPEETVKQYLELVGKPMLPPYWSLGFHLSKWGYKNIEQLSEIFQRNINAGFPIGTQWSDIDYMENYKDFTVDKEKFNGLGRFVREIKQK-YNSRFVAIVDPGISCTSGNEYPPYYEGVFMDIFIKDSQTNQPIVGKVWPGETVYPDFTHPNISMYWYKQIQRFYNDVPIDGLWIDMNEPSNFYDGSKRGCQGNSKYDNPFFVPDIRDQSLISKTICSSALHYNNEKHYNLHNLYGYTESVTTNKALLKTIHGKRPFILSRSTFSGSGKYTFHWTGDNQASWDQLRNSIRQVLNFNMFGIPMTGADICGFNGNSDEELCIRWMQLGAFYPFMRNHNAINQRDQDPASWNTEAQKIMKTAISNRYAMLPLFYTLLVKSHMNGGTVMRPMSFEFFSDKVTHSIELQFMIGSSIMATPVVYPGARSVDAYFPAGVWYDFHSGKLLHSDAEGAWLTLDAPLDKINIALRGGHIVPLLDSNRNSKSNIPNKMTLYCGM----------AQDMSASGDLYWDDGESIDSYSRNRYSYVSFNASPEQLLITPVYFGYDLLPVLN-------KIVILGFENKSITKFLLNDNDIPFHYN 2852
            + A C    N +RLDCYP  G+N+  CI RGCCW      +N+  G    +PYCY+P DYS Y + S +++  G  A+L + +P+Y   E+  + +E+  ET +R R+R T P Q  R+E  ++L  PD  P  + +Y+V +     F ++I R + ++  L  S G L    + SDQFLQIS  ++ +  +G GE  + + +     W R+GLW  D    ++ NLYG H F++G+  DG AFGVF  NSN QE A+ P PA+TYRTIGGILDFF+FTG  P + + QY  L+G P LPPYWSLGFHL ++G KN+ ++  + +RN+ AG PI  QW DIDYM+ YK ++VDK++F+G+G +V +I  K Y+ R V IVDP +S   G+ Y PY +G+ + +FI DS+T  PI+G VWPGETV+PDF+HP+   +WYK    FY  V  DGLWIDMNEP+NF  GS  GC   +K DNP ++P I   SL  KTIC SALHYN   HYNLHN+YGY E+  T+  L +    +RPFIL+RS+++GSG Y  HWTGD  ++WD L+ S+ Q++NFNMFGIPM GADICGF GN+ +ELC+RW QLGAFYPF RNHN     DQDPA W+ +  + +K ++  RY +LP  YTL  ++++NG TV R ++FEF  D  TH I  QFM+GS I+ TPV+  G   V+ Y P+G W +  +GK   S   G W+  DAPL+ I I+ R G I+P+  +   +         L+  +           + ++ASG+L+WD+G+     ++  Y Y+ F     +L +       D    ++        ++I+GF  K + +FLLND  IPF Y+
Sbjct:   21 SNAHCSDITNVQRLDCYPNVGSNESGCIERGCCWMP----NNEQDG----LPYCYFPKDYSAYTVVSTQQTKNGFIAQLSKLNPTYYSDEIKNIAVEMREETSTRLRLRFTAPSQPNRWEPSIQLGNPDNIPIENVQYKVSM-EKSPFGLKIMRNTKEQEVLLDSTGSLSSSFIVSDQFLQISFRVNAETSFGPGEVEQKYPNDFET-WTRLGLWGHDGDPHSYANLYGTHNFFMGLKHDGTAFGVFFLNSNAQELAITPLPAITYRTIGGILDFFVFTGPKPLDVLNQYYTLIGHPTLPPYWSLGFHLCRYGMKNLSEVRSVLKRNVEAGIPIDAQWFDIDYMDAYKIWSVDKKRFDGIGTYVNDILHKQYSMRTVIIVDPAVSTKGGSGYLPYEDGMRLGVFINDSRTGTPIIGTVWPGETVFPDFSHPSTEDWWYKSASDFYEVVNFDGLWIDMNEPANFNGGSLTGCPSWNKLDNPPYIPKIIQNSLYDKTICPSALHYNT-THYNLHNMYGYHEARVTHNVLKRLFPDRRPFILTRSSYAGSGMYAAHWTGDVLSNWDSLKASVAQIINFNMFGIPMVGADICGFVGNTTQELCVRWSQLGAFYPFSRNHNEDEASDQDPAYWSKDTIEAIKESLELRYHLLPYIYTLFYRAYLNGTTVARALAFEFPEDLSTHKINAQFMLGSCILVTPVLDEGRVGVEGYVPSGEWINLSTGKRYFS--RGTWMYFDAPLNIIPISTRCGCIIPIQIAAETTDIARKKGFGLFVILSSSDDGSDASGERITASGELFWDNGDD----AKLNYVYIKFEVRNRKLSVISTPSSVDTFQKIDLNELEVKTVLIVGFLRKPL-EFLLNDKAIPFMYD 873          
BLAST of Lysosomal alpha-glucosidase vs. TrEMBL
Match: gnl|BL_ORD_ID|20414719 (tr|H2KPA9|H2KPA9_CLOSI Lysosomal alpha-glucosidase OS=Clonorchis sinensis OX=79923 GN=CLF_101613 PE=3 SV=1)

HSP 1 Score: 748.043 bits (1930), Expect = 0.000e+0
Identity = 386/869 (44.42%), Postives = 524/869 (60.30%), Query Frame = 3
Query:  321 QCQIANNNERLDCYPESGANQDSCIARGCCWSEPMRLSNKLQGVPLS---IPYCYYPTDYSNYMIKSLRKSSRGIKAKLVRESPSYLPYEVAMLDLEVIYETKSRTRVRITDPKQ-KRYEVPMKLSPPDLKPPTDREYEVIIPSDGSFSIEIKRKSDDRS-LFKSFGPL----LYSDQFLQISSIMSTDQIYGIGEQNRPFLHQLSNGWERIGLWARDNPIETFMNLYGAHPFYIGMPDDGKAFGVFHFNSNGQEFALQPAPAVTYRTIGGILDFFIFTGGSPEETVKQYLELVGKPMLPPYWSLGFHLSKWGYKNIEQLSEIFQRNINAGFPIGTQWSDIDYMENYKDFTVDKEKFNGLGRFVRE-IKQKYNSRFVAIVDPGISCTSGNEYPPYYEGVFMDIFIKDSQTNQPIVGKVWPGETVYPDFTHPNISMYWYKQIQRFYNDVPIDGLWIDMNEPSNFYDGSKRGCQGNSKYDNPFFVPDIRDQSLISKTICSSALHYNNEKHYNLHNLYGYTESVTTNKALLKTIHGKRPFILSRSTFSGSGKYTFHWTGDNQASWDQLRNSIRQVLNFNMFGIPMTGADICGFNGNSDEELCIRWMQLGAFYPFMRNHNAINQRDQDPASWNTEAQKIMKTAISNRYAMLPLFYTLLVKSHMNGGTVMRPMSFEFFSDKVTHSIELQFMIGSSIMATPVVYPGARSVDAYFPAGVWYDFHSGKLLHSDAEGAWLTLDAPLDKINIALRGGHIVPLLDSNRNSKSNIPNKMTLYCGMA---------QDMSASGDLYWDDGESIDSYSRNRYSYVSFNASPEQLLITPVYFGYDLLPVLN------KIVILGFENKSITKFLLNDNDIPFHYN 2852
            QC     +ERLDCYPE+GAN+D+CI +GCCWS          G+  +   IP CY+P DY  Y ++++ ++ RG  A + + +  Y   E   + +EV++ETK+R RVR T P    R+E P+ L  PD+  P   +Y V +     F I + R    R  L  S G +    ++SDQFLQ S  +  +  +G GE    F H L   W R+GLW RDN      NLYG H F++G+  DG AFGVF  NSN QE  L P PA+TYRTIGGILDFFIFTG  P +   QYL L+G P+LPPYWSLGFHL ++GY++ E+++   +RNI AG P+  QW DIDYM+ Y+ +TVD  KF GL   +++ +  KY  R V IVDP +S      Y P+ +G    IFI DS+T  PI G VWPG+TV+PDF+HP    + Y     F+  VP DGLWIDMNEP++F  GSK  C   +  DNP FVP I D+SL +KT+C SALH+++  HYN HNLYGY  +  T+  L +   GKRPF+LSRSTFSGSG YT HWTGDN +SW  +R SI Q++NFN+FGIPM GADICGF GN+ EELC+RW QLGAFYPF RNHN +    QDPA W+  A + ++ AI  RY +LP  Y+L  ++H+NG TV R +SFEF  D  TH+++ QFM+GS I+ TPV+  G   V  Y PAG W +  +G+  +S  +  +    APL+ I I +RGG +VP   S   +K +    + L   ++         Q  +A G+L+WDDGE+        Y YV+F  +  +L I P     D +  ++      K +++   ++   + LLN   + + ++
Sbjct:   28 QCGPFPISERLDCYPEAGANKDACINKGCCWS----------GITFTEPHIPMCYFPKDYRTYTVRNVTQNPRGFVADMEKITSPYGVNEFQNVRVEVLHETKTRLRVRFTIPSDPNRWEPPIPLGKPDVNAPEPTDYAVEL-EKSPFGIRVVRNDPIRQMLLDSTGDMSVSTIFSDQFLQTSFRLGAEHGFGPGEVRADFPHWLRRTWLRMGLWTRDNAPMKEANLYGVHNFFMGLSPDGSAFGVFLINSNAQEVVLTPLPAITYRTIGGILDFFIFTGPDPMDVTAQYLSLIGHPLLPPYWSLGFHLCRFGYRDSEEVANTVERNIKAGIPVDAQWIDIDYMDAYRVWTVDPTKFGGLPSLIQDTLHSKYGIRNVLIVDPAVSAKDDPTYAPFLDGFKRGIFINDSRTGSPIEGVVWPGDTVFPDFSHPEAEAWLYNLASEFHKSVPFDGLWIDMNEPASFAAGSKTNCDQTNPLDNPPFVPPILDRSLYAKTVCPSALHHDS-THYNRHNLYGYDHARVTHNVLKQLFAGKRPFLLSRSTFSGSGLYTIHWTGDNLSSWPDMRASIAQIINFNLFGIPMVGADICGFRGNTTEELCVRWSQLGAFYPFARNHNDLASIPQDPAVWSKAATEAIRDAIKLRYLLLPYMYSLFYRAHLNGTTVARALSFEFPRDTNTHTVKEQFMLGSCILVTPVLDEGRTDVTGYVPAGYWINLSTGRRDYSTGQVKY--FQAPLNVIPILVRGGCVVPFQTSFEVTKISRKKGIALLVVLSTTDDGTLIPQTGTAKGELFWDDGEA----DPLNYVYVNFTVANRELHIVPKPLNADTIRSIDPQETQIKSILINGLSQEPKQVLLNKAPVAYTFD 878          
BLAST of Lysosomal alpha-glucosidase vs. TrEMBL
Match: gnl|BL_ORD_ID|20355062 (tr|A0A419PZA5|A0A419PZA5_CLOSI Lysosomal alpha-glucosidase OS=Clonorchis sinensis OX=79923 GN=Gaa PE=3 SV=1)

HSP 1 Score: 747.273 bits (1928), Expect = 0.000e+0
Identity = 385/869 (44.30%), Postives = 524/869 (60.30%), Query Frame = 3
Query:  321 QCQIANNNERLDCYPESGANQDSCIARGCCWSEPMRLSNKLQGVPLS---IPYCYYPTDYSNYMIKSLRKSSRGIKAKLVRESPSYLPYEVAMLDLEVIYETKSRTRVRITDPKQ-KRYEVPMKLSPPDLKPPTDREYEVIIPSDGSFSIEIKRKSDDRS-LFKSFGPL----LYSDQFLQISSIMSTDQIYGIGEQNRPFLHQLSNGWERIGLWARDNPIETFMNLYGAHPFYIGMPDDGKAFGVFHFNSNGQEFALQPAPAVTYRTIGGILDFFIFTGGSPEETVKQYLELVGKPMLPPYWSLGFHLSKWGYKNIEQLSEIFQRNINAGFPIGTQWSDIDYMENYKDFTVDKEKFNGLGRFVRE-IKQKYNSRFVAIVDPGISCTSGNEYPPYYEGVFMDIFIKDSQTNQPIVGKVWPGETVYPDFTHPNISMYWYKQIQRFYNDVPIDGLWIDMNEPSNFYDGSKRGCQGNSKYDNPFFVPDIRDQSLISKTICSSALHYNNEKHYNLHNLYGYTESVTTNKALLKTIHGKRPFILSRSTFSGSGKYTFHWTGDNQASWDQLRNSIRQVLNFNMFGIPMTGADICGFNGNSDEELCIRWMQLGAFYPFMRNHNAINQRDQDPASWNTEAQKIMKTAISNRYAMLPLFYTLLVKSHMNGGTVMRPMSFEFFSDKVTHSIELQFMIGSSIMATPVVYPGARSVDAYFPAGVWYDFHSGKLLHSDAEGAWLTLDAPLDKINIALRGGHIVPLLDSNRNSKSNIPNKMTLYCGMA---------QDMSASGDLYWDDGESIDSYSRNRYSYVSFNASPEQLLITPVYFGYDLLPVLN------KIVILGFENKSITKFLLNDNDIPFHYN 2852
            QC     +ERLDCYPE+GAN+D+CI +GCCWS          G+  +   IP CY+P DY  Y ++++ ++ RG  A + + +  Y   E   + +EV++ETK+R RVR T P    R+E P+ L  PD+  P   +Y V +     F I + R    R  L  S G +    ++SDQFLQ S  +  +  +G GE    F H L   W R+GLW RDN      NLYG H F++G+  DG AFGVF  NSN QE  L P PA+TYRTIGGILDFFIFTG  P +   QYL L+G P+LPPYWSLGFHL ++GY++ E+++   +RNI AG P+  QW DIDYM+ Y+ +TVD  KF GL   +++ +  KY  R V IVDP +S      Y P+ +G    IFI DS+T  PI G VWPG+TV+PDF+HP    + Y     F+  VP DGLWIDMNEP++F  GSK  C   +  DNP FVP I D+SL +KT+C SALH+++  HYN HNLYGY  +  T+  L +   GKRPF+LSRSTFSGSG YT HWTGDN +SW  +R SI Q++NFN+FGIPM GADICGF GN+ EELC+RW QLGAFYPF RNHN +    QDPA W+  A + ++ AI  RY +LP  Y+L  ++H+NG TV R ++FEF  D  TH+++ QFM+GS I+ TPV+  G   V  Y PAG W +  +G+  +S  +  +    APL+ I I +RGG +VP   S   +K +    + L   ++         Q  +A G+L+WDDGE+        Y YV+F  +  +L I P     D +  ++      K +++   ++   + LLN   + + ++
Sbjct:   28 QCGPFPISERLDCYPEAGANKDACINKGCCWS----------GITFTEPHIPMCYFPKDYRTYTVRNVTQNPRGFVADMEKITSPYGVNEFQNVRVEVLHETKTRLRVRFTIPSDPNRWEPPIPLGKPDVNAPEPTDYAVEL-EKSPFGIRVVRNDPIRQMLLDSTGDMSVSTIFSDQFLQTSFRLGAEHGFGPGEVRADFPHWLRRTWLRMGLWTRDNAPMKEANLYGVHNFFMGLSPDGSAFGVFLINSNAQEVVLTPLPAITYRTIGGILDFFIFTGPDPMDVTAQYLSLIGHPLLPPYWSLGFHLCRFGYRDSEEVANTVERNIKAGIPVDAQWIDIDYMDAYRVWTVDPTKFGGLPSLIQDTLHSKYGIRNVLIVDPAVSAKDDPTYAPFLDGFKRGIFINDSRTGSPIEGVVWPGDTVFPDFSHPEAEAWLYNLASEFHKSVPFDGLWIDMNEPASFAAGSKTNCDQTNPLDNPPFVPPILDRSLYAKTVCPSALHHDS-THYNRHNLYGYDHARVTHNVLKQLFAGKRPFLLSRSTFSGSGLYTIHWTGDNLSSWPDMRASIAQIINFNLFGIPMVGADICGFRGNTTEELCVRWSQLGAFYPFARNHNDLASIPQDPAVWSKAATEAIRDAIKLRYLLLPYMYSLFYRAHLNGTTVARALAFEFPRDTNTHTVKEQFMLGSCILVTPVLDEGRTDVTGYVPAGYWINLSTGRRDYSTGQVKY--FQAPLNVIPILVRGGCVVPFQTSFEVTKVSRKKGIALLVVLSTTDDGTLIPQTGTAKGELFWDDGEA----DPLNYVYVNFTVANRELHIVPKPLNADTIRSIDPQETQIKSILINGLSQEPKQVLLNKAPVAYTFD 878          
BLAST of Lysosomal alpha-glucosidase vs. TrEMBL
Match: gnl|BL_ORD_ID|22927525 (tr|A0A4S2MAN8|A0A4S2MAN8_OPIFE P-type domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_002390 PE=3 SV=1)

HSP 1 Score: 743.421 bits (1918), Expect = 0.000e+0
Identity = 378/821 (46.04%), Postives = 505/821 (61.51%), Query Frame = 3
Query:  321 QCQIANNNERLDCYPESGANQDSCIARGCCWSEPMRLSNKLQGVPLSIPYCYYPTDYSNYMIKSLRKSSRGIKAKLVRESPSYLPYEVAMLDLEVIYETKSRTRVRITDPKQ-KRYEVPMKLSPPDLKPPTDREYEVIIPSDGSFSIEIKRKSDDRS-LFKSFGPL----LYSDQFLQISSIMSTDQIYGIGEQNRPFLHQLSNGWERIGLWARDNPIETFMNLYGAHPFYIGMPDDGKAFGVFHFNSNGQEFALQPAPAVTYRTIGGILDFFIFTGGSPEETVKQYLELVGKPMLPPYWSLGFHLSKWGYKNIEQLSEIFQRNINAGFPIGTQWSDIDYMENYKDFTVDKEKFNGLGRFVRE-IKQKYNSRFVAIVDPGISCTSGNEYPPYYEGVFMDIFIKDSQTNQPIVGKVWPGETVYPDFTHPNISMYWYKQIQRFYNDVPIDGLWIDMNEPSNFYDGSKRGCQGNSKYDNPFFVPDIRDQSLISKTICSSALHYNNEKHYNLHNLYGYTESVTTNKALLKTIHGKRPFILSRSTFSGSGKYTFHWTGDNQASWDQLRNSIRQVLNFNMFGIPMTGADICGFNGNSDEELCIRWMQLGAFYPFMRNHNAINQRDQDPASWNTEAQKIMKTAISNRYAMLPLFYTLLVKSHMNGGTVMRPMSFEFFSDKVTHSIELQFMIGSSIMATPVVYPGARSVDAYFPAGVWYDFHSGKLLHSDAEGAWLTLDAPLDKINIALRGGHIVPLLDSNRNSKSNIPNKMTLYCGMA---------QDMSASGDLYWDDGESIDSYSRNRYSYVSFNASPEQLLITP 2735
            QC     +ERLDCYPE GAN+D+CI +GCCWS        +      IP CY+P DY  Y ++++ ++ RG  A + + +  Y   E   + +EV++ETK+R RVR   P    R+E P+ L  PD+  P   +Y V +     F I + R    R  L  S G L    ++SDQFLQ S  +  +  +G GE    F H L   W R+GLWARDN      NLYG H F++G+  DG AFGVF  NSN QE  L P PA+TYR IGGILDFFIFTG  P +   QYL L+G P+LPPYWSLGFHL ++GY++ E++++  +RN+ AG P+  QW DIDYM+ Y+ +TVD  KF GL   +++ +  KY  R V IVDP +S      Y P+ +G+   IFI DS+T  PI G VWPG+TV+PDF+HP    + Y    +F+  VP DGLWIDMNEP++F  GSK  C   + +DNP FVP I D+SL +KT+C SALH+++  HYN HNLYGY  +  T+  L +   GKRPF+LSRSTFSGSG YT HWTGDN +SW  +R SI Q++NFN+FGIPM GADICGF GN+ EELC+RW QLGAFYPF RNHN +    QDPA W+  A + ++ AI  RY +LP  Y+L  ++H+NG TV R ++FEF  D  TH++  QFM+GS I+ TPV+  G   V  Y PAG W +  +G+  +S  +  +    APL+ I I +RGG IVP   S   +K +    + L   ++         Q  +A G+L+WDDGE+        Y +V+F  +  +L I P
Sbjct:   28 QCGPFPISERLDCYPEEGANKDACINKGCCWS-------GIDFTEPHIPMCYFPKDYRTYTVRNVTQNPRGFVADMEKITSLYGVNEFQNVRVEVLHETKTRLRVRFAIPSDPNRWEPPIPLGKPDVDAPEPTDYAVEL-EKSPFGIRVVRNDPTRQMLLDSTGDLSVSTIFSDQFLQTSFRLGAEHGFGPGEVRADFPHWLRRTWIRMGLWARDNAPVKEANLYGVHNFFMGLSPDGSAFGVFLLNSNAQEVVLTPLPAITYRAIGGILDFFIFTGPEPIDVTAQYLSLIGHPLLPPYWSLGFHLCRYGYRDSEEVADTVERNVKAGIPLDAQWIDIDYMDAYRIWTVDSTKFGGLPSLIQDTLHSKYGIRNVLIVDPAVSAKDDPTYAPFQDGLKRGIFINDSRTGSPIEGVVWPGDTVFPDFSHPEAEAWVYNFASQFHKSVPFDGLWIDMNEPASFAAGSKTNCDQTNPFDNPPFVPLILDRSLYAKTVCPSALHHDS-THYNRHNLYGYDHARVTHNVLKQLFAGKRPFLLSRSTFSGSGLYTIHWTGDNLSSWPDMRASIAQIINFNLFGIPMVGADICGFRGNTTEELCVRWSQLGAFYPFSRNHNDLASIPQDPAVWSKTATEAIRDAIRLRYLLLPYMYSLFYRAHLNGTTVARALAFEFPRDTNTHTVGEQFMLGSCILVTPVLDEGRTDVTGYVPAGYWINLSTGRRDYSTGQVKY--FQAPLNVIPILVRGGCIVPFQTSFEVTKVSRKKGIALLVVLSTTDDGTSVPQTGTAKGELFWDDGEA----DPLNYVHVNFTVANRELHIVP 833          
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Cavefish
Match: si:ch73-12o23.1 (lysosomal alpha-glucosidase [Source:NCBI gene;Acc:103033787])

HSP 1 Score: 687.952 bits (1774), Expect = 0.000e+0
Identity = 342/797 (42.91%), Postives = 485/797 (60.85%), Query Frame = 3
Query:  324 CQIANNNERLDCYPESGA--NQDSCIARGCCWSEPMRLSNKLQGVPLSIPYCYYPTDYSNYMIKSLRKSSRGIKAKLVRESPSYLPYEVAMLDLEVIYETKSRTRVRITDPKQKRYEVPMKLSPPDLKPPTDREYEVIIPSDGSFSIEIKRKSDDRSLFKS-FGPLLYSDQFLQISSIMSTDQIYGIGEQNRPFLHQLSNGWERIGLWARDNPIETFMNLYGAHPFYIGMPDDGKAFGVFHFNSNGQEFALQPAPAVTYRTIGGILDFFIFTGGSPEETVKQYLELVGKPMLPPYWSLGFHLSKWGYKNIEQLSEIFQRNINAGFPIGTQWSDIDYMENYKDFTVDKEKFNGLGRFVREIKQKYNSRFVAIVDPGISCTS-GNEYPPYYEGVFMDIFIKDSQTNQPIVGKVWPGETVYPDFTHPNISMYWYKQIQRFYNDVPIDGLWIDMNEPSNFYDGSKRGCQGNSKYDNPFFVPDIRDQSLISKTICSSALHYNNEKHYNLHNLYGYTESVTTNKALLKTIHGKRPFILSRSTFSGSGKYTFHWTGDNQASWDQLRNSIRQVLNFNMFGIPMTGADICGFNGNSDEELCIRWMQLGAFYPFMRNHNAINQRDQDPASWNTEAQKIMKTAISNRYAMLPLFYTLLVKSHMNGGTVMRPMSFEFFSDKVTHSIELQFMIGSSIMATPVVYPGARSVDAYFPAGVWYDFHSGKLLHSDAEGAWLTLDAPLDKINIALRGGHIVPLLDSNRNSKSNIPNKMTLYCGMAQDMSASGDLYWDDGESIDSYSRNRYSYVSF 2702
            C +     R DCYPE G   N++ C  R CC+ +     +  Q     +P+C+YP D+ +Y + +  ++  G + KLVR   +Y P ++  L L+V+YE+ SR R+R+TDP + RYEVP+ +  P +K         +  ++  F + +KRK +   L  +   PL Y+DQFLQ+S+ ++++ +YG+GE    FLH +   W  + +W RD       NLYG HPFY+ M  DG A G F  NSN  +  LQPAPA+T+RTIGGILD ++F G  P   V +YLE+VGKP +P YW+LG+HL +WGY +     ++ ++  N   P   QW+DIDYM+   DFT D   F  L   V+++   ++  +V I+DPGIS T     Y P+ EG+   +FI +S  +  ++GKVWPG T +PDF++P+   +WY+ ++ F++ VP DGLWIDMNEPSNF DGS  GC  N   +NP + P +   SL +KT+C+SA    N  HYNLHNLYG  E+  +  AL K +  KRPF++SRSTFS  G Y+ HW GDN++ W  L  SI  +L FN+ GIP+ GADICGF+  + EELC+RW QLGAFYPF RNHN  + + QDP  ++  A+K M   +  RY++ P  YTL   +H++G TV RP+ FEF  D  T+ I+ QF+ G S++ TPV+ PG   V  Y P G+WYDF++G  L S  E   + L APLDKIN+ LR G I P    N     +    + L   + +D  A GDL+WDDGE+ID+Y  ++Y+Y  F
Sbjct:  103 CTLIPEGWRFDCYPERGVVVNEEMCHKRNCCFIQVAEEKSPGQN---GVPWCFYPPDFPSYELVTNNETEMGYRGKLVRRQKTYYPNDIETLQLDVLYESDSRLRIRVTDPAKDRYEVPIDV--PVVKKKASNPLYTVEFTEQPFGLIVKRKQNGAVLLNTTVAPLFYADQFLQMSTSLASEFVYGLGEHRSNFLHDVQ--WNTLTMWTRDAAPVELTNLYGVHPFYLLMESDGLAHGSFLLNSNAMDVVLQPAPALTWRTIGGILDLYVFVGPDPSSVVGEYLEVVGKPAMPIYWALGYHLCRWGYDSSNNTWDVVKKMRNNQIPQDVQWNDIDYMDRALDFTHDPVNFATLPDLVKDL-HIHDQHYVMILDPGISSTQPAGSYLPFQEGIKQGVFITNSSGDL-LIGKVWPGLTAFPDFSNPDTHEWWYQNLKTFHDQVPFDGLWIDMNEPSNFLDGSVDGCPSND-LENPPYTPAVLGGSLRAKTVCASARQKLN-SHYNLHNLYGLMEAKASASALKKLLK-KRPFVISRSTFSSHGVYSGHWLGDNRSQWKDLYMSIPGMLTFNILGIPLVGADICGFSATTTEELCVRWTQLGAFYPFTRNHNTKDSQAQDPTVFSPAARKAMTEVLLLRYSLFPFLYTLFHHAHLSGHTVARPLFFEFPRDLKTYKIDKQFLWGKSLLVTPVLAPGVDYVVGYLPQGIWYDFYTGDSLVSKGEE--IKLHAPLDKINLHLREGSITPTQRPNTTLWVSSSQPLHLIACLTEDGLAEGDLFWDDGETIDTYETDQYAYFIF 885          
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Cavefish
Match: gaa (glucosidase alpha, acid [Source:NCBI gene;Acc:103044115])

HSP 1 Score: 676.396 bits (1744), Expect = 0.000e+0
Identity = 353/833 (42.38%), Postives = 495/833 (59.42%), Query Frame = 3
Query:  312 ATAQCQIANNNERLDCYPESGANQDSCIARGCCWSEPMRLSNKLQGVPLSIPYCYYPTDYSNYMIKSLRKSSRGIKAKLVRESPSYLPYEVAMLDLEVIYETKSRTRVRITDPKQKRYEVPMKLSPPDLKPPTDRE---YEVIIPSDGSFSIEIKRKSDDRSLF-KSFGPLLYSDQFLQISSIMSTDQIYGIGEQNRPFLHQLSNGWERIGLWARDNPIETFMNLYGAHPFYIGMPDDGKAFGVFHFNSNGQEFALQPAPAVTYRTIGGILDFFIFTGGSPEETVKQYLELVGKPMLPPYWSLGFHLSKWGYKNIEQLSEIFQRNINAGFPIGTQWSDIDYMENYKDFTVDKEKFNGLGRFVREIKQKYNSRFVAIVDPGISCTSG-NEYPPYYEGVFMDIFIKDSQTNQPIVGKVWPGETVYPDFTHPNISMYWYKQIQRFYNDVPIDGLWIDMNEPSNFYDGSKRGCQGNSKYDNPFFVPDIRDQSLISKTICSSALHYNNEKHYNLHNLYGYTESVTTNKALLKTIHGKRPFILSRSTFSGSGKYTFHWTGDNQASWDQLRNSIRQVLNFNMFGIPMTGADICGFNGNSDEELCIRWMQLGAFYPFMRNHNAINQRDQDPASWNTEAQKIMKTAISNRYAMLPLFYTLLVKSHMNGGTVMRPMSFEFFSDKVTHSIELQFMIGSSIMATPVVYPGARSVDAYFPAGVWYDFHSGKLLHSDAEGAWLTLDAPLDKINIALRGGHIVPLLDSNRNSKSNIPNKMTLYCGMAQDMSASGDLYWDDGESIDSYSRNRYSYVSFNASPEQLLITP--VYFGYDLLPVLNKIVILG 2789
            A   C IA    R DC  +    Q  C  RGCC+   + L       P   P+C+YP  Y  Y +  L  +SRG +A L R + SYLP +V  L LEV+ E   R  + + DP Q RYEVP    PP    PTD +   Y+V    D  F   ++R S+ R L   +  PLL++DQ+LQ+S+ +++  + G GE        L+  W  + LW RD       NLYG+HPF +    DG+A+G+F  NSN  E   QPAPA+T+ T GGI+DF+IF G  P+   +QY +++G PM+PPYWSLGFHL +WGY +      + Q    A FP+  QW+D+DY +  + FT D ++F  L   V+E   +   ++V I+DPGIS TS    Y P+ EG    +FI++  T Q ++GKVWPG T +PDFT+P+   +W + I  FY  VP+DGLWIDMNEP+NF  GS  GC  ++  +NPF+VPD+    L + T+C S+   +   HYNLHNLYG TE++ T+ ALLK   G RPF+LSRS+F G G+Y+ HWTGD  + W+QLR SI  VL F ++G+P+ GADICGF G++ EELC+RW QLGAFYPFMRNHN  +   Q+P  +  +AQ  M++ +  RY++LP  YTL  ++  +  TV RP+  EF  D    +I+ QF+ GSS++ +PV+  GA  + AY P G+WY  + G+  +S   G +L L APLD IN+ +RGG I+P       + ++  N   L   ++ D  A G+L+WDDGES+ ++ R  YS++ F A   QL+  P  V    D L VL +I + G
Sbjct:   77 AGKDCGIAVE-RRFDCARDRALTQSQCEQRGCCY---VPLPKSAFSGP---PWCFYPVSYPGYRMGPLVPTSRGQEANLTRSTSSYLPRDVQTLTLEVMAEEAGRLHIALKDPSQDRYEVPFVAVPPTT--PTDTQSFLYDVEFQPD-PFGFVVRRASNGRVLLNTTVAPLLFADQYLQLSTTLASSLVSGFGEHYTGLTLDLN--WTSVTLWNRDMAPHRDTNLYGSHPFCLVQEGDGQAYGIFLLNSNAMEVVSQPAPALTWVTTGGIMDFYIFLGPDPQSVAQQYHQVIGYPMMPPYWSLGFHLCRWGYTSTNATRAVVQHMHQANFPLDVQWNDLDYADKRRVFTFDPQRFGDLPEMVKEFHSE-GMKYVLILDPGISSTSPPGSYKPFDEGERRGVFIRN-LTGQTLIGKVWPGPTAFPDFTNPDAVSWWEECIADFYAKVPVDGLWIDMNEPANFVQGSLLGCP-DTDLENPFYVPDMIGGQLNAGTLCMSS-QQSLSAHYNLHNLYGLTEAMATHSALLKA-RGSRPFVLSRSSFPGLGRYSGHWTGDVHSDWEQLRYSIPAVLLFGLYGVPLVGADICGFEGDTSEELCVRWTQLGAFYPFMRNHNDRSNAPQEPYVFGQQAQAAMRSVMMLRYSLLPFLYTLFHQAQTSASTVARPLFLEFPFDPNCQTIDQQFLWGSSLLISPVLEQGAVELTAYLPPGMWYSLYDGQPYNS--RGQYLLLSAPLDTINVHVRGGRIIPQQMPALTTTASRSNPFLLTVALSSDGWAVGELFWDDGESLGTFERGDYSFIIFTAEQSQLVSEPGKVNGALDGL-VLGEIRVFG 889          
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Cavefish
Match: gaa (glucosidase alpha, acid [Source:NCBI gene;Acc:103044115])

HSP 1 Score: 673.315 bits (1736), Expect = 0.000e+0
Identity = 346/810 (42.72%), Postives = 486/810 (60.00%), Query Frame = 3
Query:  312 ATAQCQIANNNERLDCYPESGANQDSCIARGCCWSEPMRLSNKLQGVPLSIPYCYYPTDYSNYMIKSLRKSSRGIKAKLVRESPSYLPYEVAMLDLEVIYETKSRTRVRITDPKQKRYEVPMKLSPPDLKPPTDRE---YEVIIPSDGSFSIEIKRKSDDRSLF-KSFGPLLYSDQFLQISSIMSTDQIYGIGEQNRPFLHQLSNGWERIGLWARDNPIETFMNLYGAHPFYIGMPDDGKAFGVFHFNSNGQEFALQPAPAVTYRTIGGILDFFIFTGGSPEETVKQYLELVGKPMLPPYWSLGFHLSKWGYKNIEQLSEIFQRNINAGFPIGTQWSDIDYMENYKDFTVDKEKFNGLGRFVREIKQKYNSRFVAIVDPGISCTSG-NEYPPYYEGVFMDIFIKDSQTNQPIVGKVWPGETVYPDFTHPNISMYWYKQIQRFYNDVPIDGLWIDMNEPSNFYDGSKRGCQGNSKYDNPFFVPDIRDQSLISKTICSSALHYNNEKHYNLHNLYGYTESVTTNKALLKTIHGKRPFILSRSTFSGSGKYTFHWTGDNQASWDQLRNSIRQVLNFNMFGIPMTGADICGFNGNSDEELCIRWMQLGAFYPFMRNHNAINQRDQDPASWNTEAQKIMKTAISNRYAMLPLFYTLLVKSHMNGGTVMRPMSFEFFSDKVTHSIELQFMIGSSIMATPVVYPGARSVDAYFPAGVWYDFHSGKLLHSDAEGAWLTLDAPLDKINIALRGGHIVPLLDSNRNSKSNIPNKMTLYCGMAQDMSASGDLYWDDGESIDSYSRNRYSYVSFNASPEQLL 2726
            A   C IA    R DC  +    Q  C  RGCC+   + L       P   P+C+YP  Y  Y +  L  +SRG +A L R + SYLP +V  L LEV+ E   R  + + DP Q RYEVP    PP    PTD +   Y+V    D  F   ++R S+ R L   +  PLL++DQ+LQ+S+ +++  + G GE        L+  W  + LW RD       NLYG+HPF +    DG+A+G+F  NSN  E   QPAPA+T+ T GGI+DF+IF G  P+   +QY +++G PM+PPYWSLGFHL +WGY +      + Q    A FP+  QW+D+DY +  + FT D ++F  L   V+E   +   ++V I+DPGIS TS    Y P+ EG    +FI++  T Q ++GKVWPG T +PDFT+P+   +W + I  FY  VP+DGLWIDMNEP+NF  GS  GC  ++  +NPF+VPD+    L + T+C S+   +   HYNLHNLYG TE++ T+ ALLK   G RPF+LSRS+F G G+Y+ HWTGD  + W+QLR SI  VL F ++G+P+ GADICGF G++ EELC+RW QLGAFYPFMRNHN  +   Q+P  +  +AQ  M++ +  RY++LP  YTL  ++  +  TV RP+  EF  D    +I+ QF+ GSS++ +PV+  GA  + AY P G+WY  + G+  +S   G +L L APLD IN+ +RGG I+P       + ++  N   L   ++ D  A G+L+WDDGES+ ++ R  YS++ F A  EQ+L
Sbjct:   77 AGKDCGIAVE-RRFDCARDRALTQSQCEQRGCCY---VPLPKSAFSGP---PWCFYPVSYPGYRMGPLVPTSRGQEANLTRSTSSYLPRDVQTLTLEVMAEEAGRLHIALKDPSQDRYEVPFVAVPP--TTPTDTQSFLYDVEFQPD-PFGFVVRRASNGRVLLNTTVAPLLFADQYLQLSTTLASSLVSGFGEHYTGLTLDLN--WTSVTLWNRDMAPHRDTNLYGSHPFCLVQEGDGQAYGIFLLNSNAMEVVSQPAPALTWVTTGGIMDFYIFLGPDPQSVAQQYHQVIGYPMMPPYWSLGFHLCRWGYTSTNATRAVVQHMHQANFPLDVQWNDLDYADKRRVFTFDPQRFGDLPEMVKEFHSE-GMKYVLILDPGISSTSPPGSYKPFDEGERRGVFIRN-LTGQTLIGKVWPGPTAFPDFTNPDAVSWWEECIADFYAKVPVDGLWIDMNEPANFVQGSLLGCP-DTDLENPFYVPDMIGGQLNAGTLCMSS-QQSLSAHYNLHNLYGLTEAMATHSALLKA-RGSRPFVLSRSSFPGLGRYSGHWTGDVHSDWEQLRYSIPAVLLFGLYGVPLVGADICGFEGDTSEELCVRWTQLGAFYPFMRNHNDRSNAPQEPYVFGQQAQAAMRSVMMLRYSLLPFLYTLFHQAQTSASTVARPLFLEFPFDPNCQTIDQQFLWGSSLLISPVLEQGAVELTAYLPPGMWYSLYDGQPYNS--RGQYLLLSAPLDTINVHVRGGRIIPQQMPALTTTASRSNPFLLTVALSSDGWAVGELFWDDGESLGTFERGDYSFIIFTA--EQVL 865          
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Cavefish
Match: ganab (glucosidase, alpha; neutral AB [Source:ZFIN;Acc:ZDB-GENE-110930-9])

HSP 1 Score: 268.855 bits (686), Expect = 6.483e-76
Identity = 212/729 (29.08%), Postives = 326/729 (44.72%), Query Frame = 3
Query:  741 DGSFSIEIKRKSDDRSLFKSFGPLLYSDQFLQISSIMSTDQIYGIGEQNRPFLHQLSNGWERIGLWARD-------NPIETFMNLYGAHPFYIGMPDDGKAFGVFHFNSNG----------------------QEFALQPAPAVTYRTIGGILDFFIFTGGSPEETVKQYLELVGKPMLPPYWSLGFHLSKWGYKNIEQLSEIFQRNINAGFPIGTQWSDIDYMENYKDFTVDKEKFNGLGRFVREIKQKYNSRFVAIVDPGISCTSGNEYPPYYEGVFMDIFIKDSQTNQPIVGKVWPGETVYPDFTHPNISMYWYKQIQRFYNDVPIDGL--WIDMNEPSNFYDGSKRGCQGNSKYDNPFFVPDIRDQSLISKTICSSALHYNNEKHYNLHNLYG-YTESVTTNKALLKTIHG-KRPFILSRSTFSGSGKYTFHWTGDNQASWDQLRNSIRQVLNFNMFGIPMTGADICGFNGNSDEELCIRWMQLGAFYPFMRNHNAINQRDQDPASWNTEAQKIMKTAISNRYAMLPLFYTLLVKSHMNGGTVMRPMSFEFFSDKVTHSIELQFMIGSSIMATPVVYPGARSVDAYFP--AGVWYDFHSGKLLHSDAEGAWLTLDAPLDKINIALRGGHIVPLLDSNRNSKSNIPNK-MTLYCGMAQDMSASGDLYWDDGESIDSYSRNRY-----SYV-----SFNASPEQLLITPVYFGYDLLPVLNKIVILG 2789
            DG +    K  +D     K  GP   S  F    S+   + +YGI E       + ++G E   L+  D       NP    M LYGA P  +   +  +  G+F  N+                        Q  +  P   V + +  GI+D FI  G  P +   QY  L G    PP   L +H  +W Y + + +  + +       P    W DI++ +  + FT D  KF      ++ IK K   + VAIVDP I   SG  Y  + E    + ++K+        G  WPG + YPDFT+P +  +W         +  ++ L  W DMNEPS F                    P++        T+   A+H + E H ++HNLYG Y +   T +  ++   G +RPF+L+R+ F+GS +Y   WTGDN A WD L+ S+   L+  + GI + GAD+ GF  +   EL +RW Q GA+ PF R H  ++   ++P  +  E   +++ AI  RYA+LP +Y    ++H  G  VMR +  E+  D  T +I+ +F+IG  ++   V   GAR V AY P    VWYD H+ +  H+ A+   L +   +  I +  RGG I+P     R S   + N   TL+  ++    A G+LY DDG + +  ++  +     S+V     S N  PE    T  +        + K++ILG
Sbjct:  186 DGLWEETFKSHTDS----KPNGPTAVSLDF----SLPGVEHVYGIPEHADNLKLKTTDGGEPYRLYNLDVFQYELYNP----MALYGAVPVMLAH-NTQRTMGIFWLNAAETWVDISSNTAGKTVFGKMLDFVQGSSETPQTDVRWISESGIIDVFIMLGPKPSDVFTQYASLTGTQSFPPLTGLAYHQCRWNYNDQDDVKAVDEGFDQHDIPCDFIWLDIEHTDGKRYFTWDPHKFPQPKDMLQGIKDK-RRKMVAIVDPHIKVDSG--YKIHNEIRDKNFYVKNKDGGD-YEGWCWPGNSGYPDFTNPEMRAWWASMFAYDQYEGSMENLYTWNDMNEPSVFNG------------------PEV--------TMHKDAMHGHWE-HRDVHNLYGLYVQHRATAEGQIQRSGGTERPFVLTRAFFAGSQRYGAVWTGDNAAEWDHLKISVPMCLSLGLVGISLCGADVGGFFKSPSAELLVRWYQTGAYQPFFRAHAHLDTPRREPWLFGPENTALIREAIRQRYALLPYWYQQFYQAHKTGQPVMRALWVEYPKDTATFTIDDEFLIGRDLLVHTVTEEGARGVTAYLPGLGEVWYDVHTFQ-KHNGAQN--LYIPVTMSSIPVFQRGGSIIPRKVRVRRSSECMENDPYTLFVALSPQRVAEGELYIDDGHTFNFQTKKEFIHRGLSFVNNVLTSKNLCPESNFSTKSW--------IEKVLILG 859          
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Cavefish
Match: ENSAMXT00000016120.2 (neutral alpha-glucosidase AB-like [Source:NCBI gene;Acc:103032339])

HSP 1 Score: 261.536 bits (667), Expect = 2.699e-73
Identity = 187/634 (29.50%), Postives = 291/634 (45.90%), Query Frame = 3
Query:  843 SIMSTDQIYGIGEQNRPFLHQLSNGWERIGLWARDN---PIETFMNLYGAHPFYIGMPDDGKAFGVFHFNS-----------NGQEF---------ALQPAPAVTYRTIG--GILDFFIFTGGSPEETVKQYLELVGKPMLPPYWSLGFHLSKWGYKNIEQLSEIFQRNINAGFPIGTQWSDIDYMENYKDFTVDKEKFNGLGRFVREIKQKYNSRFVAIVDPGISCTSGNEYPPYYEGVFMDIFIKDSQTNQPIVGKVWPGETVYPDFTHPNISMYWYKQIQRFYNDVPIDGL--WIDMNEPSNFYDGSKRGCQGNSKYDNPFFVPDIRDQSLISKTICSSALHYNNEKHYNLHNLYG-YTESVTTNKALLKTIHGKRPFILSRSTFSGSGKYTFHWTGDNQASWDQLRNSIRQVLNFNMFGIPMTGADICGFNGNSDEELCIRWMQLGAFYPFMRNHNAINQRDQDPASWNTEAQKIMKTAISNRYAMLPLFYTLLVKSHMNGGTVMRPMSFEFFSDKVTHSIELQFMIGSSIMATPVVYPGARSVDAYFPAG--VWYDFHSGKLLHSDAEGAWLTLDAPLDKINIALRGGHIVPLLDSNRNSKSNIPNK-MTLYCGMAQDMSASGDLYWDD 2651
            S    + +YGI E       + ++G E   L+  D     +   M LYGA P  I    + +  GVF  N+           +G+               AP    R I   GI+D F  +G  P +   QY  L G    P   +LG+H  +W Y + E +  + +       P    W DI++ +  + FT D  KF+     ++ +  K   + VAIVDP I   SG  Y  + E      ++K+        G  WPG + YPDFT+P +  +W  +         ++ L  W DMNEPS F                    P++        T+   A+H N E H ++HN+YG Y +  T    + ++   +RPF+L+R+ F+GS +Y   WTGDN A W  L+ SI   L+  + GI   GAD+ GF  +   EL +RW Q GA+ PF R H  ++   ++P  +  +   +++ AI  RY +LP +Y L   ++  G  VMRP+  E+  D  T +IE ++++G  ++  PV   GA+ V A+ P    VWYD H+ +  H  A+   L +   +  I +  RGG I+   D  R S + + N   TLY  ++   +A G++Y DD
Sbjct:  221 SFPGVEHLYGIPEHADTLKLKNTDGGEPYRLYNLDVFQYELNNLMALYGAVPVIISHNTE-RTMGVFWLNAAESWVDISSSTSGKTVFGKMMDFVQGSNEAPQTDVRWISESGIIDVFFMSGPRPNDVFAQYASLTGTQAFPALATLGYHQCRWNYNDQEDVKAVDEGFDEHDIPYDFIWLDIEHTDGKRYFTWDPNKFSQPKEMLQGLMDK-RRKMVAIVDPHIKVDSG--YSIHNEIRSKGFYVKNKDGGD-YEGWCWPGNSGYPDFTNPEMRAWWASKFAYDQYTGSMENLFTWNDMNEPSVFNG------------------PEV--------TMHKDAMHGNWE-HRDVHNIYGIYVQRATAEGQIQRSGGTERPFVLTRAFFAGSQRYGAVWTGDNAAEWGHLKISIPMCLSLGLVGISFCGADVGGFFKHPSTELLVRWYQAGAYQPFFRAHAHLDTPRREPWLFGPDNTALIREAIRQRYTLLPYWYQLFYNAYRTGQPVMRPLWVEYTEDPDTFAIEDEYLLGKDLLVHPVTEEGAKGVTAFLPGKGEVWYDVHTFQ-KHKGAQN--LYIPVTMSSIPVFQRGGSIISRKDRVRRSSACMENDPYTLYVALSPQGTAEGEIYIDD 819          
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005523.1 (pep scaffold:Pmarinus_7.0:GL480123:76219:97698:-1 gene:ENSPMAG00000005011.1 transcript:ENSPMAT00000005523.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 450.669 bits (1158), Expect = 3.422e-146
Identity = 254/709 (35.83%), Postives = 369/709 (52.05%), Query Frame = 3
Query:  741 DGSFSIEIKRKSDDRSLFKSFGP-LLYSDQFLQISSIMSTDQIYGIGEQNRPFLHQLSNGWERIGLWARDNPIETFMNLYGAHPFYIGMPDDGKAFGVFHFNSNGQEFALQPAPAVTYRTIGGILDFFIFTGGSPEETVKQYLELVGKPMLPPYWSLGFHLSKWGYKNIEQLSEIFQRNINAGFPIGTQWSDIDYMENYKDFTVDKEKFNGLGRFVREIKQKYNSRFVAIVDPGISCTSGNEYPPYYEGVFMDIFIKDSQTNQPIVGKVWPGETVYPDFTHPNISMYWYKQIQRFY-------NDVPIDGLWIDM-------------------NEPS------NFYDGSKRGCQGNSKYD------------------------NPFFVPDI-------RDQSLISKTICSSALHY----NNEKHYNLHNLYGYTESVTTNKALLKTIHGKRPFILSRSTFSGSGKYTFHWTGDNQASWDQLRNSIRQVLNFNMFGIPMTGADICGFNGNSDEELCIRWMQLGAFYPFMRNHNAINQRDQDPASWNTEAQKIMKTAISNRYAMLPLFYTLLVKSHMNGGTVMRPMSFEFFSDKVTHSIELQFMIGSSIMATPVVYPGARSVDAYFPAGVWYDFHSGKLLHSDAEGAWLTLDAPLDKINIALRGGHIVPLLDSNRNSKSNIPNKMTLYCGMAQDMSASGDLYWDDGESI 2663
            D  F I + RKS  + ++ S  P   ++D+F+Q+S ++ ++ IYG GE       Q    W    L       +   N YG HP+Y+ + D   A  V  FNSN  +  LQP PAVTYRT GGILDF+   G SPEE  +QY  L+G+P +PPYWSLGF L ++GY N  ++  ++     AG P  TQ+ DIDYM    DFT++KEKF      +R +  +   R + I+DP I+      YP Y  GV  D+++K     Q + GK +      PDF     + +W ++I+ FY       + +  DGLWIDM                   NEP         Y  S   C  +   D                        N  ++  I        D++   KT+C  ALH     +  +HYN+H+LYG++++  T  AL   + GKR  +++RSTF GSG+++ HW GDN A WD L  SI  ++ F++FGI  TGADICGF G+S+ +LC RWMQLGAFYP+ RNHN      QDP +W+T   ++ K  +  RY++LP  YTL+ ++H +G TV+RP+  EF SD  T +I  QF+ G +++ TPV+     +V  Y P   WYD+ + K         +  ++AP D IN+ +RGG+I+P       +K +    M+L        +A+G L+WDDG+ I
Sbjct:    4 DSPFGIRVIRKSTGKVIWNSQAPGFTFTDRFIQMSVLLPSENIYGFGETEHDTFKQ---PWYVHILGVCAVYPQYRANAYGVHPYYMSVEDGANAHSVLLFNSNAMDIVLQPNPAVTYRTTGGILDFYFTLGPSPEEVTQQYTALIGRPAMPPYWSLGFQLCRYGYANDTEILNLYNDMKAAGVPYDTQYGDIDYMVRQLDFTLNKEKFGNFPNLIRHMHDE-GMRIIIILDPAIAANETEPYPAYTRGVENDVYMKRPD-GQIMFGKHYRAYAAMPDFFRERTARWWQREIEEFYRNPTTPTDSMEFDGLWIDMNEPASFVHGSTSGCEDKELNEPPYMPRAFELYFSSLANCHTSIPLDSQHRYTTTRSSQQVTTHSHMCGDNNQTYIQKILHRKSVQADETSHHKTMCMEALHELPDGSKVQHYNVHSLYGWSQTKPTLDAL-HNVTGKRGIVVTRSTFPGSGQWSGHWLGDNSARWDNLDKSIIGMMEFSLFGITYTGADICGFFGDSNYDLCARWMQLGAFYPYSRNHNGKGNIRQDPVAWDTAFAEMSKRVLEIRYSLLPYLYTLMHEAHAHGSTVVRPLLHEFLSDNETWAISKQFLWGPALLITPVLEEEKVTVRGYVPDARWYDYQTMKGAQLTERKEYKEMNAPWDTINLHVRGGYILPTQQPANTTKYSRQKPMSLLVAPDSSGTATGSLFWDDGDGI 706          
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008911.1 (pep scaffold:Pmarinus_7.0:GL496136:1712:3787:1 gene:ENSPMAG00000008065.1 transcript:ENSPMAT00000008911.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 247.669 bits (631), Expect = 2.465e-73
Identity = 157/465 (33.76%), Postives = 238/465 (51.18%), Query Frame = 3
Query:  813 LYSDQFLQISSIMSTD-QIYGIGEQNRPFLHQLSNGWERIGLWARDNPI--ETFM----NLYGAHPFYIGMPDDGKAFGVFHFNSNGQEFAL---QPAPAVTYRTI--GGILDFFIFTGGSPEETVKQYLELVGKPMLPPYWSLGFHLSKWGYKNIEQLSEIFQRNINAGFPIGTQWSDIDYMENYKDFTVDKEKFNGLGRFVREIKQKYNSRFVAIVDPGISCTSGNEYPPYYEGVFMDIFIKDSQTNQPIVGKVWPGETVYPDFTHPNISMYWYKQIQRFYNDVPIDGLWIDMNEPSNFYDGSKRGCQGNSKYDNPF-----FVPDIRDQSLISKTICSSALHYNNEKHYNLHNLYGYTESVTTNKALLKTIHGK--RPFILSRSTFSGSGKYTFHWTGDNQASWDQLRNSIRQVLNFNMFGIPMTGADICGFNGNSDEELCIRWMQLGAFYPFMRNHNAINQ 2150
            L+ D  L+IS I S   + Y I  Q+   L  + +G     +W+RD P   ET      N+YG HPF++     G   GV +  ++ Q++ +   Q   ++   TI  GG+ D ++    SP++ V  Y  L+G+P++ P W+LG++  +WGY  +++L       +    P+  QWSDID+M  Y+ F  D+  F  L  FV ++  K   ++V IVD GI+    ++Y  + E +F  I             +VWP +  +PD+T+P+        ++  +  V  DGLW DMNE SNF  G+   C  N + D P      + P  RD  +  K++    LH N     + H+ YG  E        +K  H K  R FI+ RS+F+G GK+   W GDN +    +  SI  V+  N+FGIP+ GADICGF G+++ ELC RW  +GA+YPF RNHN   Q
Sbjct:    1 LFLDTGLKISEITSKSFEYYQIIHQST-LLQLVEDG--VYSMWSRDQPTPEETGTLPGSNMYGTHPFFMYKHKVGAWTGVLYKLAHAQDWWVKNNQAKGSIDISTIATGGVADIYVIQAQSPDDIVNNYFRLIGRPVMVPQWALGWNQCRWGYDTLDKLKGYDDNKL----PLDVQWSDIDWMNKYRSFEFDQVNFKDLPSFVDDL-HKSGRKYVPIVDAGIAYRPDSDYKAFQENLFTTI------------NEVWPNDASFPDYTNPDTG-----HLEDVHTQVAFDGLWEDMNEASNFCQGA---CYRNQQVDKPVKQNLPYTPTGRDLEI--KSMPLDTLHSNGVLQLDAHSYYGTQE--------VKATHSKNMRTFIIERSSFAGMGKFASRWLGDNFSEDKYMGYSISGVMMMNIFGIPLAGADICGFIGDTNPELCARWHHVGAYYPFSRNHNNWGQ 427          
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008912.1 (pep scaffold:Pmarinus_7.0:GL496136:2540:3769:1 gene:ENSPMAG00000008065.1 transcript:ENSPMAT00000008912.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 237.269 bits (604), Expect = 3.776e-70
Identity = 142/420 (33.81%), Postives = 215/420 (51.19%), Query Frame = 3
Query:  933 LWARDNPI--ETFM----NLYGAHPFYIGMPDDGKAFGVFHFNSNGQEFAL---QPAPAVTYRTI--GGILDFFIFTGGSPEETVKQYLELVGKPMLPPYWSLGFHLSKWGYKNIEQLSEIFQRNINAGFPIGTQWSDIDYMENYKDFTVDKEKFNGLGRFVREIKQKYNSRFVAIVDPGISCTSGNEYPPYYEGVFMDIFIKDSQTNQPIVGKVWPGETVYPDFTHPNISMYWYKQIQRFYNDVPIDGLWIDMNEPSNFYDGSKRGCQGNSKYDNPF-----FVPDIRDQSLISKTICSSALHYNNEKHYNLHNLYGYTESVTTNKALLKTIHGK--RPFILSRSTFSGSGKYTFHWTGDNQASWDQLRNSIRQVLNFNMFGIPMTGADICGFNGNSDEELCIRWMQLGAFYPFMRNHN 2138
            +W+RD P   ET      N+YG HPF++     G   GV +  ++ Q++ +   Q   ++   TI  GG+ D ++    SP++ V  Y  L+G+P++ P W+LG++  +WGY  +++L       +    P+  QWSDID+M  Y+ F  D+  F  L  FV ++  K   ++V IVD GI+    ++Y  + E                    VWP +  +PD+T+P+        ++  +  V  DGLW DMNE SNF  G+   C  N + D P      + P  RD  +  K++    LH N     + H+ YG  E        +K  H K  R FI+ RS+F+G GK+   W GDN +    +  SI  V+  N+FGIP+ GADICGF G+++ ELC RW  +GA+YPF RNHN
Sbjct:    2 MWSRDQPTPEETGTLPGSNMYGTHPFFMYKHKVGAWTGVLYKLAHAQDWWVKNNQAKGSIDISTIATGGVADIYVIQAQSPDDIVNNYFRLIGRPVMVPQWALGWNQCRWGYDTLDKLKGYDDNKL----PLDVQWSDIDWMNKYRSFEFDQVNFKDLPSFVDDL-HKSGRKYVPIVDAGIAYRPDSDYKAFQEA------------------HVWPNDASFPDYTNPDTG-----HLEDVHTQVAFDGLWEDMNEASNFCQGA---CYRNQQVDKPVKQNLPYTPTGRDLEI--KSMPLDTLHSNGVLQLDAHSYYGTQE--------VKATHSKNMRTFIIERSSFAGMGKFASRWLGDNFSEDKYMGYSISGVMMMNIFGIPLAGADICGFIGDTNPELCARWHHVGAYYPFSRNHN 380          
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008215.1 (pep scaffold:Pmarinus_7.0:GL476974:10756:37747:1 gene:ENSPMAG00000007408.1 transcript:ENSPMAT00000008215.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 249.98 bits (637), Expect = 5.596e-70
Identity = 174/589 (29.54%), Postives = 284/589 (48.22%), Query Frame = 3
Query: 1080 AVTYRTIGGILDFFIFTGGSPEETVKQYLEL----VGKPMLPPYWSLGFHLSKWGYKNIEQLSEIFQRNINAGF-----PIGTQWSDIDYMENYKDFTVDKEKFNGLGRFVREIKQKYNSRFVAIVDPGISCTSGNEYPPYYEGVFMDIFIKDSQTNQPIVGKVWP-GETVYPDFTHPNISMYWYKQIQ--RFYNDVPIDGLWIDMNEPSNFYDGSKRGCQGNSKYDNPFFVPDIRDQSLISKTICSSALHYNNEKHYNLHNLYGYTESVTTNKALLKTIHG-KRPFILSRSTFSGSGKYTFHWTGDNQASWDQLRNSIRQVLNFNMFGIPMTGADICGF-NGNSDEELCIRWMQLGAFYPFMRNHNAINQRDQDPASWNTEAQKIMKTAISNRYAMLPLFYTLLVKSHMNGGTVMRPMSFEFFSDKVTHSIELQFMIGSSIMATPVVYPGARSVDAYFPA--GVWYDFHSGKLLHSDAEGAWLTLDAPLDKINIALRGGHIVPLLDSNRNSKSNIP-NKMTLYCGMAQDMSASGDLYWDDGESIDSYSRNRYSYVSFNASPEQLLITPV--YFGYDLLPVLNKIVILG 2789
             V + +  G +D F+  G +P +  +QY  L     G   LPP ++LG+H S+W      + +E   R ++ GF          W DI++ +  + FT D ++F        ++  K   + V IVDP I     NEY  Y EG     FI++   +    G+ WP G + Y D T+P++  ++  +     + N       W DMNEP+ F+                           I KT+  + LH+   +H + HNLYG+ + + +   L++   G +RPF+L+RS F+GS +Y   WTGD+ A+WD LR S   +L+ ++ GI + GAD+ GF      + + +RW Q G+  PF R H+A  +R+  P       +K+++ A++ RYA+LP +YT   ++H  G  VMRP+  EF SD+ T  +E Q+MIG++++A PV      +V  Y P     WYD HS K   +  + A       +  I +  R G I+P   + R+S   +  +  TL   +     A G+L+ DDG S    ++ R+ +  F+ S   L    +      +    + K+VI+G
Sbjct:  313 GVRWMSESGTIDVFVLPGPTPCDVFRQYAGLTVGSAGTQALPPLFALGYHHSRWA-----EQTEADTREVDGGFRRSRIACDVLWLDIEHTDGKRYFTWDADRFPDPVGLQNDLAAK-GRKVVTIVDPHIKVD--NEYFVYSEGKARGYFIRNPDGSN-YEGRCWPEGLSSYLDLTNPDVRDWYASKFDYCNYKNSTAALFTWNDMNEPAVFHS--------------------------IEKTVPRNCLHWGGWEHRDNHNLYGFYQQMASAAGLVRRSGGLERPFVLTRSFFAGSQRYGAVWTGDSLATWDYLRMSTPMLLSLSVCGISLCGADVGGFFEEPQSQAMVLRWFQAGSLQPFFRVHSAKVRRE--PWLMGASGEKLIRRAVALRYALLPYWYTQFYRAHRTGQPVMRPLWVEFPSDEETFVLEDQYMIGNALLARPVTEDNVNTVQVYLPGRNEAWYDIHSRKRYPAPGKFA---QRVNMSSIPLYQRAGTIIPQKLNLRDSTELMKEDPYTLLVAVDPGGCAEGELFIDDGHSFLYKTQQRFLHRGFSYSDSTLTCKSLDSAGSMECRVQVEKVVIVG 861          
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008908.1 (pep scaffold:Pmarinus_7.0:GL496136:110:3787:1 gene:ENSPMAG00000008065.1 transcript:ENSPMAT00000008908.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 190.274 bits (482), Expect = 8.345e-54
Identity = 123/359 (34.26%), Postives = 177/359 (49.30%), Query Frame = 3
Query: 1227 WGYKNIEQLSEIFQRNINAGFPIGTQWSDIDYMENYKDFTVDKEKFNGLGRFVREIKQKYNSRFVAIVDPGISCTSGNEYPPYYEGVFMDIFIKDSQT-----NQPIVGKVWPGETVYPDFTHPNISMYWYKQIQRFYNDVPIDGLWIDMNEPSNFYDGS---------------KRGCQGNSKYDNPFFVPDIRDQSLISKTIC----------------------------SSALHYNNEKHYNLHNLYGYTESVTTNKALLKTIHGK---RPFILSRSTFSGSGKYTFHWTGDNQASWDQLRNSIRQVLNFNMFGIPMTGADICGFNGNSDEELCIRWMQLGAFYPFMRNHNAINQ 2150
            W Y N + + E+      AG P+ T + DI YM++YKDF+VD + F GL + + +  QK     V I+D  IS    N+         +DIFIK S       N  I+ KVWP + V+ D+ +P    +W       Y+ V  DG+WIDMNEP+ F  G                KR    + +  + ++  + +DQS+ S                                +S +    E  YN+H+LYG   +  T + + K    +   RP+IL+RSTF+ SG+Y  HW GDN   W+ +R SI  V+  N+FGIP+ GADICGF G+++ ELC RW  +GA+YPF RNHN   Q
Sbjct:    1 WKYINQDMVEEVIDNYFAAGMPLETMYLDIPYMKSYKDFSVDTKAF-GLAKRLHDANQK----LVVILDAAISADDVNDDVYQKGSTELDIFIKSSMYKSKTYNNNIISKVWPDKAVFIDWFNPKSLDFW------TYDLVDYDGIWIDMNEPTTFGHGEIKPDDAEPVTPTLAKKRLMSDDGETVDWYY--EFKDQSVGSTFTLPFIPGYVQSDDGKPGPYNGNFDYMTLSLNSTIPSLGETSYNVHSLYGLMMAKRTFEHVTKMEAKRPDERPYILTRSTFASSGRYASHWLGDNWRKWEYMRYSIAGVMMMNIFGIPLAGADICGFIGDTNPELCARWHHVGAYYPFSRNHNNWGQ 346          
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Yeast
Match: ROT2 (Glucosidase II catalytic subunit; required to trim the final glucose in N-linked glycans; required for normal cell wall synthesis; mutations in rot2 suppress tor2 mutations, and are synthetically lethal with rot1 mutations [Source:SGD;Acc:S000000433])

HSP 1 Score: 232.261 bits (591), Expect = 6.306e-64
Identity = 184/639 (28.79%), Postives = 290/639 (45.38%), Query Frame = 3
Query:  843 SIMSTDQIYGIGEQNRPF-LHQLSNGWERIGLWARDN---PIETFMNLYGAHPFYIGMPDDGKAFGVFHFNSNGQEFALQ-----PAPAVTYRTIGGILDFFIFTGGSPEETVKQYLELVGKPMLPPYWSLGFHLSKWGYKNIEQLSEIFQRNINAGFPIGTQWSDIDYMENYKDFTVDKEKFNGLGRFVREIKQKYNSRFVAIVDPGISCTSGNEYPPYYEGVFMDIFIKDSQTNQPIVGKVWPGETVYPDFTHPNISMYWYKQIQRFYNDVPID----GLWIDMNEPSNFYDGSKRGCQGNSKYDNPFFVPDIRDQSLISKTICSSALHYNNEKHYNLHNLYGYTESVTTNKALLKTIHG---KRPFILSRSTFSGSGKYTFHWTGDNQASWDQLRNSIRQVLNFNMFGIPMTGADICGFNGNSDEELCIRWMQLGAFYPFMRNHNAINQRDQDPASWNTEAQKIMKTAISNRYAMLPLFYTLLVKSHMNGGTVMRPMSFEFFSDKVTHSIELQFMIGSS-IMATPVVYPGARSVDAYFPAGVWYDFHS-GKLLHSDAEGAWLTLDAPLDKINIALRGGHIVPLLDSNRNSKSNIPNK-MTLYCGMAQDMSASGDLYWDDGESIDSYSRNRYSYVSF 2702
            S M +  +YGI E      L   S G E   L+  D     I T   +YG+ PF         +  +F  N+      ++           + +  G++D  +  G      + ++ +L G+P LPP  S+G+H  +W Y +   +  +  +      P    W D++Y  + K FT  +  F    + +    +K     V ++DP +      +Y      +  ++ +KD   N   VG  WPG +++ D         W    +RF  D+P D     +W DMNEPS  +DG +     +  +DN                       Y  E+  ++HN+YG +    T  A+ K+I+    KRPF+L+R+ F+GS +    WTGDN A+WD L+ SI  VL+ N+ G+P  GADI GF  +   EL  RW Q G +YPF R H  I+ + ++P  +N   + I++  I  RY +LP  YT+  KS + G  +M PM  E       + I+ QF   +S ++  PV  PG    +  FP G++Y+F S    +++  +     + APLDKI + + GGHI+ + D  R S   + N    +      +  A GDLY DDGE+   Y R  Y    F
Sbjct:  264 SFMGSTNVYGIPEHATSLRLMDTSGGKEPYRLFNVDVFEYNIGTSQPMYGSIPFMFS----SSSTSIFWVNAADTWVDIKYDTSKNKTMTHWISENGVIDVVMSLGPDIPTIIDKFTDLTGRPFLPPISSIGYHQCRWNYNDEMDVLTVDSQMDAHMIPYDFIWLDLEYTNDKKYFTWKQHSFPN-PKRLLSKLKKLGRNLVVLIDPHLK----KDYEISDRVINENVAVKDHNGND-YVGHCWPGNSIWIDTISKYGQKIWKSFFERFM-DLPADLTNLFIWNDMNEPS-IFDGPETTAPKDLIHDN-----------------------YIEER--SVHNIYGLSVHEATYDAI-KSIYSPSDKRPFLLTRAFFAGSQRTAATWTGDNVANWDYLKISIPMVLSNNIAGMPFIGADIAGFAEDPTPELIARWYQAGLWYPFFRAHAHIDTKRREPYLFNEPLKSIVRDIIQLRYFLLPTLYTMFHKSSVTGFPIMNPMFIEHPEFAELYHIDNQFYWSNSGLLVKPVTEPGQSETEMVFPPGIFYEFASLHSFINNGTDLIEKNISAPLDKIPLFIEGGHIITMKDKYRRSSMLMKNDPYVIVIAPDTEGRAVGDLYVDDGETF-GYQRGEYVETQF 863          
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Nematostella
Match: EDO41811 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S392])

HSP 1 Score: 646.736 bits (1667), Expect = 0.000e+0
Identity = 349/800 (43.62%), Postives = 478/800 (59.75%), Query Frame = 3
Query:  348 RLDCYPESGANQDSCIARGCCW----SEPMRL--SNKLQGV--PLSIPYCYYPTDYSNYMIKSLRKSSRGIKAKLVRESPSYLPYEVAMLDLEVIYETKSRTRVRITDPKQKRYEVPMKLSPPDLKPPTDREYEVIIPSDGSFSIEIKRKSDDRSLFKS-FGPLLYSDQFLQISSIMSTDQIYGIGEQNRPFLHQLSNGWERIGLWARD--NPIETFMNLYGAHPFYIGMPDDGKAFGVFHFNSNGQEFALQPAPAVTYRTIGGILDFFIFTGGSPEETVKQYLELVGKPMLPPYWSLGFHLSKWGYKNIEQLSEIFQRNINAGFPIGTQWSDIDYMENYKDFTVDKEKFNGLGRFVREIKQKYNSRFVAIVDPGISCTS-GNEYPPYYEGVFMDIFIKDSQTNQPIVGKVWPGETVYPDFTHPNISMYWYKQIQRFYNDVPIDGLWIDMNEPSNFYDGSKRGCQGNSKYDNPFFVPDIRDQSLISKTICSSALHYNNEKHYNLHNLYGYTESVTTNKALLKTIHGKRPFILSRSTFSGSGKYTFHWTGDNQASWDQLRNSIRQVLNFNMFGIPMTGADICGFNGNSDEELCIRWMQLGAFYPFMRNHNAINQRDQDPASWNTEAQKIMKTAISNRYAMLPLFYTLLVKSHMNGGTVMRPMSFEFFSDKVTHSIELQFMIGSSIMATPVVYPGARSVDAYFPAGVWYDFH-----------SGKLLHSDAEGAWLTLDAP-LDKINIALRGGHIVPLLDSNRNSKSNIPNKMTLYCGMA--QDMSASGDLYWDDGESIDS 2669
            R DC+PE+GA ++ C ARGCCW    + P R   ++K  GV  PL IPYC+YP +Y  Y + S   +  G K  L    P+ LP +    + ++      +    I DP  KRYEVP+  +P   +    ++Y+V   S   F I + RKS    LF S  G +++ DQFLQISS++ +  IYG+GE    F  +L+  W R  ++ARD   P     NLYG HPFY+ + +DG A G+F  NSN  E  LQP PA+TYR++GG+LDF++F G +PE   +QY+ L+GKP LPPYW LG+HL +WGY N+ +   +         P   QW+DI+YM+++ DFTVD   + GLG FV+++  +Y+  ++ IVDPGIS T     YPPY +G+ M +F+  S    PIVG+VWPG TVYPDF +P+   YW KQI +F++ VP DGLWIDMNEPSNF  GS  GC  N+K+DNP + P I    LI KT+C SA HY   +HY++H+LYGYTE+V T  A L++I GKR  ++SRSTF  SG++  HW GDNQA+W+ +  S+  +LN NMFGIP+ GADICGF GN++ ELC RW QLGAFYPF RNHN      QDPAS+  +   + +  +  RY MLP  YTL   ++  G TV RP+ FEF  D  T +I+ QFM GSS++ TPV+  GA  V  YFP   WY+ +             +L    + G +  L  P L    + +RGG I+     +  + ++  N   L           A+G L+ DDGES+ +
Sbjct:    6 RFDCFPEAGATEELCQARGCCWVPAENRPPRPEPTSKPTGVNAPLDIPYCFYPLNYG-YSLTSKVATKTGYKKTLC---PTKLPIKHQTSERKIKMTNLFKLHGDIYDPANKRYEVPIP-TPMITQKSNSQDYDVSFTSF-PFGISVTRKSTGTVLFNSTVGGMIFEDQFLQISSLLPSSNIYGLGEHADAF--KLNVTWRRDTMFARDVATPEGMQYNLYGVHPFYLNVENDGNANGLFLLNSNALEVILQPTPAITYRSLGGVLDFYMFLGPTPEAVAQQYITLIGKPRLPPYWGLGYHLCRWGYGNVSRTITVNDNMRRYKIPQDVQWNDIEYMKDHLDFTVDSTNWGGLGDFVKKLHTQYDQHYIPIVDPGISNTQPSGSYPPYSDGLAMGVFVNASN-GGPIVGQVWPGNTVYPDFFNPSTQSYWTKQISQFHDVVPFDGLWIDMNEPSNFVQGSTSGCP-NTKWDNPPYTPHIIGDKLIDKTLCMSARHY-GYRHYDVHSLYGYTETVATMSA-LESIRGKRSMVISRSTFPNSGQHGGHWLGDNQATWESMYLSVPGILNMNMFGIPLVGADICGFLGNTNYELCARWTQLGAFYPFSRNHNTKGATPQDPASFGDKFASMARGVLLTRYRMLPYLYTLFFDAYNMGSTVARPLFFEFPKDAKTLAIDRQFMWGSSLLVTPVLQQGASDVTGYFPDATWYNVYDVRLRAPCAPPGSELQREGSGGQYHKLGCPVLCDTPLHIRGGSIIATQKPDITTAASRKNPFELIVAKTGKDGEPANGRLFLDDGESLGT 793          
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Nematostella
Match: EDO48632 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJ81])

HSP 1 Score: 249.595 bits (636), Expect = 1.139e-69
Identity = 157/505 (31.09%), Postives = 247/505 (48.91%), Query Frame = 3
Query: 1206 LGFHLSKWGYKNIEQLSEIFQRNINAGFPIGTQWSDIDYMENYKDFTVDKEKFNGLGRFVREIKQKYNSRFVAIVDPGISCTSGNEYPPYYEGVFMDIFIKDSQTNQPIVGKVWPGETVYPDFTHPNISMYWYKQIQ--RFYNDVPIDGLWIDMNEPSNFYDGSKRGCQGNSKYDNPFFVPDIRDQSLISKTICSSALHYNNEKHYNLHNLYGYTESVTTNKALLKTIHGK-RPFILSRSTFSGSGKYTFHWTGDNQASWDQLRNSIRQVLNFNMFGIPMTGADICGFNGNSDEELCIRWMQLGAFYPFMRNHNAINQRDQDPASWNTEAQKIMKTAISNRYAMLPLFYTLLVKSHMNGGTVMRPMSFEFFSDKVTHSIELQFMIGSSIMATPVVYPGARSVDAYFPAG--VWYDFHSGKLLHSDAEGAWLTLDAPLDKINIALRGGHIVPLLDSNRNSKS-NIPNKMTLYCGMAQDMSASGDLYWDDGESIDSYSRNRYSYVSF 2702
            + +H  +W Y + E +  +         P    W DI++ +  +  T DK KF         I  K   + V IVDP +  TS  +Y  + E   +  +IK+    +      W G + +PDFT+P I  +W  +I   ++        +W DMNEPS F+                   P+I        T+    +HY + +H ++HN+YG      TN  L++   GK RPF+LSR+ F+G+ +Y   WTGDN A W  L+ SI  +L+  + G+P  GAD+ GF  N + EL  RW Q G F PF+R H  ++ + ++P  ++   + +++ A+  RYA+LPL+YTL   +  +G  ++RP+  E+  DK T  +E +F++G  ++  PV  PG  + D Y P     WY     K+      G  + + +PLDKI +  RGG I+P  +  R S S +  +  TL   +     A GDLY DD  S D Y    ++Y+ F
Sbjct:  335 IAYHQCRWNYNDEEDVKSVDDSFDKHDIPYDVLWLDIEHTDGKRYMTWDKVKFPNPEAMQENIASK-GRKMVTIVDPHMKRTS--DYHVHEEATSLGHYIKNKDGGE-YENWCWSGSSSWPDFTNPKIREWWASKISHDQYKGSTTNLFIWNDMNEPSVFHG------------------PEI--------TMHKDTIHYGDWEHRDVHNIYGMYFHKATNLGLIQRSGGKDRPFVLSRAFFAGTQRYGPIWTGDNMAEWSHLKASIPMILSLGVTGLPFAGADVGGFFKNPEPELLARWYQTGVFTPFLRAHAHLDTKRREPWLFDDVYKNVIRDALRTRYALLPLWYTLFFHASQDGTPIIRPLWVEYPEDKSTFKMEDEFLVGDQLLVKPVTEPGQVTSDVYLPGKEQYWYHLDDHKIYRG---GNNVKVASPLDKIPLFQRGGSIIPRKNRIRRSSSLSHDDPYTLTLALDPKGEAEGDLYIDDFHSFD-YKTGAFAYMKF 805          
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Nematostella
Match: EDO45756 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RS68])

HSP 1 Score: 62.003 bits (149), Expect = 7.964e-10
Identity = 58/251 (23.11%), Postives = 96/251 (38.25%), Query Frame = 3
Query: 1815 YNLHNL-YGYTESVTTNKALLKTIHGKRPFILSRSTFSGSGKYTFHWTGDNQASWDQ---LRNSIRQVLNFNMFGIPMTGADICGFNG-----------NSDEELCIRWMQLGAFYPFMRNHNAINQRDQDPASWNTEAQKIMKTAISNRYAMLPLFYTLLVKSHMNGGTVMRPMSFEFFSDKVTHSIELQFMIGSSIMATPVVYPGARSV---DAYFPAGVWY-DFHSGKLLHSDAEGAWLTLDAPLDKI 2510
            Y L NL YG     + N A + +  G R  I  R          F    D  + WD+   LR+ I   L   + G P    D+ G NG             D EL +RWMQ   F P M       Q    P  + +    I K  +  R  +         + + +   ++RP+ +   +D +  +++ +F++G   +  PV+ P + +      Y P G W  +F   K++     G W+     L+ +
Sbjct:  296 YQLKNLTYGNPSFYSANYAKMASKFGDR--IEVRVGHRTQSIPVFVRFLDRTSKWDEKDGLRSVIPATLTLGILGYPFVLPDMIGGNGAQLNSNSDSFNKPDNELYVRWMQAAVFLPTM-------QFSFPPWLYGSNTINIAKRLLDLRAKISETLILFARQVNQSTAPIIRPLWWVAPNDDIALTLDSEFLVGDRFLVAPVLRPYSENKGKHKVYLPQGKWKEEFGDFKVITVPKPGQWIEYTVTLEDL 537          
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Medaka
Match: si:ch73-12o23.1 (lysosomal alpha-glucosidase [Source:NCBI gene;Acc:101169174])

HSP 1 Score: 712.605 bits (1838), Expect = 0.000e+0
Identity = 365/848 (43.04%), Postives = 508/848 (59.91%), Query Frame = 3
Query:  324 CQIANNNERLDCYPESGA--NQDSCIARGCCWSEPMRLSNKLQGVPLSIPYCYYPTDYSNYMIKSLRKSSRGIKAKLVRESPSYLPYEVAMLDLEVIYETKSRTRVRITDPKQKRYEVPMKLSPPDLKPPTDREYEVIIPSDGSFSIEIKRKSDDRSLFKS-FGPLLYSDQFLQISSIMSTDQIYGIGEQNRPFLHQLSNGWERIGLWARDNPIETFMNLYGAHPFYIGMPDDGKAFGVFHFNSNGQEFALQPAPAVTYRTIGGILDFFIFTGGSPEETVKQYLELVGKPMLPPYWSLGFHLSKWGYKNIEQLSEIFQRNINAGFPIGTQWSDIDYMENYKDFTVDKEKFNGLGRFVREIKQKYNSRFVAIVDPGISCTS-GNEYPPYYEGVFMDIFIKDSQTNQPIVGKVWPGETVYPDFTHPNISMYWYKQIQRFYNDVPIDGLWIDMNEPSNFYDGSKRGCQGNSKYDNPFFVPDIRDQSLISKTICSSALHYNNEKHYNLHNLYGYTESVTTNKALLKTIHGKRPFILSRSTFSGSGKYTFHWTGDNQASWDQLRNSIRQVLNFNMFGIPMTGADICGFNGNSDEELCIRWMQLGAFYPFMRNHNAINQRDQDPASWNTEAQKIMKTAISNRYAMLPLFYTLLVKSHMNGGTVMRPMSFEFFSDKVTHSIELQFMIGSSIMATPVVYPGARSVDAYFPAGVWYDFHSGKLLHSDAEGAWLTLDAPLDKINIALRGGHIVPLLDSNRNSKSNIPNKMTLYCGMAQDMSASGDLYWDDGESIDSYSRNRYSYVSFNASPEQLLITPVYFGYDLLP--VLNKIVILGFENKSITKFLLNDNDIPFHY 2849
            C   +   R DCYPE G    +D C AR CC+      SN  Q     +P+C+YP D+ +Y + S   +  G K  LV+E  +Y P ++  +++E   ET +R  VR+TDP   R+EVP+ +  P  K   +    ++  S   F I +KR+S    L  +   PL Y+DQFLQ S+++ T  IYG+GE    FLH ++  W  + +WARD P     NLYG HPFY+ M +DG A G F  NSN  +  LQP PA+T+RTIGGILDF++F G  P   V QYLE++G P +P YW+LG+HL +WGY +     E+ +   N G P  TQW+DIDYM+   DFT D +KF  L   VR++   +N  +V ++DPGIS T     Y P+ EG+   +FIKD++  + ++GKVWPG T YPDF+      +W+  +Q+F+N VP DGLWIDMNEPSNF DGS  GC  NS  +NP + P +    L +KT+C++A       HYNLH+LYG  E+  +  AL K +  KRPF++SRSTF   G Y+ HW GDN++ W  L  SI  +L FN+ GIP+ GADICGF+    EELC+RW QLGAFYPF RNHN+I+ + QDP +++  A+  MK A+  RY++ P  YTL   +H +G +V RP+ FEF  D  T+ I+ QF+ G S++ TPV+ PG   V  YFPAG+WYDF++G  LHS  E   + L APLDKIN+ LR G ++P    N     +    + L   ++ + SA GDL+WDDGESID++  N+YSY+ F+ + +  + + V   +       +      G   K  +K L+N  D PF Y
Sbjct:  113 CSAISEPWRFDCYPERGVVVTKDMCEARNCCFIPASSSSNAGQSRKNGVPWCFYPPDFPSYSLVSTDDTLMGQKGTLVKEVKTYYPGDILTVEVETRQETDTRLHVRMTDPSNPRFEVPISVPNPTKK--AENPAYIVELSKQPFGITVKRRSTGVLLLNTTVAPLFYADQFLQFSTVLPTQFIYGLGEHRSTFLHDMN--WNTLTMWARDVPPMEKTNLYGVHPFYLAMEEDGNAHGFFLLNSNAMDVVLQPTPALTWRTIGGILDFYVFLGPDPGSVVSQYLEVIGNPAMPIYWALGYHLCRWGYNSSNSTWEVVKSLRNYGIPQDTQWNDIDYMDQSMDFTYDSKKFETLPDLVRDL-HAHNQTYVIMLDPGISSTQPEGSYWPFDEGLKRGVFIKDAE-GKTLIGKVWPGLTAYPDFSDEVTHDWWFDNLQKFHNKVPFDGLWIDMNEPSNFLDGSTNGCPSNS-LENPPYTPGVLGGLLRAKTVCATA-QQKLSMHYNLHSLYGLMEAKASASAL-KKLLTKRPFVISRSTFPSQGLYSGHWLGDNRSQWKDLYTSIAGILTFNLLGIPLVGADICGFSEEPQEELCVRWTQLGAFYPFTRNHNSIDMKPQDPTAFSPLARTAMKEALLLRYSLFPFLYTLFHHAHAHGHSVARPVMFEFPKDVKTYGIDKQFLWGRSLLVTPVLDPGVDYVVGYFPAGLWYDFYTGDSLHSKGEE--VRLQAPLDKINLHLREGSVIPTQTPNLTLWISTGQPLHLISALSDEGSAHGDLFWDDGESIDTFETNQYSYIVFSVA-QNTMTSQVLKSHQEASFITVGSASFYGVSAKP-SKVLVNSKDHPFTY 947          
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Medaka
Match: si:ch73-12o23.1 (lysosomal alpha-glucosidase [Source:NCBI gene;Acc:101169174])

HSP 1 Score: 712.605 bits (1838), Expect = 0.000e+0
Identity = 365/848 (43.04%), Postives = 508/848 (59.91%), Query Frame = 3
Query:  324 CQIANNNERLDCYPESGA--NQDSCIARGCCWSEPMRLSNKLQGVPLSIPYCYYPTDYSNYMIKSLRKSSRGIKAKLVRESPSYLPYEVAMLDLEVIYETKSRTRVRITDPKQKRYEVPMKLSPPDLKPPTDREYEVIIPSDGSFSIEIKRKSDDRSLFKS-FGPLLYSDQFLQISSIMSTDQIYGIGEQNRPFLHQLSNGWERIGLWARDNPIETFMNLYGAHPFYIGMPDDGKAFGVFHFNSNGQEFALQPAPAVTYRTIGGILDFFIFTGGSPEETVKQYLELVGKPMLPPYWSLGFHLSKWGYKNIEQLSEIFQRNINAGFPIGTQWSDIDYMENYKDFTVDKEKFNGLGRFVREIKQKYNSRFVAIVDPGISCTS-GNEYPPYYEGVFMDIFIKDSQTNQPIVGKVWPGETVYPDFTHPNISMYWYKQIQRFYNDVPIDGLWIDMNEPSNFYDGSKRGCQGNSKYDNPFFVPDIRDQSLISKTICSSALHYNNEKHYNLHNLYGYTESVTTNKALLKTIHGKRPFILSRSTFSGSGKYTFHWTGDNQASWDQLRNSIRQVLNFNMFGIPMTGADICGFNGNSDEELCIRWMQLGAFYPFMRNHNAINQRDQDPASWNTEAQKIMKTAISNRYAMLPLFYTLLVKSHMNGGTVMRPMSFEFFSDKVTHSIELQFMIGSSIMATPVVYPGARSVDAYFPAGVWYDFHSGKLLHSDAEGAWLTLDAPLDKINIALRGGHIVPLLDSNRNSKSNIPNKMTLYCGMAQDMSASGDLYWDDGESIDSYSRNRYSYVSFNASPEQLLITPVYFGYDLLP--VLNKIVILGFENKSITKFLLNDNDIPFHY 2849
            C   +   R DCYPE G    +D C AR CC+      SN  Q     +P+C+YP D+ +Y + S   +  G K  LV+E  +Y P ++  +++E   ET +R  VR+TDP   R+EVP+ +  P  K   +    ++  S   F I +KR+S    L  +   PL Y+DQFLQ S+++ T  IYG+GE    FLH ++  W  + +WARD P     NLYG HPFY+ M +DG A G F  NSN  +  LQP PA+T+RTIGGILDF++F G  P   V QYLE++G P +P YW+LG+HL +WGY +     E+ +   N G P  TQW+DIDYM+   DFT D +KF  L   VR++   +N  +V ++DPGIS T     Y P+ EG+   +FIKD++  + ++GKVWPG T YPDF+      +W+  +Q+F+N VP DGLWIDMNEPSNF DGS  GC  NS  +NP + P +    L +KT+C++A       HYNLH+LYG  E+  +  AL K +  KRPF++SRSTF   G Y+ HW GDN++ W  L  SI  +L FN+ GIP+ GADICGF+    EELC+RW QLGAFYPF RNHN+I+ + QDP +++  A+  MK A+  RY++ P  YTL   +H +G +V RP+ FEF  D  T+ I+ QF+ G S++ TPV+ PG   V  YFPAG+WYDF++G  LHS  E   + L APLDKIN+ LR G ++P    N     +    + L   ++ + SA GDL+WDDGESID++  N+YSY+ F+ + +  + + V   +       +      G   K  +K L+N  D PF Y
Sbjct:  113 CSAISEPWRFDCYPERGVVVTKDMCEARNCCFIPASSSSNAGQSRKNGVPWCFYPPDFPSYSLVSTDDTLMGQKGTLVKEVKTYYPGDILTVEVETRQETDTRLHVRMTDPSNPRFEVPISVPNPTKK--AENPAYIVELSKQPFGITVKRRSTGVLLLNTTVAPLFYADQFLQFSTVLPTQFIYGLGEHRSTFLHDMN--WNTLTMWARDVPPMEKTNLYGVHPFYLAMEEDGNAHGFFLLNSNAMDVVLQPTPALTWRTIGGILDFYVFLGPDPGSVVSQYLEVIGNPAMPIYWALGYHLCRWGYNSSNSTWEVVKSLRNYGIPQDTQWNDIDYMDQSMDFTYDSKKFETLPDLVRDL-HAHNQTYVIMLDPGISSTQPEGSYWPFDEGLKRGVFIKDAE-GKTLIGKVWPGLTAYPDFSDEVTHDWWFDNLQKFHNKVPFDGLWIDMNEPSNFLDGSTNGCPSNS-LENPPYTPGVLGGLLRAKTVCATA-QQKLSMHYNLHSLYGLMEAKASASAL-KKLLTKRPFVISRSTFPSQGLYSGHWLGDNRSQWKDLYTSIAGILTFNLLGIPLVGADICGFSEEPQEELCVRWTQLGAFYPFTRNHNSIDMKPQDPTAFSPLARTAMKEALLLRYSLFPFLYTLFHHAHAHGHSVARPVMFEFPKDVKTYGIDKQFLWGRSLLVTPVLDPGVDYVVGYFPAGLWYDFYTGDSLHSKGEE--VRLQAPLDKINLHLREGSVIPTQTPNLTLWISTGQPLHLISALSDEGSAHGDLFWDDGESIDTFETNQYSYIVFSVA-QNTMTSQVLKSHQEASFITVGSASFYGVSAKP-SKVLVNSKDHPFTY 947          
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Medaka
Match: gaa (glucosidase alpha, acid [Source:NCBI gene;Acc:101161640])

HSP 1 Score: 656.751 bits (1693), Expect = 0.000e+0
Identity = 346/851 (40.66%), Postives = 494/851 (58.05%), Query Frame = 3
Query:  321 QCQIANNNERLDCYPESGANQDSCIARGCCWSEPMRLSNKLQGVPLSIPYCYYPTDYSNYMIKSLRKSSRGIKAKLVRESPSYLPYEVAMLDLEVIYETKSRTRVRITDPKQKRYEVPMKLSPPDLKPPTDREYEVIIPSDGSFSIEIKRKSDDRSLFKS-FGPLLYSDQFLQISSIMSTDQIYGIGEQNRPFLHQLSNGWERIGLWARDNPIETFMNLYGAHPFYIGMPDDGKAFGVFHFNSNGQEFALQPAPAVTYRTIGGILDFFIFTGGSPEETVKQYLELVGKPMLPPYWSLGFHLSKWGYKNIEQLSEIFQRNINAGFPIGTQWSDIDYMENYKDFTVDKEKFNGLGRFVREIKQKYNSRFVAIVDPGISCTSG-NEYPPYYEGVFMDIFIKDSQTNQPIVGKVWPGETVYPDFTHPNISMYWYKQIQRFYNDVPIDGLWIDMNEPSNFYDGSKRGCQGNSKYDNPFFVPDIRDQSLISKTICSSALHYNNEKHYNLHNLYGYTESVTTNKALLKTIHGKRPFILSRSTFSGSGKYTFHWTGDNQASWDQLRNSIRQVLNFNMFGIPMTGADICGFNGNSDEELCIRWMQLGAFYPFMRNHNAINQRDQDPASWNTEAQKIMKTAISNRYAMLPLFYTLLVKSHMNGGTVMRPMSFEFFSDKVTHSIELQFMIGSSIMATPVVYPGARSVDAYFPAGVWYDFHSGKLLHSDAEGAWLTLDAPLDKINIALRGGHIVPLLDSNRNSKSNIPNKMTLYCGMAQDMSASGDLYWDDGESIDSYSRNRYSYVSFNASPEQLLITPVYF--GYDLLPVLNKIVILGFENKSITKFLLNDNDIPFHYNPET 2861
            +C I +   R DC  +   +Q  C  RGCC+S P+         P+  P+C+YP  Y  Y +     S+ G  A L R  PSYL  E++ L LEV+ E+     + I DP  +RYEVP+       K         +      F   ++R ++ R +  +   PLL++DQ+LQ+S+ +++  + G+GE     +  L+  W  + LW RD       NLYG+HPFY+   + G A GVF  NSN  E  LQP PA+T+ + GGILD ++F G  P+  ++QYL+++G PM+PPYWSLGFHL +WGY +      + Q   +A FP+  QW+D+DY    K FT D  +F  L   V E  ++   +++ I+DPGIS TS    YPP+ +GV  D+F+K++   + ++GKVWPG T +PDFT+     +W   I+ FY++VP+DGLWIDMNEP++F  GS  GC  N   + P + P +    L S T+C SA       HYNLHNLYG TE+  T+ AL K I  KRPF+LSRS+F G G+++  WTGD Q+ W+QL  SI  VL F++FG+P+ GADICGF GN+ EELC+RWMQLGAFYPFMRNHN      Q+P  +  +AQ  M+ A++ RY++LP  YTL   +H +  TV RP+  EF SD    SI+ QF+ G S++ +PV+  GA  V AY P G WY  ++G+  HS  +G +  L APLD INI +R GHI+P  +    + ++      L   ++ D SA GDL+WDDGES+D++    YSY+ F A   Q++  P+      D L VL  + + G  +  I      +  + F Y  +T
Sbjct:   71 ECTI-DPESRFDCGRDRLLSQGECEDRGCCFS-PLP-------SPVGPPWCFYPRWYPGYKMGPFSPSTHGKTASLTRAKPSYLFKEISPLTLEVMEESADCLHLTIKDPFTQRYEVPLPEGVSHTKADAQDVLFTVEFHSEPFGFIVRRATNGRVIMNTTVAPLLFADQYLQMSTTLASSFVSGLGEHYTSLVLDLN--WTSLTLWNRDMAPHADANLYGSHPFYMVQEEGGLAHGVFLLNSNAIEVILQPTPALTWISTGGILDLYVFMGPDPQSVIRQYLQVIGYPMMPPYWSLGFHLCRWGYTSSNATRSVAQHMHSANFPMDVQWNDLDYAHERKVFTFDPMRFGDLPEMVEEFHER-GMKYILILDPGISSTSPPRTYPPFEDGVKRDVFVKNAM-GEILIGKVWPGPTAFPDFTNVETRQWWEDCIRNFYSEVPVDGLWIDMNEPASFVQGSVEGCPDND-LERPPYTPRMVGGQLNSGTLCMSA-QQKLSTHYNLHNLYGLTEAYATHSAL-KKIQRKRPFVLSRSSFPGIGRFSAVWTGDVQSDWEQLGFSIPAVLQFSLFGVPLVGADICGFGGNTTEELCVRWMQLGAFYPFMRNHNDKPNAPQEPFVFGQKAQAAMRRAVNLRYSLLPFLYTLFHHAHTSAATVARPLFMEFPSDPNCKSIDQQFLWGGSLLISPVLKQGAVKVKAYLPLGTWYSLYNGQAFHS--KGQFFLLPAPLDTINIHVRQGHIIPQQEPALTTAASRRKPFFLIAALSGDGSARGDLFWDDGESLDTFEMQNYSYIIFTAVQFQIVSEPLKLNGALDGL-VLAGVQVFGVLSAPIYVLANGEKVLDFAYQADT 902          
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Medaka
Match: ENSORLT00000015395.2 (sucrase-isomaltase [Source:NCBI gene;Acc:101164831])

HSP 1 Score: 609.757 bits (1571), Expect = 0.000e+0
Identity = 326/820 (39.76%), Postives = 486/820 (59.27%), Query Frame = 3
Query:  324 CQIANNNERLDCYPESGANQDSCIARGCCWSEPMRLSNKLQGVPLSIPYCYYPTDYSNYMIKSLRKSS-RGIKAKLVR-ESPSYLPYEVAMLDLEVIYETKSRTRVRITDPKQKRYEVPMKLSPPDLKPPTDREYEVIIPSDGSFSIEIKRKSDDRSLF-KSFGPLLYSDQFLQISSIMSTDQIYGIGEQNRPFLHQLSNGWERIGLWARDN-PIETFMNLYGAHPFYIGMPDD-GKAFGVFHFNSNGQEFALQPAPAVTYRTIGGILDFFIFTGGSPEETVKQYLELVGKPMLPPYWSLGFHLSKWGYKNIEQLSEIFQRNINAGFPIGTQWSDIDYMENYKDFTVDKEKFNGLGRFVREIKQKYNSRFVAIVDPGISCTS--GN-EYPPYYEGVFMDIFIKDSQTNQPIVGKVWPGETVYPDFTHPNISMYWYKQIQRFYNDVPIDGLWIDMNEPSNFYDGSKRGCQGNSKYDNPFFVPDIRDQSLISKTICSSALH-YNNEKHYNLHNLYGYTESVTTNKALLKTIHGKRPFILSRSTFSGSGKYTFHWTGDNQASWDQLRNSIRQVLNFNMFGIPMTGADICGFNGNSDEELCIRWMQLGAFYPFMRNHNAINQRDQDPASWNTEAQKIM--KTAISNRYAMLPLFYTLLVKSHMNGGTVMRPMSFEFFSDKVTHSIELQFMIGSSIMATPVVYPGARSVDAYFPAGVWYDFHSGKLLHSDAEGAWLTLDAPLDKINIALRGGHIVPLLDSNRNSKSNIPNKMTLYCGMAQDMSASGDLYWDDGESIDSYSRNRYSYVSFNASPEQLLITPVYFGY 2750
            C      ER+DC+PE+GA+Q +C  RGCCWS P+   N        +P+C++ +++  Y   S++  +   I A+L R  SPS    ++  L      +T +R R +I D +QKR+EVP +        P+    + +  ++  F + ++RK + + LF  +F PL+++DQFLQ+S+ + +  IYG+GE         +N W    +++RD  P     NLYG +PF++ + D+ G +FGVF  NSN  E  LQPAPAVTYRTIGGILDFFIF G +PE+ V+++ EL+G+P++PPYWSLGF LS+W Y ++ ++ +  +RN   G P   Q++DIDYME  KDFT DK  F  L  F   + +K   +++ I+DP I+ +   G+  Y  Y  G   + ++ +S     +VG+VWPGETV+PD+T  N   +W  +  R Y +V  D LWIDMNE +NF  GS +GC  N K + P + P I D  + SKT+C  A   + N  HY++H+LYGY+  + T +AL +   G R  +L+RS+F G GKY+ HW GDN A+W+ ++ +I  +L F +FG+P  GADICGF  +S EELC RWMQ+GAFYPF RNHNA   + QDPAS+   +  +   K  +S RY +LP  YTL  K+H +G TV+RP+  EF+SD  T +++ QF+ G  ++ TPV+ PG  SV  YFP  VWYD+ + + L        L L  P DK+ + +RGG I+P  + +  +  +    M L   +  +  A+G+L+WDDG+S  +    +Y +  F+     L +     GY
Sbjct:   51 CPNVAQAERVDCFPETGASQLTCEQRGCCWS-PLDTPN--------VPWCFFSSNHG-YTAHSVKHPNPHEITAELSRMPSPSLFGADIQQLSFHAEMQTSNRLRFKIFDAQQKRFEVPHEHINTVTSNPSTPISDALEITNEPFGLIVRRKENKKVLFDTTFAPLVFADQFLQLSAKLPSHNIYGLGEHVHQNYRHDTN-WRTWPIFSRDAFPNGGTHNLYGHYPFFLCLEDNSGNSFGVFLLNSNAMEVTLQPAPAVTYRTIGGILDFFIFFGETPEQVVQEFEELIGRPVIPPYWSLGFQLSRWNYGSLSEVKKTVERNRAVGLPYDIQYTDIDYMEEKKDFTYDKVNFKDLPTFADYLHEK-GQKYILILDPAIATSKLIGDVAYGSYDRGTAKNAWVTESDGKTHLVGEVWPGETVFPDYTSQNCIDWWVDEYDRLYKEVKHDALWIDMNEVANFKQGSSKGCSVN-KLNYPPYTPRILDDLMYSKTLCMDAKQAWGN--HYDVHSLYGYSMVLATEQALQRVFGGNRTLMLTRSSFPGVGKYSGHWLGDNGANWNDIKWAIPGMLEFGLFGVPYIGADICGFFDDSSEELCRRWMQVGAFYPFSRNHNAEGYKPQDPASYGASSLLVATSKHYLSIRYTLLPYLYTLFYKAHTSGDTVVRPLLHEFYSDSDTWAVDRQFLWGKYLLITPVLDPGVESVQGYFPDAVWYDYETRERLGQRKTHVELFL--PADKLGLHIRGGAILPTQEPDVTTTHSRLRPMGLIIALDDNNQATGELFWDDGDSRATVENGKYIHYDFSVVDNVLAMDVTNAGY 853          

HSP 2 Score: 592.423 bits (1526), Expect = 0.000e+0
Identity = 330/883 (37.37%), Postives = 502/883 (56.85%), Query Frame = 3
Query:  345 ERLDCYPESGANQDSCIARGCCWSEPMRLSNKLQGVPLSIPYCYYPTDYSNYMIKSLRKSSRGIKAKLVR----------ESPSYLPYEVAMLDLEVIYETKSRTRVRITDPKQKRYEVPMKLSPPDLKPPTD---REYEVIIPSDGSFSIEIKRKSDDRSLFKSFGP-LLYSDQFLQISSIMSTDQIYGIGE-QNRPFLHQLSNGWERIGLWARDNPIETFMNLYGAHPFYIGMPDDGKAFGVFHFNSNGQEFALQPAPAVTYRTIGGILDFFIFTGGSPEETVKQYLELVGKPMLPPYWSLGFHLSKWGYKNIEQLSEIFQRNINAGFPIGTQWSDIDYMENYKDFTVDKEKFNGLGRFVREIKQKYNSRFVAIVDPGISCTSGNEYPPYYEGVFMDIFIK-DSQTNQPIV-GKVWPG------------ET---------VYPDFTHPNISMYWYKQIQRFYNDV-PIDGLWIDMNEPSNFYDGSKRG-CQGNSKYDNPFFVPDI--RDQSLISKTICSSALHYNNE----KHYNLHNLYGYTESVTTNKALLKTIHGKRPFILSRSTFSGSGKYTFHWTGDNQASWDQLRNSIRQVLNFNMFGIPMTGADICGFNGNSDEELCIRWMQLGAFYPFMRNHNAINQRDQDPASWNTEAQKIMKTAISNRYAMLPLFYTLLVKSHMNGGTVMRPMSFEFFSDKVTHSIELQFMIGSSIMATPVVYPGARSVDAYFPAGVWYDFHSGKLLHSDAEGAWLTLDAPLDKINIALRGGHIVPLLDSNRNSKSNIPNKMTLYCGMAQDMSASGDLYWDDGESIDSYSRNRYSYVSFNASPEQLLITPVYFGY---DLLPVLNKIVILGFENKSITKFLLNDNDIPFH 2846
            +R+DC+PE  +N+  C  RGC W               ++P+C+YP DY  Y + +  +++ GI+  + R          +SP     ++  L +E+ Y T    + +I DP  +R+EVP+ L+ P   P +D   R Y V + ++  F I++ RKS   +++ S  P  ++S+ F+QIS+ +S+  +YG GE ++  F H L   +   G++A+D P    MN YG HPFY+G+ + G A GV   NSN  +   QP P++TYRTIGGILDF++  G +PE  V++Y  LVG+P+LP YWSLGF L ++GY N  ++  ++     AG P   Q++DIDYME   DF +D E F GL   V +++ +   RF+ I+DP IS    N YP +  GV  D+FIK   +    IV GKVWP             ET          +PDF     + +W+++IQ FY +V   DGLWIDMNEP++F  G+  G C G +  + P ++P +  +++ L  KT+C ++    ++    KHY++HNLYG++ +  T  ALL  + GKR  +++RST+  SGK+  HW GDN +SWDQL  SI  ++ F++FGIP TGADICGF   +D E+C+RWMQLGAFYP+ RNHN      QDP +W+     I K  ++ RY +LP  YTL+ ++H  G TV+RP+  EF +DK T  I  QF+ G +++ +P +  G   V+ Y P   WYD+HS + +     G WLT+  PL++IN+ +RGG+I+P      N+K +  N + L   ++   +A G  +WDDGE ID+  + +Y + +F+ +   L    V+ G    D L  L  + + G   + IT+  L D+    H
Sbjct:  931 QRVDCHPEENSNEAECKKRGCLWE---------VSAAENVPWCFYPDDYG-YNVLNYAETTTGIRVDINRNTRYRSSGRPDSP-----DIDSLRVEINYHTGDMLQFKIWDPSTERFEVPVPLTVPS-TPESDEDKRLYRVSV-TESPFGIQVVRKSTGTTVWDSSMPGFIFSNMFIQISTKLSSKFVYGFGETEHTSFKHDLD--YHTWGMFAKDQPPGYKMNCYGVHPFYMGLENTGDAHGVLLLNSNAMDVTFQPTPSLTYRTIGGILDFYMVLGPTPEMVVQEYTSLVGRPVLPAYWSLGFQLCRYGYANDSEIENLYTDMKKAGIPYDVQYADIDYMERQLDFVLDSE-FQGLPALVDQMRAE-GMRFIFILDPAISGNETN-YPAFERGVAQDVFIKWPKELGDGIVWGKVWPDFPNVTVDEDLDWETQVQIYRSYAAFPDFFRSQTAAWWHQEIQDFYTNVMKFDGLWIDMNEPASFVHGTVGGTCLGENLLEFPPYMPPLESKEEGLKHKTLCMNSEQILSDGKRVKHYDVHNLYGWSHTKPTYDALLD-VTGKRGIVVTRSTYPSSGKWAGHWLGDNNSSWDQLYKSIIGMMEFSLFGIPYTGADICGFFNEADYEMCLRWMQLGAFYPYSRNHNGKGNPRQDPVAWDDRFATISKDVLNIRYTLLPYLYTLMFEAHTQGSTVVRPVLHEFTNDKTTWDIHRQFLWGPALLISPALDAGQTVVNGYLPVARWYDYHSAQDV--GVRGKWLTMQTPLERINLHVRGGYILPWQKPESNTKLSRKNPLGLIVALSDSGTAEGSFFWDDGEGIDTVEQKKYLHATFSTASNTLTNKVVHNGLNPEDRL-TLGSVKVWGTGTEKITEVTLTDSTGKIH 1787          
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Medaka
Match: ENSORLT00000015393.2 (sucrase-isomaltase [Source:NCBI gene;Acc:101164831])

HSP 1 Score: 609.372 bits (1570), Expect = 0.000e+0
Identity = 326/820 (39.76%), Postives = 486/820 (59.27%), Query Frame = 3
Query:  324 CQIANNNERLDCYPESGANQDSCIARGCCWSEPMRLSNKLQGVPLSIPYCYYPTDYSNYMIKSLRKSS-RGIKAKLVR-ESPSYLPYEVAMLDLEVIYETKSRTRVRITDPKQKRYEVPMKLSPPDLKPPTDREYEVIIPSDGSFSIEIKRKSDDRSLF-KSFGPLLYSDQFLQISSIMSTDQIYGIGEQNRPFLHQLSNGWERIGLWARDN-PIETFMNLYGAHPFYIGMPDD-GKAFGVFHFNSNGQEFALQPAPAVTYRTIGGILDFFIFTGGSPEETVKQYLELVGKPMLPPYWSLGFHLSKWGYKNIEQLSEIFQRNINAGFPIGTQWSDIDYMENYKDFTVDKEKFNGLGRFVREIKQKYNSRFVAIVDPGISCTS--GN-EYPPYYEGVFMDIFIKDSQTNQPIVGKVWPGETVYPDFTHPNISMYWYKQIQRFYNDVPIDGLWIDMNEPSNFYDGSKRGCQGNSKYDNPFFVPDIRDQSLISKTICSSALH-YNNEKHYNLHNLYGYTESVTTNKALLKTIHGKRPFILSRSTFSGSGKYTFHWTGDNQASWDQLRNSIRQVLNFNMFGIPMTGADICGFNGNSDEELCIRWMQLGAFYPFMRNHNAINQRDQDPASWNTEAQKIM--KTAISNRYAMLPLFYTLLVKSHMNGGTVMRPMSFEFFSDKVTHSIELQFMIGSSIMATPVVYPGARSVDAYFPAGVWYDFHSGKLLHSDAEGAWLTLDAPLDKINIALRGGHIVPLLDSNRNSKSNIPNKMTLYCGMAQDMSASGDLYWDDGESIDSYSRNRYSYVSFNASPEQLLITPVYFGY 2750
            C      ER+DC+PE+GA+Q +C  RGCCWS P+   N        +P+C++ +++  Y   S++  +   I A+L R  SPS    ++  L      +T +R R +I D +QKR+EVP +        P+    + +  ++  F + ++RK + + LF  +F PL+++DQFLQ+S+ + +  IYG+GE         +N W    +++RD  P     NLYG +PF++ + D+ G +FGVF  NSN  E  LQPAPAVTYRTIGGILDFFIF G +PE+ V+++ EL+G+P++PPYWSLGF LS+W Y ++ ++ +  +RN   G P   Q++DIDYME  KDFT DK  F  L  F   + +K   +++ I+DP I+ +   G+  Y  Y  G   + ++ +S     +VG+VWPGETV+PD+T  N   +W  +  R Y +V  D LWIDMNE +NF  GS +GC  N K + P + P I D  + SKT+C  A   + N  HY++H+LYGY+  + T +AL +   G R  +L+RS+F G GKY+ HW GDN A+W+ ++ +I  +L F +FG+P  GADICGF  +S EELC RWMQ+GAFYPF RNHNA   + QDPAS+   +  +   K  +S RY +LP  YTL  K+H +G TV+RP+  EF+SD  T +++ QF+ G  ++ TPV+ PG  SV  YFP  VWYD+ + + L        L L  P DK+ + +RGG I+P  + +  +  +    M L   +  +  A+G+L+WDDG+S  +    +Y +  F+     L +     GY
Sbjct:   51 CPNVAQAERVDCFPETGASQLTCEQRGCCWS-PLDTPN--------VPWCFFSSNHG-YTAHSVKHPNPHEITAELSRMPSPSLFGADIQQLSFHAEMQTSNRLRFKIFDAQQKRFEVPHEHINTVTSNPSTPISDALEITNEPFGLIVRRKENKKVLFDTTFAPLVFADQFLQLSAKLPSHNIYGLGEHVHQNYRHDTN-WRTWPIFSRDAFPNGGTHNLYGHYPFFLCLEDNSGNSFGVFLLNSNAMEVTLQPAPAVTYRTIGGILDFFIFFGETPEQVVQEFEELIGRPVIPPYWSLGFQLSRWNYGSLSEVKKTVERNRAVGLPYDIQYTDIDYMEEKKDFTYDKVNFKDLPTFADYLHEK-GQKYILILDPAIATSKLIGDVAYGSYDRGTAKNAWVTESDGKTHLVGEVWPGETVFPDYTSQNCIDWWVDEYDRLYKEVKHDALWIDMNEVANFKQGSSKGCSVN-KLNYPPYTPRILDDLMYSKTLCMDAKQAWGN--HYDVHSLYGYSMVLATEQALQRVFGGNRTLMLTRSSFPGVGKYSGHWLGDNGANWNDIKWAIPGMLEFGLFGVPYIGADICGFFDDSSEELCRRWMQVGAFYPFSRNHNAEGYKPQDPASYGASSLLVATSKHYLSIRYTLLPYLYTLFYKAHTSGDTVVRPLLHEFYSDSDTWAVDRQFLWGKYLLITPVLDPGVESVQGYFPDAVWYDYETRERLGQRKTHVELFL--PADKLGLHIRGGAILPTQEPDVTTTHSRLRPMGLIIALDDNNQATGELFWDDGDSRATVENGKYIHYDFSVVDNVLAMDVTNAGY 853          

HSP 2 Score: 592.423 bits (1526), Expect = 0.000e+0
Identity = 330/883 (37.37%), Postives = 502/883 (56.85%), Query Frame = 3
Query:  345 ERLDCYPESGANQDSCIARGCCWSEPMRLSNKLQGVPLSIPYCYYPTDYSNYMIKSLRKSSRGIKAKLVR----------ESPSYLPYEVAMLDLEVIYETKSRTRVRITDPKQKRYEVPMKLSPPDLKPPTD---REYEVIIPSDGSFSIEIKRKSDDRSLFKSFGP-LLYSDQFLQISSIMSTDQIYGIGE-QNRPFLHQLSNGWERIGLWARDNPIETFMNLYGAHPFYIGMPDDGKAFGVFHFNSNGQEFALQPAPAVTYRTIGGILDFFIFTGGSPEETVKQYLELVGKPMLPPYWSLGFHLSKWGYKNIEQLSEIFQRNINAGFPIGTQWSDIDYMENYKDFTVDKEKFNGLGRFVREIKQKYNSRFVAIVDPGISCTSGNEYPPYYEGVFMDIFIK-DSQTNQPIV-GKVWPG------------ET---------VYPDFTHPNISMYWYKQIQRFYNDV-PIDGLWIDMNEPSNFYDGSKRG-CQGNSKYDNPFFVPDI--RDQSLISKTICSSALHYNNE----KHYNLHNLYGYTESVTTNKALLKTIHGKRPFILSRSTFSGSGKYTFHWTGDNQASWDQLRNSIRQVLNFNMFGIPMTGADICGFNGNSDEELCIRWMQLGAFYPFMRNHNAINQRDQDPASWNTEAQKIMKTAISNRYAMLPLFYTLLVKSHMNGGTVMRPMSFEFFSDKVTHSIELQFMIGSSIMATPVVYPGARSVDAYFPAGVWYDFHSGKLLHSDAEGAWLTLDAPLDKINIALRGGHIVPLLDSNRNSKSNIPNKMTLYCGMAQDMSASGDLYWDDGESIDSYSRNRYSYVSFNASPEQLLITPVYFGY---DLLPVLNKIVILGFENKSITKFLLNDNDIPFH 2846
            +R+DC+PE  +N+  C  RGC W               ++P+C+YP DY  Y + +  +++ GI+  + R          +SP     ++  L +E+ Y T    + +I DP  +R+EVP+ L+ P   P +D   R Y V + ++  F I++ RKS   +++ S  P  ++S+ F+QIS+ +S+  +YG GE ++  F H L   +   G++A+D P    MN YG HPFY+G+ + G A GV   NSN  +   QP P++TYRTIGGILDF++  G +PE  V++Y  LVG+P+LP YWSLGF L ++GY N  ++  ++     AG P   Q++DIDYME   DF +D E F GL   V +++ +   RF+ I+DP IS    N YP +  GV  D+FIK   +    IV GKVWP             ET          +PDF     + +W+++IQ FY +V   DGLWIDMNEP++F  G+  G C G +  + P ++P +  +++ L  KT+C ++    ++    KHY++HNLYG++ +  T  ALL  + GKR  +++RST+  SGK+  HW GDN +SWDQL  SI  ++ F++FGIP TGADICGF   +D E+C+RWMQLGAFYP+ RNHN      QDP +W+     I K  ++ RY +LP  YTL+ ++H  G TV+RP+  EF +DK T  I  QF+ G +++ +P +  G   V+ Y P   WYD+HS + +     G WLT+  PL++IN+ +RGG+I+P      N+K +  N + L   ++   +A G  +WDDGE ID+  + +Y + +F+ +   L    V+ G    D L  L  + + G   + IT+  L D+    H
Sbjct:  931 QRVDCHPEENSNEAECKKRGCLWE---------VSAAENVPWCFYPDDYG-YNVLNYAETTTGIRVDINRNTRYRSSGRPDSP-----DIDSLRVEINYHTGDMLQFKIWDPSTERFEVPVPLTVPS-TPESDEDKRLYRVSV-TESPFGIQVVRKSTGTTVWDSSMPGFIFSNMFIQISTKLSSKFVYGFGETEHTSFKHDLD--YHTWGMFAKDQPPGYKMNCYGVHPFYMGLENTGDAHGVLLLNSNAMDVTFQPTPSLTYRTIGGILDFYMVLGPTPEMVVQEYTSLVGRPVLPAYWSLGFQLCRYGYANDSEIENLYTDMKKAGIPYDVQYADIDYMERQLDFVLDSE-FQGLPALVDQMRAE-GMRFIFILDPAISGNETN-YPAFERGVAQDVFIKWPKELGDGIVWGKVWPDFPNVTVDEDLDWETQVQIYRSYAAFPDFFRSQTAAWWHQEIQDFYTNVMKFDGLWIDMNEPASFVHGTVGGTCLGENLLEFPPYMPPLESKEEGLKHKTLCMNSEQILSDGKRVKHYDVHNLYGWSHTKPTYDALLD-VTGKRGIVVTRSTYPSSGKWAGHWLGDNNSSWDQLYKSIIGMMEFSLFGIPYTGADICGFFNEADYEMCLRWMQLGAFYPYSRNHNGKGNPRQDPVAWDDRFATISKDVLNIRYTLLPYLYTLMFEAHTQGSTVVRPVLHEFTNDKTTWDIHRQFLWGPALLISPALDAGQTVVNGYLPVARWYDYHSAQDV--GVRGKWLTMQTPLERINLHVRGGYILPWQKPESNTKLSRKNPLGLIVALSDSGTAEGSFFWDDGEGIDTVEQKKYLHATFSTASNTLTNKVVHNGLNPEDRL-TLGSVKVWGTGTEKITEVTLTDSTGKIH 1787          
BLAST of Lysosomal alpha-glucosidase vs. Planmine SMEST
Match: SMESG000004892.1 (SMESG000004892.1)

HSP 1 Score: 1592.79 bits (4123), Expect = 0.000e+0
Identity = 765/871 (87.83%), Postives = 818/871 (93.92%), Query Frame = 3
Query:  312 ATAQCQIANNNERLDCYPESGANQDSCIARGCCWSEPMRLSNKLQGVPLSIPYCYYPTDYSNYMIKSLRKSSRGIKAKLVRESPSYLPYEVAMLDLEVIYETKSRTRVRITDPKQKRYEVPMKLSPPDLKPPTDREYEVIIPSDGSFSIEIKRKSDDRSLFKSFGPLLYSDQFLQISSIMSTDQIYGIGEQNRPFLHQLSNGWERIGLWARDNPIETFMNLYGAHPFYIGMPDDGKAFGVFHFNSNGQEFALQPAPAVTYRTIGGILDFFIFTGGSPEETVKQYLELVGKPMLPPYWSLGFHLSKWGYKNIEQLSEIFQRNINAGFPIGTQWSDIDYMENYKDFTVDKEKFNGLGRFVREIKQKYNSRFVAIVDPGISCTSGNEYPPYYEGVFMDIFIKDSQTNQPIVGKVWPGETVYPDFTHPNISMYWYKQIQRFYNDVPIDGLWIDMNEPSNFYDGSKRGCQGNSKYDNPFFVPDIRDQSLISKTICSSALHYNNEKHYNLHNLYGYTESVTTNKALLKTIHGKRPFILSRSTFSGSGKYTFHWTGDNQASWDQLRNSIRQVLNFNMFGIPMTGADICGFNGNSDEELCIRWMQLGAFYPFMRNHNAINQRDQDPASWNTEAQKIMKTAISNRYAMLPLFYTLLVKSHMNGGTVMRPMSFEFFSDKVTHSIELQFMIGSSIMATPVVYPGARSVDAYFPAGVWYDFHSGKLLHSDAEGAWLTLDAPLDKINIALRGGHIVPLLDSNRNSKSNIPNKMTLYCGMAQDMSASGDLYWDDGESIDSYSRNRYSYVSFNASPEQLLITPVYFGYDLLPVLNKIVILGFENKSITKFLLNDNDIPFHYNPETXXXXXXXXXXXXXXEIKIQWM 2924
            ATAQCQIANNNERLDCYPESGANQDSCI+RGCCWSEPMRLSNKLQGVPLSIPYCYYPTDYSNYMIKSLRKSSRGIKAKLVRESPSYLP EVAMLDLEVIYETKSRTRVRITDPKQKRYEVPMKLS  DLKPPTDREYEVIIPSDGSFSIEIKRKSDDRSLFKSFGPLLYSDQFLQISSIMSTDQIYGIGEQNRPFLHQLSNGWERIGLWARD+P+ETF+NLYGAHPFYIGMP+DGKAFGVFHFNSNGQEFALQPAPAVTYRTIGG+LDFFIFTGGSPEETVKQYLELVGKPMLPPYWSLGFHLSK+GYK+I+++ E  QRN+N+G  +  QWSD+DYM+ YKDF+VD +K+   G FV++I+  YN+R+V I+D  IS  +   Y PY +G+ MDIFIK+  TN+PI+G+VWPG+TV+PDFTHP+I+ YW KQI+ F++ VP+DGLWIDMN+PS+F DGS  GC  N++YD PFFVP+IRDQSLI+KTICSS+LHYN EKHYNLHN+YG+ ESV TN  LL+    KRPF+LSRSTFSGSGKY FHWTGDNQASWD LRNSIRQVLNFNMFGIPMTGADICGFNGNSDEELCIRWMQLGAFYPFMRNHNAINQRDQDPASWNTEAQKIMKTAISNRYAMLPLFYTLLVKSHMNGGTVMRPMSFEFFSDKVTHSIELQFMIGSSIMATPVVYPGARSVDAYFPAGVWYDFHSGKLLHSDAEGAWLTLDAPLDKINIALRGGHIVPLLDSNRNSKSNIPNKMTLYCGMAQDMSASGDLYWDDGESIDSYSRNRYSYVSFNASPEQLLITPVY GYDLLPVLNKIVILGF+NKSITKF+LNDNDIPFHYNPETSSVVLSSLNANLNSEIKIQWM
Sbjct:   21 ATAQCQIANNNERLDCYPESGANQDSCISRGCCWSEPMRLSNKLQGVPLSIPYCYYPTDYSNYMIKSLRKSSRGIKAKLVRESPSYLPNEVAMLDLEVIYETKSRTRVRITDPKQKRYEVPMKLSSQDLKPPTDREYEVIIPSDGSFSIEIKRKSDDRSLFKSFGPLLYSDQFLQISSIMSTDQIYGIGEQNRPFLHQLSNGWERIGLWARDHPVETFINLYGAHPFYIGMPEDGKAFGVFHFNSNGQEFALQPAPAVTYRTIGGVLDFFIFTGGSPEETVKQYLELVGKPMLPPYWSLGFHLSKYGYKDIKEIHETLQRNVNSGISVDVQWSDVDYMDGYKDFSVDNQKYQNFGEFVKQIRDTYNTRYVVIIDSAIS--NSENYIPYTDGLEMDIFIKNPDTNEPIIGEVWPGKTVFPDFTHPDITKYWSKQIRAFHDMVPVDGLWIDMNDPSSFVDGSTTGCSNNNRYDRPFFVPEIRDQSLIAKTICSSSLHYNKEKHYNLHNIYGFKESVVTNDVLLQMFPKKRPFLLSRSTFSGSGKYAFHWTGDNQASWDHLRNSIRQVLNFNMFGIPMTGADICGFNGNSDEELCIRWMQLGAFYPFMRNHNAINQRDQDPASWNTEAQKIMKTAISNRYAMLPLFYTLLVKSHMNGGTVMRPMSFEFFSDKVTHSIELQFMIGSSIMATPVVYPGARSVDAYFPAGVWYDFHSGKLLHSDAEGAWLTLDAPLDKINIALRGGHIVPLLDSNRNSKSNIPNKMTLYCGMAQDMSASGDLYWDDGESIDSYSRNRYSYVSFNASPEQLLITPVYLGYDLLPVLNKIVILGFDNKSITKFVLNDNDIPFHYNPETSSVVLSSLNANLNSEIKIQWM 889          
BLAST of Lysosomal alpha-glucosidase vs. Planmine SMEST
Match: SMESG000005069.1 (SMESG000005069.1)

HSP 1 Score: 1437.94 bits (3721), Expect = 0.000e+0
Identity = 676/869 (77.79%), Postives = 768/869 (88.38%), Query Frame = 3
Query:  315 TAQCQIANNNERLDCYPESGANQDSCIARGCCWSEPMRLSNKLQGVPLSIPYCYYPTDYSNYMIKSLRKSSRGIKAKLVRESPSYLPYEVAMLDLEVIYETKSRTRVRITDPKQKRYEVPMKLSPPDLKPPTDREYEVIIPSDGSFSIEIKRKSDDRSLFKSFGPLLYSDQFLQISSIMSTDQIYGIGEQNRPFLHQLSNGWERIGLWARDNPIETFMNLYGAHPFYIGMPDDGKAFGVFHFNSNGQEFALQPAPAVTYRTIGGILDFFIFTGGSPEETVKQYLELVGKPMLPPYWSLGFHLSKWGYKNIEQLSEIFQRNINAGFPIGTQWSDIDYMENYKDFTVDKEKFNGLGRFVREIKQKYNSRFVAIVDPGISCTSGNEYPPYYEGVFMDIFIKDSQTNQPIVGKVWPGETVYPDFTHPNISMYWYKQIQRFYNDVPIDGLWIDMNEPSNFYDGSKRGCQGNSKYDNPFFVPDIRDQSLISKTICSSALHYNNEKHYNLHNLYGYTESVTTNKALLKTIHGKRPFILSRSTFSGSGKYTFHWTGDNQASWDQLRNSIRQVLNFNMFGIPMTGADICGFNGNSDEELCIRWMQLGAFYPFMRNHNAINQRDQDPASWNTEAQKIMKTAISNRYAMLPLFYTLLVKSHMNGGTVMRPMSFEFFSDKVTHSIELQFMIGSSIMATPVVYPGARSVDAYFPAGVWYDFHSGKLLHSDAEGAWLTLDAPLDKINIALRGGHIVPLLDSNRNSKSNIPNKMTLYCGMAQDMSASGDLYWDDGESIDSYSRNRYSYVSFNASPEQLLITPVYFGYDLLPVLNKIVILGFENKSITKFLLNDNDIPFHYNPETXXXXXXXXXXXXXXEIKIQW 2921
            + QC I NNNERLDC+PE  AN+ SC ++GCCWSEPMR SNKLQ +P SIPYCY+PT+Y NY +K +  S+RGIKAKL+++  ++LP E+  L+L+VIYETKSR R+RI+D + KR+EVP+KL+P D  PPTD +Y+VIIPSDGSFSIEIKRKSD RSLFK+FGPLLYSDQFLQIS++MSTDQ+YGIGEQNRPFLHQLSNGW RIGLWARD  IETF NLYG HPFY+G+PDDGKAFGVFHFNSN QEF+LQPAPA+TYR+IGGILD FIFTG +PEETVKQY+ L+GKPMLPPYWSLGFHLSKWGYKNIEQLSEIFQRNINAGFPIGTQWSDIDYMENYKDFTVDKEKFNGLGRFVREIKQKYNSRFVAIVDPGISCTSGNEY PYYEGVFMDIFIKDS TNQPIVGKVWPGETVYPDFTHPNISMYWYKQIQRFYNDVPIDGLWIDMNEPSNFYDGSKRGCQGNSKYDNPFFVPDIRDQSLISKTICSSALHYNNEKHYNLHNLYGYTESVTTNKALLKTIHGKRPFILSRSTFSGSGKYTFHWTGDNQASWDQLRNSIRQVLNFNMFGIPMTGADICGFNGNS+EELCIRWMQLGAFYPFMRNHNAINQRDQDPASW+ EAQKIMK AI+ RYA+ P FYT LVKSH+ GGTVM+PMSFEF+SD+ TH ++LQFMIGSSIM  PVV  GAR V+AYFPAG+WYDF SG +L+SD++GA +TLDAPLDKIN ALRGGHIV L+  +  +     NKM LYC +++D  ASGD YWDDGE++DSYS  +Y+Y+ F A+  +L I+  + GY+L+PVL+K+VILG +   +    +ND  + + ++ E S +++S+++ +++S I + W
Sbjct:   34 SPQCLIQNNNERLDCHPEPNANEQSCRSKGCCWSEPMRSSNKLQALPGSIPYCYFPTNYPNYAVKDIEVSNRGIKAKLIKQKFNHLPEEILSLNLDVIYETKSRVRIRISDTENKRFEVPIKLNPADPTPPTDTDYDVIIPSDGSFSIEIKRKSDGRSLFKTFGPLLYSDQFLQISTLMSTDQVYGIGEQNRPFLHQLSNGWTRIGLWARDYGIETFNNLYGTHPFYMGIPDDGKAFGVFHFNSNAQEFSLQPAPAITYRSIGGILDIFIFTGDTPEETVKQYVTLIGKPMLPPYWSLGFHLSKWGYKNIEQLSEIFQRNINAGFPIGTQWSDIDYMENYKDFTVDKEKFNGLGRFVREIKQKYNSRFVAIVDPGISCTSGNEYSPYYEGVFMDIFIKDSHTNQPIVGKVWPGETVYPDFTHPNISMYWYKQIQRFYNDVPIDGLWIDMNEPSNFYDGSKRGCQGNSKYDNPFFVPDIRDQSLISKTICSSALHYNNEKHYNLHNLYGYTESVTTNKALLKTIHGKRPFILSRSTFSGSGKYTFHWTGDNQASWDQLRNSIRQVLNFNMFGIPMTGADICGFNGNSNEELCIRWMQLGAFYPFMRNHNAINQRDQDPASWSIEAQKIMKIAINIRYALFPHFYTSLVKSHLYGGTVMKPMSFEFYSDRNTHGLDLQFMIGSSIMVVPVVDQGARKVNAYFPAGIWYDFQSGSILYSDSKGAQVTLDAPLDKINFALRGGHIVSLISDSMTNPQMSTNKMILYCALSEDSQASGDAYWDDGENVDSYSGKKYNYLKFIANGNRLEISVEFKGYELVPVLSKVVILGVKQTGVQNVSINDRPVDYQFDAEKSILLISNIDLSIDSHILLSW 902          
BLAST of Lysosomal alpha-glucosidase vs. Planmine SMEST
Match: SMESG000005050.1 (SMESG000005050.1)

HSP 1 Score: 1134.78 bits (2934), Expect = 0.000e+0
Identity = 530/841 (63.02%), Postives = 648/841 (77.05%), Query Frame = 3
Query:  321 QCQIANNNERLDCYPESGANQDSCIARGCCWSEPMRLSNKLQGVPLSIPYCYYPTDYSNYMIKSLRKSSRGIKAKLVRESPSYLPYEVAMLDLEVIYETKSRTRVRITDPKQKRYEVPMKLSPPDLKPPTDREYEVIIPSDGSFSIEIKRKSDDRSLFKSFGPLLYSDQFLQISSIMSTDQIYGIGEQNRPFLHQLSNGWERIGLWARDNPIETFMNLYGAHPFYIGMPDDGKAFGVFHFNSNGQEFALQPAPAVTYRTIGGILDFFIFTGGSPEETVKQYLELVGKPMLPPYWSLGFHLSKWGYKNIEQLSEIFQRNINAGFPIGTQWSDIDYMENYKDFTVDKEKFNGLGRFVREIKQKYNSRFVAIVDPGISCTSGNEYPPYYEGVFMDIFIKDSQTNQPIVGKVWPGETVYPDFTHPNISMYWYKQIQRFYNDVPIDGLWIDMNEPSNFYDGSKRGCQGNSKYDNPFFVPDIRDQSLISKTICSSALHYNNEKHYNLHNLYGYTESVTTNKALLKTIHGKRPFILSRSTFSGSGKYTFHWTGDNQASWDQLRNSIRQVLNFNMFGIPMTGADICGFNGNSDEELCIRWMQLGAFYPFMRNHNAINQRDQDPASWNTEAQKIMKTAISNRYAMLPLFYTLLVKSHMNGGTVMRPMSFEFFSDKVTHSIELQFMIGSSIMATPVVYPGARSVDAYFPAGVWYDFHSGKLLHSDAEGAWLTLDAPLDKINIALRGGHIVPLLDSNRNSKSNIPNKMTLYCGMAQDMSASGDLYWDDGESIDSYSRNRYSYVSFNASPEQLLITPVYFGYDLLPVLNKIVILGFENKSITKFLLNDNDIPF 2843
            QC + NNN RLDC+P S ANQ+ C+ARGCCWS P       Q  P +IPYC++P +Y NY I S   + RG KA+L ++  S+L  E+  L+ EVI+ET +R R+RITDP  +R+EVP++L  PD  PP++ +Y+  +P++GSF  E+KR SD  SLFK+FGPLLYSDQF+QISS+MS   +YGIGEQNRPFLH LS  WERIGLWARDN I+T+ NLYG HPFY+ +PD G+AFGV++FNSN QEF LQPAPA+TYRTIGGILD FIF+GG+PE TV QY EL+G+PMLPP+WSLGFHLSK+GYK+I  +S    RNIN   PI  QWSDIDYM+ YKDFT+D   ++ L  FV+ + Q    R++ I+DPGIS  S   Y  Y EG+ M+IFIKD+ T +P++G+VWPGET YPDFTHPN S YW  QIQRF++ VPIDGLWIDMNEPSNFYDGS+ GC  N+ YD PFFVP IRD SLI KTICSS+LHYNN  HYNLHNLYGYTE+V T+ ALL TI  KRPFILSRSTFSGSGKYTFHWTGDN A+WDQL NSIRQVLNFNMFGIPMTGADICGFNG+S+EELCIRWMQLGAFYPFMRNHN+I  + QDPASW+ EAQ IMK +I  RY  LP FYTLLVKS++ GGTVMRP+SF+F+SD  TH IE QFMIGSS++  PVV  GAR+V AYFPAGVWYD ++ +++HS   G W++LDAP+DK+N A+RGG I+  L     + S+      LYC ++ + +ASG+LYWDDGES DSYS N+YSY++F A    L +TP + G+  +P+L  I ++G EN SITK  LN  ++PF
Sbjct:   20 QCSVPNNNYRLDCFPGSNANQNDCLARGCCWSPP-ETREYSQNNP-TIPYCFFPIEYPNYQINSFTPTDRGFKARLTKQQKSFLRKEILNLNFEVIFETNTRLRIRITDPNVQRFEVPIQLGSPDPTPPSNIQYKFTMPTNGSFGFEVKRNSDGLSLFKTFGPLLYSDQFIQISSLMSIQHVYGIGEQNRPFLHDLSTQWERIGLWARDNGIDTYNNLYGTHPFYMSLPDSGEAFGVYYFNSNAQEFVLQPAPAITYRTIGGILDIFIFSGGTPETTVSQYTELIGRPMLPPFWSLGFHLSKYGYKSIADVSNTLYRNINISIPIEVQWSDIDYMDKYKDFTLDPINYSKLSSFVKYLNQSLGIRYIVIIDPGISIQSPGAYSAYDEGLEMNIFIKDANTKKPLIGQVWPGETCYPDFTHPNASKYWSHQIQRFHSQVPIDGLWIDMNEPSNFYDGSRTGCALNNPYDYPFFVPTIRDGSLIKKTICSSSLHYNNVMHYNLHNLYGYTEAVATHSALLNTIPNKRPFILSRSTFSGSGKYTFHWTGDNSANWDQLANSIRQVLNFNMFGIPMTGADICGFNGDSNEELCIRWMQLGAFYPFMRNHNSIGAKAQDPASWSQEAQIIMKKSIIIRYVWLPNFYTLLVKSYLYGGTVMRPLSFQFYSDAETHEIERQFMIGSSMLVNPVVVQGARNVVAYFPAGVWYDGYTNQVVHSGPIGKWISLDAPIDKLNYAIRGGSILTGLFPAMTTTSSRNGPCFLYCALSLNRTASGELYWDDGESFDSYSGNKYSYITFTADSRGLRVTPQFVGFRSIPLLASISVVGLENLSITKVSLNGKEVPF 858          
BLAST of Lysosomal alpha-glucosidase vs. Planmine SMEST
Match: SMESG000005054.1 (SMESG000005054.1)

HSP 1 Score: 1117.06 bits (2888), Expect = 0.000e+0
Identity = 522/842 (62.00%), Postives = 635/842 (75.42%), Query Frame = 3
Query:  321 QCQIANNNERLDCYPESGANQDSCIARGCCWSEPMRLSNKLQGVPLSIPYCYYPTDYSNYMIKSLRKSSRGIKAKLVRESPSYLPYEVAMLDLEVIYETKSRTRVRITDPKQKRYEVPMKLSPPDLKPPTDREYEVIIPSDGSFSIEIKRKSDDRSLFKSFGPLLYSDQFLQISSIMSTDQIYGIGEQNRPFLHQLSNGWERIGLWARDNPIETFMNLYGAHPFYIGMPDDGKAFGVFHFNSNGQEFALQPAPAVTYRTIGGILDFFIFTGGSPEETVKQYLELVGKPMLPPYWSLGFHLSKWGYKNIEQLSEIFQRNINAGFPIGTQWSDIDYMENYKDFTVDKEKFNGLGRFVREIKQKYNSRFVAIVDPGISCTSGNEYPPYYEGVFMDIFIKDSQTNQPIVGKVWPGETVYPDFTHPNISMYWYKQIQRFYNDVPIDGLWIDMNEPSNFYDGSKRGCQGNSKYDNPFFVPDIRDQSLISKTICSSALHYNNEKHYNLHNLYGYTESVTTNKALLKTIHGKRPFILSRSTFSGSGKYTFHWTGDNQASWDQLRNSIRQVLNFNMFGIPMTGADICGFNGNSDEELCIRWMQLGAFYPFMRNHNAINQRDQDPASWNTEAQKIMKTAISNRYAMLPLFYTLLVKSHMNGGTVMRPMSFEFFSDKVTHSIELQFMIGSSIMATPVVYPGARSVDAYFPAGVWYDFHSGKLLHSDAEGAWLTLDAPLDKINIALRGGHIVPLLDSNRNSKSNIPNKMTLYCGMAQDMSASGDLYWDDGESIDSYSRNRYSYVSFNASPEQLLITPVYFGYDLLPVLNKIVILGFENKSITKFLLNDNDIPFH 2846
            QC + NNN RLDC+P S ANQ+ C+ARGCCWS P       Q  P +IPYC++P +Y NY I S   + RG KA+L ++  S+L  E+  L+ EVI+ET +R R+RITDP  +R+EVP++L  PD  PP++ +Y+  +P +GSF  E+KR SD  SLFK+FGPLLYSDQF+QISS+MS   +YGIGEQNRPFLH LS  WERIGLWARDNP++T+ NLYG HPFY+ +PD G+AFGV++FNSN QEF LQPAPA+TYRTIGGILD FIF+GG+PE TV QY EL+G+PMLPPYWSLGFHLSK+GYK+I  +S    RNIN   PI  QWSDIDYM+ YKDFT D  K+   G FV  +      R++ I+DPGIS  S   Y PY EG+ M+++IKD+ T +P++ KVWPGET +PDFTHPN S YW  QIQRF++ VPIDGLWIDMNEPSNFY GSK GC GNS YD P+F P IRD SLI  TIC S+LHYNN  HYNLHNLYGYTE+V T+ ALL TI  KRPFILSRSTFSGSGKYTFHWTGDN A+WDQL NSIRQVLNFNMFGIPMTGADICGF G+S+EELCIRWMQLGAFYPFMRNHN +  RDQDPA+W+  AQ IM+ +I+ RYA+LP  YTLLVKSH+ GGTVMRP+SFEF+ D  T  IE QFMIGS+I+  PVV  GAR+V AYFPAG+WYD     +++S   G W++L+APL++ N+ALRGGH + +L S  NS       + L C ++ + +A+GDLYWDDGES+DSYS  ++SY  F A+   +LI P   GY +LP LN I+ILG    SIT   +ND  I F+
Sbjct:   19 QCSVPNNNYRLDCFPGSNANQNDCLARGCCWSPP-ETREYSQNNP-TIPYCFFPIEYPNYQINSFTPTVRGFKARLTKQQKSFLRKEILNLNFEVIFETNTRLRIRITDPNVQRFEVPIQLGSPDPTPPSNVQYKFTMPRNGSFGFEVKRNSDGLSLFKTFGPLLYSDQFIQISSLMSIQHVYGIGEQNRPFLHDLSTQWERIGLWARDNPVDTYNNLYGTHPFYMSLPDSGEAFGVYYFNSNAQEFVLQPAPAITYRTIGGILDIFIFSGGTPETTVSQYTELIGRPMLPPYWSLGFHLSKYGYKSIADVSNTLYRNINISIPIEVQWSDIDYMDKYKDFTSDPIKYANFGSFVAYLNITLGIRYIVIIDPGISIQSPGAYSPYDEGLEMNLYIKDANTKKPLIAKVWPGETCFPDFTHPNASKYWSNQIQRFHSQVPIDGLWIDMNEPSNFYYGSKTGCPGNSPYDQPYFTPLIRDNSLIKSTICLSSLHYNNVMHYNLHNLYGYTEAVATHSALLNTIPNKRPFILSRSTFSGSGKYTFHWTGDNSANWDQLANSIRQVLNFNMFGIPMTGADICGFLGDSNEELCIRWMQLGAFYPFMRNHNTLGVRDQDPAAWSKGAQDIMRQSINIRYALLPNLYTLLVKSHLYGGTVMRPLSFEFYGDAETLEIERQFMIGSAILVNPVVVQGARNVVAYFPAGIWYDATDLSVIYSGKTGKWISLNAPLERTNVALRGGHAL-ILSSLVNSTEYSRKVINLVCILSMNQTAAGDLYWDDGESMDSYSGKKFSYFKFTATSSSVLINPEILGYSVLPSLNSIIILGINTSSITTVTINDKPIQFY 857          
BLAST of Lysosomal alpha-glucosidase vs. Planmine SMEST
Match: SMESG000005053.1 (SMESG000005053.1)

HSP 1 Score: 1091.64 bits (2822), Expect = 0.000e+0
Identity = 509/841 (60.52%), Postives = 633/841 (75.27%), Query Frame = 3
Query:  321 QCQIANNNERLDCYPESGANQDSCIARGCCWSEPMRLSNKLQGVPLSIPYCYYPTDYSNYMIKSLRKSSRGIKAKLVRESPSYLPYEVAMLDLEVIYETKSRTRVRITDPKQKRYEVPMKLSPPDLKPPTDREYEVIIPSDGSFSIEIKRKSDDRSLFKSFGPLLYSDQFLQISSIMSTDQIYGIGEQNRPFLHQLSNGWERIGLWARDNPIETFMNLYGAHPFYIGMPDDGKAFGVFHFNSNGQEFALQPAPAVTYRTIGGILDFFIFTGGSPEETVKQYLELVGKPMLPPYWSLGFHLSKWGYKNIEQLSEIFQRNINAGFPIGTQWSDIDYMENYKDFTVDKEKFNGLGRFVREIKQKYNSRFVAIVDPGISCTSGNEYPPYYEGVFMDIFIKDSQTNQPIVGKVWPGETVYPDFTHPNISMYWYKQIQRFYNDVPIDGLWIDMNEPSNFYDGSKRGCQGNSKYDNPFFVPDIRDQSLISKTICSSALHYNNEKHYNLHNLYGYTESVTTNKALLKTIHGKRPFILSRSTFSGSGKYTFHWTGDNQASWDQLRNSIRQVLNFNMFGIPMTGADICGFNGNSDEELCIRWMQLGAFYPFMRNHNAINQRDQDPASWNTEAQKIMKTAISNRYAMLPLFYTLLVKSHMNGGTVMRPMSFEFFSDKVTHSIELQFMIGSSIMATPVVYPGARSVDAYFPAGVWYDFHSGKLLHSDAEGAWLTLDAPLDKINIALRGGHIVPLLDSNRNSKSNIPNKMTLYCGMAQDMSASGDLYWDDGESIDSYSRNRYSYVSFNASPEQLLITPVYFGYDLLPVLNKIVILGFENKSITKFLLNDNDIPF 2843
            QC + NNN RLDC+P + +NQ+ C+ARGCCWS P       Q  P +IPYC++P +Y NY I S   + RG KA+L ++  S+L  E+  L+ EVI+ET +R R+RITDP  +R+EVP++L  PD  PP++ +Y+  +P++GSF  E+KR SD  SLFK+FGPLLYSDQF+QISS+MS   +YGIGEQNRPFLH LS  WERIGLW+RD  I+T+ NLYG HPFY+ +PD G+AFGV++FNSN QEF LQPAPA+TYRTIGGILD FIF+GG+PE TV QY EL+G+PMLPP+WSLGFHLSK+G  NI  +S    RNIN   PI  QWSDIDYM+ YKDFT D  ++   G FV  + Q    +++ I+DPGIS  S   Y  Y EG+ ++IFIKD+ T + ++  VWPGET +PDFTHPN S YW  QIQRF++ VPIDGLWIDMNEP++FY GS  GC GN+ YD PFFVP IRD SLI+KTICSS+LHYNN  HYNLHNLYGYTE+V T+ ALL TI  KRPFILSRSTFSGSGKYTFHWTGDN + WDQL NSIRQ+LNFNMFG+PM G DICGFN N +EELCIRWMQLGAFYPFMRNHN    RDQDPASW+ EAQ IM+ +I+ RY  LP FYTLLVKS++ GGTVMRP+SF+F+ D  T  IE QFMIGSS++  PVV  GAR+V AYFP+GVWYD ++ +++HS   G W++LDAP+DK+N A+RGG I+  L     + S+      LYC ++ + +ASG+LYWDDGES DSYS N+YSY++F A    L +TP + G+  +P+L  I ++G EN SITK  LN  ++PF
Sbjct:   20 QCSVLNNNYRLDCFPGTNSNQNDCLARGCCWSPP-ETREYSQNNP-TIPYCFFPIEYPNYQINSFTPTDRGFKARLTKQQKSFLRKEILNLNFEVIFETNTRLRIRITDPNVQRFEVPIQLGSPDPTPPSNIQYKFTMPTNGSFGFEVKRNSDGLSLFKTFGPLLYSDQFIQISSLMSIQHVYGIGEQNRPFLHDLSTQWERIGLWSRDYGIDTYNNLYGTHPFYMSLPDSGEAFGVYYFNSNAQEFVLQPAPAITYRTIGGILDIFIFSGGTPETTVSQYTELIGRPMLPPFWSLGFHLSKYGQNNIADVSNTLYRNINISIPIEVQWSDIDYMDKYKDFTSDPIRYPNFGSFVAHLNQSLGIKYIVIIDPGISIQSPGVYSAYDEGLELNIFIKDANTKKDLISNVWPGETCFPDFTHPNASKYWSHQIQRFHSQVPIDGLWIDMNEPASFYYGSHIGCPGNNPYDYPFFVPTIRDSSLITKTICSSSLHYNNVMHYNLHNLYGYTEAVATHSALLNTIPNKRPFILSRSTFSGSGKYTFHWTGDNWSHWDQLANSIRQLLNFNMFGMPMVGEDICGFNDNCNEELCIRWMQLGAFYPFMRNHNTYGVRDQDPASWSKEAQNIMRKSINLRYVWLPNFYTLLVKSYLYGGTVMRPLSFQFYDDVETREIERQFMIGSSMLVNPVVVQGARNVVAYFPSGVWYDGYTNQVVHSGPIGKWISLDAPIDKLNYAIRGGSILTGLFPAMTTTSSRNGPCFLYCALSLNRTASGELYWDDGESFDSYSGNKYSYITFTADSRGLKVTPQFVGFRSIPLLASISVVGLENLSITKVSLNGKEVPF 858          
The following BLAST results are available for this feature:
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GAA0.000e+041.17glucosidase alpha, acid [Source:HGNC Symbol;Acc:HG... [more]
GAA0.000e+041.17glucosidase alpha, acid [Source:HGNC Symbol;Acc:HG... [more]
MGAM0.000e+040.88maltase-glucoamylase [Source:HGNC Symbol;Acc:HGNC:... [more]
MGAM0.000e+040.88maltase-glucoamylase [Source:HGNC Symbol;Acc:HGNC:... [more]
MGAM0.000e+040.88maltase-glucoamylase [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
aagr-12.216e-15535.18Acid Alpha Glucosidase Relate [Source:UniProtKB/T... [more]
aagr-12.216e-15535.18Acid Alpha Glucosidase Relate [Source:UniProtKB/T... [more]
aagr-12.216e-15535.18Acid Alpha Glucosidase Relate [Source:UniProtKB/T... [more]
aagr-22.372e-14634.28Acid Alpha Glucosidase Relate [Source:UniProtKB/T... [more]
aagr-44.944e-8430.73Acid Alpha Glucosidase Relate [Source:UniProtKB/T... [more]
back to top
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GCS2alpha4.255e-7728.69gene:FBgn0027588 transcript:FBtr0070058[more]
GCS2alpha4.255e-7728.69gene:FBgn0027588 transcript:FBtr0070062[more]
GCS2alpha4.255e-7728.69gene:FBgn0027588 transcript:FBtr0070061[more]
GCS2alpha4.255e-7728.69gene:FBgn0027588 transcript:FBtr0070060[more]
GCS2alpha4.255e-7728.69gene:FBgn0027588 transcript:FBtr0070059[more]
back to top
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch73-12o23.10.000e+044.84si:ch73-12o23.1 [Source:ZFIN;Acc:ZDB-GENE-130530-7... [more]
CABZ01079192.18.698e-17235.70sucrase-isomaltase (alpha-glucosidase) [Source:NCB... [more]
GAA1.221e-10740.79glucosidase alpha, acid [Source:HGNC Symbol;Acc:HG... [more]
gaa3.786e-10341.37glucosidase, alpha; acid (Pompe disease, glycogen ... [more]
CABZ01088484.14.940e-8234.36pep chromosome:GRCz11:18:1768804:1791127:1 gene:EN... [more]
back to top
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GAA0.000e+044.15glucosidase, alpha; acid [Source:NCBI gene;Acc:100... [more]
GAA0.000e+043.98glucosidase, alpha; acid [Source:NCBI gene;Acc:100... [more]
GAA0.000e+043.76glucosidase, alpha; acid [Source:NCBI gene;Acc:100... [more]
GAA0.000e+043.73glucosidase, alpha; acid [Source:NCBI gene;Acc:100... [more]
GAA0.000e+043.65glucosidase, alpha; acid [Source:NCBI gene;Acc:100... [more]
back to top
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Gaa0.000e+041.70glucosidase, alpha, acid [Source:MGI Symbol;Acc:MG... [more]
Gaa0.000e+041.70glucosidase, alpha, acid [Source:MGI Symbol;Acc:MG... [more]
Mgam0.000e+041.89maltase-glucoamylase [Source:MGI Symbol;Acc:MGI:12... [more]
Mgam0.000e+041.89maltase-glucoamylase [Source:MGI Symbol;Acc:MGI:12... [more]
Mgam0.000e+041.89maltase-glucoamylase [Source:MGI Symbol;Acc:MGI:12... [more]
back to top
BLAST of Lysosomal alpha-glucosidase vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6P7A9|LYAG_RAT0.000e+041.91Lysosomal alpha-glucosidase OS=Rattus norvegicus O... [more]
sp|P70699|LYAG_MOUSE0.000e+041.70Lysosomal alpha-glucosidase OS=Mus musculus OX=100... [more]
sp|Q5R7A9|LYAG_PONAB0.000e+041.03Lysosomal alpha-glucosidase OS=Pongo abelii OX=960... [more]
sp|P10253|LYAG_HUMAN0.000e+041.17Lysosomal alpha-glucosidase OS=Homo sapiens OX=960... [more]
sp|Q9MYM4|LYAG_BOVIN0.000e+041.30Lysosomal alpha-glucosidase OS=Bos taurus OX=9913 ... [more]
back to top
BLAST of Lysosomal alpha-glucosidase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|250556630.000e+044.12tr|A0A1D1VXK3|A0A1D1VXK3_RAMVA P-type domain-conta... [more]
gnl|BL_ORD_ID|171882430.000e+043.86tr|A0A4Z2D8T0|A0A4Z2D8T0_SCHJA Lysosomal alpha-glu... [more]
gnl|BL_ORD_ID|204147190.000e+044.42tr|H2KPA9|H2KPA9_CLOSI Lysosomal alpha-glucosidase... [more]
gnl|BL_ORD_ID|203550620.000e+044.30tr|A0A419PZA5|A0A419PZA5_CLOSI Lysosomal alpha-glu... [more]
gnl|BL_ORD_ID|229275250.000e+046.04tr|A0A4S2MAN8|A0A4S2MAN8_OPIFE P-type domain-conta... [more]
back to top
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch73-12o23.10.000e+042.91lysosomal alpha-glucosidase [Source:NCBI gene;Acc:... [more]
gaa0.000e+042.38glucosidase alpha, acid [Source:NCBI gene;Acc:1030... [more]
gaa0.000e+042.72glucosidase alpha, acid [Source:NCBI gene;Acc:1030... [more]
ganab6.483e-7629.08glucosidase, alpha; neutral AB [Source:ZFIN;Acc:ZD... [more]
ENSAMXT00000016120.22.699e-7329.50neutral alpha-glucosidase AB-like [Source:NCBI gen... [more]
back to top
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000005523.13.422e-14635.83pep scaffold:Pmarinus_7.0:GL480123:76219:97698:-1 ... [more]
ENSPMAT00000008911.12.465e-7333.76pep scaffold:Pmarinus_7.0:GL496136:1712:3787:1 gen... [more]
ENSPMAT00000008912.13.776e-7033.81pep scaffold:Pmarinus_7.0:GL496136:2540:3769:1 gen... [more]
ENSPMAT00000008215.15.596e-7029.54pep scaffold:Pmarinus_7.0:GL476974:10756:37747:1 g... [more]
ENSPMAT00000008908.18.345e-5434.26pep scaffold:Pmarinus_7.0:GL496136:110:3787:1 gene... [more]
back to top
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
ROT26.306e-6428.79Glucosidase II catalytic subunit; required to trim... [more]
back to top
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO418110.000e+043.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO486321.139e-6931.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO457567.964e-1023.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch73-12o23.10.000e+043.04lysosomal alpha-glucosidase [Source:NCBI gene;Acc:... [more]
si:ch73-12o23.10.000e+043.04lysosomal alpha-glucosidase [Source:NCBI gene;Acc:... [more]
gaa0.000e+040.66glucosidase alpha, acid [Source:NCBI gene;Acc:1011... [more]
ENSORLT00000015395.20.000e+039.76sucrase-isomaltase [Source:NCBI gene;Acc:101164831... [more]
ENSORLT00000015393.20.000e+039.76sucrase-isomaltase [Source:NCBI gene;Acc:101164831... [more]
back to top
BLAST of Lysosomal alpha-glucosidase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000004892.10.000e+087.83SMESG000004892.1[more]
SMESG000005069.10.000e+077.79SMESG000005069.1[more]
SMESG000005050.10.000e+063.02SMESG000005050.1[more]
SMESG000005054.10.000e+062.00SMESG000005054.1[more]
SMESG000005053.10.000e+060.52SMESG000005053.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30028442 ID=SMED30028442|Name=Lysosomal alpha-glucosidase|organism=Schmidtea mediterranea sexual|type=transcript|length=2946bp
ATTGTTATGCAAAATTATTTTAGCAAAAATTCCGATAGGTTTTATCTAAT
TAGTAATTAAGTAGATACTTCATGCTCTTGAACTTGATTTTATTTTAAAA
TGGAGGTGTGTCGCTGATCTGGAAAAGTTTAATTTCAAATTATCTTTAAT
TAGATCATCACACCTATTTTAGTTGTTGTAGAGAGTCAAAGTTCAGCTTT
TAATTAATATATATTCAATTAAAAATTTGCAAAAAATTATTTCCATTTCA
AATGAAATTAATAATATTAATAAGTTTTATTAATTTGATTTCGTTATTCA
ACTTTTCCAACGCGACAGCACAATGTCAAATAGCCAATAACAATGAGAGA
CTTGATTGCTACCCAGAATCCGGAGCCAATCAAGATTCATGTATAGCAAG
GGGGTGTTGCTGGTCCGAACCAATGAGATTGTCCAATAAATTGCAAGGTG
TTCCACTATCAATCCCATATTGCTATTATCCAACTGATTATTCCAACTAT
ATGATTAAATCCTTAAGAAAATCTTCAAGAGGGATCAAAGCAAAATTAGT
CAGGGAATCACCAAGTTATTTACCCTATGAAGTTGCAATGTTAGATCTTG
AGGTAATTTATGAAACAAAATCTAGAACTCGAGTCAGAATAACAGATCCT
AAACAAAAAAGATATGAAGTTCCAATGAAACTCAGTCCTCCAGATTTGAA
GCCACCGACTGATCGAGAATATGAAGTCATAATCCCATCTGATGGTTCAT
TTTCTATTGAAATTAAACGAAAATCAGATGATCGTTCACTTTTCAAATCA
TTTGGGCCACTTTTATATTCTGATCAATTTTTACAAATATCTTCAATAAT
GTCAACTGATCAAATCTATGGAATAGGAGAACAAAATAGACCCTTTCTTC
ATCAATTATCCAATGGCTGGGAAAGAATTGGATTGTGGGCAAGAGACAAT
CCGATTGAAACATTTATGAATCTTTATGGAGCTCATCCATTTTATATCGG
TATGCCAGACGATGGAAAAGCTTTCGGTGTTTTTCACTTTAATAGTAATG
GTCAAGAATTCGCTTTACAACCGGCACCAGCAGTAACTTATAGAACAATC
GGTGGAATTTTAGATTTCTTTATTTTTACCGGAGGCAGCCCTGAAGAAAC
AGTAAAACAATACCTAGAATTGGTAGGAAAGCCAATGCTTCCTCCATATT
GGTCTCTTGGATTCCATCTGTCAAAATGGGGTTACAAAAATATTGAGCAA
TTGTCTGAAATATTTCAAAGAAATATTAATGCCGGTTTCCCAATCGGTAC
TCAGTGGAGTGATATAGATTATATGGAAAATTATAAAGATTTTACTGTCG
ACAAAGAGAAATTTAATGGATTGGGAAGATTTGTCAGAGAGATTAAACAA
AAATATAACTCTAGATTTGTTGCAATTGTTGATCCAGGAATAAGCTGCAC
AAGTGGTAACGAATATCCACCTTATTATGAAGGAGTATTTATGGATATTT
TCATCAAAGATTCACAGACCAATCAACCAATTGTTGGCAAGGTTTGGCCC
GGAGAAACAGTTTATCCAGACTTCACTCATCCGAACATTTCTATGTATTG
GTATAAACAAATTCAACGCTTTTATAATGATGTTCCAATTGATGGGCTTT
GGATTGATATGAATGAGCCATCTAATTTCTACGATGGTTCCAAAAGAGGC
TGTCAAGGAAATAGTAAATATGACAATCCATTTTTTGTACCGGATATTCG
AGATCAGTCATTAATATCTAAAACTATTTGTTCTTCAGCACTCCATTACA
ATAACGAAAAGCATTATAATTTGCACAATCTCTACGGCTATACGGAATCA
GTAACAACAAATAAAGCATTATTAAAAACGATACACGGAAAAAGACCTTT
TATTTTATCCCGGTCAACTTTCAGTGGATCTGGTAAATATACCTTCCATT
GGACCGGGGATAATCAAGCAAGTTGGGATCAGTTAAGAAATTCCATTAGA
CAAGTGCTTAATTTCAACATGTTTGGTATTCCGATGACTGGTGCTGACAT
TTGTGGATTTAACGGTAACAGTGATGAAGAACTCTGTATTAGATGGATGC
AATTGGGCGCTTTTTATCCATTCATGAGGAACCACAATGCAATCAACCAG
AGAGATCAAGATCCAGCTTCATGGAATACGGAAGCCCAGAAAATAATGAA
AACAGCTATTTCTAATCGTTATGCAATGTTGCCTTTATTTTATACATTAT
TAGTCAAATCCCATATGAATGGTGGCACCGTAATGAGACCAATGAGCTTT
GAATTCTTTTCAGATAAAGTAACGCATTCTATAGAATTACAGTTTATGAT
TGGATCCTCGATTATGGCAACTCCAGTTGTTTATCCTGGGGCCAGATCTG
TAGATGCATATTTTCCAGCTGGAGTCTGGTACGATTTTCACAGTGGAAAA
TTGTTACATTCAGATGCTGAAGGAGCTTGGTTGACTTTGGATGCTCCTTT
GGACAAAATTAATATTGCATTACGCGGCGGTCATATAGTTCCTCTATTGG
ATTCCAATAGAAATTCTAAATCAAACATACCAAATAAAATGACATTGTAT
TGCGGAATGGCACAAGATATGAGTGCTTCTGGAGATTTATATTGGGACGA
TGGCGAGAGCATTGACTCCTACTCACGCAATAGATATAGCTATGTATCAT
TCAATGCTAGCCCTGAGCAACTGTTAATAACACCGGTTTACTTTGGCTAC
GACTTGTTGCCGGTCTTAAACAAAATCGTAATCCTTGGGTTTGAGAATAA
GTCAATTACTAAATTTCTATTAAATGACAATGATATTCCTTTCCATTATA
ATCCGGAGACTTCATCTGTGGTGCTCAGCAGTTTAAATGCCAATTTAAAT
TCCGAAATAAAAATTCAATGGATGTGAATAATTTTTTGTATTTTAT
back to top

protein sequence of SMED30028442-orf-1

>SMED30028442-orf-1 ID=SMED30028442-orf-1|Name=SMED30028442-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=892bp
MKLIILISFINLISLFNFSNATAQCQIANNNERLDCYPESGANQDSCIAR
GCCWSEPMRLSNKLQGVPLSIPYCYYPTDYSNYMIKSLRKSSRGIKAKLV
RESPSYLPYEVAMLDLEVIYETKSRTRVRITDPKQKRYEVPMKLSPPDLK
PPTDREYEVIIPSDGSFSIEIKRKSDDRSLFKSFGPLLYSDQFLQISSIM
STDQIYGIGEQNRPFLHQLSNGWERIGLWARDNPIETFMNLYGAHPFYIG
MPDDGKAFGVFHFNSNGQEFALQPAPAVTYRTIGGILDFFIFTGGSPEET
VKQYLELVGKPMLPPYWSLGFHLSKWGYKNIEQLSEIFQRNINAGFPIGT
QWSDIDYMENYKDFTVDKEKFNGLGRFVREIKQKYNSRFVAIVDPGISCT
SGNEYPPYYEGVFMDIFIKDSQTNQPIVGKVWPGETVYPDFTHPNISMYW
YKQIQRFYNDVPIDGLWIDMNEPSNFYDGSKRGCQGNSKYDNPFFVPDIR
DQSLISKTICSSALHYNNEKHYNLHNLYGYTESVTTNKALLKTIHGKRPF
ILSRSTFSGSGKYTFHWTGDNQASWDQLRNSIRQVLNFNMFGIPMTGADI
CGFNGNSDEELCIRWMQLGAFYPFMRNHNAINQRDQDPASWNTEAQKIMK
TAISNRYAMLPLFYTLLVKSHMNGGTVMRPMSFEFFSDKVTHSIELQFMI
GSSIMATPVVYPGARSVDAYFPAGVWYDFHSGKLLHSDAEGAWLTLDAPL
DKINIALRGGHIVPLLDSNRNSKSNIPNKMTLYCGMAQDMSASGDLYWDD
GESIDSYSRNRYSYVSFNASPEQLLITPVYFGYDLLPVLNKIVILGFENK
SITKFLLNDNDIPFHYNPETSSVVLSSLNANLNSEIKIQWM*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002031embryonic gut
PLANA:0002087primitive gut
PLANA:0000058embryonic digestive system
PLANA:0000059embryonic gut cell
PLANA:0000023embryonic pharynx
PLANA:0000085primitive gut cell
Vocabulary: INTERPRO
TermDefinition
IPR013780Glyco_hydro_b
IPR000519P_trefoil_dom
IPR025887Glyco_hydro_31_N_dom
IPR000322Glyco_hydro_31
IPR031727Gal_mutarotase_N
IPR030459Glyco_hydro_31_CS
IPR030458Glyco_hydro_31_AS
IPR011013Gal_mutarotase_sf_dom
IPR017853Glycoside_hydrolase_SF
Vocabulary: molecular function
TermDefinition
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0003824catalytic activity
GO:0030246carbohydrate binding
GO:0004558alpha-1,4-glucosidase activity
GO:0016787hydrolase activity
GO:0016798hydrolase activity, acting on glycosyl bonds
GO:0032450maltose alpha-glucosidase activity
Vocabulary: biological process
TermDefinition
GO:0005975carbohydrate metabolic process
GO:0000023maltose metabolic process
GO:0005980glycogen catabolic process
GO:0008152metabolic process
Vocabulary: cellular component
TermDefinition
GO:0005764lysosome
GO:0005765lysosomal membrane
GO:0016020membrane
Vocabulary: Schmidtea mediterranea Developmental Stages
TermDefinition
PLANA:0000002Stage 2
PLANA:0000006Stage 6
PLANA:0000004Stage 4
PLANA:0000003Stage 3
PLANA:0000005Stage 5
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000519P-type trefoil domainSMARTSM00018P_2coord: 23..81
e-value: 1.1E-7
score: 41.5
IPR000519P-type trefoil domainPFAMPF00088Trefoilcoord: 25..77
e-value: 4.5E-10
score: 39.2
IPR000519P-type trefoil domainPROSITEPS51448P_TREFOIL_2coord: 23..78
score: 15.576
IPR000519P-type trefoil domainCDDcd00111Trefoilcoord: 23..78
e-value: 5.02395E-8
score: 47.7238
IPR000322Glycoside hydrolase family 31PFAMPF01055Glyco_hydro_31coord: 290..761
e-value: 1.3E-149
score: 499.1
IPR025887Glycoside hydrolase family 31, N-terminal domainPFAMPF13802Gal_mutarotas_2coord: 203..266
e-value: 3.8E-7
score: 30.3
IPR013780Glycosyl hydrolase, all-betaGENE3DG3DSA:2.60.40.1180coord: 657..757
e-value: 2.3E-30
score: 106.7
IPR013780Glycosyl hydrolase, all-betaGENE3DG3DSA:2.60.40.1180coord: 758..888
e-value: 4.0E-22
score: 80.8
NoneNo IPR availableGENE3DG3DSA:3.20.20.80coord: 311..656
e-value: 6.6E-144
score: 481.3
NoneNo IPR availableGENE3DG3DSA:2.60.40.1760coord: 78..309
e-value: 2.0E-65
score: 222.6
NoneNo IPR availableGENE3DG3DSA:4.10.110.10coord: 22..75
e-value: 1.1E-13
score: 52.6
NoneNo IPR availablePANTHERPTHR22762ALPHA-GLUCOSIDASEcoord: 24..888
NoneNo IPR availablePANTHERPTHR22762:SF92LYSOSOMAL ALPHA-GLUCOSIDASEcoord: 24..888
NoneNo IPR availableCDDcd14752GH31_Ncoord: 203..309
e-value: 3.3256E-23
score: 93.4044
NoneNo IPR availableCDDcd06602GH31_MGAM_SI_GAAcoord: 309..669
e-value: 0.0
score: 586.4
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..23
score: 0.67
NoneNo IPR availableSUPERFAMILYSSF51011Glycosyl hydrolase domaincoord: 675..756
NoneNo IPR availableSUPERFAMILYSSF57492Trefoilcoord: 22..83
IPR031727Galactose mutarotase, N-terminal barrelPFAMPF16863NtCtMGAM_Ncoord: 95..199
e-value: 3.3E-22
score: 78.9
IPR030459Glycosyl hydrolases family 31, conserved sitePROSITEPS00707GLYCOSYL_HYDROL_F31_2coord: 595..625
IPR011013Galactose mutarotase-like domain superfamilySUPERFAMILYSSF74650Galactose mutarotase-likecoord: 71..297
IPR017853Glycoside hydrolase superfamilySUPERFAMILYSSF51445(Trans)glycosidasescoord: 299..672