Lysosomal alpha-glucosidase

Overview
NameLysosomal alpha-glucosidase
Smed IDSMED30028442
Uniprot Best hitLysosomal alpha-glucosidase OS=Rattus norvegicus GN=Gaa PE=2 SV=1 (E=0)
Length (bp)2946
Neoblast Clusters

Zeng et. al., 2018


 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017


Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

Download CSV of Expression Data

 

back to top

Expression Details

Click to see image symbols and abbreviations
Abbreviation or symbolDefinition
Ooral hemisphere
Aaboral hemisphere
Ddorsal
Vventral
Llateral
black arrowheadembryonic pharynx
red arrowheaddefinitive pharynx
black arrowsprimitive gut
yellow arrowsprimitive ectoderm cells
cyan arrowsbrain
cyan arrowheadsnerve cords
blue arrowheadseye progenitors (trail cells)
purple arrowheadseyes
scale bar100 µm

 

Mitotic activity is restricted to piwi-1+ blastomere

Mitotic activity is restricted to piwi-1+ blastomeres, which cycle asynchronously.

SPIM reconstructed S4 embryo costained with piwi-1 and LYAG-like (both in green) and H3S10p antibodies (red). LYAG-like marks the temporary embryonic pharynx and is not expressed in piwi-1+ blastomeres. Several examples of piwi-1+, H3S10p+ cells are evident.

Homology
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Human
Match: GAA (glucosidase alpha, acid [Source:HGNC Symbol;Acc:HGNC:4065])

HSP 1 Score: 699.508 bits (1804), Expect = 0.000e+0
Identity = 359/872 (41.17%), Postives = 523/872 (59.98%), Query Frame = 3
Query:  321 QCQIANNNERLDCYPESGANQDSCIARGCCWSEPMRLSNKLQGVPLSIPYCYYPTDYSNYMIKSLRKSSRGIKAKLVRESPSYLPYEVAMLDLEVIYETKSRTRVRITDPKQKRYEVPMKLSPPDLKPPTDREYEVIIPSDGSFSIEIKRKSDDRSLF-KSFGPLLYSDQFLQISSIMSTDQIYGIGEQNRPFLHQLSNGWERIGLWARDNPIETFMNLYGAHPFYIGMPDDGKAFGVFHFNSNGQEFALQPAPAVTYRTIGGILDFFIFTGGSPEETVKQYLELVGKPMLPPYWSLGFHLSKWGYKNIEQLSEIFQRNINAGFPIGTQWSDIDYMENYKDFTVDKEKFNGLGRFVREIKQKYNSRFVAIVDPGISCTS-GNEYPPYYEGVFMDIFIKDSQTNQPIVGKVWPGETVYPDFTHPNISMYWYKQIQRFYNDVPIDGLWIDMNEPSNFYDGSKRGCQGNSKYDNPFFVPDIRDQSLISKTICSSALHYNNEKHYNLHNLYGYTESVTTNKALLKTIHGKRPFILSRSTFSGSGKYTFHWTGDNQASWDQLRNSIRQVLNFNMFGIPMTGADICGFNGNSDEELCIRWMQLGAFYPFMRNHNAINQRDQDPASWNTEAQKIMKTAISNRYAMLPLFYTLLVKSHMNGGTVMRPMSFEFFSDKVTHSIELQFMIGSSIMATPVVYPGARSVDAYFPAGVWYDFHS------GKL-----------LHSDAEGAWLTLDAPLDKINIALRGGHIVPLLDSNRNSKSNIPNKMTLYCGMAQDMSASGDLYWDDGESIDSYSRNRYSYVSFNASPEQL---LITPVYFGYDLLPVLNKIVILGFENKSITKFLLNDNDIP---FHYNPET 2861
            QC +  N+ R DC P+    Q+ C ARGCC+   +     LQG  +  P+C++P  Y +Y +++L  S  G  A L R +P++ P ++  L L+V+ ET++R    I DP  +RYEVP++      + P+   Y V   S+  F + ++R+ D R L   +  PL ++DQFLQ+S+ + +  I G+ E   P +  LS  W RI LW RD       NLYG+HPFY+ + D G A GVF  NSN  +  LQP+PA+++R+ GGILD +IF G  P+  V+QYL++VG P +PPYW LGFHL +WGY +     ++ +    A FP+  QW+D+DYM++ +DFT +K+ F      V+E+ Q    R++ IVDP IS +     Y PY EG+   +FI + +T QP++GKVWPG T +PDFT+P    +W   +  F++ VP DG+WIDMNEPSNF  GS+ GC  N++ +NP +VP +   +L + TIC+S+ H     HYNLHNLYG TE++ +++AL+K   G RPF++SRSTF+G G+Y  HWTGD  +SW+QL +S+ ++L FN+ G+P+ GAD+CGF GN+ EELC+RW QLGAFYPFMRNHN++    Q+P S++  AQ+ M+ A++ RYA+LP  YTL  ++H+ G TV RP+  EF  D  T +++ Q + G +++ TPV+  G   V  YFP G WYD  +      G L           +HS  EG W+TL APLD IN+ LR G+I+PL      +  +    M L   + +   A G+L+WDDGES++   R  Y+ V F A    +   L+     G  L   L K+ +LG             N +P   F Y+P+T
Sbjct:   81 QCDVPPNS-RFDCAPDKAITQEQCEARGCCY---IPAKQGLQGAQMGQPWCFFPPSYPSYKLENLSSSEMGYTATLTRTTPTFFPKDILTLRLDVMMETENRLHFTIKDPANRRYEVPLETPHVHSRAPSPL-YSVEF-SEEPFGVIVRRQLDGRVLLNTTVAPLFFADQFLQLSTSLPSQYITGLAEHLSPLM--LSTSWTRITLWNRDLAPTPGANLYGSHPFYLALEDGGSAHGVFLLNSNAMDVVLQPSPALSWRSTGGILDVYIFLGPEPKSVVQQYLDVVGYPFMPPYWGLGFHLCRWGYSSTAITRQVVENMTRAHFPLDVQWNDLDYMDSRRDFTFNKDGFRDFPAMVQELHQG-GRRYMMIVDPAISSSGPAGSYRPYDEGLRRGVFITN-ETGQPLIGKVWPGSTAFPDFTNPTALAWWEDMVAEFHDQVPFDGMWIDMNEPSNFIRGSEDGCP-NNELENPPYVPGVVGGTLQAATICASS-HQFLSTHYNLHNLYGLTEAIASHRALVKA-RGTRPFVISRSTFAGHGRYAGHWTGDVWSSWEQLASSVPEILQFNLLGVPLVGADVCGFLGNTSEELCVRWTQLGAFYPFMRNHNSLLSLPQEPYSFSEPAQQAMRKALTLRYALLPHLYTLFHQAHVAGETVARPLFLEFPKDSSTWTVDHQLLWGEALLITPVLQAGKAEVTGYFPLGTWYDLQTVPVEALGSLPPPPAAPREPAIHS--EGQWVTLPAPLDTINVHLRAGYIIPLQGPGLTTTESRQQPMALAVALTKGGEARGELFWDDGESLEVLERGAYTQVIFLARNNTIVNELVRVTSEGAGL--QLQKVTVLGVATAPQQVL---SNGVPVSNFTYSPDT 932          
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Human
Match: GAA (glucosidase alpha, acid [Source:HGNC Symbol;Acc:HGNC:4065])

HSP 1 Score: 699.508 bits (1804), Expect = 0.000e+0
Identity = 359/872 (41.17%), Postives = 523/872 (59.98%), Query Frame = 3
Query:  321 QCQIANNNERLDCYPESGANQDSCIARGCCWSEPMRLSNKLQGVPLSIPYCYYPTDYSNYMIKSLRKSSRGIKAKLVRESPSYLPYEVAMLDLEVIYETKSRTRVRITDPKQKRYEVPMKLSPPDLKPPTDREYEVIIPSDGSFSIEIKRKSDDRSLF-KSFGPLLYSDQFLQISSIMSTDQIYGIGEQNRPFLHQLSNGWERIGLWARDNPIETFMNLYGAHPFYIGMPDDGKAFGVFHFNSNGQEFALQPAPAVTYRTIGGILDFFIFTGGSPEETVKQYLELVGKPMLPPYWSLGFHLSKWGYKNIEQLSEIFQRNINAGFPIGTQWSDIDYMENYKDFTVDKEKFNGLGRFVREIKQKYNSRFVAIVDPGISCTS-GNEYPPYYEGVFMDIFIKDSQTNQPIVGKVWPGETVYPDFTHPNISMYWYKQIQRFYNDVPIDGLWIDMNEPSNFYDGSKRGCQGNSKYDNPFFVPDIRDQSLISKTICSSALHYNNEKHYNLHNLYGYTESVTTNKALLKTIHGKRPFILSRSTFSGSGKYTFHWTGDNQASWDQLRNSIRQVLNFNMFGIPMTGADICGFNGNSDEELCIRWMQLGAFYPFMRNHNAINQRDQDPASWNTEAQKIMKTAISNRYAMLPLFYTLLVKSHMNGGTVMRPMSFEFFSDKVTHSIELQFMIGSSIMATPVVYPGARSVDAYFPAGVWYDFHS------GKL-----------LHSDAEGAWLTLDAPLDKINIALRGGHIVPLLDSNRNSKSNIPNKMTLYCGMAQDMSASGDLYWDDGESIDSYSRNRYSYVSFNASPEQL---LITPVYFGYDLLPVLNKIVILGFENKSITKFLLNDNDIP---FHYNPET 2861
            QC +  N+ R DC P+    Q+ C ARGCC+   +     LQG  +  P+C++P  Y +Y +++L  S  G  A L R +P++ P ++  L L+V+ ET++R    I DP  +RYEVP++      + P+   Y V   S+  F + ++R+ D R L   +  PL ++DQFLQ+S+ + +  I G+ E   P +  LS  W RI LW RD       NLYG+HPFY+ + D G A GVF  NSN  +  LQP+PA+++R+ GGILD +IF G  P+  V+QYL++VG P +PPYW LGFHL +WGY +     ++ +    A FP+  QW+D+DYM++ +DFT +K+ F      V+E+ Q    R++ IVDP IS +     Y PY EG+   +FI + +T QP++GKVWPG T +PDFT+P    +W   +  F++ VP DG+WIDMNEPSNF  GS+ GC  N++ +NP +VP +   +L + TIC+S+ H     HYNLHNLYG TE++ +++AL+K   G RPF++SRSTF+G G+Y  HWTGD  +SW+QL +S+ ++L FN+ G+P+ GAD+CGF GN+ EELC+RW QLGAFYPFMRNHN++    Q+P S++  AQ+ M+ A++ RYA+LP  YTL  ++H+ G TV RP+  EF  D  T +++ Q + G +++ TPV+  G   V  YFP G WYD  +      G L           +HS  EG W+TL APLD IN+ LR G+I+PL      +  +    M L   + +   A G+L+WDDGES++   R  Y+ V F A    +   L+     G  L   L K+ +LG             N +P   F Y+P+T
Sbjct:   81 QCDVPPNS-RFDCAPDKAITQEQCEARGCCY---IPAKQGLQGAQMGQPWCFFPPSYPSYKLENLSSSEMGYTATLTRTTPTFFPKDILTLRLDVMMETENRLHFTIKDPANRRYEVPLETPHVHSRAPSPL-YSVEF-SEEPFGVIVRRQLDGRVLLNTTVAPLFFADQFLQLSTSLPSQYITGLAEHLSPLM--LSTSWTRITLWNRDLAPTPGANLYGSHPFYLALEDGGSAHGVFLLNSNAMDVVLQPSPALSWRSTGGILDVYIFLGPEPKSVVQQYLDVVGYPFMPPYWGLGFHLCRWGYSSTAITRQVVENMTRAHFPLDVQWNDLDYMDSRRDFTFNKDGFRDFPAMVQELHQG-GRRYMMIVDPAISSSGPAGSYRPYDEGLRRGVFITN-ETGQPLIGKVWPGSTAFPDFTNPTALAWWEDMVAEFHDQVPFDGMWIDMNEPSNFIRGSEDGCP-NNELENPPYVPGVVGGTLQAATICASS-HQFLSTHYNLHNLYGLTEAIASHRALVKA-RGTRPFVISRSTFAGHGRYAGHWTGDVWSSWEQLASSVPEILQFNLLGVPLVGADVCGFLGNTSEELCVRWTQLGAFYPFMRNHNSLLSLPQEPYSFSEPAQQAMRKALTLRYALLPHLYTLFHQAHVAGETVARPLFLEFPKDSSTWTVDHQLLWGEALLITPVLQAGKAEVTGYFPLGTWYDLQTVPVEALGSLPPPPAAPREPAIHS--EGQWVTLPAPLDTINVHLRAGYIIPLQGPGLTTTESRQQPMALAVALTKGGEARGELFWDDGESLEVLERGAYTQVIFLARNNTIVNELVRVTSEGAGL--QLQKVTVLGVATAPQQVL---SNGVPVSNFTYSPDT 932          
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Human
Match: MGAM (maltase-glucoamylase [Source:HGNC Symbol;Acc:HGNC:7043])

HSP 1 Score: 647.892 bits (1670), Expect = 0.000e+0
Identity = 352/861 (40.88%), Postives = 512/861 (59.47%), Query Frame = 3
Query:  312 ATAQCQIANNNERLDCYPESGANQDSCIARGCCWSEPMRLSNKLQGVPLSIPYCYYPTDYSNYMIKSLRKSSRGIKAKL--VRESPSYLPYEVAMLDLEVIYETKSRTRVRITDPKQKRYEVPMK-LSPPDLKPPTDREYEVIIPSDGSFSIEIKRKSDDRSLF-KSFGPLLYSDQFLQISSIMSTDQIYGIGEQ-NRPFLHQLSNGWERIGLWARDN-PIETFMNLYGAHPFYIGMPD-DGKAFGVFHFNSNGQEFALQPAPAVTYRTIGGILDFFIFTGGSPEETVKQYLELVGKPMLPPYWSLGFHLSKWGYKNIEQLSEIFQRNINAGFPIGTQWSDIDYMENYKDFTVDKEKFNGLGRFVREIKQKYNSRFVAIVDPGIS--CTSGNEYPPYYEGVFMDIFIKDSQTNQPIVGKVWPGETVYPDFTHPNISMYWYKQIQRFYNDVPIDGLWIDMNEPSNFYDGSKRGCQGNSKYDNPFFVPDIRDQSLISKTICSSALHYNNEKHYNLHNLYGYTESVTTNKALLKTIHGKRPFILSRSTFSGSGKYTFHWTGDNQASWDQLRNSIRQVLNFNMFGIPMTGADICGFNGNSDEELCIRWMQLGAFYPFMRNHNAINQRDQDPASWNTEAQKIMKTA--ISNRYAMLPLFYTLLVKSHMNGGTVMRPMSFEFFSDKVTHSIELQFMIGSSIMATPVVYPGARSVDAYFPAGVWYDFHSGKLLHSDAEGAWLTLDAPLDKINIALRGGHIVPLLDSNRNSKSNIPNKMTLYCGMAQDMSASGDLYWDDGESIDSYSRNRYSYVSFNASPEQLLITPVYFGYDLLPVL--NKIVILGFENKSITKFLLNDNDIPFHYNP 2855
             +A+C + N  ER++C P+    + +C  RGCCW+         QG  +S+P+CYY  ++S ++  +L  ++ G  A+L  +  SP +    V  + L   Y+T +R   ++TD    R+EVP + +            Y+V I S   FSI++ R+S++R LF  S GPLL++DQFLQ+S+ + +  +YG+GE  ++ + H ++  W+   ++ RD  P     NLYGA  F++ + D  G +FGVF  NSN  E  LQPAPA+TYRTIGGILDF++F G +PE+ V++YLEL+G+P LP YW+LGFHLS++ Y  ++ + E+ +RN  A  P   Q +DIDYM+  +DFT D   F G   FV E+      + V IVDP IS   +S   Y PY  G  M I++  S    P++G+VWPG+TV+PD+T+PN +++W K+ + F+N V  DG+WIDMNE SNF DGS  GC  N+  +NP F P I D  L  KT+C  A+ +   K Y++HNLYGY+ +V T +A       KR FIL+RSTF+GSGK+  HW GDN A+WD LR SI  VL FN+FGIPM G DICGF  ++ EELC RWMQLGAFYPF RNHN    +DQDPAS+  ++  +  +   ++ RY +LP  YTL  ++H  G TV RP+  EF+ D  T  +  QF+ G  ++ TPV+  GA  V AY P  VWYD+ +G  +    +   + ++ P DKI + LRGG+I P    N  + ++  N + L   + ++  A G+L+WD+GE+ D+ +   Y    F+ +  +L +      Y     L  N+I ILG E  S     +  N +P   +P
Sbjct:   86 VSAECPVVNELERINCIPDQPPTKATCDQRGCCWNP--------QGA-VSVPWCYYSKNHSYHVEGNLVNTNAGFTARLKNLPSSPVF-GSNVDNVLLTAEYQTSNRFHFKLTDQTNNRFEVPHEHVQSFSGNAAASLTYQVEI-SRQPFSIKVTRRSNNRVLFDSSIGPLLFADQFLQLSTRLPSTNVYGLGEHVHQQYRHDMN--WKTWPIFNRDTTPNGNGTNLYGAQTFFLCLEDASGLSFGVFLMNSNAMEVVLQPAPAITYRTIGGILDFYVFLGNTPEQVVQEYLELIGRPALPSYWALGFHLSRYEYGTLDNMREVVERNRAAQLPYDVQHADIDYMDERRDFTYDSVDFKGFPEFVNELHNN-GQKLVIIVDPAISNNSSSSKPYGPYDRGSDMKIWVNSSDGVTPLIGEVWPGQTVFPDYTNPNCAVWWTKEFELFHNQVEFDGIWIDMNEVSNFVDGSVSGCSTNN-LNNPPFTPRILDGYLFCKTLCMDAVQHWG-KQYDIHNLYGYSMAVATAEAAKTVFPNKRSFILTRSTFAGSGKFAAHWLGDNTATWDDLRWSIPGVLEFNLFGIPMVGPDICGFALDTPEELCRRWMQLGAFYPFSRNHNGQGYKDQDPASFGADSLLLNSSRHYLNIRYTLLPYLYTLFFRAHSRGDTVARPLLHEFYEDNSTWDVHQQFLWGPGLLITPVLDEGAEKVMAYVPDAVWYDYETGSQVRWRKQK--VEMELPGDKIGLHLRGGYIFPTQQPNTTTLASRKNPLGLIIALDENKEAKGELFWDNGETKDTVANKVYLLCEFSVTQNRLEVNISQSTYKDPNNLAFNEIKILGTEEPS--NVTVKHNGVPSQTSP 926          

HSP 2 Score: 599.356 bits (1544), Expect = 0.000e+0
Identity = 323/835 (38.68%), Postives = 489/835 (58.56%), Query Frame = 3
Query:  339 NNERLDCYP-ESGANQDSCIARGCCWSEPMRLSNKLQGVPLSIPYCYYPTDYSNYMIKSLRKSSRGIKAKLVRESPSYL----PYEVAMLDLEVIYETKSRTRVRITDPKQKRYEVPMKLSPPDL--KPPTDREYEVIIPSDGSFSIEIKRKSDDRSLFKS-FGPLLYSDQFLQISSIMSTDQIYGIGE-QNRPFLHQLSNGWERIGLWARDNPIETFMNLYGAHPFYIGMPDDGKAFGVFHFNSNGQEFALQPAPAVTYRTIGGILDFFIFTGGSPEETVKQYLELVGKPMLPPYWSLGFHLSKWGYKNIEQLSEIFQRNINAGFPIGTQWSDIDYMENYKDFTVDKEKFNGLGRFVREIKQKYNSRFVAIVDPGISCTSGNEYPPYYEGVFMDIFIKDSQTNQPIVGKVWP---------------------GETVYPDFTHPNISMYWYKQIQRFYND-------VPIDGLWIDMNEPSNFYDGSKR-GCQGNSKYDNPFFVPDI--RDQSLISKTICSSALHYNNE----KHYNLHNLYGYTESVTTNKALLKTIHGKRPFILSRSTFSGSGKYTFHWTGDNQASWDQLRNSIRQVLNFNMFGIPMTGADICGFNGNSDEELCIRWMQLGAFYPFMRNHNAINQRDQDPASWNTEAQKIMKTAISNRYAMLPLFYTLLVKSHMNGGTVMRPMSFEFFSDKVTHSIELQFMIGSSIMATPVVYPGARSVDAYFPAGVWYDFHSGKLLHSDAEGAWLTLDAPLDKINIALRGGHIVPLLDSNRNSKSNIPNKMTLYCGMAQDMSASGDLYWDDGESIDSYSRNRYSYVSFNAS 2711
            + E++DCYP E+GA+ ++C ARGC W      ++   GVP    +CY+  D   Y +  ++ +S G  A +  +S  Y        V  L L+V Y      + +I DP + RYEVP+ L+ P +    P  + Y+V+I  +  F IEI+RKS    ++ S      +SD F++IS+ + +  +YG GE ++R +   L   W   G+++RD P     N YG HP+Y+G+ +DG A GV   NSN  +   QP PA+TYRT GG+LDF++F G +PE   +QY EL+G+P++ PYWSLGF L ++GY+N  +++ ++   + A  P   Q+SDIDYME   DFT+   KF G    +  +K     R + I+DP IS      YP +  GV  D+FIK       + GKVWP                         +PDF   + + +W ++I+  YN+       +  DG+WIDMNEPS+F +G+   GC+ ++  ++P ++P +  RD+ L SKT+C  +     +    +HYN+HNLYG++++  T +A+ + + G+R  +++RSTF  SG++  HW GDN A+WDQL+ SI  ++ F++FGI  TGADICGF  +++ E+C+RWMQLGAFYPF RNHN I  R QDP SW+     I +T +  RY +LP  YTL+ K+H  G TV+RP+  EF SD+VT  I+ QF++G + + +PV+   AR+V AYFP   WYD+++G  +  +A G W TL APLD IN+ +RGG+I+P  +   N+  +    M     +  + +A G L+WDDG+SID+Y +  Y   SF+AS
Sbjct:  960 DEEKIDCYPDENGASAENCTARGCIWE-----ASNSSGVP----FCYFVNDL--YSVSDVQYNSHGATADISLKSSVYANAFPSTPVNPLRLDVTYHKNEMLQFKIYDPNKNRYEVPVPLNIPSMPSSTPEGQLYDVLIKKN-PFGIEIRRKSTGTIIWDSQLLGFTFSDMFIRISTRLPSKYLYGFGETEHRSYRRDLE--WHTWGMFSRDQPPGYKKNSYGVHPYYMGLEEDGSAHGVLLLNSNAMDVTFQPLPALTYRTTGGVLDFYVFLGPTPELVTQQYTELIGRPVMVPYWSLGFQLCRYGYQNDSEIASLYDEMVAAQIPYDVQYSDIDYMERQLDFTL-SPKFAGFPALINRMKAD-GMRVILILDPAISGNETQPYPAFTRGVEDDVFIKYPNDGDIVWGKVWPDFPDVVVNGSLDWDSQVELYRAYVAFPDFFRNSTAKWWKREIEELYNNPQNPERSLKFDGMWIDMNEPSSFVNGAVSPGCR-DASLNHPPYMPHLESRDRGLSSKTLCMESQQILPDGSLVQHYNVHNLYGWSQTRPTYEAV-QEVTGQRGVVITRSTFPSSGRWAGHWLGDNTAAWDQLKKSIIGMMEFSLFGISYTGADICGFFQDAEYEMCVRWMQLGAFYPFSRNHNTIGTRRQDPVSWDVAFVNISRTVLQTRYTLLPYLYTLMHKAHTEGVTVVRPLLHEFVSDQVTWDIDSQFLLGPAFLVSPVLERNARNVTAYFPRARWYDYYTG--VDINARGEWKTLPAPLDHINLHVRGGYILPWQEPALNTHLSRQKFMGFKIALDDEGTAGGWLFWDDGQSIDTYGKGLYYLASFSAS 1774          
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Human
Match: MGAM (maltase-glucoamylase [Source:HGNC Symbol;Acc:HGNC:7043])

HSP 1 Score: 647.892 bits (1670), Expect = 0.000e+0
Identity = 352/861 (40.88%), Postives = 512/861 (59.47%), Query Frame = 3
Query:  312 ATAQCQIANNNERLDCYPESGANQDSCIARGCCWSEPMRLSNKLQGVPLSIPYCYYPTDYSNYMIKSLRKSSRGIKAKL--VRESPSYLPYEVAMLDLEVIYETKSRTRVRITDPKQKRYEVPMK-LSPPDLKPPTDREYEVIIPSDGSFSIEIKRKSDDRSLF-KSFGPLLYSDQFLQISSIMSTDQIYGIGEQ-NRPFLHQLSNGWERIGLWARDN-PIETFMNLYGAHPFYIGMPD-DGKAFGVFHFNSNGQEFALQPAPAVTYRTIGGILDFFIFTGGSPEETVKQYLELVGKPMLPPYWSLGFHLSKWGYKNIEQLSEIFQRNINAGFPIGTQWSDIDYMENYKDFTVDKEKFNGLGRFVREIKQKYNSRFVAIVDPGIS--CTSGNEYPPYYEGVFMDIFIKDSQTNQPIVGKVWPGETVYPDFTHPNISMYWYKQIQRFYNDVPIDGLWIDMNEPSNFYDGSKRGCQGNSKYDNPFFVPDIRDQSLISKTICSSALHYNNEKHYNLHNLYGYTESVTTNKALLKTIHGKRPFILSRSTFSGSGKYTFHWTGDNQASWDQLRNSIRQVLNFNMFGIPMTGADICGFNGNSDEELCIRWMQLGAFYPFMRNHNAINQRDQDPASWNTEAQKIMKTA--ISNRYAMLPLFYTLLVKSHMNGGTVMRPMSFEFFSDKVTHSIELQFMIGSSIMATPVVYPGARSVDAYFPAGVWYDFHSGKLLHSDAEGAWLTLDAPLDKINIALRGGHIVPLLDSNRNSKSNIPNKMTLYCGMAQDMSASGDLYWDDGESIDSYSRNRYSYVSFNASPEQLLITPVYFGYDLLPVL--NKIVILGFENKSITKFLLNDNDIPFHYNP 2855
             +A+C + N  ER++C P+    + +C  RGCCW+         QG  +S+P+CYY  ++S ++  +L  ++ G  A+L  +  SP +    V  + L   Y+T +R   ++TD    R+EVP + +            Y+V I S   FSI++ R+S++R LF  S GPLL++DQFLQ+S+ + +  +YG+GE  ++ + H ++  W+   ++ RD  P     NLYGA  F++ + D  G +FGVF  NSN  E  LQPAPA+TYRTIGGILDF++F G +PE+ V++YLEL+G+P LP YW+LGFHLS++ Y  ++ + E+ +RN  A  P   Q +DIDYM+  +DFT D   F G   FV E+      + V IVDP IS   +S   Y PY  G  M I++  S    P++G+VWPG+TV+PD+T+PN +++W K+ + F+N V  DG+WIDMNE SNF DGS  GC  N+  +NP F P I D  L  KT+C  A+ +   K Y++HNLYGY+ +V T +A       KR FIL+RSTF+GSGK+  HW GDN A+WD LR SI  VL FN+FGIPM G DICGF  ++ EELC RWMQLGAFYPF RNHN    +DQDPAS+  ++  +  +   ++ RY +LP  YTL  ++H  G TV RP+  EF+ D  T  +  QF+ G  ++ TPV+  GA  V AY P  VWYD+ +G  +    +   + ++ P DKI + LRGG+I P    N  + ++  N + L   + ++  A G+L+WD+GE+ D+ +   Y    F+ +  +L +      Y     L  N+I ILG E  S     +  N +P   +P
Sbjct:   86 VSAECPVVNELERINCIPDQPPTKATCDQRGCCWNP--------QGA-VSVPWCYYSKNHSYHVEGNLVNTNAGFTARLKNLPSSPVF-GSNVDNVLLTAEYQTSNRFHFKLTDQTNNRFEVPHEHVQSFSGNAAASLTYQVEI-SRQPFSIKVTRRSNNRVLFDSSIGPLLFADQFLQLSTRLPSTNVYGLGEHVHQQYRHDMN--WKTWPIFNRDTTPNGNGTNLYGAQTFFLCLEDASGLSFGVFLMNSNAMEVVLQPAPAITYRTIGGILDFYVFLGNTPEQVVQEYLELIGRPALPSYWALGFHLSRYEYGTLDNMREVVERNRAAQLPYDVQHADIDYMDERRDFTYDSVDFKGFPEFVNELHNN-GQKLVIIVDPAISNNSSSSKPYGPYDRGSDMKIWVNSSDGVTPLIGEVWPGQTVFPDYTNPNCAVWWTKEFELFHNQVEFDGIWIDMNEVSNFVDGSVSGCSTNN-LNNPPFTPRILDGYLFCKTLCMDAVQHWG-KQYDIHNLYGYSMAVATAEAAKTVFPNKRSFILTRSTFAGSGKFAAHWLGDNTATWDDLRWSIPGVLEFNLFGIPMVGPDICGFALDTPEELCRRWMQLGAFYPFSRNHNGQGYKDQDPASFGADSLLLNSSRHYLNIRYTLLPYLYTLFFRAHSRGDTVARPLLHEFYEDNSTWDVHQQFLWGPGLLITPVLDEGAEKVMAYVPDAVWYDYETGSQVRWRKQK--VEMELPGDKIGLHLRGGYIFPTQQPNTTTLASRKNPLGLIIALDENKEAKGELFWDNGETKDTVANKVYLLCEFSVTQNRLEVNISQSTYKDPNNLAFNEIKILGTEEPS--NVTVKHNGVPSQTSP 926          

HSP 2 Score: 599.356 bits (1544), Expect = 0.000e+0
Identity = 323/835 (38.68%), Postives = 489/835 (58.56%), Query Frame = 3
Query:  339 NNERLDCYP-ESGANQDSCIARGCCWSEPMRLSNKLQGVPLSIPYCYYPTDYSNYMIKSLRKSSRGIKAKLVRESPSYL----PYEVAMLDLEVIYETKSRTRVRITDPKQKRYEVPMKLSPPDL--KPPTDREYEVIIPSDGSFSIEIKRKSDDRSLFKS-FGPLLYSDQFLQISSIMSTDQIYGIGE-QNRPFLHQLSNGWERIGLWARDNPIETFMNLYGAHPFYIGMPDDGKAFGVFHFNSNGQEFALQPAPAVTYRTIGGILDFFIFTGGSPEETVKQYLELVGKPMLPPYWSLGFHLSKWGYKNIEQLSEIFQRNINAGFPIGTQWSDIDYMENYKDFTVDKEKFNGLGRFVREIKQKYNSRFVAIVDPGISCTSGNEYPPYYEGVFMDIFIKDSQTNQPIVGKVWP---------------------GETVYPDFTHPNISMYWYKQIQRFYND-------VPIDGLWIDMNEPSNFYDGSKR-GCQGNSKYDNPFFVPDI--RDQSLISKTICSSALHYNNE----KHYNLHNLYGYTESVTTNKALLKTIHGKRPFILSRSTFSGSGKYTFHWTGDNQASWDQLRNSIRQVLNFNMFGIPMTGADICGFNGNSDEELCIRWMQLGAFYPFMRNHNAINQRDQDPASWNTEAQKIMKTAISNRYAMLPLFYTLLVKSHMNGGTVMRPMSFEFFSDKVTHSIELQFMIGSSIMATPVVYPGARSVDAYFPAGVWYDFHSGKLLHSDAEGAWLTLDAPLDKINIALRGGHIVPLLDSNRNSKSNIPNKMTLYCGMAQDMSASGDLYWDDGESIDSYSRNRYSYVSFNAS 2711
            + E++DCYP E+GA+ ++C ARGC W      ++   GVP    +CY+  D   Y +  ++ +S G  A +  +S  Y        V  L L+V Y      + +I DP + RYEVP+ L+ P +    P  + Y+V+I  +  F IEI+RKS    ++ S      +SD F++IS+ + +  +YG GE ++R +   L   W   G+++RD P     N YG HP+Y+G+ +DG A GV   NSN  +   QP PA+TYRT GG+LDF++F G +PE   +QY EL+G+P++ PYWSLGF L ++GY+N  +++ ++   + A  P   Q+SDIDYME   DFT+   KF G    +  +K     R + I+DP IS      YP +  GV  D+FIK       + GKVWP                         +PDF   + + +W ++I+  YN+       +  DG+WIDMNEPS+F +G+   GC+ ++  ++P ++P +  RD+ L SKT+C  +     +    +HYN+HNLYG++++  T +A+ + + G+R  +++RSTF  SG++  HW GDN A+WDQL+ SI  ++ F++FGI  TGADICGF  +++ E+C+RWMQLGAFYPF RNHN I  R QDP SW+     I +T +  RY +LP  YTL+ K+H  G TV+RP+  EF SD+VT  I+ QF++G + + +PV+   AR+V AYFP   WYD+++G  +  +A G W TL APLD IN+ +RGG+I+P  +   N+  +    M     +  + +A G L+WDDG+SID+Y +  Y   SF+AS
Sbjct:  960 DEEKIDCYPDENGASAENCTARGCIWE-----ASNSSGVP----FCYFVNDL--YSVSDVQYNSHGATADISLKSSVYANAFPSTPVNPLRLDVTYHKNEMLQFKIYDPNKNRYEVPVPLNIPSMPSSTPEGQLYDVLIKKN-PFGIEIRRKSTGTIIWDSQLLGFTFSDMFIRISTRLPSKYLYGFGETEHRSYRRDLE--WHTWGMFSRDQPPGYKKNSYGVHPYYMGLEEDGSAHGVLLLNSNAMDVTFQPLPALTYRTTGGVLDFYVFLGPTPELVTQQYTELIGRPVMVPYWSLGFQLCRYGYQNDSEIASLYDEMVAAQIPYDVQYSDIDYMERQLDFTL-SPKFAGFPALINRMKAD-GMRVILILDPAISGNETQPYPAFTRGVEDDVFIKYPNDGDIVWGKVWPDFPDVVVNGSLDWDSQVELYRAYVAFPDFFRNSTAKWWKREIEELYNNPQNPERSLKFDGMWIDMNEPSSFVNGAVSPGCR-DASLNHPPYMPHLESRDRGLSSKTLCMESQQILPDGSLVQHYNVHNLYGWSQTRPTYEAV-QEVTGQRGVVITRSTFPSSGRWAGHWLGDNTAAWDQLKKSIIGMMEFSLFGISYTGADICGFFQDAEYEMCVRWMQLGAFYPFSRNHNTIGTRRQDPVSWDVAFVNISRTVLQTRYTLLPYLYTLMHKAHTEGVTVVRPLLHEFVSDQVTWDIDSQFLLGPAFLVSPVLERNARNVTAYFPRARWYDYYTG--VDINARGEWKTLPAPLDHINLHVRGGYILPWQEPALNTHLSRQKFMGFKIALDDEGTAGGWLFWDDGQSIDTYGKGLYYLASFSAS 1774          
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Human
Match: SI (sucrase-isomaltase [Source:HGNC Symbol;Acc:HGNC:10856])

HSP 1 Score: 636.336 bits (1640), Expect = 0.000e+0
Identity = 356/852 (41.78%), Postives = 517/852 (60.68%), Query Frame = 3
Query:  342 NERLDCYPESGANQDSCIARGCCWSEPMRLSNKLQGVPLSIPYCYYPTDYSNYMIKSLRKSSRGIKAKLVR-ESPSYLPYEVAMLDLEVIYETKSRTRVRITDPKQKRYEVPMKLSPPDLKPP-TDREYEVIIPSDGSFSIEIKRKSDDRSLF-KSFGPLLYSDQFLQISSIMSTDQIYGIGEQ-NRPFLHQLSNGWERIGLWARDN-PIETFMNLYGAHPFYIGMPD-DGKAFGVFHFNSNGQEFALQPAPAVTYRTIGGILDFFIFTGGSPEETVKQYLELVGKPMLPPYWSLGFHLSKWGYKNIEQLSEIFQRNINAGFPIGTQWSDIDYMENYKDFTVDKEKFNGLGRFVREIKQKYNSRFVAIVDPGISC---TSGNEYPPYYEGVFMDIFIKDSQTNQPIVGKVWPGETVYPDFTHPNISMYWYKQIQRFYNDVPIDGLWIDMNEPSNFYDGSKRGCQGNSKYDNPFFVPDIRDQSLISKTICSSALHYNNEKHYNLHNLYGYTESVTTNKALLKTIHGKRPFILSRSTFSGSGKYTFHWTGDNQASWDQLRNSIRQVLNFNMFGIPMTGADICGFNGNSDEELCIRWMQLGAFYPFMRNHNAINQRDQDPASW--NTEAQKIMKTAISNRYAMLPLFYTLLVKSHMNGGTVMRPMSFEFFSDKVTHSIELQFMIGSSIMATPVVYPGARSVDAYFPAGVWYDFHSGKLLHSDAEGAW----LTLDAPLDKINIALRGGHIVPLLDSNRNSKSNIPNKMTLYCGMAQDMSASGDLYWDDGESIDSYSRNRYSYVSFNASPEQLLITPVYFGYDLLPVL--NKIVILGFENKSITKFLLNDNDIPFH 2846
            N R++C PE    +  C  RGCCW  P   S         IP+C++  D   Y ++ +  +S G++AKL R  SP+    ++  +      +T +R R +ITDP  +RYEVP +       P  +D  Y+V + +   FSI++ RKS+ ++LF  S GPL+YSDQ+LQIS+ + +D IYGIGEQ ++ F H LS  W+   ++ RD  P +   NLYG   F++ + D  GK+FGVF  NSN  E  +QP P VTYR  GGILDF+I  G +PE+ V+QY +LVG P +P YW+LGF LS+W YK+++ + E+ +RN  AG P  TQ +DIDYME+ KDFT D+  FNGL +FV+++   +  ++V I+DP IS     +G  Y  Y  G    ++I +S  + PI+G+VWPG TVYPDFT+PN   +W  +   F+ +V  DGLWIDMNE S+F  GS +GC  N K + P F PDI D+ + SKTIC  A+  N  K Y++H+LYGY+ ++ T +A+ K    KR FIL+RSTF+GSG++  HW GDN ASW+Q+  SI  +L F++FGIP+ GADICGF   + EELC RWMQLGAFYPF RNHN+     QDPA +  N+   K  +  ++ RY +LP  YTL  K+H+ G TV RP+  EF+ D  +   + +F+ G +++ TPV+  GA +V AY P  +WYD+ SG      A+  W    + +  P DKI + LRGG+I+P+ + +  + ++  N + L   + ++ +A GD +WDDGE+ D+     Y   +F+ S   L I   +  Y     L    + ILG  + S+T+  + +N+ P +
Sbjct:   72 NVRINCIPEQFPTEGICAQRGCCW-RPWNDS--------LIPWCFF-VDNHGYNVQDMTTTSIGVEAKLNRIPSPTLFGNDINSVLFTTQNQTPNRFRFKITDPNNRRYEVPHQYVKEFTGPTVSDTLYDVKV-AQNPFSIQVIRKSNGKTLFDTSIGPLVYSDQYLQISTRLPSDYIYGIGEQVHKRFRHDLS--WKTWPIFTRDQLPGDNNNNLYGHQTFFMCIEDTSGKSFGVFLMNSNAMEIFIQPTPIVTYRVTGGILDFYILLGDTPEQVVQQYQQLVGLPAMPAYWNLGFQLSRWNYKSLDVVKEVVRRNREAGIPFDTQVTDIDYMEDKKDFTYDQVAFNGLPQFVQDL-HDHGQKYVIILDPAISIGRRANGTTYATYERGNTQHVWINESDGSTPIIGEVWPGLTVYPDFTNPNCIDWWANECSIFHQEVQYDGLWIDMNEVSSFIQGSTKGCNVN-KLNYPPFTPDILDKLMYSKTICMDAVQ-NWGKQYDVHSLYGYSMAIATEQAVQKVFPNKRSFILTRSTFAGSGRHAAHWLGDNTASWEQMEWSITGMLEFSLFGIPLVGADICGFVAETTEELCRRWMQLGAFYPFSRNHNSDGYEHQDPAFFGQNSLLVKSSRQYLTIRYTLLPFLYTLFYKAHVFGETVARPVLHEFYEDTNSWIEDTEFLWGPALLITPVLKQGADTVSAYIPDAIWYDYESG------AKRPWRKQRVDMYLPADKIGLHLRGGYIIPIQEPDVTTTASRKNPLGLIVALGENNTAKGDFFWDDGETKDTIQNGNYILYTFSVSNNTLDIVCTHSSYQEGTTLAFQTVKILGLTD-SVTEVRVAENNQPMN 900          

HSP 2 Score: 612.068 bits (1577), Expect = 0.000e+0
Identity = 336/845 (39.76%), Postives = 488/845 (57.75%), Query Frame = 3
Query:  327 QIANNNERLDCYPESG-ANQDSCIARGCCWSEPMRLSNKLQGVPLSIPYCYYPTDYSNYMIKSLRKSSRGIKAKLVRESPSY---LPYE-VAMLDLEVIYETKSRTRVRITDPKQKRYEVPMKLSPPDLKPPT--DREYEVIIPSDGSFSIEIKRKSDDRSLFKSFGP-LLYSDQFLQISSIMSTDQIYGIGE-QNRPFLHQLSNGWERIGLWARDNPIETFMNLYGAHPFYIGMPDDGKAFGVFHFNSNGQEFALQPAPAVTYRTIGGILDFFIFTGGSPEETVKQYLELVGKPMLPPYWSLGFHLSKWGYKNIEQLSEIFQRNINAGFPIGTQWSDIDYMENYKDFTVDKEKFNGLGRFVREIKQKYNSRFVAIVDPGISCTSGNEYPPYYEGVFMDIFIKDSQTNQPIVGKVWP---------------------GETVYPDFTHPNISMYWYKQIQRFYND-VPIDGLWIDMNEPSNFYDGSKRGCQGNSKYDNPFFVPDI--RDQSLISKTICSSALHYNNEK----HYNLHNLYGYTESVTTNKALLKTIHGKRPFILSRSTFSGSGKYTFHWTGDNQASWDQLRNSIRQVLNFNMFGIPMTGADICGFNGNSDEELCIRWMQLGAFYPFMRNHNAINQRDQDPASWNTEAQKIMKTAISNRYAMLPLFYTLLVKSHMNGGTVMRPMSFEFFSDKVTHSIELQFMIGSSIMATPVVYPGARSVDAYFPAGVWYDFHSGKLLHSDAEGAWLTLDAPLDKINIALRGGHIVPLLDSNRNSKSNIPNKMTLYCGMAQDMSASGDLYWDDGESIDSYSRNRYSYVSFNASPEQLLITPVYFGY 2750
            QI + NER +CYP++  A +  C  RGC W     LS          P CY+P   ++Y + S R SS GI A L   + +    LP + ++ L +EV Y      + +I DP++KRYEVP+ L+ P     T  DR Y+V I  +  F I+I+R+S  R ++ S+ P   ++DQF+QIS+ + ++ IYG GE ++  F   L+  W   G++ RD P    +N YG HP+Y+ + ++G A GVF  NSN  +   QP PA+TYRT+GGILDF++F G +PE   KQY E++G P++P YW+LGF L ++GY N  ++ E++   + A  P   Q++DIDYME   DFT+  E F  L +FV +I+ +   R++ I+DP IS      YP +  G   D+F+K   TN     KVWP                         +PDF   + + +W ++I  FYN+ +  DGLWIDMNEPS+F +G+      N + + P + P++  R   L  +TIC  A    ++     HY++HNLYG+++   T+ AL KT  GKR  ++SRST+  SG++  HW GDN A WD +  SI  ++ F++FG+  TGADICGF  NS+  LC RWMQLGAFYP+ RNHN  N R QDPASWN    ++ +  ++ RY +LP FYT + + H NGGTV+RP+  EFF +K T  I  QF+ G + M TPV+ P  ++V+AY P   W+D+H+GK +     G + T +A  D IN+ +RGGHI+P  +  +N+  +    M L      +  A G L+WDDGESID+Y R+ Y  V FN +   L  T +  GY
Sbjct:  933 QIFSENERFNCYPDADLATEQKCTQRGCVWRTGSSLSKA--------PECYFPRQDNSYSVNSARYSSMGITADLQLNTANARIKLPSDPISTLRVEVKYHKNDMLQFKIYDPQKKRYEVPVPLNIPTTPISTYEDRLYDVEI-KENPFGIQIRRRSSGRVIWDSWLPGFAFNDQFIQISTRLPSEYIYGFGEVEHTAFKRDLN--WNTWGMFTRDQPPGYKLNSYGFHPYYMALEEEGNAHGVFLLNSNAMDVTFQPTPALTYRTVGGILDFYMFLGPTPEVATKQYHEVIGHPVMPAYWALGFQLCRYGYANTSEVRELYDAMVAANIPYDVQYTDIDYMERQLDFTI-GEAFQDLPQFVDKIRGE-GMRYIIILDPAISGNETKTYPAFERGQQNDVFVKWPNTNDICWAKVWPDLPNITIDKTLTEDEAVNASRAHVAFPDFFRTSTAEWWAREIVDFYNEKMKFDGLWIDMNEPSSFVNGTTTNQCRNDELNYPPYFPELTKRTDGLHFRTICMEAEQILSDGTSVLHYDVHNLYGWSQMKPTHDALQKTT-GKRGIVISRSTYPTSGRWGGHWLGDNYARWDNMDKSIIGMMEFSLFGMSYTGADICGFFNNSEYHLCTRWMQLGAFYPYSRNHNIANTRRQDPASWNETFAEMSRNILNIRYTLLPYFYTQMHEIHANGGTVIRPLLHEFFDEKPTWDIFKQFLWGPAFMVTPVLEPYVQTVNAYVPNARWFDYHTGKDI--GVRGQFQTFNASYDTINLHVRGGHILPCQEPAQNTFYSRQKHMKLIVAADDNQMAQGSLFWDDGESIDTYERDLYLSVQFNLNQTTLTSTILKRGY 1761          
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Celegans
Match: aagr-1 (Acid Alpha Glucosidase Relate [Source:RefSeq peptide;Acc:NP_501419])

HSP 1 Score: 483.411 bits (1243), Expect = 7.387e-154
Identity = 292/830 (35.18%), Postives = 438/830 (52.77%), Query Frame = 3
Query:  327 QIANNNERLDCYPESGANQDSCIARGCCWSEPMRLSNKLQGVPLSIPYCYYPTDYSNYMIKSLRKSSRGIKAKLVRESPSYLPYEVAMLDLEVIYETKSRTRVRITDPKQKRYEVPMKLSPPDLKPPTDRE----YEVIIPSDGSFSIEIKRKSDDRSLF-KSFGPLLYSDQFLQISSIMSTDQIYGIGEQNRPFLHQLSNGWERIGLWARD-----NPIETFMNLYGAHPFYIGMPDDGKAFGVFHFNSNGQEFALQPAPAVTYRTIGGILDFFIFTGGSPEETVKQYLELVGKPMLPPYWSLGFHLSKWGYKNIEQLSEIFQRNINAGFPIGTQWSDIDYMENYKDFTVDKEKFNGLGRFVREIKQKYNSRFVAIVDPGISCTSGNEYPPYYEGVFMDI-FIKDSQTNQP----------------IVGKVWPGE-TVYPDFTHP--NISMYWYKQIQRFYNDVPIDGLWIDMNEPSNFYDGS-----------KRGCQGNSKYDNPFFVPDIRDQS--------LISKTICS-SALHYNNEKHYNLHNLYGYTESVTTNKALLKTIHGKRPFILSRSTFSGSGKYTFHWTGDNQASWDQLRNSIRQVLNFNMFGIPMTGADICGFNGNSDEELCIRWMQLGAFYPFMRNHNAINQRDQDPASWNTEAQKIMKTAISNRYAMLPLFYTLLVKSHMNGGTVMRPMSFEFFSDKVTHSIELQFMIGSSIMATPVVYPGARSVDAYFPAGVWYDFHSGKLLHSDAEGAWLTLDAPLDKIN-IALRGGHIVPLLDSNRNSKSNIPNKMTLYCGMAQDMSASGDLYWDDGESI 2663
            Q  + ++R+DCYPE GA+QD+C +RGC W+E    S      P+  P+CYYPT+ S + ++S   +S  + AK         PY   +  L V Y +   T + +T     RY  P+       KP T  E        I S   FS ++ R S   +L+  S G + ++D+F+QI++ + +  IYG G+     +    + +    ++ARD         +  NLYG HPFY+ +  DGKA GVF  NSN QE    P P + YRTIGG +D   F G +PE+ V QYL+ +G P LP YW+LG+ L +WGY N++ +  +  RN   G P+   ++DIDYM +Y+DFT + + ++G   + ++I  +     + I DP +      +Y  +  G+  D  FI+ ++ +Q                 ++G VWP   T +PDF  P  N + +W  +  +F+  +P DG+WIDMNEPSNF  G+           K  C      D+   VP    Q+        L SKT+C      +     Y+  NLYG++E+  T +A+ + + GKR  ++SRSTF  SG+Y  HW GDN A W  L+ S+  V+ FNMFG+P  G+DICGFNG S+EELC+RW Q GAF PF R+HN+    DQDPA W + A    K A++ RY  LP  Y+L   +   G TV+RP+ FEF  D+ T +I  QF+ GS++M  P +Y G  SV AYFP+  WY             G +  ++APL  +  + +RGG ++P       + ++  +   L   +  + ++SGDLY+D G+ +
Sbjct:   23 QSVDVSKRVDCYPEPGASQDACQSRGCIWTEAPSSS------PVGTPWCYYPTE-SGFTVQSTGTNSFVLAAKTKN------PYGNNISPLNVKYSSNGATLL-LTIGNDDRYVPPVNFPK---KPSTSTESLKFTSGTIGSSDVFSFKVTRASTGVALWDTSIGGMQFADKFIQIATYLPSKNIYGFGDHIHKKIRHNLDRYTTWPMFARDIGPDSGSALSTQNLYGVHPFYMCIEADGKAHGVFILNSNAQEVETGPGPHLLYRTIGGRIDMAFFPGPTPEQVVNQYLQHIGFPFLPAYWALGYQLCRWGYGNLDAMKTVISRNQALGIPLDVPYADIDYMNHYEDFT-EGDNWSGFPAYTQQIHAQ-GLHLIVIFDPAVEV----DYASFQRGINADASFIEWARDDQVPHNIQDQYPMAKNTKIMLGNVWPDRNTAFPDFLDPRNNTNAWWAGEFAQFHKTLPFDGMWIDMNEPSNFDTGTYNTVEEQLASAKLSCPITGS-DSSLDVPPYPTQAVYQRNGEYLFSKTLCMLGKTAHRTRDFYDTKNLYGWSEARATYQAIPQ-VTGKRSAVISRSTFPSSGRYGGHWLGDNTARWGDLQTSVIGVMEFNMFGVPYVGSDICGFNGVSNEELCLRWHQFGAFSPFSRDHNSEGMPDQDPAVWPSVANA-AKIALTFRYYFLPFLYSLHYNAARYGHTVIRPLFFEFPKDEETLNISEQFLWGSALMIAPALYQGQTSVHAYFPSDTWYSLQPETYGQKMFSG-FNDVNAPLSSLTPVFVRGGFVLPRQSPGTTTTASRLSPFELLITVKTNAASSGDLYYDGGDDL 825          
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Celegans
Match: aagr-1 (Acid Alpha Glucosidase Relate [Source:RefSeq peptide;Acc:NP_501419])

HSP 1 Score: 483.411 bits (1243), Expect = 7.387e-154
Identity = 292/830 (35.18%), Postives = 438/830 (52.77%), Query Frame = 3
Query:  327 QIANNNERLDCYPESGANQDSCIARGCCWSEPMRLSNKLQGVPLSIPYCYYPTDYSNYMIKSLRKSSRGIKAKLVRESPSYLPYEVAMLDLEVIYETKSRTRVRITDPKQKRYEVPMKLSPPDLKPPTDRE----YEVIIPSDGSFSIEIKRKSDDRSLF-KSFGPLLYSDQFLQISSIMSTDQIYGIGEQNRPFLHQLSNGWERIGLWARD-----NPIETFMNLYGAHPFYIGMPDDGKAFGVFHFNSNGQEFALQPAPAVTYRTIGGILDFFIFTGGSPEETVKQYLELVGKPMLPPYWSLGFHLSKWGYKNIEQLSEIFQRNINAGFPIGTQWSDIDYMENYKDFTVDKEKFNGLGRFVREIKQKYNSRFVAIVDPGISCTSGNEYPPYYEGVFMDI-FIKDSQTNQP----------------IVGKVWPGE-TVYPDFTHP--NISMYWYKQIQRFYNDVPIDGLWIDMNEPSNFYDGS-----------KRGCQGNSKYDNPFFVPDIRDQS--------LISKTICS-SALHYNNEKHYNLHNLYGYTESVTTNKALLKTIHGKRPFILSRSTFSGSGKYTFHWTGDNQASWDQLRNSIRQVLNFNMFGIPMTGADICGFNGNSDEELCIRWMQLGAFYPFMRNHNAINQRDQDPASWNTEAQKIMKTAISNRYAMLPLFYTLLVKSHMNGGTVMRPMSFEFFSDKVTHSIELQFMIGSSIMATPVVYPGARSVDAYFPAGVWYDFHSGKLLHSDAEGAWLTLDAPLDKIN-IALRGGHIVPLLDSNRNSKSNIPNKMTLYCGMAQDMSASGDLYWDDGESI 2663
            Q  + ++R+DCYPE GA+QD+C +RGC W+E    S      P+  P+CYYPT+ S + ++S   +S  + AK         PY   +  L V Y +   T + +T     RY  P+       KP T  E        I S   FS ++ R S   +L+  S G + ++D+F+QI++ + +  IYG G+     +    + +    ++ARD         +  NLYG HPFY+ +  DGKA GVF  NSN QE    P P + YRTIGG +D   F G +PE+ V QYL+ +G P LP YW+LG+ L +WGY N++ +  +  RN   G P+   ++DIDYM +Y+DFT + + ++G   + ++I  +     + I DP +      +Y  +  G+  D  FI+ ++ +Q                 ++G VWP   T +PDF  P  N + +W  +  +F+  +P DG+WIDMNEPSNF  G+           K  C      D+   VP    Q+        L SKT+C      +     Y+  NLYG++E+  T +A+ + + GKR  ++SRSTF  SG+Y  HW GDN A W  L+ S+  V+ FNMFG+P  G+DICGFNG S+EELC+RW Q GAF PF R+HN+    DQDPA W + A    K A++ RY  LP  Y+L   +   G TV+RP+ FEF  D+ T +I  QF+ GS++M  P +Y G  SV AYFP+  WY             G +  ++APL  +  + +RGG ++P       + ++  +   L   +  + ++SGDLY+D G+ +
Sbjct:   23 QSVDVSKRVDCYPEPGASQDACQSRGCIWTEAPSSS------PVGTPWCYYPTE-SGFTVQSTGTNSFVLAAKTKN------PYGNNISPLNVKYSSNGATLL-LTIGNDDRYVPPVNFPK---KPSTSTESLKFTSGTIGSSDVFSFKVTRASTGVALWDTSIGGMQFADKFIQIATYLPSKNIYGFGDHIHKKIRHNLDRYTTWPMFARDIGPDSGSALSTQNLYGVHPFYMCIEADGKAHGVFILNSNAQEVETGPGPHLLYRTIGGRIDMAFFPGPTPEQVVNQYLQHIGFPFLPAYWALGYQLCRWGYGNLDAMKTVISRNQALGIPLDVPYADIDYMNHYEDFT-EGDNWSGFPAYTQQIHAQ-GLHLIVIFDPAVEV----DYASFQRGINADASFIEWARDDQVPHNIQDQYPMAKNTKIMLGNVWPDRNTAFPDFLDPRNNTNAWWAGEFAQFHKTLPFDGMWIDMNEPSNFDTGTYNTVEEQLASAKLSCPITGS-DSSLDVPPYPTQAVYQRNGEYLFSKTLCMLGKTAHRTRDFYDTKNLYGWSEARATYQAIPQ-VTGKRSAVISRSTFPSSGRYGGHWLGDNTARWGDLQTSVIGVMEFNMFGVPYVGSDICGFNGVSNEELCLRWHQFGAFSPFSRDHNSEGMPDQDPAVWPSVANA-AKIALTFRYYFLPFLYSLHYNAARYGHTVIRPLFFEFPKDEETLNISEQFLWGSALMIAPALYQGQTSVHAYFPSDTWYSLQPETYGQKMFSG-FNDVNAPLSSLTPVFVRGGFVLPRQSPGTTTTASRLSPFELLITVKTNAASSGDLYYDGGDDL 825          
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Celegans
Match: aagr-1 (Acid Alpha Glucosidase Relate [Source:RefSeq peptide;Acc:NP_501419])

HSP 1 Score: 483.411 bits (1243), Expect = 7.387e-154
Identity = 292/830 (35.18%), Postives = 438/830 (52.77%), Query Frame = 3
Query:  327 QIANNNERLDCYPESGANQDSCIARGCCWSEPMRLSNKLQGVPLSIPYCYYPTDYSNYMIKSLRKSSRGIKAKLVRESPSYLPYEVAMLDLEVIYETKSRTRVRITDPKQKRYEVPMKLSPPDLKPPTDRE----YEVIIPSDGSFSIEIKRKSDDRSLF-KSFGPLLYSDQFLQISSIMSTDQIYGIGEQNRPFLHQLSNGWERIGLWARD-----NPIETFMNLYGAHPFYIGMPDDGKAFGVFHFNSNGQEFALQPAPAVTYRTIGGILDFFIFTGGSPEETVKQYLELVGKPMLPPYWSLGFHLSKWGYKNIEQLSEIFQRNINAGFPIGTQWSDIDYMENYKDFTVDKEKFNGLGRFVREIKQKYNSRFVAIVDPGISCTSGNEYPPYYEGVFMDI-FIKDSQTNQP----------------IVGKVWPGE-TVYPDFTHP--NISMYWYKQIQRFYNDVPIDGLWIDMNEPSNFYDGS-----------KRGCQGNSKYDNPFFVPDIRDQS--------LISKTICS-SALHYNNEKHYNLHNLYGYTESVTTNKALLKTIHGKRPFILSRSTFSGSGKYTFHWTGDNQASWDQLRNSIRQVLNFNMFGIPMTGADICGFNGNSDEELCIRWMQLGAFYPFMRNHNAINQRDQDPASWNTEAQKIMKTAISNRYAMLPLFYTLLVKSHMNGGTVMRPMSFEFFSDKVTHSIELQFMIGSSIMATPVVYPGARSVDAYFPAGVWYDFHSGKLLHSDAEGAWLTLDAPLDKIN-IALRGGHIVPLLDSNRNSKSNIPNKMTLYCGMAQDMSASGDLYWDDGESI 2663
            Q  + ++R+DCYPE GA+QD+C +RGC W+E    S      P+  P+CYYPT+ S + ++S   +S  + AK         PY   +  L V Y +   T + +T     RY  P+       KP T  E        I S   FS ++ R S   +L+  S G + ++D+F+QI++ + +  IYG G+     +    + +    ++ARD         +  NLYG HPFY+ +  DGKA GVF  NSN QE    P P + YRTIGG +D   F G +PE+ V QYL+ +G P LP YW+LG+ L +WGY N++ +  +  RN   G P+   ++DIDYM +Y+DFT + + ++G   + ++I  +     + I DP +      +Y  +  G+  D  FI+ ++ +Q                 ++G VWP   T +PDF  P  N + +W  +  +F+  +P DG+WIDMNEPSNF  G+           K  C      D+   VP    Q+        L SKT+C      +     Y+  NLYG++E+  T +A+ + + GKR  ++SRSTF  SG+Y  HW GDN A W  L+ S+  V+ FNMFG+P  G+DICGFNG S+EELC+RW Q GAF PF R+HN+    DQDPA W + A    K A++ RY  LP  Y+L   +   G TV+RP+ FEF  D+ T +I  QF+ GS++M  P +Y G  SV AYFP+  WY             G +  ++APL  +  + +RGG ++P       + ++  +   L   +  + ++SGDLY+D G+ +
Sbjct:   23 QSVDVSKRVDCYPEPGASQDACQSRGCIWTEAPSSS------PVGTPWCYYPTE-SGFTVQSTGTNSFVLAAKTKN------PYGNNISPLNVKYSSNGATLL-LTIGNDDRYVPPVNFPK---KPSTSTESLKFTSGTIGSSDVFSFKVTRASTGVALWDTSIGGMQFADKFIQIATYLPSKNIYGFGDHIHKKIRHNLDRYTTWPMFARDIGPDSGSALSTQNLYGVHPFYMCIEADGKAHGVFILNSNAQEVETGPGPHLLYRTIGGRIDMAFFPGPTPEQVVNQYLQHIGFPFLPAYWALGYQLCRWGYGNLDAMKTVISRNQALGIPLDVPYADIDYMNHYEDFT-EGDNWSGFPAYTQQIHAQ-GLHLIVIFDPAVEV----DYASFQRGINADASFIEWARDDQVPHNIQDQYPMAKNTKIMLGNVWPDRNTAFPDFLDPRNNTNAWWAGEFAQFHKTLPFDGMWIDMNEPSNFDTGTYNTVEEQLASAKLSCPITGS-DSSLDVPPYPTQAVYQRNGEYLFSKTLCMLGKTAHRTRDFYDTKNLYGWSEARATYQAIPQ-VTGKRSAVISRSTFPSSGRYGGHWLGDNTARWGDLQTSVIGVMEFNMFGVPYVGSDICGFNGVSNEELCLRWHQFGAFSPFSRDHNSEGMPDQDPAVWPSVANA-AKIALTFRYYFLPFLYSLHYNAARYGHTVIRPLFFEFPKDEETLNISEQFLWGSALMIAPALYQGQTSVHAYFPSDTWYSLQPETYGQKMFSG-FNDVNAPLSSLTPVFVRGGFVLPRQSPGTTTTASRLSPFELLITVKTNAASSGDLYYDGGDDL 825          
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Celegans
Match: aagr-2 (Acid Alpha Glucosidase Relate [Source:RefSeq peptide;Acc:NP_494897])

HSP 1 Score: 460.299 bits (1183), Expect = 6.917e-145
Identity = 290/846 (34.28%), Postives = 421/846 (49.76%), Query Frame = 3
Query:  336 NNNERLDCYPESGANQDSCIARGCCWSEPMRLSNKLQGVPLSIPYCYYPTDYSNYMIKSLRKSSRGIKAKLVRESPSYLPYEVAMLDLEVIYETKSRTRV-RITDPKQKRYEVPMKLSPPDLKPPTDREYEVIIPSDGSFSIEIKRKSDDRSLF-KSFGPLLYSDQFLQISSIMSTDQIYGIGEQNRPFLHQLSNGWERIGLWARDNPIET----FMNLYGAHPFYIGMPDDGKAFGVFHFNSNGQEFALQPAPAVTYRTIGGILDFFIFTGGSPEETVKQYLELVGKPMLPPYWSLGFHLSKWGYKNIEQLSEIFQRNINAGFPIGTQWSDIDYMENYKDFTVDKEKFNGLGRFVREIKQKYNSRFVAIVDPGISCTSGNEYPPYYEGVFMDIFIKDSQTNQPI-----------------VGKVWPGETV-YPDF--THPNISMYWYKQIQRFYNDVPIDGLWIDMNEPSNFYDGSKRGCQGNSK---YDNPFFVP---------------------DIRDQSLISK-TICSSALH-YNNEKHYNLHNLYGYTESVTTNKALLKTIHGKRPFILSRSTFSGSGKYTFHWTGDNQASWDQLRNSIRQVLNFNMFGIPMTGADICGFNGNSDEELCIRWMQLGAFYPFMRNHNAINQRDQDPASWNTEAQKIMKTAISNRYAMLPLFYTLLVKSHMNGGTVMRPMSFEFFSDKVTHSIELQFMIGSSIMATPVVYPGARSVDAYFPAGVWY---DFHSGKLLHSDAEGAWLTLDAP-LDKINIALRGGHIVPLLDSNRNSKSNIPNKMTLYCGMAQDMSASGDLYWDDGESIDSYSRNRYSYVSFN 2705
            N   R DC PE   NQ +C ARGC W E     N         P+CY+  D   Y + S + S+  ++      +P            E+   TKS   V  +      RYE P+   P + +  T+        S+G FS  + R+S +R LF  S G L++SDQF+QI++ + ++ +YG GE     L      +    ++ARD P  +     +NLYG HP+Y+ +  DGKA GV   NSN QE    P P++ YRTIGG LD + F G +PE   +QYL+ +GKP LP YW+LG+ LS++GYK + ++    Q   +AG PI    +DIDYM+ YKDFT   + + G   +V+ +   +  + + I DP I  T    YP +   +  +    + +T   +                 +G VWP   V +PDF  +  N   +W  +   + + V  DG+WIDMNEPSNF          +S     D P F P                     D    + +S  T+C  A      ++ YN+ NLYG TE++ T KAL K   GKR  ++SRST+  +G+Y  HW GDN A W+ LR S+     FN+FGIP  G+D+CGF G + EELC+RW Q+GAF+ F RNHN I    QDPA W + A    K  +  RY  LP  ++L   + ++G TV+RP+ FE+ +D  T ++  +FM GS I+  PV+Y G  SV+AY P   WY   D+  G ++       + T+ AP   +I + +RG  ++P    +  + +   N   L           G LYWDDGE+I +   N Y Y  F+
Sbjct:   17 NAAPRFDCLPEPNGNQGACEARGCIWKEDDTGKNA--------PWCYF-KDGVGYNLDSQQGSTYNLRKNGGPSNP------WGADSTEIKLTTKSIGSVLNVKIGIDGRYEPPVDF-PRETQSSTESLSLSTSFSNGVFSFSVVRQSTNRKLFDTSIGGLIFSDQFIQIATYLPSENMYGWGENTHQSLRHDFTKYLTWAMFARDQPPNSGSLDTVNLYGVHPYYMILEPDGKAHGVLIINSNAQEVTTAPGPSLIYRTIGGNLDMYFFPGPTPEMVTQQYLKFIGKPFLPAYWALGYQLSRYGYKGLAEMKTRIQAVRDAGIPIDIGVADIDYMQRYKDFTT-GDDWAGFSDYVKTM-HDWGMKLILIFDPAIEAT----YPSFQRAIAANAKFIEWETKAQVQTAIQNLYPMAKDTKIMLGVVWPDNHVAFPDFLDSTNNTQNWWINEFVNYQSQVAFDGIWIDMNEPSNFGTNQDHPWYFDSDDHPNDAPLFCPTNGSSPWEMPPYKTRAVWRFGDANSGAFLSSNTLCMLAQQDGGKQRFYNVKNLYGLTEAINTQKALFKAT-GKRGAVVSRSTYPSAGRYAGHWLGDNTARWEDLRTSVIGAQEFNLFGIPYVGSDVCGFIGTTTEELCLRWQQMGAFHSFFRNHNTIGAPAQDPAVWPSVAAATKKANLF-RYQYLPYLFSLHFTASLSGATVIRPVFFEYPTDAETFNLGYEFMWGSRILVAPVIYQGTTSVNAYLPTDRWYSLFDYRYGSIMSP----GYATVPAPTTSRIPVFVRGYSVIPRQTPSITTTATRSNPFELLIAPCPLGMGEGTLYWDDGETIVN-DFNSYDYHQFD 833          
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Celegans
Match: aagr-4 (Acid Alpha Glucosidase Relate [Source:RefSeq peptide;Acc:NP_508105])

HSP 1 Score: 291.197 bits (744), Expect = 3.053e-83
Identity = 189/615 (30.73%), Postives = 301/615 (48.94%), Query Frame = 3
Query:  966 MNLYGAHPFYIGMPDDGKAFGVFHFNSNGQEFALQPAPA-----------------------VTYRTIGGILDFFIFTGGSPEETVKQYLELVGKPMLPPYWSLGFHLSKWGYKNIEQLSEIFQRNINAGFPIGTQWSDIDYMENYKDFTVDKEKFNGLGRFVREIKQKYNSRFVAIVDPGISCTSGNEYPPYYEGVFMDIFIKDSQTNQPIVGKVWPGETVYPDFTHPNISMYWYKQI--QRFYNDVPIDGLWIDMNEPSNFYDGSKRGCQGNSKYDNPFFVPDIRDQSLISKTICSSALHYNNEKHYNLHNLYGYTESVTTNKAL-LKTIHGKRPFILSRSTFSGSGKYTFHWTGDNQASWDQLRNSIRQVLNFNMFGIPMTGADICGFNGNSDEELCIRWMQLGAFYPFMRNHNAINQRDQDPASWNTEAQKIMKTAISNRYAMLPLFYTLLVKSHMNGGTVMRPMSFEFFSDKVTHSIELQFMIGSSIMATPVVYPGARSVDAYFPAG--VWYDFHSGKLLHSDAEGAWLTLDAPLDKINIALRGGHIVPLLDSNR-NSKSNIPNKMTLYCGMAQDMS-ASGDLYWDDGESIDSYSRNRYSYVSFNASPEQ 2720
            M LYG+ P+ +G+    ++ G    N+      ++P  A                         + +  G++D FI  G  P +  +Q   L G   LPP ++LG+H S+W YK+ + + E+    +    P+   W DI++ +N   FT DK+ F      ++++  K N + V IVDP I   S  +Y  Y E       +KD++ +    G  WPG++ Y DF +P    +W +Q    ++        +W DMNEPS F +G                 P+I        T+   A H+   +H ++HN+YG+ +  +T + L  ++ +  RPF+LSRS F+GS +    WTGDN+A W  L+ SI  +L+ +  G+P  GAD+ GF GN DEEL +RW Q GAF PF R H+  + + ++P  +     + ++ AI  RYA LP +YTL  +    G  VMRP   EF  D+ +   + Q+M+G+ ++  PV+    + +  Y P    VWYD+ + K   S   GA + + A L+ I +  RGG I+P L   +  +K N    + LY  + Q    A+G +Y DDGES  +Y +  ++Y  F    E 
Sbjct:  244 MALYGSIPYLVGV-HQKRSVGALWLNAAETWVDIEPTTADKGGLSKEVLDADTKPRQVPQHNARFYSESGLIDVFITLGPQPNDIFRQLAALTGVTPLPPAFALGYHQSRWNYKDQKDVKEVHDGFVKHDIPLDVLWLDIEHTDNKAYFTFDKDAFGKPEDMIKDLADK-NRKLVTIVDPHIKKDS--KYYIYKEAKKNKYLVKDAK-DTIYEGNCWPGDSTYIDFINPKARKWWSEQFAFDKYKGTTKDVHIWNDMNEPSVF-NG-----------------PEI--------TMHKDAKHHGEFEHRDVHNVYGFHQHSSTFEGLKARSNNEVRPFVLSRSFFAGSQRTAAVWTGDNKADWAHLKQSIPMLLSLSTAGLPFVGADVGGFFGNPDEELLVRWYQAGAFQPFFRGHSHQDTKRREPWLFADNTTEAIRNAIKTRYAFLPYWYTLFYEHAKTGKPVMRPFWMEFIEDEPSWDEDRQWMVGNGLLVKPVLEEKVKELSIYLPGKRQVWYDWETHKARPS--PGA-VQIPAELNTIGLYHRGGTIIPKLSEVKLTTKENHEQPIILYIAVNQKGDFANGTIYLDDGESY-AYEKGDFAYWGFTFKREH 823          
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Fly
Match: CG14476 (pep:known chromosome:BDGP6:X:21600600:21604680:-1 gene:FBgn0027588 transcript:FBtr0070062 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CG14476)

HSP 1 Score: 272.322 bits (695), Expect = 1.717e-76
Identity = 202/704 (28.69%), Postives = 326/704 (46.31%), Query Frame = 3
Query:  795 KSFGPLLYSDQFLQISSIMSTDQIYGIGEQNRPFLHQLSNGWERIGLWARD---NPIETFMNLYGAHPFYIGMPDDGKAFGVFHFNSNGQEFALQ--------------------PAPAVTYRTIGGILDFFIFTGGSPEETVKQYLELVGKPMLPPYWSLGFHLSKWGYKNIEQLSEIFQRNINAGFPIGTQWSDIDYMENYKDFTVDKEKFNGLGRFVREIKQKYNSRFVAIVDPGISCTSGNEYPPYYEGVFMDIFIKDSQTNQPIVGKVWPGETVYPDFTHPNISMYWYKQ--IQRFYNDVPIDGLWIDMNEPSNFYDGSKRGCQGNSKYDNPFFVPDIRDQSLISKTICSSALHYNNEKHYNLHNLYGYTESVTTNKALLKTIHGKRPFILSRSTFSGSGKYTFHWTGDNQASWDQLRNSIRQVLNFNMFGIPMTGADICGFNGNSDEELCIRWMQLGAFYPFMRNHNAINQRDQDPASWNTEAQKIMKTAISNRYAMLPLFYTLLVKSHMNGGTVMRPMSFEFFSDKVTHSIELQFMIGSSIMATPVVYPGARSVDAYFPA-------GVWYDFHSGKLLHSDAEGAWLTLDAPLDKINIALRGGHIVPLLDSNRNSKS-NIPNKMTLYCGMAQDMSASGDLYWDDGESIDSYSRNRYSYVSFNASPEQLLITPVYFG---YDLLPVLNKIVILGFEN 2798
            K +GP   +  F    S  +   ++GI E    F+ + ++G +   L+  D     +++ M LYG+ P   G      A GV+  N+      +Q                    P PA  + +  GI+D FI  G  P +T KQY  L G   LP  ++L +H S+W Y +   ++ +  +      P+ T W DI++ +  + FT DK KF      ++ + +      V IVDP I     N Y  + +      ++K  + N    G  WPG   YPDF +P +  Y+  Q  + +F        LW DMNEPS F +G                 P+I        T     +HY N +H ++HNLYG+   + +   L +    +RPFIL+R+ F+GS +Y   WTGDN A W  L++S++  L   + G    GAD+  F GN D EL  RW Q GAF PF R H  I+ + ++P  +    +++++ A+  RY+ LPL+YT   +  + G  V+RP+  ++  DK    ++ Q ++   ++  PV+  G   VD YFPA         WYD  +           ++++     KI +  RGG IVP  +  R + +  + +  TL   + +   ASG LY DD +S  +Y + +  +V++  + +QL+ +  + G   Y  L  + +IVI G E 
Sbjct:  217 KPYGPEAVALDF----SFPAAKVLFGIPEHADSFILKSTSGTDPYRLYNLDVFEYVVDSKMALYGSVPVIYGHGAQRTA-GVYWQNAAETWVDIQTSETNVVSSLVNFVSGSQKTPPPAAHFMSESGIVDAFIMLGPKPMDTFKQYAALTGTHELPQLFALAYHQSRWNYNDERDVTSVSAKFDEYNIPMDTMWLDIEHTDGKRYFTWDKFKFPHPLAMIKNLTE-LGRHLVVIVDPHIK--RDNNYFFHRDCTDRGYYVKTREGND-YEGWCWPGAASYPDFFNPVVREYYASQYALDKFQTVTADVMLWNDMNEPSVF-NG-----------------PEI--------TAPKDLIHYGNWEHRDVHNLYGHMHLMGSFAGLQQRDPNQRPFILTRAHFAGSQRYAAIWTGDNFADWSHLQHSVKMCLTEAVAGFSFCGADVGAFFGNPDTELLERWYQTGAFLPFFRAHAHIDTKRREPWLFPERTRQVIQNAVIKRYSYLPLWYTAFYELELTGEPVIRPLLAQYPLDKEAFGVDNQLLVQDRLLVRPVMQQGVSKVDVYFPAIDDKKNGDWWYDVDT---YQRQERSGYVSVPVDDFKIPVWQRGGSIVPKKERQRRASTLMLHDPYTLIICLDRQGKASGSLYLDDEKSY-AYRQGQRIHVNYEFAHDQLVNS--FVGKPKYKTLAWIERIVIAGLEK 879          
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Fly
Match: CG14476 (pep:known chromosome:BDGP6:X:21600600:21604936:-1 gene:FBgn0027588 transcript:FBtr0070061 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CG14476)

HSP 1 Score: 272.322 bits (695), Expect = 1.717e-76
Identity = 202/704 (28.69%), Postives = 326/704 (46.31%), Query Frame = 3
Query:  795 KSFGPLLYSDQFLQISSIMSTDQIYGIGEQNRPFLHQLSNGWERIGLWARD---NPIETFMNLYGAHPFYIGMPDDGKAFGVFHFNSNGQEFALQ--------------------PAPAVTYRTIGGILDFFIFTGGSPEETVKQYLELVGKPMLPPYWSLGFHLSKWGYKNIEQLSEIFQRNINAGFPIGTQWSDIDYMENYKDFTVDKEKFNGLGRFVREIKQKYNSRFVAIVDPGISCTSGNEYPPYYEGVFMDIFIKDSQTNQPIVGKVWPGETVYPDFTHPNISMYWYKQ--IQRFYNDVPIDGLWIDMNEPSNFYDGSKRGCQGNSKYDNPFFVPDIRDQSLISKTICSSALHYNNEKHYNLHNLYGYTESVTTNKALLKTIHGKRPFILSRSTFSGSGKYTFHWTGDNQASWDQLRNSIRQVLNFNMFGIPMTGADICGFNGNSDEELCIRWMQLGAFYPFMRNHNAINQRDQDPASWNTEAQKIMKTAISNRYAMLPLFYTLLVKSHMNGGTVMRPMSFEFFSDKVTHSIELQFMIGSSIMATPVVYPGARSVDAYFPA-------GVWYDFHSGKLLHSDAEGAWLTLDAPLDKINIALRGGHIVPLLDSNRNSKS-NIPNKMTLYCGMAQDMSASGDLYWDDGESIDSYSRNRYSYVSFNASPEQLLITPVYFG---YDLLPVLNKIVILGFEN 2798
            K +GP   +  F    S  +   ++GI E    F+ + ++G +   L+  D     +++ M LYG+ P   G      A GV+  N+      +Q                    P PA  + +  GI+D FI  G  P +T KQY  L G   LP  ++L +H S+W Y +   ++ +  +      P+ T W DI++ +  + FT DK KF      ++ + +      V IVDP I     N Y  + +      ++K  + N    G  WPG   YPDF +P +  Y+  Q  + +F        LW DMNEPS F +G                 P+I        T     +HY N +H ++HNLYG+   + +   L +    +RPFIL+R+ F+GS +Y   WTGDN A W  L++S++  L   + G    GAD+  F GN D EL  RW Q GAF PF R H  I+ + ++P  +    +++++ A+  RY+ LPL+YT   +  + G  V+RP+  ++  DK    ++ Q ++   ++  PV+  G   VD YFPA         WYD  +           ++++     KI +  RGG IVP  +  R + +  + +  TL   + +   ASG LY DD +S  +Y + +  +V++  + +QL+ +  + G   Y  L  + +IVI G E 
Sbjct:  217 KPYGPEAVALDF----SFPAAKVLFGIPEHADSFILKSTSGTDPYRLYNLDVFEYVVDSKMALYGSVPVIYGHGAQRTA-GVYWQNAAETWVDIQTSETNVVSSLVNFVSGSQKTPPPAAHFMSESGIVDAFIMLGPKPMDTFKQYAALTGTHELPQLFALAYHQSRWNYNDERDVTSVSAKFDEYNIPMDTMWLDIEHTDGKRYFTWDKFKFPHPLAMIKNLTE-LGRHLVVIVDPHIK--RDNNYFFHRDCTDRGYYVKTREGND-YEGWCWPGAASYPDFFNPVVREYYASQYALDKFQTVTADVMLWNDMNEPSVF-NG-----------------PEI--------TAPKDLIHYGNWEHRDVHNLYGHMHLMGSFAGLQQRDPNQRPFILTRAHFAGSQRYAAIWTGDNFADWSHLQHSVKMCLTEAVAGFSFCGADVGAFFGNPDTELLERWYQTGAFLPFFRAHAHIDTKRREPWLFPERTRQVIQNAVIKRYSYLPLWYTAFYELELTGEPVIRPLLAQYPLDKEAFGVDNQLLVQDRLLVRPVMQQGVSKVDVYFPAIDDKKNGDWWYDVDT---YQRQERSGYVSVPVDDFKIPVWQRGGSIVPKKERQRRASTLMLHDPYTLIICLDRQGKASGSLYLDDEKSY-AYRQGQRIHVNYEFAHDQLVNS--FVGKPKYKTLAWIERIVIAGLEK 879          
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Fly
Match: CG14476 (pep:known chromosome:BDGP6:X:21600502:21605264:-1 gene:FBgn0027588 transcript:FBtr0070059 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CG14476)

HSP 1 Score: 272.322 bits (695), Expect = 1.717e-76
Identity = 202/704 (28.69%), Postives = 326/704 (46.31%), Query Frame = 3
Query:  795 KSFGPLLYSDQFLQISSIMSTDQIYGIGEQNRPFLHQLSNGWERIGLWARD---NPIETFMNLYGAHPFYIGMPDDGKAFGVFHFNSNGQEFALQ--------------------PAPAVTYRTIGGILDFFIFTGGSPEETVKQYLELVGKPMLPPYWSLGFHLSKWGYKNIEQLSEIFQRNINAGFPIGTQWSDIDYMENYKDFTVDKEKFNGLGRFVREIKQKYNSRFVAIVDPGISCTSGNEYPPYYEGVFMDIFIKDSQTNQPIVGKVWPGETVYPDFTHPNISMYWYKQ--IQRFYNDVPIDGLWIDMNEPSNFYDGSKRGCQGNSKYDNPFFVPDIRDQSLISKTICSSALHYNNEKHYNLHNLYGYTESVTTNKALLKTIHGKRPFILSRSTFSGSGKYTFHWTGDNQASWDQLRNSIRQVLNFNMFGIPMTGADICGFNGNSDEELCIRWMQLGAFYPFMRNHNAINQRDQDPASWNTEAQKIMKTAISNRYAMLPLFYTLLVKSHMNGGTVMRPMSFEFFSDKVTHSIELQFMIGSSIMATPVVYPGARSVDAYFPA-------GVWYDFHSGKLLHSDAEGAWLTLDAPLDKINIALRGGHIVPLLDSNRNSKS-NIPNKMTLYCGMAQDMSASGDLYWDDGESIDSYSRNRYSYVSFNASPEQLLITPVYFG---YDLLPVLNKIVILGFEN 2798
            K +GP   +  F    S  +   ++GI E    F+ + ++G +   L+  D     +++ M LYG+ P   G      A GV+  N+      +Q                    P PA  + +  GI+D FI  G  P +T KQY  L G   LP  ++L +H S+W Y +   ++ +  +      P+ T W DI++ +  + FT DK KF      ++ + +      V IVDP I     N Y  + +      ++K  + N    G  WPG   YPDF +P +  Y+  Q  + +F        LW DMNEPS F +G                 P+I        T     +HY N +H ++HNLYG+   + +   L +    +RPFIL+R+ F+GS +Y   WTGDN A W  L++S++  L   + G    GAD+  F GN D EL  RW Q GAF PF R H  I+ + ++P  +    +++++ A+  RY+ LPL+YT   +  + G  V+RP+  ++  DK    ++ Q ++   ++  PV+  G   VD YFPA         WYD  +           ++++     KI +  RGG IVP  +  R + +  + +  TL   + +   ASG LY DD +S  +Y + +  +V++  + +QL+ +  + G   Y  L  + +IVI G E 
Sbjct:  217 KPYGPEAVALDF----SFPAAKVLFGIPEHADSFILKSTSGTDPYRLYNLDVFEYVVDSKMALYGSVPVIYGHGAQRTA-GVYWQNAAETWVDIQTSETNVVSSLVNFVSGSQKTPPPAAHFMSESGIVDAFIMLGPKPMDTFKQYAALTGTHELPQLFALAYHQSRWNYNDERDVTSVSAKFDEYNIPMDTMWLDIEHTDGKRYFTWDKFKFPHPLAMIKNLTE-LGRHLVVIVDPHIK--RDNNYFFHRDCTDRGYYVKTREGND-YEGWCWPGAASYPDFFNPVVREYYASQYALDKFQTVTADVMLWNDMNEPSVF-NG-----------------PEI--------TAPKDLIHYGNWEHRDVHNLYGHMHLMGSFAGLQQRDPNQRPFILTRAHFAGSQRYAAIWTGDNFADWSHLQHSVKMCLTEAVAGFSFCGADVGAFFGNPDTELLERWYQTGAFLPFFRAHAHIDTKRREPWLFPERTRQVIQNAVIKRYSYLPLWYTAFYELELTGEPVIRPLLAQYPLDKEAFGVDNQLLVQDRLLVRPVMQQGVSKVDVYFPAIDDKKNGDWWYDVDT---YQRQERSGYVSVPVDDFKIPVWQRGGSIVPKKERQRRASTLMLHDPYTLIICLDRQGKASGSLYLDDEKSY-AYRQGQRIHVNYEFAHDQLVNS--FVGKPKYKTLAWIERIVIAGLEK 879          
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Fly
Match: CG14476 (pep:known chromosome:BDGP6:X:21600600:21605264:-1 gene:FBgn0027588 transcript:FBtr0070058 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CG14476)

HSP 1 Score: 272.322 bits (695), Expect = 1.717e-76
Identity = 202/704 (28.69%), Postives = 326/704 (46.31%), Query Frame = 3
Query:  795 KSFGPLLYSDQFLQISSIMSTDQIYGIGEQNRPFLHQLSNGWERIGLWARD---NPIETFMNLYGAHPFYIGMPDDGKAFGVFHFNSNGQEFALQ--------------------PAPAVTYRTIGGILDFFIFTGGSPEETVKQYLELVGKPMLPPYWSLGFHLSKWGYKNIEQLSEIFQRNINAGFPIGTQWSDIDYMENYKDFTVDKEKFNGLGRFVREIKQKYNSRFVAIVDPGISCTSGNEYPPYYEGVFMDIFIKDSQTNQPIVGKVWPGETVYPDFTHPNISMYWYKQ--IQRFYNDVPIDGLWIDMNEPSNFYDGSKRGCQGNSKYDNPFFVPDIRDQSLISKTICSSALHYNNEKHYNLHNLYGYTESVTTNKALLKTIHGKRPFILSRSTFSGSGKYTFHWTGDNQASWDQLRNSIRQVLNFNMFGIPMTGADICGFNGNSDEELCIRWMQLGAFYPFMRNHNAINQRDQDPASWNTEAQKIMKTAISNRYAMLPLFYTLLVKSHMNGGTVMRPMSFEFFSDKVTHSIELQFMIGSSIMATPVVYPGARSVDAYFPA-------GVWYDFHSGKLLHSDAEGAWLTLDAPLDKINIALRGGHIVPLLDSNRNSKS-NIPNKMTLYCGMAQDMSASGDLYWDDGESIDSYSRNRYSYVSFNASPEQLLITPVYFG---YDLLPVLNKIVILGFEN 2798
            K +GP   +  F    S  +   ++GI E    F+ + ++G +   L+  D     +++ M LYG+ P   G      A GV+  N+      +Q                    P PA  + +  GI+D FI  G  P +T KQY  L G   LP  ++L +H S+W Y +   ++ +  +      P+ T W DI++ +  + FT DK KF      ++ + +      V IVDP I     N Y  + +      ++K  + N    G  WPG   YPDF +P +  Y+  Q  + +F        LW DMNEPS F +G                 P+I        T     +HY N +H ++HNLYG+   + +   L +    +RPFIL+R+ F+GS +Y   WTGDN A W  L++S++  L   + G    GAD+  F GN D EL  RW Q GAF PF R H  I+ + ++P  +    +++++ A+  RY+ LPL+YT   +  + G  V+RP+  ++  DK    ++ Q ++   ++  PV+  G   VD YFPA         WYD  +           ++++     KI +  RGG IVP  +  R + +  + +  TL   + +   ASG LY DD +S  +Y + +  +V++  + +QL+ +  + G   Y  L  + +IVI G E 
Sbjct:  217 KPYGPEAVALDF----SFPAAKVLFGIPEHADSFILKSTSGTDPYRLYNLDVFEYVVDSKMALYGSVPVIYGHGAQRTA-GVYWQNAAETWVDIQTSETNVVSSLVNFVSGSQKTPPPAAHFMSESGIVDAFIMLGPKPMDTFKQYAALTGTHELPQLFALAYHQSRWNYNDERDVTSVSAKFDEYNIPMDTMWLDIEHTDGKRYFTWDKFKFPHPLAMIKNLTE-LGRHLVVIVDPHIK--RDNNYFFHRDCTDRGYYVKTREGND-YEGWCWPGAASYPDFFNPVVREYYASQYALDKFQTVTADVMLWNDMNEPSVF-NG-----------------PEI--------TAPKDLIHYGNWEHRDVHNLYGHMHLMGSFAGLQQRDPNQRPFILTRAHFAGSQRYAAIWTGDNFADWSHLQHSVKMCLTEAVAGFSFCGADVGAFFGNPDTELLERWYQTGAFLPFFRAHAHIDTKRREPWLFPERTRQVIQNAVIKRYSYLPLWYTAFYELELTGEPVIRPLLAQYPLDKEAFGVDNQLLVQDRLLVRPVMQQGVSKVDVYFPAIDDKKNGDWWYDVDT---YQRQERSGYVSVPVDDFKIPVWQRGGSIVPKKERQRRASTLMLHDPYTLIICLDRQGKASGSLYLDDEKSY-AYRQGQRIHVNYEFAHDQLVNS--FVGKPKYKTLAWIERIVIAGLEK 879          
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Fly
Match: CG14476 (pep:known chromosome:BDGP6:X:21600600:21605264:-1 gene:FBgn0027588 transcript:FBtr0070060 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CG14476)

HSP 1 Score: 272.322 bits (695), Expect = 1.717e-76
Identity = 202/704 (28.69%), Postives = 326/704 (46.31%), Query Frame = 3
Query:  795 KSFGPLLYSDQFLQISSIMSTDQIYGIGEQNRPFLHQLSNGWERIGLWARD---NPIETFMNLYGAHPFYIGMPDDGKAFGVFHFNSNGQEFALQ--------------------PAPAVTYRTIGGILDFFIFTGGSPEETVKQYLELVGKPMLPPYWSLGFHLSKWGYKNIEQLSEIFQRNINAGFPIGTQWSDIDYMENYKDFTVDKEKFNGLGRFVREIKQKYNSRFVAIVDPGISCTSGNEYPPYYEGVFMDIFIKDSQTNQPIVGKVWPGETVYPDFTHPNISMYWYKQ--IQRFYNDVPIDGLWIDMNEPSNFYDGSKRGCQGNSKYDNPFFVPDIRDQSLISKTICSSALHYNNEKHYNLHNLYGYTESVTTNKALLKTIHGKRPFILSRSTFSGSGKYTFHWTGDNQASWDQLRNSIRQVLNFNMFGIPMTGADICGFNGNSDEELCIRWMQLGAFYPFMRNHNAINQRDQDPASWNTEAQKIMKTAISNRYAMLPLFYTLLVKSHMNGGTVMRPMSFEFFSDKVTHSIELQFMIGSSIMATPVVYPGARSVDAYFPA-------GVWYDFHSGKLLHSDAEGAWLTLDAPLDKINIALRGGHIVPLLDSNRNSKS-NIPNKMTLYCGMAQDMSASGDLYWDDGESIDSYSRNRYSYVSFNASPEQLLITPVYFG---YDLLPVLNKIVILGFEN 2798
            K +GP   +  F    S  +   ++GI E    F+ + ++G +   L+  D     +++ M LYG+ P   G      A GV+  N+      +Q                    P PA  + +  GI+D FI  G  P +T KQY  L G   LP  ++L +H S+W Y +   ++ +  +      P+ T W DI++ +  + FT DK KF      ++ + +      V IVDP I     N Y  + +      ++K  + N    G  WPG   YPDF +P +  Y+  Q  + +F        LW DMNEPS F +G                 P+I        T     +HY N +H ++HNLYG+   + +   L +    +RPFIL+R+ F+GS +Y   WTGDN A W  L++S++  L   + G    GAD+  F GN D EL  RW Q GAF PF R H  I+ + ++P  +    +++++ A+  RY+ LPL+YT   +  + G  V+RP+  ++  DK    ++ Q ++   ++  PV+  G   VD YFPA         WYD  +           ++++     KI +  RGG IVP  +  R + +  + +  TL   + +   ASG LY DD +S  +Y + +  +V++  + +QL+ +  + G   Y  L  + +IVI G E 
Sbjct:  217 KPYGPEAVALDF----SFPAAKVLFGIPEHADSFILKSTSGTDPYRLYNLDVFEYVVDSKMALYGSVPVIYGHGAQRTA-GVYWQNAAETWVDIQTSETNVVSSLVNFVSGSQKTPPPAAHFMSESGIVDAFIMLGPKPMDTFKQYAALTGTHELPQLFALAYHQSRWNYNDERDVTSVSAKFDEYNIPMDTMWLDIEHTDGKRYFTWDKFKFPHPLAMIKNLTE-LGRHLVVIVDPHIK--RDNNYFFHRDCTDRGYYVKTREGND-YEGWCWPGAASYPDFFNPVVREYYASQYALDKFQTVTADVMLWNDMNEPSVF-NG-----------------PEI--------TAPKDLIHYGNWEHRDVHNLYGHMHLMGSFAGLQQRDPNQRPFILTRAHFAGSQRYAAIWTGDNFADWSHLQHSVKMCLTEAVAGFSFCGADVGAFFGNPDTELLERWYQTGAFLPFFRAHAHIDTKRREPWLFPERTRQVIQNAVIKRYSYLPLWYTAFYELELTGEPVIRPLLAQYPLDKEAFGVDNQLLVQDRLLVRPVMQQGVSKVDVYFPAIDDKKNGDWWYDVDT---YQRQERSGYVSVPVDDFKIPVWQRGGSIVPKKERQRRASTLMLHDPYTLIICLDRQGKASGSLYLDDEKSY-AYRQGQRIHVNYEFAHDQLVNS--FVGKPKYKTLAWIERIVIAGLEK 879          
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Zebrafish
Match: si:ch73-12o23.1 (si:ch73-12o23.1 [Source:ZFIN;Acc:ZDB-GENE-130530-749])

HSP 1 Score: 710.294 bits (1832), Expect = 0.000e+0
Identity = 361/805 (44.84%), Postives = 496/805 (61.61%), Query Frame = 3
Query:  324 CQIANNNERLDCYPESGA--NQDSCIARGCCWSEPMRLSNKLQGVPLSIPYCYYPTDYSNYMIKSLRKSSRGIKAKLVRESPSYLPYEVAMLDLEVIYETKSRTRVRITDPKQKRYEVPMKLSPPDLKPPTDREYEVIIPSDGSFSIEIKRKSDDRSLFK-SFGPLLYSDQFLQISSIMSTDQIYGIGEQNRPFLHQLSNGWERIGLWARDNPIETFMNLYGAHPFYIGMPDDGKAFGVFHFNSNGQEFALQPAPAVTYRTIGGILDFFIFTGGSPEETVKQYLELVGKPMLPPYWSLGFHLSKWGYKNIEQLSEIFQRNINAGFPIGTQWSDIDYMENYKDFTVDKEKFNGLGRFVREIKQKYNSRFVAIVDPGISCTSG-NEYPPYYEGVFMDIFIKDSQTNQPIVGKVWPGETVYPDFTHPNISMYWYKQIQRFYNDVPIDGLWIDMNEPSNFYDGSKRGCQGNSKYDNPFFVPDIRDQSLISKTICSSALHYNNEKHYNLHNLYGYTESVTTNKALLKTIHGKRPFILSRSTFSGSGKYTFHWTGDNQASWDQLRNSIRQVLNFNMFGIPMTGADICGFNGNSDEELCIRWMQLGAFYPFMRNHNAINQRDQDPASWNTEAQKIMKTAISNRYAMLPLFYTLLVKSHMNGGTVMRPMSFEFFSDKVTHSIELQFMIGSSIMATPVVYPGARSVDAYFPAGVWYDFHSGKLLHSDAEGAWLTLDAPLDKINIALRGGHIVPLLDSNRNSKSNIPNKMTLYCGMAQDMSASGDLYWDDGESIDSYSRNRYSYVSFNASPEQLL 2726
            C       R DCYPE      +D C AR CC+ +  R +   Q     +P+C+Y  DY +Y + S+  +  G   KL+R   +Y P ++  L LEV++E   R RV+ITDP +KRYEVP+ + P   K  ++  Y V    +  F + +KR      L   S  PL Y+DQFLQ+SS + T  IYG+GE    FLH +   W  + +WARD P     NLYG HPFY+ M  DG A G F  NSN  +  LQPAPAVT+R IGGILDF+IF G  P   + QYL++VGKP +P YW+LG+HL +WGYK   +   + +   N G P   QW+DIDYM+   DFT D   F+ L   V+++ Q+++  +V I+DPGIS +     Y P+ EG    IFI DS  +  ++GKVWPG T +PDF++P+   +WY+ +QRF+N VP DG+WIDMNEPSNF+DGS  GC  N + +NP + P I   +L  KT+C+SA       HYN+H+LYG  E+  T  AL + I  KRPFI+SRSTF   GKY+ HW GDN++ W  L  SI  +L FN+ GIP+ GADICGF G++ EELC+RW QLGAFYPF RNHN+I+++DQ+P +++  A+  MK AI  RY++ P  YTL   +H++G TV  P+ F+F +D+ T+ I+ QF+ G S++ TPV+  G   V  YFP G+WYDFH+G  L S  E   + L+AP DKIN+ LR G ++P    N     +    + L   +++D  A GDLYWDDGE+IDSY  N+Y+Y+ F      ++
Sbjct:  101 CSQVPEGWRFDCYPERNVVVTEDMCHARNCCFIQSSRGNVSAQN---GVPWCFYTPDYPSYELMSIVDTEMGKVGKLLRNKKTYYPKDIDALQLEVLFEEDHRLRVKITDPTEKRYEVPIDV-PVVHKRASNPSYTVDFIKE-PFGLIVKRTQTGAVLLNTSIAPLFYADQFLQMSSSLPTRFIYGLGEHRSNFLHDVQ--WNTLTMWARDVPPMELTNLYGVHPFYLSMESDGNAHGFFMLNSNAMDVVLQPAPAVTWRMIGGILDFYIFLGPDPSSVIGQYLDVVGKPAMPIYWALGYHLCRWGYKTSNKTWSVVKEMRNYGIPQDVQWNDIDYMDRSLDFTYDPSGFSTLPDLVKDL-QRHDQHYVMILDPGISNSQPPGSYWPFDEGKKKGIFINDSNGDI-LIGKVWPGLTAFPDFSNPDTHEWWYQNLQRFHNKVPFDGVWIDMNEPSNFFDGSLNGCPDN-ELENPPYTPGILGGTLKGKTVCASARQ-KISVHYNIHSLYGLMEAQATESAL-RRITKKRPFIISRSTFPSQGKYSGHWLGDNRSQWKDLATSIPGMLTFNILGIPLIGADICGFGGSTTEELCVRWTQLGAFYPFTRNHNSIDEQDQEPTAFSPAARTAMKEAILLRYSLFPHLYTLFHHAHVSGHTVATPLLFQFPTDEKTYGIDKQFLWGKSLLVTPVLDAGRDYVVGYFPKGLWYDFHTGNSLISSGEE--IKLEAPADKINLHLREGSVIPTQRPNTTLWVSSGQPLHLIVSLSEDGRAKGDLYWDDGETIDSYESNQYAYIYFTVEQNTMM 891          
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Zebrafish
Match: gaa (glucosidase, alpha; acid (Pompe disease, glycogen storage disease type II) [Source:ZFIN;Acc:ZDB-GENE-070212-2])

HSP 1 Score: 664.455 bits (1713), Expect = 0.000e+0
Identity = 360/888 (40.54%), Postives = 520/888 (58.56%), Query Frame = 3
Query:  321 QCQIANNNERLDCYPESGANQDSCIARGCCWSEPMRLSNKLQGVPLSIPYCYYPTDYSNYMIKSLRKSSRGIKAKLVRESPSYLPYEVAMLDLEVIYETKSRTRVRITDPKQKRYEVP-MKLSPPDLKPPTDREYEVIIPSDGSFSIEIKRKSDDRSLF-KSFGPLLYSDQFLQISSIMSTDQIYGIGEQNRPFLHQLSNGWERIGLWARDNPIETFMNLYGAHPFYIGMPDDGKAFGVFHFNSNGQEFALQPAPAVTYRTIGGILDFFIFTGGSPEETVKQYLELVGKPMLPPYWSLGFHLSKWGYKNIEQLSEIFQRNINAGFPIGTQWSDIDYMENYKDFTVDKEKFNGLGRFVREIKQKYNSRFVAIVDPGISCTSG-NEYPPYYEGVFMDIFIKDSQTNQPIVGKVWPGETVYPDFTHPNISMYWYKQIQRFYNDVPIDGLWIDMNEPSNFYDGSKRGCQGNSKYDNPFFVPDIRDQSLISKTICSSALHYNNEKHYNLHNLYGYTESVTTNKALLKTIHGKRPFILSRSTFSGSGKYTFHWTGDNQASWDQLRNSIRQVLNFNMFGIPMTGADICGFNGNSDEELCIRWMQLGAFYPFMRNHNAINQRDQDPASWNTEAQKIMKTAISNRYAMLPLFYTLLVKSHMNGGTVMRPMSFEFFSDKVTHSIELQFMIGSSIMATPVVYPGARSVDAYFPAGVWYDFH--SGKLLHS--------------DAEGAWLTLDAPLDKINIALRGGHIVPLLDSNRNSKSNIPNKMTLYCGMAQDMSASGDLYWDDGESIDSYSRNRYSYVSFNASPEQLLITPVYFGYDLLP-VLNKIVILGFENKSITKFLLNDNDIP-FHYNPETXXXXXXXXXXXXXXEIKIQW 2921
            QC IA    R+DC  +   ++  C +RGCC+  P+  S  L+G P    +C+Y   Y  Y +  +  + RG +A L R +PSYLP ++  L L+V+ ET+ R  + + DP   RYEVP +K      K   +  Y+V    +  F   ++RKS+ R L   + GPLL++DQ+LQ+S+ +++  + G+GE   P    L   W  + LW RD       NLYG+HPF++    DG+A GVF  NSN  E  +QPAPA+T+ TIGGILDFFIF G SP+  ++QY E++G PM+PPYWSLGFHL +WGY +      + Q    A  P+  QW+D+DY +  + FT D ++F  L + V +  Q    ++V I+DPGIS  S    Y P+ +G+   +FI +S T Q ++GKVWPG T +PDFT+P    +W   I+ FYN VP+DGLWIDMNEPSNF  GS  GC  +S+ + P + P +    L S T+C SA  Y +  HYNLHNLYG TE++ T++ALLK +   RPF+LSRS+F G G+++ HWTGD ++ W+QLR SI  VL F ++GIP+ GAD+CGF G+++EELC+RW QLGAFYPFMRNHN      Q+P  ++  AQ  M+  I+ RY++LP  YTL   +H +  TV RP+  +F +D    SI+ QF+ GSS++ +PV+  GA  V AY P G WY  H  + K +H                 +G ++   A LD I + +R   I+P       +  +  N  TL  G++    A G+L+WDDGES+D++ R  YSY+ F A    ++  P+     L   VL ++ + G +    T    N   +P F Y  +T  + ++ L   + ++I IQW
Sbjct:   14 QCGIAVE-RRIDCARDRSLSRAECESRGCCYL-PLPQSG-LRGPP----WCFYTVFYPGYKMGPMLPTERGHRAILTRSAPSYLPRDIHTLQLDVMAETQDRLHLTLKDPTSPRYEVPFVKSQSKGHKSMENPLYDVDFQPE-PFGFSVRRKSNGRVLLNTTIGPLLFADQYLQLSTSLASSTVSGLGEHYTPITLDLD--WSSVSLWNRDMAPHRSANLYGSHPFFLVQEGDGQAHGVFLLNSNAMEVFMQPAPALTWVTIGGILDFFIFLGPSPQSVIQQYQEVIGYPMMPPYWSLGFHLCRWGYTSTNITRTVVQLMRQAKIPLDVQWNDLDYADQRRVFTFDPQRFGDLPQMVEDFHQ-LGMKYVLILDPGISSASPPGSYKPFDDGLKKGVFINNS-TGQILIGKVWPGPTAFPDFTNPTTQDWWMDWIKDFYNKVPVDGLWIDMNEPSNFVQGSVDGCP-DSELEKPPYTPGVIGGQLNSGTLCVSAQQYLS-NHYNLHNLYGLTEAIATHRALLK-VKKTRPFVLSRSSFPGLGRFSAHWTGDVRSDWEQLRFSIPAVLLFGLYGIPLVGADVCGFGGDTNEELCVRWTQLGAFYPFMRNHNDRPNAPQEPYVFSQRAQDAMRMVINLRYSLLPFLYTLFHHAHTSASTVARPLFLQFPTDPDCRSIDRQFLWGSSLLISPVLEQGAVEVMAYLPPGTWYSLHNMTNKCIHDVPFSESVLHIVTCVHTKGQYIVFPASLDTIIVHVRERSIIPQQAPALTTAISRKNPFTLTVGLSVGNLAKGELFWDDGESLDTFERGDYSYLLFFAEESYVVSKPIKLNGSLDGLVLGEVRVFGVQTPP-TAVWANGQKVPDFSYRLDTKVLTVAGLELPMTAKITIQW 885          
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Zebrafish
Match: MGAM (maltase-glucoamylase [Source:HGNC Symbol;Acc:HGNC:7043])

HSP 1 Score: 537.724 bits (1384), Expect = 2.632e-170
Identity = 317/888 (35.70%), Postives = 498/888 (56.08%), Query Frame = 3
Query:  345 ERLDCYPESGANQDSCIARGCCWSEPMRLSNKLQGVPLSIPYCYYPTDYSNYMIKSLRKSSRGIKAKLVRESPSYLPYE------VAMLDLEVIYETKSRTRVRITDPKQKRYEVPMKLSPPDLKPPTDREYEVIIPSDGSFSIEIKRKSDDRSLFKSFGP-LLYSDQFLQISSIMSTDQIYGIGEQNRP-FLHQLSNGWERIGLWARDNPIETFMNLYGAHPFYIGMPDDGKAFGVFHFNSNGQE-FALQPAPAVTYRTIGGILDFFIFTGGSPEETVKQYLE-LVGKPMLPPYWSLGFHLSKWGYKNIEQLSEIFQRNINAGFPIGTQWSDIDYMENYKDFTVDKEKFNGLGRFVREIKQKYNSRFVAIVDPGISC--TSGNEYPPYYEGVFMDIFIK--DSQTNQPIVGKVWPGE---------------------TVYPDFTHPNISMYWYKQIQRFYNDV-PIDGLWIDMNEPSNFYDGSKRG-CQGNSKYDNPFFVPDI--RDQSLISKTICSSALHY----NNEKHYNLHNLYGYTESVTTNKALLKTIHGKRPFILSRSTFSGSGKYTFHWTGDNQASWDQLRNSIRQVLNFNMFGIPMTGADICGFNGNSDEELCIRWMQLGAFYPFMRNHNAINQRDQDPASWNTEAQKIMKTAISNRYAMLPLFYTLLVKSHMNGGTVMRPMSFEFFSDKVTHSIELQFMIGSSIMATPVVYPGARSVDAYFPAGVWYDFHSGKLLHSDAEGAWLTLDAPLDKINIALRGGHIVPLLDSNRNSKSNIPNKMTLYCGMAQDMSASGDLYWDDGESIDSYSRNRYSYVSFNASPEQLL-ITPVYFGYDLLPVLNKIVILGFENKSITKFLL-----NDNDIPFHYNPET 2861
            ER+DCYPE GA +  C  RGC W          +G+PL++P CYY  ++  Y   ++ ++  GI A L  E  +  P +      +  L +E+ +  +   R +I DP++ RYEVP+ L+ P+  P    +   +  ++  F I + RK     +F S  P  ++SDQF+QIS+ + T+ +YG GE   P + H L+  +   GL+A+D P    +N YG HPFY+GM    KA G+   NSN    F + P   + +R +  +L  ++F   +    +K Y + L+G+P+LP YWSLGF L ++GY N  +++++++    A  P   Q++DIDYME   DFT+DK  F GL   V  ++ +   RF+ I+DP I+   T+G+ Y  +  G+  D+FIK   + +N  + GKVWP                         +PDF     + +W  QI+ +Y++V   DGLWIDMNEP++F  G+  G C G+   +NP ++P +  +++ L  KT+C ++          +HY++HNLYG + +  T  AL  T  GKR  I++RST+  SG++  HW GDN ++WDQL  SI  ++ F++FG+  TGADICGF   + +E+C+RWMQLGAFYPF RNHN IN   QDP +W  E   + +  ++ RY +LP  YTL+ ++H  G TV+RPM  EF +D+ T  I+ QF+ GS+++ TP +  G   V  Y P   WYD+H+ +++  + +G ++ +D PLDKIN+ +RG +I+P  +  RN++ +  N M L   +     A+G+L+WDDGE ID+    +Y Y  F+AS   L  +          P+L ++ +LG  + S+T+  +     +   + F Y PET
Sbjct:  436 ERIDCYPEEGATKAECEGRGCIWEHS-------KGIPLAVPMCYYSENHG-YKASNVVENMYGITADL--EINTAFPSQRSQSPDINKLRVEITFHDEICLRWKIYDPEKARYEVPVPLNLPNPPPLWGEQTYKVEINEEPFGIRVIRKDTSEVIFDSVLPGFIFSDQFIQISTRLPTEYVYGFGETEHPSYKHDLN--FHTYGLFAKDQPPGYKLNSYGIHPFYMGMEKSKKAHGILLLNSNAMGIFTVLPFTFLFWRNVFLLLLMYVFINNTESLFMKTYNDMLIGRPVLPAYWSLGFQLCRYGYANDSEIADLYRDMRAAEIPYDVQYADIDYMERQMDFTLDKTNFLGLPALVDRMRGE-GMRFIFILDPAIAANETTGS-YAAFDSGIEKDVFIKWPPALSNDIVWGKVWPDYPNITVDNSLDWDTQVELFRSFVAFPDFFKNGTAEWWADQIKDYYDNVMKFDGLWIDMNEPASFVHGTVGGKCLGDPLLENPPYMPPLESKEKGLNHKTLCMNSEQILADGTRVRHYDVHNLYGLSHTKPTYDALHSTT-GKRGVIITRSTYPTSGRWAGHWLGDNYSAWDQLLKSIIGMMEFSIFGVSYTGADICGFFNPAQKEMCLRWMQLGAFYPFSRNHNTINMPRQDPVAWGPEFANMSRDVLNIRYTLLPYLYTLMYEAHTKGTTVVRPMLHEFVNDEKTWDIDRQFLWGSALLITPALEEGVTVVKGYLPKTRWYDYHTNEVV--EGQGQFVDMDTPLDKINLHVRGRYIIPYQNPERNTQLSRKNPMNLLVALDGSGYATGNLFWDDGEGIDTLKNRKYIYKQFSASRGSLSGVRETGLEEADRPLLGEVKVLGV-SSSVTEVTITVTGGSTTPLTFDYYPET 1305          

HSP 2 Score: 270.781 bits (691), Expect = 7.742e-75
Identity = 160/390 (41.03%), Postives = 223/390 (57.18%), Query Frame = 3
Query: 1656 DMNEPSNFYDGSKRGCQGNSKYDNPFFVPDIRDQSLISKTICSSALH-YNNEKHYNLHNLYGYTESVTTNKALLKTIHGKRPFILSRSTFSGSGKYTFHWTGDNQASWDQLRNSIRQVLNFNMFGIPMTGADICGFNGNSDEELCIRWMQLGAFYPFMRNHNAINQRDQDPASWNTEAQKI--MKTAISNRYAMLPLFYTLLVKSHMNGGTVMRPMSFEFFSDKVTHSIELQFMIGSSIMATPVVYPGARSVDAYFPAGVWYDFHSGKLLHSDAEGAWLTLDAPLDKINIALRGGHI-VPLLDSNRNSKSNIPNK---MTLYCGMAQDMSASGDLYWDDGESIDSYSRNRYSYVSFNASPEQLLITPVYFGYDLLPVLN--KIVILGFEN 2798
            DMNE SNF  GS +GC  N K + P F P I D  + SKT+C  A   + N  HY++H+LYGY+  + T +A  +     R  + +RS+F G GKY+ HW GDN A+W+ ++ +I  +L FN+FGIP  GADICGF  NS EELC RWMQ+GAFYPF RNHNA    DQDPAS+  ++  +   +  ++ RY +LP  YTL  K+H+NG TV+RP+  EF+SD  T  I  QFM G+ ++ TPV+ PG   V+AY P  +WYDF +   L S         +  L+  NI +   +  +    S R      P++   M L   +  + SASG+L+WDDG+S D+ S   + +  F+ +   L +     GY     L    I ILGF +
Sbjct:    1 DMNEISNFIKGSNKGCADN-KLNYPPFTPRILDDLMYSKTLCMDAKQKWGN--HYDVHSLYGYSMVLATERASKEVFGTNRSMVFTRSSFPGVGKYSGHWLGDNGANWNDIKWAIPGMLEFNLFGIPYIGADICGFFDNSTEELCRRWMQVGAFYPFSRNHNAQGYEDQDPASYGLDSLLVNTSRHYLNIRYKLLPYLYTLFYKAHVNGETVVRPLMHEFYSDSQTWDIHKQFMWGAHLLITPVLDPGVHYVEAYIPDAIWYDFEN---LKSKVNFKKFKSNVNLNVNNIKMNKKNKHLNYFPSQRMKVVCSPSRRHPMGLIIALDDNKSASGELFWDDGDSRDTVSSGNHIHYQFSVTDGSLTMHVTKNGYSDPNNLKFENITILGFSS 384          
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Zebrafish
Match: ENSDART00000167477.1 (pep:novel chromosome:GRCz10:18:2211054:2233382:1 gene:ENSDARG00000104569.1 transcript:ENSDART00000167477.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 273.863 bits (699), Expect = 4.037e-81
Identity = 156/454 (34.36%), Postives = 245/454 (53.96%), Query Frame = 3
Query:  321 QCQIANNNERLDCYPESGANQDSCIARGCCWSEPMRLSNKLQGVPLSIPYCYYPTDYSNYMIKSLRKSSRGIKAKLVR-ESPSYLPYEVAMLDLEVIYETKSRTRVRITDPKQKRYEVPMKLSPPDLKPPTD-REYEVIIPSDGSFSIEIKRKSDDRSLF-KSFGPLLYSDQFLQISSIMSTDQIYGIGEQ-NRPFLHQLSNGWERIGLWARDNPIETFMNLYGAHPFYIGMPDDGKAFGVFHFNSNGQEFALQPAPAVTYRTIGGILDFFIFTGGSPEETVKQYLELVGKPMLPPYWSLGFHLSKWGYKNIEQLSEIFQRNINAGFPIGTQWSDIDYMENYKDFTVDKEKFNGLGRFVREIKQKYNSRFVAIVDPGISCTS--GNEYPPYYEGVFMDIFIKDSQTNQPIVGKVWPGETVYPDFTHPNISMYWYKQIQRFYNDVPIDGLWIDMN 1664
            +C      +R+DC+P+ GA+Q  C+ R CCWS P+  +N        +P+C++  ++     +     S  I+AKL R  +PS    ++  L      +T++R R +ITD KQ R+EVP +       PPT   +Y+V I     F ++I R + ++ LF  + GPL+++DQ+LQ+S+ + +  IYG+GE  ++ F H     W    ++ RD           + P  I +                    +QPAPAVT+RTIGG+LDF++  G +PE  V ++ +L+G+P +PPYWSLGF +S+W Y +++ + E+ +RN NA  P   Q++DIDYME  K FT D  KF  L  F   +  K   +++ I+DP +S        Y     G    +++ +S    P+VG+VWPGETV+PDFT+     +W  +I RF+ +V  D LWI  N
Sbjct:   37 ECPDIPLTDRVDCFPDGGASQQKCLERACCWS-PLDETN--------VPWCFFSKNHGYTADRVSNPDSTHIEAKLTRMNAPSLFGADIKDLTFHGEMQTENRFRFKITDAKQARFEVPHENVKAPANPPTGPLKYKVEI-VQKPFGVKIWRTTPEKLLFDTTIGPLVFADQYLQLSAKLPSHNIYGLGEHVHQTFRHD--TNWRTWPIFTRD-----------SFPNGISL--------------------IQPAPAVTFRTIGGVLDFYVLVGDTPEAVVDEFTKLIGRPFIPPYWSLGFQISRWDYGSLDAVKEVVERNRNASLPYDVQYTDIDYMEEKKIFTYDLVKFADLPNFADYMHDK-GQKYIVILDPAVSTGRRLNGPYDTVDRGHAAKVWVTESDGETPLVGEVWPGETVFPDFTNEACIKWWVDEISRFHKEVKHDALWIVSN 446          
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Zebrafish
Match: ganab (glucosidase, alpha; neutral AB [Source:ZFIN;Acc:ZDB-GENE-110930-9])

HSP 1 Score: 283.108 bits (723), Expect = 4.446e-80
Identity = 206/714 (28.85%), Postives = 324/714 (45.38%), Query Frame = 3
Query:  843 SIMSTDQIYGIGEQNRPFLHQLSNGWERIGLWARD-------NPIETFMNLYGAHPFYIGMPDDGKAFGVFHFNSNG----------------------QEFALQPAPAVTYRTIGGILDFFIFTGGSPEETVKQYLELVGKPMLPPYWSLGFHLSKWGYKNIEQLSEIFQRNINAGFPIGTQWSDIDYMENYKDFTVDKEKFNGLGRFVREIKQKYNSRFVAIVDPGISCTSGNEYPPYYEGVFMDIFIKDSQTNQPIVGKVWPGETVYPDFTHPNISMYWYKQIQRFYNDVPIDGL--WIDMNEPSNFYDGSKRGCQGNSKYDNPFFVPDIRDQSLISKTICSSALHYNNEKHYNLHNLYG-YTESVTTNKALLKTIHGKRPFILSRSTFSGSGKYTFHWTGDNQASWDQLRNSIRQVLNFNMFGIPMTGADICGFNGNSDEELCIRWMQLGAFYPFMRNHNAINQRDQDPASWNTEAQKIMKTAISNRYAMLPLFYTLLVKSHMNGGTVMRPMSFEFFSDKVTHSIELQFMIGSSIMATPVVYPGARSVDAYFPAG--VWYDFHSGKLLHSDAEGAWLTLDAPLDKINIALRGGHIVPLLDSNRNSKSNIPNK-MTLYCGMAQDMSASGDLYWDDGESIDSYSRNRY----------SYVSFNASPEQLLITPVYFGYDLLPVLNKIVILGFENKSITKFLLNDNDIPFHY 2849
            S+   + +YGI E       + ++G +   L+  D       NP    M LYG+ P  I   +  +  G+F  N+                        Q  +  P   V + +  GI+D FI  G  P +   QY  L G    PP  SL +H  +W Y + + +  + +       P    W DI++ +  + FT D  KF      ++ + +K   + VAIVDP I   S  +Y  + E    D ++K+S   +   G  WPG + YPDFT+P +  +W         +  ++ L  W DMNEPS F                    P+I        T+   A+H   E H ++HN+YG Y +  T    + ++   +RPF+L+R+ F+GS +Y   WTGDN A W  L+ SI   L+  + GI   GAD+ GF  N   EL +RW Q GA+ PF R H  ++   ++P  +  E   +++ AI  RYA+LP +Y L+ ++H  G  VMRP+  ++  +  T +I+ +F+IG  ++  PV   G+R V AY P    VWYD H+ +  H+ A+   L +   L  I +  RGG I+P  D  R S + + N   TLY  ++    A G+LY DDG S +  +++ +          S  S N  P+    T  +        + K+VILG          ++  + P  +
Sbjct:  242 SLPGVEHVYGIPEHADNLKLKTTDGGDPYRLYNLDVFQYELYNP----MALYGSVPVMIAH-NTQRTMGIFWLNAAETWVDISSNTAGKTVFGKMLDFVQGSSETPQTDVRWISESGIIDVFIMLGPKPSDVFSQYASLTGTQSFPPLASLAYHQCRWNYNDQDDVKSVDEGFDQHDIPYDFIWLDIEHADGKRYFTWDPHKFPEPKEMLQGLMEK-RRKMVAIVDPHIKVDS--DYKIHNEITNKDFYVKNSD-GRNYEGWCWPGNSGYPDFTNPEMRAWWASMFSYDQYEGSMENLFTWNDMNEPSVFNG------------------PEI--------TMHKDAIHGKWE-HRDVHNIYGLYVQKATAEGQIQRSGGVERPFVLTRAFFAGSQRYGAVWTGDNAADWGHLKISIPMCLSLGLVGISFCGADVGGFFNNPSTELLVRWYQTGAYQPFFRAHAHLDTTRREPWLFGPENTALIREAIRQRYALLPYWYQLIYQAHTTGMPVMRPLWVDYPKETATFTIDDEFLIGRDLLVHPVTEEGSRGVTAYLPGAGEVWYDVHTFQ-KHNGAQN--LYIPVTLSSIPVFQRGGSIIPRKDRIRRSSACMENDPYTLYVALSPKKFAEGELYIDDGHSFNYDTKSEFIHRKLTFANNSLTSRNLCPDCKFSTSSW--------VEKVVILGASKPRKVLLKVDGKETPVEF 908          
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Xenopus
Match: gaa (glucosidase, alpha; acid [Source:Xenbase;Acc:XB-GENE-6054131])

HSP 1 Score: 699.893 bits (1805), Expect = 0.000e+0
Identity = 353/806 (43.80%), Postives = 507/806 (62.90%), Query Frame = 3
Query:  321 QCQIANNNERLDCYPESGANQDSCIARGCCWSEPMRLSNKLQGVPLSIPYCYYPTDYSNYMIKSLRKSSRGIKAKLVRESPSYLPYEVAMLDLEVIYETKSRTRVRITDPKQKRYEVPMKLSPPDLKPPTDREYEVIIPSDGSFSIEIKRKSDDRSLFKS---FGPLLYSDQFLQISSIMSTDQIYGIGEQNRPFLHQLSNGWERIGLWARDNPIETFMNLYGAHPFYIGMPDDGKAFGVFHFNSNGQEFALQPAPAVTYRTIGGILDFFIFTGGSPEETVKQYLELVGKPMLPPYWSLGFHLSKWGYKNIEQLSEIFQRNINAGFPIGTQWSDIDYMENYKDFTVDKEKFNGLGRFVREIKQKYNSRFVAIVDPGISCT-SGNEYPPYYEGVFMDIFIKDSQTNQPIVGKVWPGETVYPDFTHPNISMYWYKQIQRFYNDVPIDGLWIDMNEPSNFYDGSKRGCQGNSKYDNPFFVPDIRDQSLISKTICSSALHYNNEKHYNLHNLYGYTESVTTNKALLKTIHGKRPFILSRSTFSGSGKYTFHWTGDNQASWDQLRNSIRQVLNFNMFGIPMTGADICGFNGNSDEELCIRWMQLGAFYPFMRNHNAINQRDQDPASWNTEAQKIMKTAISNRYAMLPLFYTLLVKSHMNGGTVMRPMSFEFFSDKVTHSIELQFMIGSSIMATPVVYPGARSVDAYFPAGVWYDFHSGKLLHSDAEGAWLTLDAPLDKINIALRGGHIVPLLDSNRNSKSNIPNKMTLYCGMAQDMSASGDLYWDDGESIDSYSRNRYSYVSFNASPEQLL 2726
            QC ++ N  R DC PE   +++ C ARGCC+S      N  Q      P+C++P  Y +Y + +L ++ RG  A L R   +++P+++  L LEV++ET+SR    I DP +KRYEVP+  +P      +   ++V    D  F + I+RKS    L+ +      +   DQFLQIS+ + +  +YG+GE        LS  W R+  W RD       NLYG+HPFY+ M + G++ GVF  NSN  +  LQ APA+T+RT GGILDF++F G  P+  ++QY +++G P +PPYWSLGFHL +WGY       ++ +   +A  P+  QW+DIDYM+  +DFT D+ +F      V+E  Q+   +++ I+DP IS + +   YPPY +G+   +FI D +  +P+VGKVWPG TV+PDFT P    +WY  ++ F++ VP DG+WIDMNEPSNF  GS  GC  N++ +NP +VP +   SL S TIC+S+  + +  HYNLHNLYG +E+V T+ AL+K +  KRPFI+SRSTF+  G Y  HWTGD  +SW+Q+  S+  +L FNMFG+PM GADICGF GN+ EELC+RW QLGAFYPFMRNHN  +   Q+P  +++EAQK +K+A+  RY +LP  YTL  K+H +G TV R +  EF +D  T +I+ Q++ G +++ TPV+  G  +V+AYFP G WY   SG  + S  +G WL L APLDKIN+ +RGG+I+P      N++ +  NK+ L   +  D  A GDL+WDDG S+ ++ R  Y++V F A+   LL
Sbjct:   23 QCSVSPN-RRFDCVPEKCVSKEECEARGCCYSPAGDKGNIGQ------PWCFFPPSYPSYKMFNLTQTDRGYNATLKRSVGTFMPHDIMTLQLEVLFETESRLHFTIKDPAKKRYEVPIP-TPQVSGKASSTLFDVQFSCD-PFGLIIRRKSSGLILYTAASRIKAIFLKDQFLQISTSLPSGYLYGLGEHLTA--RNLSLQWNRLTFWNRDLRPSKDSNLYGSHPFYLSMEEGGQSHGVFLLNSNAMDVLLQEAPALTWRTTGGILDFYVFLGPEPKSVIRQYQDIIGYPFMPPYWSLGFHLCRWGYSTSNCTRQVVKNMRDAKIPLDVQWNDIDYMDAMRDFTYDQNRFGDFPEMVKEFHQQ-GVKYIMILDPAISSSNTPGSYPPYDDGLKRGVFITDDE-GKPLVGKVWPGLTVFPDFTMPETFSWWYDMVKLFHDQVPFDGIWIDMNEPSNFVQGSVDGCP-NNELENPPYVPGVVGGSLRSTTICASSQQHLSS-HYNLHNLYGLSEAVATHYALVKILK-KRPFIISRSTFASHGHYAGHWTGDVVSSWEQIYYSVPAILLFNMFGVPMVGADICGFGGNTTEELCVRWSQLGAFYPFMRNHNDHDSVSQEPYVFSSEAQKAIKSALLIRYTLLPYLYTLFHKAHSSGETVARALFIEFPTDPNTWTIDRQYLWGEALLITPVLEQGKTTVNAYFPTGTWYAPESGTGIQS--KGQWLMLPAPLDKINVHIRGGYILPAQVPGMNTEESRKNKLLLVVALTPDGVARGDLFWDDGVSLGTFERQDYTHVVFLAANNILL 810          
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Xenopus
Match: mgam (maltase-glucoamylase [Source:Xenbase;Acc:XB-GENE-964595])

HSP 1 Score: 630.172 bits (1624), Expect = 0.000e+0
Identity = 332/806 (41.19%), Postives = 486/806 (60.30%), Query Frame = 3
Query:  342 NERLDCYPESGANQDSCIARGCCWSEPMRLSNKLQGVPLSIPYCYYPTDYSNYMIKSLRKSSRGIKAKLVR-ESPSYLPYEVAMLDLEVIYETKSRTRVRITDPKQKRYEVP---MKLSPPDLKPPTDREYEVIIPSDGSFSIEIKRKSDDRSLFKS-FGPLLYSDQFLQISSIMSTDQIYGIGEQ-NRPFLHQLSNGWERIGLWARDN-PIETFMNLYGAHPFYIGMPD-DGKAFGVFHFNSNGQEFALQPAPAVTYRTIGGILDFFIFTGGSPEETVKQYLELVGKPMLPPYWSLGFHLSKWGYKNIEQLSEIFQRNINAGFPIGTQWSDIDYMENYKDFTVDKEKFNGLGRFVREIKQKYNSRFVAIVDPGISCTS--GNEYPPYYEGVFMDIFIKDSQTNQPIVGKVWPGETVYPDFTHPNISMYWYKQIQRFYNDVPIDGLWIDMNEPSNFYDGSKRGCQGNSKYDNPFFVPDIRDQSLISKTICSSALHYNNEKHYNLHNLYGYTESVTTNKALLKTIHGKRPFILSRSTFSGSGKYTFHWTGDNQASWDQLRNSIRQVLNFNMFGIPMTGADICGFNGNSDEELCIRWMQLGAFYPFMRNHNAINQRDQDPASWNTEA--QKIMKTAISNRYAMLPLFYTLLVKSHMNGGTVMRPMSFEFFSDKVTHSIELQFMIGSSIMATPVVYPGARSVDAYFPAGVWYDFHSGKLLHSDAEGAW----LTLDAPLDKINIALRGGHIVPLLDSNRNSKSNIPNKMTLYCGMAQDMSASGDLYWDDGESIDSYSRNRYSYVSFNAS 2711
            + R+DC PE  A+Q+ CI RGCCWS P  + N        +P+CY+ T+   Y +K  + +  G +A L R  +P+     +  L L    ++ +R R +ITDPK KR+EVP   +K          + +Y+++   D  F I++ RKS+ R LF S  GPLLY+DQ LQ+S  + +  IYG+GE  +R + H     W++  ++ RD  P     NLYGAH F++ + D DG +FGVF  NSN  E  +QPAPA+TYRTIGGILDF++F G SPE+ V +YLEL+G+P +P YW+LGFHLS+WGY +++++ ++ +RN   G P   Q++DIDYME  KDFT DK KF  L  F  ++   +  R++ I+DP I+ T      Y  Y  G  + +++ +S    P+VGKVWPG+TVYPD+T+   + +W ++   FY  VP DG+WIDMNE SNF  GS +GC  N K + P + P I+D  + SKT+C  A       HY++HNLYGY+ +++T +A+     GKR  I SRSTF+G+GKY+ HW GDN A+W+ ++ +I  +  F++FGIP  GADICGF  +S EELC RWMQ+GAFYPF RNHNA   + QDPAS+  ++   K  +  ++ RY +LP  YTL  K+H  G TV+RP+  EF+SD  T  I+ QF+ G  ++ TP++ P + +   Y P   WY++ +G       + +W    + +  P DKI + +RGG+I P       +  +  N + L   +  + +A GD +WDDGES  +     +    F+ S
Sbjct:    4 DHRIDCIPEDVASQEICIQRGCCWS-PHDVIN--------VPWCYF-TNAHGYEVKGKKNTQAGFEANLQRLPAPAIYENNIEQLLLAAEMQSNNRFRFKITDPKSKRFEVPHEHIKEFTGSAASNLNYDYKLL---DKPFGIQVIRKSNSRILFDSTIGPLLYADQVLQLSIKLPSSNIYGLGEHVHRQYKHDTY--WKKWAIFTRDEFPNGDGNNLYGAHTFFLCLEDTDGSSFGVFLMNSNAMEVTIQPAPAITYRTIGGILDFYVFVGNSPEQVVMEYLELIGRPYMPAYWTLGFHLSRWGYSSLDEVKQVVERNRAIGIPYDVQFTDIDYMEEKKDFTYDKVKFKDLPSFAEDL-HAHGQRYIIILDPAIANTPLIDGPYLAYERGTNLGVWVNESDGVTPLVGKVWPGDTVYPDYTNEACTKWWVQECLEFYKQVPYDGIWIDMNEVSNFVRGSNKGCASN-KLNYPPYTPRIKDNVMYSKTLCMDAKQAWG-LHYDVHNLYGYSMALSTEEAIKAVFPGKRSIIFSRSTFAGAGKYSGHWLGDNAANWNDIKWAIPGMFEFSLFGIPYIGADICGFFDDSSEELCRRWMQVGAFYPFSRNHNAETFKHQDPASYGADSLLVKTSRHYLNIRYTLLPYLYTLFYKAHTKGETVVRPLLHEFYSDPETWGIDNQFLWGPGLLITPILNPNSVNAYVYIPDAKWYNYETG------TQASWRKQNVDMYIPEDKIGLHVRGGYIFPTQQPANTTFYSRKNPLGLIIALDDNQAARGDFFWDDGESRGTIESGTHILYEFSVS 785          

HSP 2 Score: 584.719 bits (1506), Expect = 0.000e+0
Identity = 324/842 (38.48%), Postives = 498/842 (59.14%), Query Frame = 3
Query:  327 QIANNNERLDCYPESGANQDSCIARGCCWSEPMRLSNKLQGVPLSIPYCYYPTDYSNYMIKSLRKSSRGIKAKLVRESPSYLPY-----EVAMLDLEVIYETKSRTRVRITDPKQKRYEVPMKLSPPDLKPPTD--REYEVIIPSDGSFSIEIKRKSDDRSLFKSFGPLLY-SDQFLQISSIMSTDQIYGIGE-QNRPFLHQLSNGWERIGLWARDNPIETFMNLYGAHPFYIGMPDDGKAFGVFHFNSNGQEFALQPAPAVTYRTIGGILDFFIFTGGSPEETVKQYLELVGKPMLPPYWSLGFHLSKWGYKNIEQLSEIFQRNINAGFPIGTQWSDIDYMENYKDFTVDKEKFNGLGRFVREIKQKYNSRFVAIVDPGISCTSGNEYPPYYEGVFMDIFIKDSQTNQPIVGKVWP---------------------GETVYPDFTHPNISMYWYKQIQRFY-NDVPIDGLWIDMNEPSNFYDGSKRGCQGNSKYDNPFFVP-----DIRDQSLISKTICSSALHY----NNEKHYNLHNLYGYTESVTTNKALLKTIHGKRPFILSRSTFSGSGKYTFHWTGDNQASWDQLRNSIRQVLNFNMFGIPMTGADICGFNGNSDEELCIRWMQLGAFYPFMRNHNAINQRDQDPASWNTEAQKIMKTAISNRYAMLPLFYTLLVKSHMNGGTVMRPMSFEFFSDKVTHSIELQFMIGSSIMATPVVYPGARSVDAYFPAGVWYDFHSGKLLHSDAEGAWLTLDAPLDKINIALRGGHIVPLLDSNRNSKSNIPNKMTLYCGMAQDMSASGDLYWDDGESIDSYSRNRYSYVSFNASPEQLLIT 2732
            QI  N E+ DC+PE  A +  C +RGC W EP  +  +        P+CY+P++Y  Y + +++ +S GIK ++ + S    P+      ++ ++++VIY   +  + +I DP  KRYEVP+ L+ P+    T+  R YEV + +D  F ++I+RKS    ++ S  P  Y SD  L++S+ + +  +YG+GE ++  F H L+     IGL+A+D P +   N YG HPFY+ M DDG A GV   NSN  +  LQP PA+TY+TIGGILDF++  G +PE  V+QY  L+G+P++P YW+LGF L ++GY+N  ++S+++     A  P   Q++DIDYME   DFT+    F GL   V  ++ +   RF+ ++DP I+      YP +  GV  D+FIK    +  + GKVWP                         +PDF     + +W+++I+ +  N +  DGLWIDMNEP++F  G+  GC+ N+  + P ++P     + +D+ L  KT+C  +  +    N  +HY++H+LYG++ S  T  AL + + G+R  ++SRST+  SG++  HW GDN A+W+Q+  S+  +++F++FGI  TGADICGF  +S  ELC RWMQLGAFYPF RNHN    + QDP S++T  + + +  ++ RY +LP  YTLL ++H  G TV+RP+  EF  DK T  +  QF+ G ++M +PV+  GARSV+ Y P  +WYD+H+G  ++ + +G W  L APLD IN+ +RGG+I+PL     N+  +  N M L   + Q+  A+G L+WDDG SI S  R  Y    F+A P  + +T
Sbjct:  863 QIEKNFEKYDCHPEPDAYEAKCQSRGCIW-EPSDVPKE--------PWCYFPSNYG-YRVGNVQSTSTGIKMEITKGSMVVSPFGDLSPPISPINVDVIYHENNMLQFKIYDPNNKRYEVPVPLNLPNSPTSTEAQRLYEVTV-TDNPFGLQIRRKSSGAIIWDSQVPGFYFSDMLLRLSTKLPSPYVYGLGEVEHNTFRHNLNR--TVIGLFAKDQPPQEHTNSYGVHPFYMAMEDDGSATGVLLLNSNAMDLTLQPTPALTYQTIGGILDFYMVLGPTPELVVQQYTALIGRPVMPAYWALGFQLCRYGYQNDAEISDLYNEMKRAQIPYDVQYADIDYMERQMDFTLGA-SFKGLPALVDNMRSE-GMRFIILLDPAIAGNETKPYPAFTRGVADDVFIKWDDGSGIVWGKVWPDLPDVFVDESLDFETQVKLYRAYAAFPDFFLDRTAKWWHQEIKEYRENHIRFDGLWIDMNEPASFVHGTVDGCR-NNILNYPPYMPKKTELESKDRGLSHKTLCMESRQHLPNGNPVRHYDVHSLYGWSHSKPTFDAL-RDVTGERGIVISRSTYPTSGQWVGHWLGDNTAAWNQMDKSVIGMMDFSLFGISYTGADICGFFQDSTYELCARWMQLGAFYPFSRNHNGKGSKRQDPVSFDTAFEDLSRKVLNTRYTLLPYLYTLLFEAHTKGSTVVRPLLHEFTEDKQTWDVYKQFLWGPALMISPVMNEGARSVNVYVPNTIWYDYHTG--ININIKGQWAELQAPLDHINLHVRGGYILPLQAPANNTHFSRKNPMKLLVALDQNEMANGQLFWDDGTSITSIERGVYIMYEFSAGPNFVNLT 1685          
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Xenopus
Match: ganab (glucosidase, alpha; neutral AB [Source:Xenbase;Acc:XB-GENE-997256])

HSP 1 Score: 306.22 bits (783), Expect = 2.433e-88
Identity = 198/613 (32.30%), Postives = 304/613 (49.59%), Query Frame = 3
Query: 1071 PAPAVTYRTIGGILDFFIFTGGSPEETVKQYLELVGKPMLPPYWSLGFHLSKWGYKNIEQLSEIFQRNINAGF-----PIGTQWSDIDYMENYKDFTVDKEKFNGLGRFVREIKQKYNSRFVAIVDPGISCTSGNEYPPYYEGVFMDIFIKDSQTNQPIVGKVWPGETVYPDFTHPNISMYWYKQIQRFYNDVPIDGL--WIDMNEPSNFYDGSKRGCQGNSKYDNPFFVPDIRDQSLISKTICSSALHYNNEKHYNLHNLYGYTESVTTNKALLKTIHGK-RPFILSRSTFSGSGKYTFHWTGDNQASWDQLRNSIRQVLNFNMFGIPMTGADICGFNGNSDEELCIRWMQLGAFYPFMRNHNAINQRDQDPASWNTEAQKIMKTAISNRYAMLPLFYTLLVKSHMNGGTVMRPMSFEFFSDKVTHSIELQFMIGSSIMATPVVYPGARSVDAYFPAG--VWYDFHSGKLLHSDAEGAWLTLDAPLDKINIALRGGHIVPLLDSNRNSKSNIPNK-MTLYCGMAQDMSASGDLYWDDGESIDSYSRNRYSYVSFNASPEQLLITPVYFG--YDLLPVLNKIVILGFENKSITKFLL---NDNDIPFHYNPET 2861
            P   V + +  GI+D F+  G SP +  KQY  L G   LPPY+SLG+H  +W Y + E +     RN++AGF     P    W DI++ +  + FT D  KF      +  +K K   + VAIVDP I   SG  Y  + +    +++IK ++      G  WPG   YPDFT+P +  +W         +  +D L  W DMNEPS F                    P++        T+   A+H+   +H ++HNLYG+     T++ L++   GK RPF+L+R+ F+GS +Y   WTGDN A WD L+ SI   L+ ++ GI   GAD+ GF  N D EL +RW Q GA+ PF R H  ++   ++P     +   +++ A+  RY +LP +YTL  ++   G  VMRP+  EF SD  T +++  +M+GS+++  PV    AR V  Y P    VWYD HS +   +        L   ++ I +  RGG I+P  D  R S   + +   TLY  +     A G+L+ DDG S + Y +N + Y  FN S  +L  + +     +     + +I+I+G    +     L   +++ + F Y+  T
Sbjct:  346 PQTDVRWMSESGIIDVFLLLGPSPFDVFKQYASLTGTQALPPYFSLGYHQCRWNYNDEEDV-----RNVDAGFDEHDLPYDVIWLDIEHADGKRYFTWDPHKFPNPRDMLSGLKNK-RRKMVAIVDPHIKIDSG--YRIHNDIRSQNLYIK-TKDGSDYEGWCWPGSAAYPDFTNPEMRKWWASMFAYDKYEGSMDNLFVWNDMNEPSVFNG------------------PEV--------TMHKDAVHWGGWEHRDVHNLYGFYVQRATSEGLIQRSGGKERPFVLTRAFFAGSQRYGAVWTGDNAAEWDHLKISIPMCLSLSLVGISFCGADVGGFFKNPDAELLVRWYQAGAYQPFFRAHAHLDTPRREPWLHGDDNMAVIREALRQRYTLLPFWYTLFYRALREGEPVMRPLWVEFPSDASTFAMDSHYMLGSALLVRPVTEAKARGVQIYLPGDGEVWYDVHSYQRYEAPQT---FYLPITMNSIPVYQRGGSIIPRKDRPRRSSDCMKDDPFTLYVALNVQGEARGELFLDDGHSFN-YEQNEFLYREFNYSQGKLTASSLDPSGVFKTASWIERIIIIGATKPASVMLTLPGGSESALEFEYDQTT 919          
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Xenopus
Match: ganc (glucosidase, alpha; neutral C [Source:Xenbase;Acc:XB-GENE-5928423])

HSP 1 Score: 295.819 bits (756), Expect = 6.411e-85
Identity = 181/553 (32.73%), Postives = 279/553 (50.45%), Query Frame = 3
Query: 1071 PAPAVTYRTIGGILDFFIFTGGSPEETVKQYLELVGKPMLPPYWSLGFHLSKWGYKN---IEQLSEIFQRNINAGFPIGTQWSDIDYMENYKDFTVDKEKFNGLGRFVREIKQKYNSRFVAIVDPGISCTSGNEYPPYYEGVFMDIFIKDSQTNQPIVGKVWPGETVYPDFTHPNISMYWYKQ--IQRFYNDVPIDGLWIDMNEPSNFYDGSKRGCQGNSKYDNPFFVPDIRDQSLISKTICSSALHYNNEKHYNLHNLYGYTESVTTNKALLKTIHGK-RPFILSRSTFSGSGKYTFHWTGDNQASWDQLRNSIRQVLNFNMFGIPMTGADICGFNGNSDEELCIRWMQLGAFYPFMRNHNAINQRDQDPASWNTEAQKIMKTAISNRYAMLPLFYTLLVKSHMNGGTVMRPMSFEFFSDKVTHSIELQFMIGSSIMATPVVYPGARSVDAYFPAG--VWYDFHSGKLLHSDAEGAWLTLDAPLDKINIALRGGHIVPL-LDSNRNSKSNIPNKMTLYCGMAQDMSASGDLYWDDGESIDSYSRNRYSYVSF 2702
            P   V + +  GI+D F+  G SP +  +QY  L G   LPP +SLG+H  +W Y++   +E +   F  N     P    W DI++ +  + FT D+EKF    R   ++KQK   + V I DP I      +Y  Y E      F+KD +  Q   G  WPG + Y DFT+P +  ++  Q  +  + +   +  +W DMNEPS F              D+P              T+  +A+HY   +H +LHNLYG+ + ++T K L++   G+ RPF+L+RS F+GS +Y   WTGDN+A W+ L+ S+  +L  ++ GI   GAD+ GF G+ + EL IRW Q GAF PF R H   + + ++P  +  +   ++K  I  RY +LP +Y L  ++H++   VMRPM  EF     +   E Q+M+GS+++  PV+ PG  SVD  FP     WYDF   + +          +   L++I +  RGG I+PL     R++         L   +     A G+L+ DDG S +    N +++  F
Sbjct:  320 PQTEVRWMSESGIVDLFLLMGPSPPDVFRQYANLTGFQSLPPLFSLGYHQCRWNYEDEADVEAVDLGFDLN---NIPYDVIWLDIEHTDGKRYFTWDREKFCNPTRMQEKLKQK-KRKLVVISDPHIKVDP--DYSLYSEAKARGYFVKD-RGGQDFEGNCWPGTSCYLDFTNPAVQDWYSAQYALDSYKDSTEVLFVWNDMNEPSVF--------------DSP------------EMTMPKNAVHYKGWEHRDLHNLYGFYQQMSTFKGLMQRSAGQERPFVLTRSFFAGSQRYGAVWTGDNKADWEYLKISVPMLLTLSVTGISFCGADVGGFVGDPEPELLIRWYQAGAFQPFFRAHAIQDSKRREPWLFGEDNTLLIKKVIEERYTLLPFWYLLFYRAHVSAQPVMRPMWVEFPKHTESFEEETQYMLGSALLVVPVLAPGVSSVDILFPGSGERWYDFRKYECVRGPHRK---KVKVTLNEIPVFQRGGSIIPLHTRVGRSTGWMDEFPYELRVALDSKGFAEGELFLDDGHSFNYIQENVFAHRKF 836          
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Xenopus
Match: kiaa1161 (KIAA1161 [Source:Xenbase;Acc:XB-GENE-6047570])

HSP 1 Score: 75.8702 bits (185), Expect = 6.341e-14
Identity = 81/359 (22.56%), Postives = 133/359 (37.05%), Query Frame = 3
Query: 1482 GVFMDIFIKDSQTNQPIVGKVWPGETVYPDFTHPNISMYWYKQIQRFYNDVPIDGLWIDMNEPSNFYDGSKRGCQGNSKYDNPFFVPDIRDQSLISKTICSSALHYNNEKHYNLHNLYGYTESVTTNKALLKTIHGKRPFILSRSTFSGSGKYTFHWTGDNQASWDQ---LRNSIRQVLNFNMFGIPMTGADICGFNGNS----------DEELCIRWMQLGAFYPFMRNHNAINQRDQDPASWNTEAQKIMKTAISNRYAMLPLFYTLLVKSHMNGGTVMRPMSFEFFSDKVTHSIELQFMIGSSIMATPVVYPGARSVDAYFPAGVWYDFHSGKLLHSDAEGAWLTLDAPLDKINIA 2519
            G+  ++F+K+     P + + W G     DFT+PN   ++   ++R      I     D  E S          +  S Y        + D S+ S+     A+ + +                                   R  +       F    D  + W     L++ I  VL  +M G P    D+ G N  +          D EL IRW++L AF P M+        D++      +  +I  T ++      PL   L  +    G  ++RP+ +   +D+  H I+ QF+IG ++M  PV+ PG +  D Y P G W  +  G+L  S      L  D P+D   +A
Sbjct:  369 GIERELFVKEPNGRLPAMVQWWNGIGAILDFTNPNAREWFQNNLKRLRTKYGISSFKFDAGETSYL-------PEQFSTYR------PLSDPSMFSRRYTEMAIPFYDRAEV-------------------------------RVGYQSQNISCFFRIIDRDSVWGYELGLKSLIPTVLTISMLGYPFILPDMIGGNIYTNGTMDSDKIPDRELYIRWLELSAFMPSMQFSVPPWLYDKEVIEIAQKFTQIHATLVA------PLLLELAGEVTDTGDPIIRPIWWISPNDENAHKIDSQFLIGDTLMVAPVLEPGKQERDVYLPEGRWRSY-KGELFQSTPV---LLTDYPVDLDEVA 673          
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Mouse
Match: Gaa (glucosidase, alpha, acid [Source:MGI Symbol;Acc:MGI:95609])

HSP 1 Score: 716.457 bits (1848), Expect = 0.000e+0
Identity = 364/873 (41.70%), Postives = 524/873 (60.02%), Query Frame = 3
Query:  312 ATAQCQIANNNERLDCYPESGANQDSCIARGCCWSEPMRLSNKLQGVPLSIPYCYYPTDYSNYMIKSLRKSSRGIKAKLVRESPSYLPYEVAMLDLEVIYETKSRTRVRITDPKQKRYEVPMKLSPPDLKPPTDREYEVIIPSDGSFSIEIKRKSDDRSLF-KSFGPLLYSDQFLQISSIMSTDQIYGIGEQNRPFLHQLSNGWERIGLWARDNPIETFMNLYGAHPFYIGMPDDGKAFGVFHFNSNGQEFALQPAPAVTYRTIGGILDFFIFTGGSPEETVKQYLELVGKPMLPPYWSLGFHLSKWGYKNIEQLSEIFQRNINAGFPIGTQWSDIDYMENYKDFTVDKEKFNGLGRFVREIKQKYNSRFVAIVDPGISCTS-GNEYPPYYEGVFMDIFIKDSQTNQPIVGKVWPGETVYPDFTHPNISMYWYKQIQRFYNDVPIDGLWIDMNEPSNFYDGSKRGCQGNSKYDNPFFVPDIRDQSLISKTICSSALHYNNEKHYNLHNLYGYTESVTTNKALLKTIHGKRPFILSRSTFSGSGKYTFHWTGDNQASWDQLRNSIRQVLNFNMFGIPMTGADICGFNGNSDEELCIRWMQLGAFYPFMRNHNAINQRDQDPASWNTEAQKIMKTAISNRYAMLPLFYTLLVKSHMNGGTVMRPMSFEFFSDKVTHSIELQFMIGSSIMATPVVYPGARSVDAYFPAGVWYDFHS------GKLLHS----------DAEGAWLTLDAPLDKINIALRGGHIVPLLDSNRNSKSNIPNKMTLYCGMAQDMSASGDLYWDDGESIDSYSRNRYSYVSFNASPEQL---LITPVYFGYDLLPVLNKIVILGFENKSITKFLLNDNDIP---FHYNPE 2858
            A  QC +  ++ R DC P+ G +Q+ C ARGCC+    ++  + Q   +  P+C++P  Y +Y +++L  +  G  A L R SP++ P +V  L LEV+ ET SR   +I DP  KRYEVP++ +P  L       Y V   S+  F + ++RK   R L   +  PL ++DQFLQ+S+ + +  I G+GE   P +  LS  W RI LW RD P     NLYG+HPFY+ + D G A GVF  NSN  +  LQP+PA+T+R+ GGILD ++F G  P+  V+QYL++VG P +PPYW LGFHL +WGY +   + ++ +      FP+  QW+D+DYM+  +DFT +++ F      VRE+ Q    R++ IVDP IS       Y PY EG+   +FI + +T QP++GKVWPG T +PDFT+P    +W   +  F+  VP DG+W+DMNEPSNF  GS++GC  N++ +NP +VP +    L + TIC+S+ H     HYNLHNLYG TE++ +++AL+KT  G RPF++SRSTFSG G+Y  HWTGD ++SW+ L  S+  +L FN+ G+P+ GADICGF G++ EELC+RW QLGAFYPFMRNHN +N   Q+P  ++  AQ+ M+ A + RYA+LP  YTL  ++H+ G TV RP+  EF  D  T S++ Q + G +++ TPV+ PG   V  YFP G WY+         G L              ++G WLTL+APLD IN+ LR G+I+PL   +  +  +    M L   +     A G+L+WDDGES+    R  Y+ V+F+A    +   L+     G +L   L ++ +LG      T+ L   N IP   F Y+P+
Sbjct:   78 APTQCDVPPSS-RFDCAPDKGISQEQCEARGCCYVPAGQVLKEPQ---IGQPWCFFPPSYPSYRLENLSSTESGYTATLTRTSPTFFPKDVLTLQLEVLMETDSRLHFKIKDPASKRYEVPLE-TPRVLSQAPSPLYSVEF-SEEPFGVIVRRKLGGRVLLNTTVAPLFFADQFLQLSTSLPSQHITGLGEHLSPLM--LSTDWARITLWNRDTPPSQGTNLYGSHPFYLALEDGGLAHGVFLLNSNAMDVILQPSPALTWRSTGGILDVYVFLGPEPKSVVQQYLDVVGYPFMPPYWGLGFHLCRWGYSSTAIVRQVVENMTRTHFPLDVQWNDLDYMDARRDFTFNQDSFADFPDMVRELHQD-GRRYMMIVDPAISSAGPAGSYRPYDEGLRRGVFITN-ETGQPLIGKVWPGTTAFPDFTNPETLDWWQDMVSEFHAQVPFDGMWLDMNEPSNFVRGSQQGCP-NNELENPPYVPGVVGGILQAATICASS-HQFLSTHYNLHNLYGLTEAIASSRALVKT-RGTRPFVISRSTFSGHGRYAGHWTGDVRSSWEHLAYSVPDILQFNLLGVPLVGADICGFIGDTSEELCVRWTQLGAFYPFMRNHNDLNSVPQEPYRFSETAQQAMRKAFALRYALLPYLYTLFHRAHVRGDTVARPLFLEFPEDPSTWSVDRQLLWGPALLITPVLEPGKTEVTGYFPKGTWYNMQMVSVDSLGTLPSPSSASSFRSAVQSKGQWLTLEAPLDTINVHLREGYIIPLQGPSLTTTESRKQPMALAVALTASGEADGELFWDDGESLAVLERGAYTLVTFSAKNNTIVNKLVRVTKEGAEL--QLREVTVLGVATAP-TQVL--SNGIPVSNFTYSPD 932          
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Mouse
Match: Gaa (glucosidase, alpha, acid [Source:MGI Symbol;Acc:MGI:95609])

HSP 1 Score: 716.457 bits (1848), Expect = 0.000e+0
Identity = 364/873 (41.70%), Postives = 524/873 (60.02%), Query Frame = 3
Query:  312 ATAQCQIANNNERLDCYPESGANQDSCIARGCCWSEPMRLSNKLQGVPLSIPYCYYPTDYSNYMIKSLRKSSRGIKAKLVRESPSYLPYEVAMLDLEVIYETKSRTRVRITDPKQKRYEVPMKLSPPDLKPPTDREYEVIIPSDGSFSIEIKRKSDDRSLF-KSFGPLLYSDQFLQISSIMSTDQIYGIGEQNRPFLHQLSNGWERIGLWARDNPIETFMNLYGAHPFYIGMPDDGKAFGVFHFNSNGQEFALQPAPAVTYRTIGGILDFFIFTGGSPEETVKQYLELVGKPMLPPYWSLGFHLSKWGYKNIEQLSEIFQRNINAGFPIGTQWSDIDYMENYKDFTVDKEKFNGLGRFVREIKQKYNSRFVAIVDPGISCTS-GNEYPPYYEGVFMDIFIKDSQTNQPIVGKVWPGETVYPDFTHPNISMYWYKQIQRFYNDVPIDGLWIDMNEPSNFYDGSKRGCQGNSKYDNPFFVPDIRDQSLISKTICSSALHYNNEKHYNLHNLYGYTESVTTNKALLKTIHGKRPFILSRSTFSGSGKYTFHWTGDNQASWDQLRNSIRQVLNFNMFGIPMTGADICGFNGNSDEELCIRWMQLGAFYPFMRNHNAINQRDQDPASWNTEAQKIMKTAISNRYAMLPLFYTLLVKSHMNGGTVMRPMSFEFFSDKVTHSIELQFMIGSSIMATPVVYPGARSVDAYFPAGVWYDFHS------GKLLHS----------DAEGAWLTLDAPLDKINIALRGGHIVPLLDSNRNSKSNIPNKMTLYCGMAQDMSASGDLYWDDGESIDSYSRNRYSYVSFNASPEQL---LITPVYFGYDLLPVLNKIVILGFENKSITKFLLNDNDIP---FHYNPE 2858
            A  QC +  ++ R DC P+ G +Q+ C ARGCC+    ++  + Q   +  P+C++P  Y +Y +++L  +  G  A L R SP++ P +V  L LEV+ ET SR   +I DP  KRYEVP++ +P  L       Y V   S+  F + ++RK   R L   +  PL ++DQFLQ+S+ + +  I G+GE   P +  LS  W RI LW RD P     NLYG+HPFY+ + D G A GVF  NSN  +  LQP+PA+T+R+ GGILD ++F G  P+  V+QYL++VG P +PPYW LGFHL +WGY +   + ++ +      FP+  QW+D+DYM+  +DFT +++ F      VRE+ Q    R++ IVDP IS       Y PY EG+   +FI + +T QP++GKVWPG T +PDFT+P    +W   +  F+  VP DG+W+DMNEPSNF  GS++GC  N++ +NP +VP +    L + TIC+S+ H     HYNLHNLYG TE++ +++AL+KT  G RPF++SRSTFSG G+Y  HWTGD ++SW+ L  S+  +L FN+ G+P+ GADICGF G++ EELC+RW QLGAFYPFMRNHN +N   Q+P  ++  AQ+ M+ A + RYA+LP  YTL  ++H+ G TV RP+  EF  D  T S++ Q + G +++ TPV+ PG   V  YFP G WY+         G L              ++G WLTL+APLD IN+ LR G+I+PL   +  +  +    M L   +     A G+L+WDDGES+    R  Y+ V+F+A    +   L+     G +L   L ++ +LG      T+ L   N IP   F Y+P+
Sbjct:   78 APTQCDVPPSS-RFDCAPDKGISQEQCEARGCCYVPAGQVLKEPQ---IGQPWCFFPPSYPSYRLENLSSTESGYTATLTRTSPTFFPKDVLTLQLEVLMETDSRLHFKIKDPASKRYEVPLE-TPRVLSQAPSPLYSVEF-SEEPFGVIVRRKLGGRVLLNTTVAPLFFADQFLQLSTSLPSQHITGLGEHLSPLM--LSTDWARITLWNRDTPPSQGTNLYGSHPFYLALEDGGLAHGVFLLNSNAMDVILQPSPALTWRSTGGILDVYVFLGPEPKSVVQQYLDVVGYPFMPPYWGLGFHLCRWGYSSTAIVRQVVENMTRTHFPLDVQWNDLDYMDARRDFTFNQDSFADFPDMVRELHQD-GRRYMMIVDPAISSAGPAGSYRPYDEGLRRGVFITN-ETGQPLIGKVWPGTTAFPDFTNPETLDWWQDMVSEFHAQVPFDGMWLDMNEPSNFVRGSQQGCP-NNELENPPYVPGVVGGILQAATICASS-HQFLSTHYNLHNLYGLTEAIASSRALVKT-RGTRPFVISRSTFSGHGRYAGHWTGDVRSSWEHLAYSVPDILQFNLLGVPLVGADICGFIGDTSEELCVRWTQLGAFYPFMRNHNDLNSVPQEPYRFSETAQQAMRKAFALRYALLPYLYTLFHRAHVRGDTVARPLFLEFPEDPSTWSVDRQLLWGPALLITPVLEPGKTEVTGYFPKGTWYNMQMVSVDSLGTLPSPSSASSFRSAVQSKGQWLTLEAPLDTINVHLREGYIIPLQGPSLTTTESRKQPMALAVALTASGEADGELFWDDGESLAVLERGAYTLVTFSAKNNTIVNKLVRVTKEGAEL--QLREVTVLGVATAP-TQVL--SNGIPVSNFTYSPD 932          
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Mouse
Match: Mgam (maltase-glucoamylase [Source:MGI Symbol;Acc:MGI:1203495])

HSP 1 Score: 643.269 bits (1658), Expect = 0.000e+0
Identity = 341/814 (41.89%), Postives = 495/814 (60.81%), Query Frame = 3
Query:  324 CQIANNNERLDCYPESGANQDSCIARGCCWSEPMRLSNKLQGVPLSIPYCYYPTDYSNYMIKSLRKSSRGIKAKLVRESPSYLPY--EVAMLDLEVIYETKSRTRVRITDPKQKRYEVPMK-LSPPDLKPPTDREYEVIIPSDGSFSIEIKRKSDDRSLF-KSFGPLLYSDQFLQISSIMSTDQIYGIGEQ-NRPFLHQLSNGWERIGLWARDN-PIETFMNLYGAHPFYIGMPDD-GKAFGVFHFNSNGQEFALQPAPAVTYRTIGGILDFFIFTGGSPEETVKQYLELVGKPMLPPYWSLGFHLSKWGYKNIEQLSEIFQRNINAGFPIGTQWSDIDYMENYKDFTVDKEKFNGLGRFVREIKQKYNSRFVAIVDPGISCTS--GNEYPPYYEGVFMDIFIKDSQTNQPIVGKVWPGETVYPDFTHPNISMYWYKQIQRFYNDVPIDGLWIDMNEPSNFYDGSKRGCQGNSKYDNPFFVPDIRDQSLISKTICSSALHYNNEKHYNLHNLYGYTESVTTNKALLKTIHGKRPFILSRSTFSGSGKYTFHWTGDNQASWDQLRNSIRQVLNFNMFGIPMTGADICGFNGNSDEELCIRWMQLGAFYPFMRNHNAINQRDQDPASW--NTEAQKIMKTAISNRYAMLPLFYTLLVKSHMNGGTVMRPMSFEFFSDKVTHSIELQFMIGSSIMATPVVYPGARSVDAYFPAGVWYDFHSGKLLHSDAEGAWLTLDAPLDKINIALRGGHIVPLLDSNRNSKSNIPNKMTLYCGMAQDMSASGDLYWDDGESIDSYSRNRYSYVSFNASPEQLLIT 2732
            C + +  ER++C P+  +N+ +C  RGCCW          QG  +S+P CYY  ++   M   +  ++ G  A L +  PS   +   +  + L   Y+T +R   ++TD  +KRYEVP + + P     P+   Y+V + S   FSI++ RKS++R LF  S GPLL+SDQFLQ S+ + +  +YG+GE  ++ + H ++  W+   +++RD  P E   NLYG   F++ + D+ G +FGVF  NSN  E  LQP PA+TYRT GGILDF++F G +PE+ V++YLEL+G+P LP YW+LGF LS++ YK+++ +  + +RN  A  P   Q +DIDYM+  KDFT D   F G   FV+E+      + V I+DP IS  S   N Y PY  G  M I++  S    P++GKVWPG TV+PD+T PN +++W K+ + F+ +V  DG+WIDMNE SNF DGS  GC  N+  + P F P + D  L SKT+C  A+ +   K Y++HNLYGY+ ++ T KA+      KR FI++RSTF+GSGK+  HW GDN A+W  L+ SI  +L FN+FGIPM GADICGF  ++ EELC RWMQLGAFYPF RNHN    +DQDPAS+  N+      +  ++ RY +LP  YTL  ++H  G TV RP+  EF+ D  T  I+ QF+ G  ++ TPV+  GA  V AY P   WYD+ +G+ L    +   + +  P DKI + LRGG+I P       ++++  N + L   + ++  A G+L+WDDGES D+ ++N Y +  F+ +   L +T
Sbjct:   65 CPVLSELERINCIPDQSSNKGTCDERGCCWDP--------QG-SISVP-CYYSRNHGYKMESDVVNTNAGFTATL-KNLPSAPVFGNSIENILLTAEYQTSNRFHFKLTDQTKKRYEVPHEHVQPFSGNAPSSLNYKVEV-SKEPFSIKVTRKSNNRVLFDSSIGPLLFSDQFLQFSTHLPSANVYGLGEHVHQQYRHNMN--WKTWPMFSRDTTPNEDGTNLYGVQTFFLCLEDNSGLSFGVFLMNSNAMEVTLQPTPAITYRTTGGILDFYVFLGNTPEQVVQEYLELIGRPALPSYWTLGFQLSRYDYKSLDNMKAVVERNRAAQLPYDVQHADIDYMDQKKDFTYDPVNFKGFPEFVKELHNN-GQKLVIILDPAISNNSFSSNPYGPYDRGSAMKIWVNSSDGISPVIGKVWPGTTVFPDYTSPNCAVWWTKEFELFHKEVEFDGIWIDMNEVSNFIDGSFSGCSQNN-LNYPPFTPKVLDGYLFSKTLCMDAVQHWG-KQYDVHNLYGYSMAIATAKAVKDVFPDKRSFIITRSTFAGSGKFAAHWLGDNTATWKDLQWSIPGMLEFNLFGIPMVGADICGFAQDTYEELCRRWMQLGAFYPFSRNHNGQGYKDQDPASFGNNSLLLNSSRHYLNIRYTLLPYLYTLFYRAHSRGDTVARPLLHEFYDDNNTWGIDRQFLWGPGLLITPVLDQGAEKVKAYVPNATWYDYETGEELGWRKQS--IEMQLPGDKIGLHLRGGYIFPTQQPATTTEASRKNPLGLIVALDENKEARGELFWDDGESKDTVAQNIYLFSEFSVTQNHLDVT 859          

HSP 2 Score: 587.8 bits (1514), Expect = 0.000e+0
Identity = 327/896 (36.50%), Postives = 503/896 (56.14%), Query Frame = 3
Query:  345 ERLDCYP-ESGANQDSCIARGCCWSEPMRLSNKLQGVPLSIPYCYYPTDYSNYMIKSLRKSSRGIKAKLVRESPSY---LPYE-VAMLDLEVIYETKSRTRVRITDPKQKRYEVPMKLSPPD--LKPPTDREYEVIIPSDGSFSIEIKRKSDDRSLFKS-FGPLLYSDQFLQISSIMSTDQIYGIGEQNRPFLHQLSNGWERIGLWARDNPIETFMNLYGAHPFYIGMPDDGKAFGVFHFNSNGQEFALQPAPAVTYRTIGGILDFFIFTGGSPEETVKQYLELVGKPMLPPYWSLGFHLSKWGYKNIEQLSEIFQRNINAGFPIGTQWSDIDYMENYKDFTVDKEKFNGLGRFVREIKQKYNSRFVAIVDPGISCTSGNEYPPYYEGVFMDIFIKDSQTNQPIVGKVWP---------------------GETVYPDFTHPNISMYWYKQIQRFYND-------VPIDGLWIDMNEPSNFYDGSKRGCQGNSKYDNPFFVP--DIRDQSLISKTICSSALHY----NNEKHYNLHNLYGYTESVTTNKALLKTIHGKRPFILSRSTFSGSGKYTFHWTGDNQASWDQLRNSIRQVLNFNMFGIPMTGADICGFNGNSDEELCIRWMQLGAFYPFMRNHNAINQRDQDPASWNTEAQKIMKTAISNRYAMLPLFYTLLVKSHMNGGTVMRPMSFEFFSDKVTHSIELQFMIGSSIMATPVVYPGARSVDAYFPAGVWYDFHSGKLLHSDAEGAWLTLDAPLDKINIALRGGHIVPLLDSNRNSKSNIPNKMTLYCGMAQDMSASGDLYWDDGESIDSYSRNRYSYVSFNASPEQLL-----------ITPVYFGYDLLPVLNKIVILGFENKSITKFLL----NDNDIPFHYNPET 2861
            ER+DCYP E GA++ +C ARGC W      SN  +G P     CY+  +   Y + +++  S G  A +  ++ +Y    P   V  L L+V Y      + +I DP   RYEVP+ L+ P   L  P  R Y+V+I  +  F I+I+RK+    ++ S      ++D F++IS+ + +  IYG GE       ++   W   G+++RD P     N YG HP+Y+G+ +DG A GV   NSN  +   QP PA+TYRTIGGILDF++F G +PE   +QY EL+G+P++ PYWSLGF L ++GY+N  +++ ++   +    P   Q+SDIDYME   DF +   KF+G    +  +K     R + I+DP IS      YP +  GV  D+FI+       + GKVWP                         +PDF   + + +W K+I+  +++       +  DGLWIDMNEPS+F +G+      ++  ++P ++P  + RD+ L SKT+C  +       +  +HY++HNLYG++++  T +A+ + + G+R  +++RSTF  SG++  HW GDN A+WDQL  SI  +++F++FGI  TG+DICGF  +++ E+C+RWMQLGAFYPF RNHN I  R QDP SWN   + I ++ +  RY +LP  YTL+ K+H  G TV+RP+  EF SD+ T +I+ QF++G + + +PV+ P AR V+AYFP   WYD++ G  +  +A G W TL+APL+ IN+ +RGG+I+P  +   N+  +    M L   +  +  A G L+WDDG+ I++   ++Y    F+ +   LL             P+Y GY        I I G  + SIT   +    N+ ++  +YN  T
Sbjct:  936 ERIDCYPDEHGASEANCSARGCIWEA----SNTTRGPP-----CYFAHEL--YSVSNVQYDSHGATADISLKASTYSNAFPSTPVNKLKLQVTYHKNEMLQFKIYDPNHSRYEVPVPLNIPSAPLSTPEGRLYDVLI-KENPFGIQIRRKTTGTVIWDSQLLGFTFNDMFIRISTRLPSTYIYGFGETEHTTF-KIDMNWHTWGMFSRDEPPGYKKNSYGVHPYYMGLEEDGNAHGVLLMNSNAMDVTFQPMPALTYRTIGGILDFYVFLGPTPEIVTQQYTELIGRPVMVPYWSLGFQLCRYGYENDTEIANLYDEMVAKQIPYDVQYSDIDYMERQLDFKLSP-KFSGFPALINRMKAN-GMRVILILDPAISGNETEPYPAFTRGVENDVFIRYPNNGSIVWGKVWPDYPNITVDPSLGWDHQVEQYRAYVAFPDFFRNSTATWWKKEIKELHSNTQDPAKSLKFDGLWIDMNEPSSFVNGAVPSGCSDATLNHPPYMPYLEARDRGLSSKTLCMESEQILPDGSRVRHYDVHNLYGWSQTRPTYEAV-QEVTGERGIVITRSTFPSSGRWGGHWLGDNTAAWDQLGKSIIGMMDFSLFGISYTGSDICGFFQDAEYEMCVRWMQLGAFYPFSRNHNTIGTRRQDPVSWNKTFEDISRSVLETRYTLLPYLYTLMYKAHTEGSTVVRPLLHEFVSDRETWNIDKQFLLGPAFLVSPVLEPNARKVEAYFPRARWYDYYKG--VDINATGEWKTLEAPLEYINLHIRGGYILPWQEPAMNTHLSRQKFMGLRAALNAEGRAEGWLFWDDGKRINT---DQYYLARFSVNQTTLLTHEKFNNYLTGTAPLYLGY--------IDIWGLSSSSITNVSISWNTNNEEVFANYNSTT 1802          
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Mouse
Match: Mgam (maltase-glucoamylase [Source:MGI Symbol;Acc:MGI:1203495])

HSP 1 Score: 643.269 bits (1658), Expect = 0.000e+0
Identity = 341/814 (41.89%), Postives = 495/814 (60.81%), Query Frame = 3
Query:  324 CQIANNNERLDCYPESGANQDSCIARGCCWSEPMRLSNKLQGVPLSIPYCYYPTDYSNYMIKSLRKSSRGIKAKLVRESPSYLPY--EVAMLDLEVIYETKSRTRVRITDPKQKRYEVPMK-LSPPDLKPPTDREYEVIIPSDGSFSIEIKRKSDDRSLF-KSFGPLLYSDQFLQISSIMSTDQIYGIGEQ-NRPFLHQLSNGWERIGLWARDN-PIETFMNLYGAHPFYIGMPDD-GKAFGVFHFNSNGQEFALQPAPAVTYRTIGGILDFFIFTGGSPEETVKQYLELVGKPMLPPYWSLGFHLSKWGYKNIEQLSEIFQRNINAGFPIGTQWSDIDYMENYKDFTVDKEKFNGLGRFVREIKQKYNSRFVAIVDPGISCTS--GNEYPPYYEGVFMDIFIKDSQTNQPIVGKVWPGETVYPDFTHPNISMYWYKQIQRFYNDVPIDGLWIDMNEPSNFYDGSKRGCQGNSKYDNPFFVPDIRDQSLISKTICSSALHYNNEKHYNLHNLYGYTESVTTNKALLKTIHGKRPFILSRSTFSGSGKYTFHWTGDNQASWDQLRNSIRQVLNFNMFGIPMTGADICGFNGNSDEELCIRWMQLGAFYPFMRNHNAINQRDQDPASW--NTEAQKIMKTAISNRYAMLPLFYTLLVKSHMNGGTVMRPMSFEFFSDKVTHSIELQFMIGSSIMATPVVYPGARSVDAYFPAGVWYDFHSGKLLHSDAEGAWLTLDAPLDKINIALRGGHIVPLLDSNRNSKSNIPNKMTLYCGMAQDMSASGDLYWDDGESIDSYSRNRYSYVSFNASPEQLLIT 2732
            C + +  ER++C P+  +N+ +C  RGCCW          QG  +S+P CYY  ++   M   +  ++ G  A L +  PS   +   +  + L   Y+T +R   ++TD  +KRYEVP + + P     P+   Y+V + S   FSI++ RKS++R LF  S GPLL+SDQFLQ S+ + +  +YG+GE  ++ + H ++  W+   +++RD  P E   NLYG   F++ + D+ G +FGVF  NSN  E  LQP PA+TYRT GGILDF++F G +PE+ V++YLEL+G+P LP YW+LGF LS++ YK+++ +  + +RN  A  P   Q +DIDYM+  KDFT D   F G   FV+E+      + V I+DP IS  S   N Y PY  G  M I++  S    P++GKVWPG TV+PD+T PN +++W K+ + F+ +V  DG+WIDMNE SNF DGS  GC  N+  + P F P + D  L SKT+C  A+ +   K Y++HNLYGY+ ++ T KA+      KR FI++RSTF+GSGK+  HW GDN A+W  L+ SI  +L FN+FGIPM GADICGF  ++ EELC RWMQLGAFYPF RNHN    +DQDPAS+  N+      +  ++ RY +LP  YTL  ++H  G TV RP+  EF+ D  T  I+ QF+ G  ++ TPV+  GA  V AY P   WYD+ +G+ L    +   + +  P DKI + LRGG+I P       ++++  N + L   + ++  A G+L+WDDGES D+ ++N Y +  F+ +   L +T
Sbjct:   65 CPVLSELERINCIPDQSSNKGTCDERGCCWDP--------QG-SISVP-CYYSRNHGYKMESDVVNTNAGFTATL-KNLPSAPVFGNSIENILLTAEYQTSNRFHFKLTDQTKKRYEVPHEHVQPFSGNAPSSLNYKVEV-SKEPFSIKVTRKSNNRVLFDSSIGPLLFSDQFLQFSTHLPSANVYGLGEHVHQQYRHNMN--WKTWPMFSRDTTPNEDGTNLYGVQTFFLCLEDNSGLSFGVFLMNSNAMEVTLQPTPAITYRTTGGILDFYVFLGNTPEQVVQEYLELIGRPALPSYWTLGFQLSRYDYKSLDNMKAVVERNRAAQLPYDVQHADIDYMDQKKDFTYDPVNFKGFPEFVKELHNN-GQKLVIILDPAISNNSFSSNPYGPYDRGSAMKIWVNSSDGISPVIGKVWPGTTVFPDYTSPNCAVWWTKEFELFHKEVEFDGIWIDMNEVSNFIDGSFSGCSQNN-LNYPPFTPKVLDGYLFSKTLCMDAVQHWG-KQYDVHNLYGYSMAIATAKAVKDVFPDKRSFIITRSTFAGSGKFAAHWLGDNTATWKDLQWSIPGMLEFNLFGIPMVGADICGFAQDTYEELCRRWMQLGAFYPFSRNHNGQGYKDQDPASFGNNSLLLNSSRHYLNIRYTLLPYLYTLFYRAHSRGDTVARPLLHEFYDDNNTWGIDRQFLWGPGLLITPVLDQGAEKVKAYVPNATWYDYETGEELGWRKQS--IEMQLPGDKIGLHLRGGYIFPTQQPATTTEASRKNPLGLIVALDENKEARGELFWDDGESKDTVAQNIYLFSEFSVTQNHLDVT 859          

HSP 2 Score: 587.8 bits (1514), Expect = 0.000e+0
Identity = 327/896 (36.50%), Postives = 503/896 (56.14%), Query Frame = 3
Query:  345 ERLDCYP-ESGANQDSCIARGCCWSEPMRLSNKLQGVPLSIPYCYYPTDYSNYMIKSLRKSSRGIKAKLVRESPSY---LPYE-VAMLDLEVIYETKSRTRVRITDPKQKRYEVPMKLSPPD--LKPPTDREYEVIIPSDGSFSIEIKRKSDDRSLFKS-FGPLLYSDQFLQISSIMSTDQIYGIGEQNRPFLHQLSNGWERIGLWARDNPIETFMNLYGAHPFYIGMPDDGKAFGVFHFNSNGQEFALQPAPAVTYRTIGGILDFFIFTGGSPEETVKQYLELVGKPMLPPYWSLGFHLSKWGYKNIEQLSEIFQRNINAGFPIGTQWSDIDYMENYKDFTVDKEKFNGLGRFVREIKQKYNSRFVAIVDPGISCTSGNEYPPYYEGVFMDIFIKDSQTNQPIVGKVWP---------------------GETVYPDFTHPNISMYWYKQIQRFYND-------VPIDGLWIDMNEPSNFYDGSKRGCQGNSKYDNPFFVP--DIRDQSLISKTICSSALHY----NNEKHYNLHNLYGYTESVTTNKALLKTIHGKRPFILSRSTFSGSGKYTFHWTGDNQASWDQLRNSIRQVLNFNMFGIPMTGADICGFNGNSDEELCIRWMQLGAFYPFMRNHNAINQRDQDPASWNTEAQKIMKTAISNRYAMLPLFYTLLVKSHMNGGTVMRPMSFEFFSDKVTHSIELQFMIGSSIMATPVVYPGARSVDAYFPAGVWYDFHSGKLLHSDAEGAWLTLDAPLDKINIALRGGHIVPLLDSNRNSKSNIPNKMTLYCGMAQDMSASGDLYWDDGESIDSYSRNRYSYVSFNASPEQLL-----------ITPVYFGYDLLPVLNKIVILGFENKSITKFLL----NDNDIPFHYNPET 2861
            ER+DCYP E GA++ +C ARGC W      SN  +G P     CY+  +   Y + +++  S G  A +  ++ +Y    P   V  L L+V Y      + +I DP   RYEVP+ L+ P   L  P  R Y+V+I  +  F I+I+RK+    ++ S      ++D F++IS+ + +  IYG GE       ++   W   G+++RD P     N YG HP+Y+G+ +DG A GV   NSN  +   QP PA+TYRTIGGILDF++F G +PE   +QY EL+G+P++ PYWSLGF L ++GY+N  +++ ++   +    P   Q+SDIDYME   DF +   KF+G    +  +K     R + I+DP IS      YP +  GV  D+FI+       + GKVWP                         +PDF   + + +W K+I+  +++       +  DGLWIDMNEPS+F +G+      ++  ++P ++P  + RD+ L SKT+C  +       +  +HY++HNLYG++++  T +A+ + + G+R  +++RSTF  SG++  HW GDN A+WDQL  SI  +++F++FGI  TG+DICGF  +++ E+C+RWMQLGAFYPF RNHN I  R QDP SWN   + I ++ +  RY +LP  YTL+ K+H  G TV+RP+  EF SD+ T +I+ QF++G + + +PV+ P AR V+AYFP   WYD++ G  +  +A G W TL+APL+ IN+ +RGG+I+P  +   N+  +    M L   +  +  A G L+WDDG+ I++   ++Y    F+ +   LL             P+Y GY        I I G  + SIT   +    N+ ++  +YN  T
Sbjct:  936 ERIDCYPDEHGASEANCSARGCIWEA----SNTTRGPP-----CYFAHEL--YSVSNVQYDSHGATADISLKASTYSNAFPSTPVNKLKLQVTYHKNEMLQFKIYDPNHSRYEVPVPLNIPSAPLSTPEGRLYDVLI-KENPFGIQIRRKTTGTVIWDSQLLGFTFNDMFIRISTRLPSTYIYGFGETEHTTF-KIDMNWHTWGMFSRDEPPGYKKNSYGVHPYYMGLEEDGNAHGVLLMNSNAMDVTFQPMPALTYRTIGGILDFYVFLGPTPEIVTQQYTELIGRPVMVPYWSLGFQLCRYGYENDTEIANLYDEMVAKQIPYDVQYSDIDYMERQLDFKLSP-KFSGFPALINRMKAN-GMRVILILDPAISGNETEPYPAFTRGVENDVFIRYPNNGSIVWGKVWPDYPNITVDPSLGWDHQVEQYRAYVAFPDFFRNSTATWWKKEIKELHSNTQDPAKSLKFDGLWIDMNEPSSFVNGAVPSGCSDATLNHPPYMPYLEARDRGLSSKTLCMESEQILPDGSRVRHYDVHNLYGWSQTRPTYEAV-QEVTGERGIVITRSTFPSSGRWGGHWLGDNTAAWDQLGKSIIGMMDFSLFGISYTGSDICGFFQDAEYEMCVRWMQLGAFYPFSRNHNTIGTRRQDPVSWNKTFEDISRSVLETRYTLLPYLYTLMYKAHTEGSTVVRPLLHEFVSDRETWNIDKQFLLGPAFLVSPVLEPNARKVEAYFPRARWYDYYKG--VDINATGEWKTLEAPLEYINLHIRGGYILPWQEPAMNTHLSRQKFMGLRAALNAEGRAEGWLFWDDGKRINT---DQYYLARFSVNQTTLLTHEKFNNYLTGTAPLYLGY--------IDIWGLSSSSITNVSISWNTNNEEVFANYNSTT 1802          
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Mouse
Match: Sis (sucrase isomaltase (alpha-glucosidase) [Source:MGI Symbol;Acc:MGI:1917233])

HSP 1 Score: 636.336 bits (1640), Expect = 0.000e+0
Identity = 340/845 (40.24%), Postives = 509/845 (60.24%), Query Frame = 3
Query:  342 NERLDCYPESGANQDSCIARGCCWSEPMRLSNKLQGVPLSIPYCYYPTDYSNYMIKSLRKSSRGIKAKLVR-ESPSYLPYEVAMLDLEVIYETKSRTRVRITDPKQKRYEVPMK-LSPPDLKPPTDREYEVIIPSDGSFSIEIKRKSDDRSLF-KSFGPLLYSDQFLQISSIMSTDQIYGIGEQ-NRPFLHQLSNGWERIGLWARDN-PIETFMNLYGAHPFYIGMPDD-GKAFGVFHFNSNGQEFALQPAPAVTYRTIGGILDFFIFTGGSPEETVKQYLELVGKPMLPPYWSLGFHLSKWGYKNIEQLSEIFQRNINAGFPIGTQWSDIDYMENYKDFTVDKEKFNGLGRFVREIKQKYNSRFVAIVDPGISC---TSGNEYPPYYEGVFMDIFIKDSQTNQPIVGKVWPGETVYPDFTHPNISMYWYKQIQRFYNDVPIDGLWIDMNEPSNFYDGSKRGCQGNSKYDNPFFVPDIRDQSLISKTICSSAL-HYNNEKHYNLHNLYGYTESVTTNKALLKTIHGKRPFILSRSTFSGSGKYTFHWTGDNQASWDQLRNSIRQVLNFNMFGIPMTGADICGFNGNSDEELCIRWMQLGAFYPFMRNHNAINQRDQDPASWNTEAQKI--MKTAISNRYAMLPLFYTLLVKSHMNGGTVMRPMSFEFFSDKVTHSIELQFMIGSSIMATPVVYPGARSVDAYFPAGVWYDFHSGKLLHSDAEGAWLTLDAPLDKINIALRGGHIVPLLDSNRNSKSNIPNKMTLYCGMAQDMSASGDLYWDDGESIDSYSRNRYSYVSFNASPEQLLITPVYFGYDL--LPVLNKIVILGFENKSITKFLLNDND 2834
            NER++C PE    +  C  RGCCW      +N +      IP+C++  D   Y   S+   + G+KA L R  SP+    ++  + L    +T++R R ++TDP  KRYEVP + +   +  P  D  Y+V + S+  FSI++ RKS+++ LF  S GPL+YS+Q+LQIS+ + ++ IYG GE  ++ F H L   W+   ++ RD  P +   NLYG   F++G+ D+ GK++GVF  NSN  E  +QP P +TYR  GG+LDF+IF G +PE+ V+QY EL+G+P +P YW+LGF LS+W Y +++++ E+ +RN  AG P   Q +DIDYME+ KDFT D+  F GL  F +++   +  +++ I+DP IS     +G EY  Y  G   ++++K+S     ++G+VWPG TVYPDFT+P    +W  +   F+  V  DGLWIDMNE S+F  GS++GC  N   + P F P I D+ + SKT+C  A+ H+ N+  Y++H+LYGY+ ++ T KA+ K    KR FIL+RSTF+GSG +  HW GDN ASW+Q+  SI  +L F MFG+P+ GADICGF  N+ EELC RWMQLGAFYPF RNHNA    +QDPA W  ++  +   +  ++ RY +LP  YTL  ++H  G TV RP   EF+ D  +   + QF+ G +++ TPV+ P  + V AY P   WYD+ +G+      +   + L  P DKI + LRGG+I+P    +  + ++  N + L   + ++ +A G+L+WDDGES D+  +  Y    F+ S   L++   +  Y      V   I +LG  + ++T   + +ND
Sbjct:   62 NERINCIPEQHPTKAKCEERGCCWRP---WNNTI------IPWCFF-ADNHGYTAASVTNDNSGLKATLSRIPSPTLFGEDIKSVLLTTQSQTRNRFRFKLTDPNNKRYEVPHQFVKDGNGIPAADTLYDVKV-SENPFSIKVIRKSNNKVLFDTSIGPLVYSNQYLQISTRLPSEYIYGFGEHIHKRFRHDLY--WKTWPIFTRDEIPGDNNHNLYGHQTFFMGIEDNSGKSYGVFLMNSNAMEVFIQPTPIITYRVTGGVLDFYIFLGDTPEQVVQQYQELIGRPAMPAYWNLGFQLSRWNYVSLDKVKEVVRRNREAGIPYDAQVTDIDYMEDKKDFTYDEVAFKGLPEFAQDL-HNHGQKYIIILDPAISINKRANGAEYQTYVRGNEQNVWVKESDGTTSLIGEVWPGLTVYPDFTNPRTWEWWANECNLFHQQVEYDGLWIDMNEVSSFIHGSQKGCAPN-LLNYPPFTPGILDKIMYSKTLCMDAVQHWGNQ--YDVHSLYGYSMAIATEKAVEKVFPNKRSFILTRSTFAGSGHHAAHWLGDNTASWEQMEWSITGMLEFGMFGMPLVGADICGFLANTTEELCRRWMQLGAFYPFSRNHNAEGYAEQDPAFWGADSLLVNTSRHYLTIRYTLLPFLYTLFYRAHAFGETVARPFLHEFYEDPNSWIEDTQFLWGPALLITPVLRPETKYVSAYIPDATWYDYETGEKRPWRKQRVDMYL--PEDKIGLHLRGGYIIPTQQPDVTTTASRKNPLGLIVALDENQAAKGELFWDDGESKDTIEKKIYILYEFSVSNNNLIVNCTHSSYPEGNTLVFKTIKVLGL-SATVTAVTVGEND 886          

HSP 2 Score: 602.823 bits (1553), Expect = 0.000e+0
Identity = 322/844 (38.15%), Postives = 488/844 (57.82%), Query Frame = 3
Query:  327 QIANNNERLDCYPESG-ANQDSCIARGCCWSEPMRLSNKLQGVPLSIPYCYYPTDYSNYMIKSLRKSSRGIKAKLVRESPSY---LPYE-VAMLDLEVIYETKSRTRVRITDPKQKRYEVPMKLSPPDLKPPTD--REYEVIIPSDGSFSIEIKRKSDDRSLFKSFGP-LLYSDQFLQISSIMSTDQIYGIGEQNRPFLHQLSNGWERIGLWARDNPIETFMNLYGAHPFYIGMPDDGKAFGVFHFNSNGQEFALQPAPAVTYRTIGGILDFFIFTGGSPEETVKQYLELVGKPMLPPYWSLGFHLSKWGYKNIEQLSEIFQRNINAGFPIGTQWSDIDYMENYKDFTVDKEKFNGLGRFVREIKQKYNSRFVAIVDPGISCTSGNEYPPYYEGVFMDIFIKDSQTNQPIVGKVWP---------------------GETVYPDFTHPNISMYWYKQIQRFYND-VPIDGLWIDMNEPSNFYDGSKRGCQGNSKYDNPFFVPDI--RDQSLISKTICSSALHYNNEK----HYNLHNLYGYTESVTTNKALLKTIHGKRPFILSRSTFSGSGKYTFHWTGDNQASWDQLRNSIRQVLNFNMFGIPMTGADICGFNGNSDEELCIRWMQLGAFYPFMRNHNAINQRDQDPASWNTEAQKIMKTAISNRYAMLPLFYTLLVKSHMNGGTVMRPMSFEFFSDKVTHSIELQFMIGSSIMATPVVYPGARSVDAYFPAGVWYDFHSGKLLHSDAEGAWLTLDAPLDKINIALRGGHIVPLLDSNRNSKSNIPNKMTLYCGMAQDMSASGDLYWDDGESIDSYSRNRYSYVSFNASPEQLLITPVYFGY 2750
            Q  ++NE+  CYP+ G A + +C+ RGC W     L+N        +P CY+P++++ Y++ S +K + GI A+L     S    LP   ++ L +EV Y      + +I D   KRYEVP+ L+ PD    ++  R Y+V I  +  F I+++R+S  + ++ S  P   ++DQF+QIS+ + +  +YG GE       +  N W   G++ RD P    +N YG HP+Y+ + D+G A GV   NSNG +   QP PA+TYRTIGGILDF++F G +PE   KQY E++G P++PPYW+LGF L ++GY+N  ++ +++     A  P   Q++DI+YME   DFT+  E+F  L +FV +I+ K   +++ I+DP IS      YP +  G+  D+F+K   TN     KVWP                         +PDF   + S +W ++I  FYN+ +  DGLWIDMNEPS+F +G+      N   + P + P++  R++ L  +T+C    H  ++     HY++HNLYG+++   T  AL  T  G R  ++SRST+  +G++  HW GDN A+W+ L  S+  +L FN+FGIP  GADICGF  +S+  LC RWMQ+GAFYP+ RNHN    R QDP SWN    ++ K  +  RY +LP FYT + ++H++GGTV+RP+  EFF DK T  I  QF+ G + M TPV+ P   +V+ Y P   W+D+H+G+ +     G   T  AP D IN+ +RGG+I+P  +  +N+  +    M L      + +A G L+WDDGESID+Y +N+Y+ + FN + + L  T +  GY
Sbjct:  924 QSFSDNEKFTCYPDVGTATEKTCVERGCIWEPVSGLAN--------VPPCYFPSNHNPYLLTSTQKLATGITAELQLNPASARIKLPSNPISTLRVEVKYHKNDMLQFKIYDAHHKRYEVPVPLNIPDTPTSSEENRLYDVEI-KENPFGIQVRRRSTGKLIWDSCLPGFAFNDQFIQISTRLPSQYLYGFGEAEHTAFKRNLN-WHTWGMFTRDQPPGYKLNSYGFHPYYMALEDEGNAHGVLLQNSNGMDVTFQPTPALTYRTIGGILDFYMFLGPTPEGATKQYHEVIGFPVMPPYWALGFQLCRYGYRNTSEIEQLYNDMKAAQIPYDVQYTDINYMERQLDFTIG-ERFKTLPQFVEKIR-KEGMKYIVILDPAISGNETQPYPAFERGIQKDVFVKWPNTNDICWAKVWPDLPNITIDETITEDEAVNASRAHVAFPDFFRNSTSEWWTREIYDFYNEKMKFDGLWIDMNEPSSFVNGTVTNKCRNDTLNYPPYFPELTKRNEGLHFRTMCMETEHILSDGSSVLHYDVHNLYGWSQVKPTLDALRNTT-GLRGIVISRSTYPTAGRWGGHWLGDNYANWENLEKSLIGMLEFNLFGIPYVGADICGFFNDSEYHLCARWMQVGAFYPYSRNHNIQFTRRQDPVSWNETFAQMSKKVLEIRYTLLPYFYTQMHEAHIHGGTVIRPLMHEFFDDKETWEIYKQFLWGPAFMVTPVIGPFQTAVNGYVPKARWFDYHTGEDI--KVRGKLQTFSAPFDTINLHVRGGYILPCQEPAQNTYYSRQKYMKLIVAADDNQTAKGTLFWDDGESIDTYEKNQYTLIEFNLNQKNLTSTVLKDGY 1752          
BLAST of Lysosomal alpha-glucosidase vs. UniProt
Match: sp|Q6P7A9|LYAG_RAT (Lysosomal alpha-glucosidase OS=Rattus norvegicus GN=Gaa PE=2 SV=1)

HSP 1 Score: 721.465 bits (1861), Expect = 0.000e+0
Identity = 365/871 (41.91%), Postives = 524/871 (60.16%), Query Frame = 3
Query:  318 AQCQIANNNERLDCYPESGANQDSCIARGCCWSEPMRLSNKLQGVPLSIPYCYYPTDYSNYMIKSLRKSSRGIKAKLVRESPSYLPYEVAMLDLEVIYETKSRTRVRITDPKQKRYEVPMKLSPPDLKPPTDREYEVIIPSDGSFSIEIKRKSDDRSLF-KSFGPLLYSDQFLQISSIMSTDQIYGIGEQNRPFLHQLSNGWERIGLWARDNPIETFMNLYGAHPFYIGMPDDGKAFGVFHFNSNGQEFALQPAPAVTYRTIGGILDFFIFTGGSPEETVKQYLELVGKPMLPPYWSLGFHLSKWGYKNIEQLSEIFQRNINAGFPIGTQWSDIDYMENYKDFTVDKEKFNGLGRFVREIKQKYNSRFVAIVDPGISCTS-GNEYPPYYEGVFMDIFIKDSQTNQPIVGKVWPGETVYPDFTHPNISMYWYKQIQRFYNDVPIDGLWIDMNEPSNFYDGSKRGCQGNSKYDNPFFVPDIRDQSLISKTICSSALHYNNEKHYNLHNLYGYTESVTTNKALLKTIHGKRPFILSRSTFSGSGKYTFHWTGDNQASWDQLRNSIRQVLNFNMFGIPMTGADICGFNGNSDEELCIRWMQLGAFYPFMRNHNAINQRDQDPASWNTEAQKIMKTAISNRYAMLPLFYTLLVKSHMNGGTVMRPMSFEFFSDKVTHSIELQFMIGSSIMATPVVYPGARSVDAYFPAGVWYDFH------------------SGKLLHSDAEGAWLTLDAPLDKINIALRGGHIVPLLDSNRNSKSNIPNKMTLYCGMAQDMSASGDLYWDDGESIDSYSRNRYSYVSFNASPEQLLITPVYF---GYDLLPVLNKIVILGFENKSITKFLLNDNDIP-FHYNPE 2858
             QC +  N+ R DC P+ G  Q+ C ARGCCW   +     L G  +  P+C++P  Y +Y +++L  +  G  A L R SP++ P +V  L LEV+ ET SR    I DP  KRYEVP++ +P  L       Y V   S+  F + ++RK   R L   +  PL ++DQFLQ+S+ + +  I G+GE   P +  LS  W RI LW RD      +NLYG+HPFY+ + D G A GVF  NSN  +  LQP+PA+T+R+ GGILD ++F G  P+  V+QYL++VG P +PPYW LGFHL +WGY +   + ++ +      FP+  QW+D+DYM+  +DFT +++ F      V E+ Q    R++ IVDP IS +     Y PY EG+   +FI + +T QP++GKVWPG T +PDFT+P    +W   +  F+  VP DG+WIDMNEPSNF  GS++GC  N + +NP +VP +   +L + TIC+S+ H     HYNLHNLYG TE++ +++AL+KT  G RPF++SRSTF+G G+Y  HWTGD  +SW+ L  S+ ++L FN+ G+P+ GADICGF GN+ EELC+RW QLGAFYPFMRNHN +N   Q+P  ++  AQ+ M+ A + RYA+LP  YTL   +H+ G TV RP+  EF  D  T S++ Q + G +++ TPV+ PG   V  YFP G+WY+                       ++HS  +G WLTL+APLD IN+ LR G+I+PL   +  +  +    M L   + +   ASG+L+WDDGES+    R  Y+ V+F+A    ++   V+    G +L   L ++ ILG    + T+ L N   +  F Y+P+
Sbjct:   80 TQCDVTPNS-RFDCAPDKGITQEQCEARGCCW---VPAGQVLNGPVMGQPWCFFPPSYPSYRLENLSSTESGYTATLTRTSPTFFPKDVLTLQLEVLMETDSRLHFMIKDPTSKRYEVPLE-TPRVLSQAPSPLYSVEF-SEEPFGVIVRRKLGGRVLLNTTVAPLFFADQFLQLSTSLPSQHIAGLGEHLSPLM--LSTEWTRITLWNRDVAPSQGVNLYGSHPFYLALEDGGLAHGVFLLNSNAMDVVLQPSPALTWRSTGGILDVYVFLGPEPKSVVQQYLDVVGYPFMPPYWGLGFHLCRWGYSSTAIVRQVVENMTRTHFPLDVQWNDLDYMDARRDFTFNQDGFADFPDMVHELHQG-GRRYMMIVDPAISSSGPAGSYRPYDEGLRRGVFITN-ETGQPLIGKVWPGSTAFPDFTNPETLDWWQDMVSEFHAQVPFDGMWIDMNEPSNFIRGSQQGCPDN-ELENPPYVPGVVGGALQAATICASS-HQFLSTHYNLHNLYGLTEAIASSRALVKT-RGTRPFVISRSTFAGHGRYAGHWTGDVWSSWEHLAYSVPEILQFNLLGVPLVGADICGFQGNTTEELCVRWTQLGAFYPFMRNHNDLNSLPQEPYRFSETAQQAMRKAFTLRYALLPYLYTLFHGAHVKGDTVARPLFLEFPEDPSTWSVDRQLLWGPALLITPVLEPGKTDVTGYFPKGMWYNLQMVPVETLGSLPSSSPASSFRSIVHS--KGQWLTLEAPLDTINVHLRAGYIIPLQGPSLTTTESRKQPMALAVALTESGEASGELFWDDGESLGVLERGAYTLVTFSAKNNTIVNKLVHVTKEGGEL--QLREVTILGV-TTAPTQVLSNGISVSNFTYSPD 932          
BLAST of Lysosomal alpha-glucosidase vs. UniProt
Match: sp|P70699|LYAG_MOUSE (Lysosomal alpha-glucosidase OS=Mus musculus GN=Gaa PE=1 SV=2)

HSP 1 Score: 716.457 bits (1848), Expect = 0.000e+0
Identity = 364/873 (41.70%), Postives = 524/873 (60.02%), Query Frame = 3
Query:  312 ATAQCQIANNNERLDCYPESGANQDSCIARGCCWSEPMRLSNKLQGVPLSIPYCYYPTDYSNYMIKSLRKSSRGIKAKLVRESPSYLPYEVAMLDLEVIYETKSRTRVRITDPKQKRYEVPMKLSPPDLKPPTDREYEVIIPSDGSFSIEIKRKSDDRSLF-KSFGPLLYSDQFLQISSIMSTDQIYGIGEQNRPFLHQLSNGWERIGLWARDNPIETFMNLYGAHPFYIGMPDDGKAFGVFHFNSNGQEFALQPAPAVTYRTIGGILDFFIFTGGSPEETVKQYLELVGKPMLPPYWSLGFHLSKWGYKNIEQLSEIFQRNINAGFPIGTQWSDIDYMENYKDFTVDKEKFNGLGRFVREIKQKYNSRFVAIVDPGISCTS-GNEYPPYYEGVFMDIFIKDSQTNQPIVGKVWPGETVYPDFTHPNISMYWYKQIQRFYNDVPIDGLWIDMNEPSNFYDGSKRGCQGNSKYDNPFFVPDIRDQSLISKTICSSALHYNNEKHYNLHNLYGYTESVTTNKALLKTIHGKRPFILSRSTFSGSGKYTFHWTGDNQASWDQLRNSIRQVLNFNMFGIPMTGADICGFNGNSDEELCIRWMQLGAFYPFMRNHNAINQRDQDPASWNTEAQKIMKTAISNRYAMLPLFYTLLVKSHMNGGTVMRPMSFEFFSDKVTHSIELQFMIGSSIMATPVVYPGARSVDAYFPAGVWYDFHS------GKLLHS----------DAEGAWLTLDAPLDKINIALRGGHIVPLLDSNRNSKSNIPNKMTLYCGMAQDMSASGDLYWDDGESIDSYSRNRYSYVSFNASPEQL---LITPVYFGYDLLPVLNKIVILGFENKSITKFLLNDNDIP---FHYNPE 2858
            A  QC +  ++ R DC P+ G +Q+ C ARGCC+    ++  + Q   +  P+C++P  Y +Y +++L  +  G  A L R SP++ P +V  L LEV+ ET SR   +I DP  KRYEVP++ +P  L       Y V   S+  F + ++RK   R L   +  PL ++DQFLQ+S+ + +  I G+GE   P +  LS  W RI LW RD P     NLYG+HPFY+ + D G A GVF  NSN  +  LQP+PA+T+R+ GGILD ++F G  P+  V+QYL++VG P +PPYW LGFHL +WGY +   + ++ +      FP+  QW+D+DYM+  +DFT +++ F      VRE+ Q    R++ IVDP IS       Y PY EG+   +FI + +T QP++GKVWPG T +PDFT+P    +W   +  F+  VP DG+W+DMNEPSNF  GS++GC  N++ +NP +VP +    L + TIC+S+ H     HYNLHNLYG TE++ +++AL+KT  G RPF++SRSTFSG G+Y  HWTGD ++SW+ L  S+  +L FN+ G+P+ GADICGF G++ EELC+RW QLGAFYPFMRNHN +N   Q+P  ++  AQ+ M+ A + RYA+LP  YTL  ++H+ G TV RP+  EF  D  T S++ Q + G +++ TPV+ PG   V  YFP G WY+         G L              ++G WLTL+APLD IN+ LR G+I+PL   +  +  +    M L   +     A G+L+WDDGES+    R  Y+ V+F+A    +   L+     G +L   L ++ +LG      T+ L   N IP   F Y+P+
Sbjct:   78 APTQCDVPPSS-RFDCAPDKGISQEQCEARGCCYVPAGQVLKEPQ---IGQPWCFFPPSYPSYRLENLSSTESGYTATLTRTSPTFFPKDVLTLQLEVLMETDSRLHFKIKDPASKRYEVPLE-TPRVLSQAPSPLYSVEF-SEEPFGVIVRRKLGGRVLLNTTVAPLFFADQFLQLSTSLPSQHITGLGEHLSPLM--LSTDWARITLWNRDTPPSQGTNLYGSHPFYLALEDGGLAHGVFLLNSNAMDVILQPSPALTWRSTGGILDVYVFLGPEPKSVVQQYLDVVGYPFMPPYWGLGFHLCRWGYSSTAIVRQVVENMTRTHFPLDVQWNDLDYMDARRDFTFNQDSFADFPDMVRELHQD-GRRYMMIVDPAISSAGPAGSYRPYDEGLRRGVFITN-ETGQPLIGKVWPGTTAFPDFTNPETLDWWQDMVSEFHAQVPFDGMWLDMNEPSNFVRGSQQGCP-NNELENPPYVPGVVGGILQAATICASS-HQFLSTHYNLHNLYGLTEAIASSRALVKT-RGTRPFVISRSTFSGHGRYAGHWTGDVRSSWEHLAYSVPDILQFNLLGVPLVGADICGFIGDTSEELCVRWTQLGAFYPFMRNHNDLNSVPQEPYRFSETAQQAMRKAFALRYALLPYLYTLFHRAHVRGDTVARPLFLEFPEDPSTWSVDRQLLWGPALLITPVLEPGKTEVTGYFPKGTWYNMQMVSVDSLGTLPSPSSASSFRSAVQSKGQWLTLEAPLDTINVHLREGYIIPLQGPSLTTTESRKQPMALAVALTASGEADGELFWDDGESLAVLERGAYTLVTFSAKNNTIVNKLVRVTKEGAEL--QLREVTVLGVATAP-TQVL--SNGIPVSNFTYSPD 932          
BLAST of Lysosomal alpha-glucosidase vs. UniProt
Match: sp|Q5R7A9|LYAG_PONAB (Lysosomal alpha-glucosidase OS=Pongo abelii GN=GAA PE=2 SV=1)

HSP 1 Score: 701.049 bits (1808), Expect = 0.000e+0
Identity = 357/870 (41.03%), Postives = 527/870 (60.57%), Query Frame = 3
Query:  321 QCQIANNNERLDCYPESGANQDSCIARGCCWSEPMRLSNKLQGVPLSIPYCYYPTDYSNYMIKSLRKSSRGIKAKLVRESPSYLPYEVAMLDLEVIYETKSRTRVRITDPKQKRYEVPMKLSPPDLKPPTDREYEVIIPSDGSFSIEIKRKSDDRSLF-KSFGPLLYSDQFLQISSIMSTDQIYGIGEQNRPFLHQLSNGWERIGLWARDNPIETFMNLYGAHPFYIGMPDDGKAFGVFHFNSNGQEFALQPAPAVTYRTIGGILDFFIFTGGSPEETVKQYLELVGKPMLPPYWSLGFHLSKWGYKNIEQLSEIFQRNINAGFPIGTQWSDIDYMENYKDFTVDKEKFNGLGRFVREIKQKYNSRFVAIVDPGISCTS-GNEYPPYYEGVFMDIFIKDSQTNQPIVGKVWPGETVYPDFTHPNISMYWYKQIQRFYNDVPIDGLWIDMNEPSNFYDGSKRGCQGNSKYDNPFFVPDIRDQSLISKTICSSALHYNNEKHYNLHNLYGYTESVTTNKALLKTIHGKRPFILSRSTFSGSGKYTFHWTGDNQASWDQLRNSIRQVLNFNMFGIPMTGADICGFNGNSDEELCIRWMQLGAFYPFMRNHNAINQRDQDPASWNTEAQKIMKTAISNRYAMLPLFYTLLVKSHMNGGTVMRPMSFEFFSDKVTHSIELQFMIGSSIMATPVVYPGARSVDAYFPAGVWYDFHS------GKL-----------LHSDAEGAWLTLDAPLDKINIALRGGHIVPLLDSNRNSKSNIPNKMTLYCGMAQDMSASGDLYWDDGESIDSYSRNRYSYVSFNASPEQLLITPVYFGYDLLPV-LNKIVILGFENKSITKFLLNDNDIP---FHYNPET 2861
            QC +  N+ R DC P+    ++ C ARGCC+   +     L+G  +  P+C++P  Y +Y +++L  S  G  A L R +P++ P ++  L L+V+ ET++R    I DP  +RYEVP++      + P+   Y V   S+  F + ++R+ D R L   +  PL ++DQFLQ+S+ + +  I G+ E   P +  LS  W R+ LW RD       NLYG+HPFY+ + D G A GVF  NSN  +  LQP+PA+++R+ GGILD +IF G  P+  V+QYL++VG P +PPYW LGFHL +WGY +    S++ +    A FP+  QW+D+DYM+  +DFT +K+ F      VRE+ Q    R++ IVDP IS +     Y PY EG+   +FI + +T+QP++GKVWPG T +PDFT+P    +W   +  F++ VP DG+WIDMNEPSNF  GS+ GC  N + +NP +VP +   +L + TIC+S+ H     HYNLHNLYG TE++ +++AL+K   G RPF++SRSTF+G G+Y  HWTGD  +SW+QL +S+ ++L FN+ G+P+ GAD+CGF GN+ EELC+RW QLGAFYPFMRNHN +    Q+P S++  AQ+ M+ A++ RYA+LP  YTL  ++H+ G TV RP+  EF  D  T +++ Q + G +++ TPV+  G   V  YFP G+WYD  +      G L           +HS  EG W+TL APLD IN+ LR G+I+PL      +  +    M L   + +   A G+L+WDDGES++   R  Y+ V F A    ++   V+   +   + L K+ +LG    + T   +  N +P   F Y+P+T
Sbjct:   81 QCDVPPNS-RFDCAPDKAITREQCDARGCCY---IPAKQGLRGAQMGQPWCFFPPSYPSYKLENLSSSEMGYTATLTRTTPTFFPKDILTLRLDVMMETENRLHFTIKDPANRRYEVPLETPRVHSRAPSPL-YSVEF-SEEPFGVIVRRQLDGRVLLNTTVAPLFFADQFLQLSTSLPSQYITGLAEHLSPLM--LSTSWTRVTLWNRDLAPTPGANLYGSHPFYLALEDGGSAHGVFLLNSNAMDVVLQPSPALSWRSTGGILDVYIFLGPEPKSVVRQYLDVVGYPFMPPYWGLGFHLCRWGYSSTAITSQVVENMTRAHFPLDVQWNDLDYMDARRDFTFNKDGFRDFPAMVRELHQG-GRRYMMIVDPAISSSGPAGSYRPYDEGLRRGVFITN-ETSQPLIGKVWPGSTAFPDFTNPAALAWWEDMVAEFHDQVPFDGMWIDMNEPSNFIRGSEDGCPDN-ELENPPYVPGVVGGTLQAATICASS-HQFLSTHYNLHNLYGLTEAIASHRALVKA-RGTRPFVISRSTFAGHGRYAGHWTGDVWSSWEQLASSVPEILQFNLLGVPLVGADVCGFLGNTSEELCVRWTQLGAFYPFMRNHNGLLNLPQEPYSFSEPAQQAMRKALTLRYALLPHLYTLFHQAHVAGETVARPLFLEFPKDSSTWTVDHQLLWGEALLITPVLQAGKAEVTGYFPLGIWYDLQTVPIEALGSLPPPPAAPREPAIHS--EGQWVTLPAPLDTINVHLRAGYIIPLQGPGLTTTESRQQPMALAVALTKGGEARGELFWDDGESLEVLERGAYTQVLFLARNNTIVNELVHVTSEGAGLQLQKVTVLGV---ATTPQQVLSNGVPVSNFTYSPDT 932          
BLAST of Lysosomal alpha-glucosidase vs. UniProt
Match: sp|P10253|LYAG_HUMAN (Lysosomal alpha-glucosidase OS=Homo sapiens GN=GAA PE=1 SV=4)

HSP 1 Score: 699.508 bits (1804), Expect = 0.000e+0
Identity = 359/872 (41.17%), Postives = 523/872 (59.98%), Query Frame = 3
Query:  321 QCQIANNNERLDCYPESGANQDSCIARGCCWSEPMRLSNKLQGVPLSIPYCYYPTDYSNYMIKSLRKSSRGIKAKLVRESPSYLPYEVAMLDLEVIYETKSRTRVRITDPKQKRYEVPMKLSPPDLKPPTDREYEVIIPSDGSFSIEIKRKSDDRSLF-KSFGPLLYSDQFLQISSIMSTDQIYGIGEQNRPFLHQLSNGWERIGLWARDNPIETFMNLYGAHPFYIGMPDDGKAFGVFHFNSNGQEFALQPAPAVTYRTIGGILDFFIFTGGSPEETVKQYLELVGKPMLPPYWSLGFHLSKWGYKNIEQLSEIFQRNINAGFPIGTQWSDIDYMENYKDFTVDKEKFNGLGRFVREIKQKYNSRFVAIVDPGISCTS-GNEYPPYYEGVFMDIFIKDSQTNQPIVGKVWPGETVYPDFTHPNISMYWYKQIQRFYNDVPIDGLWIDMNEPSNFYDGSKRGCQGNSKYDNPFFVPDIRDQSLISKTICSSALHYNNEKHYNLHNLYGYTESVTTNKALLKTIHGKRPFILSRSTFSGSGKYTFHWTGDNQASWDQLRNSIRQVLNFNMFGIPMTGADICGFNGNSDEELCIRWMQLGAFYPFMRNHNAINQRDQDPASWNTEAQKIMKTAISNRYAMLPLFYTLLVKSHMNGGTVMRPMSFEFFSDKVTHSIELQFMIGSSIMATPVVYPGARSVDAYFPAGVWYDFHS------GKL-----------LHSDAEGAWLTLDAPLDKINIALRGGHIVPLLDSNRNSKSNIPNKMTLYCGMAQDMSASGDLYWDDGESIDSYSRNRYSYVSFNASPEQL---LITPVYFGYDLLPVLNKIVILGFENKSITKFLLNDNDIP---FHYNPET 2861
            QC +  N+ R DC P+    Q+ C ARGCC+   +     LQG  +  P+C++P  Y +Y +++L  S  G  A L R +P++ P ++  L L+V+ ET++R    I DP  +RYEVP++      + P+   Y V   S+  F + ++R+ D R L   +  PL ++DQFLQ+S+ + +  I G+ E   P +  LS  W RI LW RD       NLYG+HPFY+ + D G A GVF  NSN  +  LQP+PA+++R+ GGILD +IF G  P+  V+QYL++VG P +PPYW LGFHL +WGY +     ++ +    A FP+  QW+D+DYM++ +DFT +K+ F      V+E+ Q    R++ IVDP IS +     Y PY EG+   +FI + +T QP++GKVWPG T +PDFT+P    +W   +  F++ VP DG+WIDMNEPSNF  GS+ GC  N++ +NP +VP +   +L + TIC+S+ H     HYNLHNLYG TE++ +++AL+K   G RPF++SRSTF+G G+Y  HWTGD  +SW+QL +S+ ++L FN+ G+P+ GAD+CGF GN+ EELC+RW QLGAFYPFMRNHN++    Q+P S++  AQ+ M+ A++ RYA+LP  YTL  ++H+ G TV RP+  EF  D  T +++ Q + G +++ TPV+  G   V  YFP G WYD  +      G L           +HS  EG W+TL APLD IN+ LR G+I+PL      +  +    M L   + +   A G+L+WDDGES++   R  Y+ V F A    +   L+     G  L   L K+ +LG             N +P   F Y+P+T
Sbjct:   81 QCDVPPNS-RFDCAPDKAITQEQCEARGCCY---IPAKQGLQGAQMGQPWCFFPPSYPSYKLENLSSSEMGYTATLTRTTPTFFPKDILTLRLDVMMETENRLHFTIKDPANRRYEVPLETPHVHSRAPSPL-YSVEF-SEEPFGVIVRRQLDGRVLLNTTVAPLFFADQFLQLSTSLPSQYITGLAEHLSPLM--LSTSWTRITLWNRDLAPTPGANLYGSHPFYLALEDGGSAHGVFLLNSNAMDVVLQPSPALSWRSTGGILDVYIFLGPEPKSVVQQYLDVVGYPFMPPYWGLGFHLCRWGYSSTAITRQVVENMTRAHFPLDVQWNDLDYMDSRRDFTFNKDGFRDFPAMVQELHQG-GRRYMMIVDPAISSSGPAGSYRPYDEGLRRGVFITN-ETGQPLIGKVWPGSTAFPDFTNPTALAWWEDMVAEFHDQVPFDGMWIDMNEPSNFIRGSEDGCP-NNELENPPYVPGVVGGTLQAATICASS-HQFLSTHYNLHNLYGLTEAIASHRALVKA-RGTRPFVISRSTFAGHGRYAGHWTGDVWSSWEQLASSVPEILQFNLLGVPLVGADVCGFLGNTSEELCVRWTQLGAFYPFMRNHNSLLSLPQEPYSFSEPAQQAMRKALTLRYALLPHLYTLFHQAHVAGETVARPLFLEFPKDSSTWTVDHQLLWGEALLITPVLQAGKAEVTGYFPLGTWYDLQTVPVEALGSLPPPPAAPREPAIHS--EGQWVTLPAPLDTINVHLRAGYIIPLQGPGLTTTESRQQPMALAVALTKGGEARGELFWDDGESLEVLERGAYTQVIFLARNNTIVNELVRVTSEGAGL--QLQKVTVLGVATAPQQVL---SNGVPVSNFTYSPDT 932          
BLAST of Lysosomal alpha-glucosidase vs. UniProt
Match: sp|Q9MYM4|LYAG_BOVIN (Lysosomal alpha-glucosidase OS=Bos taurus GN=GAA PE=2 SV=1)

HSP 1 Score: 671.003 bits (1730), Expect = 0.000e+0
Identity = 337/816 (41.30%), Postives = 489/816 (59.93%), Query Frame = 3
Query:  312 ATAQCQIANNNERLDCYPESGANQDSCIARGCCWSEPMRLSNKLQGVPLSIPYCYYPTDYSNYMIKSLRKSSRGIKAKLVRESPSYLPYEVAMLDLEVIYETKSRTRVRITDPKQKRYEVPMKLSPPDLKPPTDREYEVIIPSDGSFSIEIKRKSDDRSLF-KSFGPLLYSDQFLQISSIMSTDQIYGIGEQNRPFLHQLSNGWERIGLWARDNPIETFMNLYGAHPFYIGMPDDGKAFGVFHFNSNGQEFALQPAPAVTYRTIGGILDFFIFTGGSPEETVKQYLELVGKPMLPPYWSLGFHLSKWGYKNIEQLSEIFQRNINAGFPIGTQWSDIDYMENYKDFTVDKEKFNGLGRFVREIKQKYNSRFVAIVDPGISCTS-GNEYPPYYEGVFMDIFIKDSQTNQPIVGKVWPGETVYPDFTHPNISMYWYKQIQRFYNDVPIDGLWIDMNEPSNFYDGSKRGCQGNSKYDNPFFVPDIRDQSLISKTICSSALHYNNEKHYNLHNLYGYTESVTTNKALLKTIHGKRPFILSRSTFSGSGKYTFHWTGDNQASWDQLRNSIRQVLNFNMFGIPMTGADICGFNGNSDEELCIRWMQLGAFYPFMRNHNAINQRDQDPASWNTEAQKIMKTAISNRYAMLPLFYTLLVKSHMNGGTVMRPMSFEFFSDKVTHSIELQFMIGSSIMATPVVYPGARSVDAYFPAGVWYDFHS---------------GKLLHSDAEGAWLTLDAPLDKINIALRGGHIVPLLDSNRNSKSNIPNKMTLYCGMAQDMSASGDLYWDDGESIDSYSRNRYSYVSFNA 2708
            A  QC +  N+ R DC P+ G     C ARGCC+  P       Q   +  P+C++P  Y +Y +++L  +  G  A L R  P++ P ++  L L+++ ET+SR    I DP  +RYEVP++ +P          Y V   S+  F + ++RK D R L   +  PL ++DQFLQ+S+ + +  I G+ E     +  LS  W +I LW RD   E  +NLYG+HPFY+ + D G A GVF  NSN  +  LQP+PA+++R+ GGILD +IF G  P+  V+QYL++VG P +PPYW LGFHL +WGY       ++ +    A FP+  QW+D+DYM+  +DFT +K+ F      V+E+ Q    R++ IVDP IS +     Y PY EG+   +FI + +T QP++G+VWPG T +PDFT+P    +W   +  F+  VP DG+WIDMNEPSNF  GS  GC  NS  +NP ++P +   +L + TIC+S+ H     HY+LHNLYG TE++ +++AL+K   G RPF++SRSTF+G G+Y+ HWTGD  ++W+QL  S+ ++L FN+ G+P+ GADICGF GN+ EELC+RW QLGAFYPFMRNHNA+N + Q+P  ++  AQ+ M+ A + RY +LP  YTL  ++H+ G TV RP+  EF  D  T +++ Q + G +++ TPV+      V  YFP G WYD  +                 ++HS  +G W+TL APLD IN+ LR GHI+P+      +  +    M L   +     A G+L+WDDGES+       Y+ + F A
Sbjct:   66 APTQCDLPPNS-RFDCAPDKGITPQQCEARGCCYM-PAEWPPDAQ---MGQPWCFFPPSYPSYRLENLTTTETGYTATLTRAVPTFFPKDIMTLRLDMLMETESRLHFTIKDPANRRYEVPLE-TPRVYSQAPFTLYSVEF-SEEPFGVVVRRKLDGRVLLNTTVAPLFFADQFLQLSTSLPSQHITGLAEHLGSLM--LSTNWTKITLWNRDIAPEPNVNLYGSHPFYLVLEDGGLAHGVFLLNSNAMDVVLQPSPALSWRSTGGILDVYIFLGPEPKSVVQQYLDVVGYPFMPPYWGLGFHLCRWGYSTSAITRQVVENMTRAYFPLDVQWNDLDYMDARRDFTFNKDHFGDFPAMVQELHQG-GRRYIMIVDPAISSSGPAGTYRPYDEGLRRGVFITN-ETGQPLIGQVWPGLTAFPDFTNPETLDWWQDMVTEFHAQVPFDGMWIDMNEPSNFVRGSVDGCPDNS-LENPPYLPGVVGGTLRAATICASS-HQFLSTHYDLHNLYGLTEALASHRALVKA-RGMRPFVISRSTFAGHGRYSGHWTGDVWSNWEQLSYSVPEILLFNLLGVPLVGADICGFLGNTSEELCVRWTQLGAFYPFMRNHNALNSQPQEPYRFSETAQQAMRKAFTLRYVLLPYLYTLFHRAHVRGETVARPLFLEFPEDPSTWTVDRQLLWGEALLITPVLEAEKVEVTGYFPQGTWYDLQTVPMEAFGSLPPPAPLTSVIHS--KGQWVTLSAPLDTINVHLRAGHIIPMQGPALTTTESRKQHMALAVALTASGEAQGELFWDDGESLGVLDGGDYTQLIFLA 865          
BLAST of Lysosomal alpha-glucosidase vs. TrEMBL
Match: tr|A0A1D1VXK3|A0A1D1VXK3_RAMVA (Uncharacterized protein OS=Ramazzottius varieornatus GN=RvY_16194-1 PE=3 SV=1)

HSP 1 Score: 768.844 bits (1984), Expect = 0.000e+0
Identity = 379/859 (44.12%), Postives = 544/859 (63.33%), Query Frame = 3
Query:  312 ATAQCQIANNNERLDCYPESGANQDSCIARGCCWSEPMRLSNKLQGVPLSIPYCYYPTDYSNYMIKSLRKSSRGIKAKLVR--ESPSYLPYEVAMLDLEVIYETKSRTRVRITDPKQKRYEVPMKLSP--PDLKPPTDREYEVIIPSDGSFSIEIKRKSDDRSLFKSF-GPLLYSDQFLQISSIMSTDQIYGIGEQ-NRPFLHQLSNGWERIGLWARDNPIETFMNLYGAHPFYIGMPDDGKAFGVFHFNSNGQEFALQPAPAVTYRTIGGILDFFIFTGGSPEETVKQYLELVGKPMLPPYWSLGFHLSKWGYKNIEQLSEIFQRNINAGFPIGTQWSDIDYMENYKDFTVDKEKFNGLGRFVREIKQKYNSRFVAIVDPGISCTSG-NEYPPYYEGVFMDIFIKDSQTNQPIVGKVWPGE-TVYPDFTHPNISMYWYKQIQRFYNDVPIDGLWIDMNEPSNFYDGSKRGCQGNSKYDNPFFVPDIRDQSLISKTICSSALHYNNEKHYNLHNLYGYTESVTTNKALLKTIHGKRPFILSRSTFSGSGKYTFHWTGDNQASWDQLRNSIRQVLNFNMFGIPMTGADICGFNGNSDEELCIRWMQLGAFYPFMRNHNAINQRDQDPASWNTEAQKIMKTAISNRYAMLPLFYTLLVKSHMNGGTVMRPMSFEFFSDKVTHSIELQFMIGSSIMATPVVYPGARSVDAYFPAGVWYDFHSGKLLHSDAEGAWLTLDAPLDKINIALRGGHIVPLLDSNRNSKSNIPNKMTLYCGMAQDMSASGDLYWDDGESIDSYSRNRYSYVSFNASPEQLLITPVYFGYDLLPVLNKIVILGFENKSITKFLLN-DNDIPFHYNPET 2861
            + A C    +++R DC P+   ++ SC+ARGCCW++   +      V L +P C+YP  Y  Y +++ ++++ G +  L R  ++    P  +  L L+VI++T  R  V+ITD  + RYEVP+ + P  P  KP T   Y+ ++  +  FS ++KRKS    L  +      + DQF+QISS++ +  IYG+GE  +  FLH ++  W++  +W  D        LYG HPFY  M +DG A GV  FNSN  +  LQP PA+TYRTIGG+LDF+ F G SP++   QY+EL+GKP +PPYW+LG+HL +WGY ++E   ++ +RN+ AG P+  QW+DIDYM+  KDFT+D  KFNG+  FV E+  K   R+V IVDPGIS       Y  Y +G+ M++F++++ ++Q I G+VW G    YPDFTHPNIS YW KQI  F   VP+DGLWIDMNEPSNF DGS  GC  +S  +NP ++P+I  ++L ++T+C +A H+    HYNLH+ YG  ++  T  ALL+    KRPF++SRSTF G G+Y+ HWTGD  +SW  L+ SI  +LNFNMFGIP  GADICGF  N+ EELC+RW QLGAFYPF RNHNA++ RDQDPA+W+  A + ++T +  RY++LP + TLL ++ ++G TV+RP+ FEF  DK T+SI+ QF+IGSS+M +PV  P    + AY P G W+DF+S K + SD  G W+ LDAPLDK+N+ LR G IVP+      +     N + L   + +   A G++YWDDGE +D   +  +S V F     +L  T V   Y  +P +  + ++G E +++ K + N   ++ F +N  T
Sbjct:  186 SNAVCSTMADDDRFDCLPQGDISEASCMARGCCWNQRSSVQMVNGTVKLGLPACFYPYKYPTYRLENYKETANGFEGTLQRSKDAKDIYPNPINSLRLQVIFDTAQRLHVKITDATKDRYEVPLPVLPGAPFSKPDTTL-YDFVVTKE-PFSFQVKRKSTGGVLVDTATNTFAFYDQFIQISSLLPSKYIYGLGEHTDAHFLHSVN--WKQFTMWTTDIYPNLETPLYGVHPFYFSMEEDGDANGVLLFNSNAMDVILQPTPAITYRTIGGVLDFYFFLGPSPQDVTSQYMELLGKPQMPPYWALGYHLCRWGYGSVENTRKVMERNLAAGIPLDAQWNDIDYMDKNKDFTIDGSKFNGITEFVNEVHAK-GLRYVVIVDPGISSAEAPGSYQAYTDGLAMNVFVQNA-SDQVIEGRVWTGNPQAYPDFTHPNISQYWLKQITDFRKVVPVDGLWIDMNEPSNFVDGSMVGCPKDSSLENPPYLPNIAGKTLNTRTLCMTAKHHAG-LHYNLHSTYGIYQAKATQAALLQVFPNKRPFVVSRSTFVGQGQYSAHWTGDESSSWSDLQTSIGDILNFNMFGIPFVGADICGFGDNATEELCLRWHQLGAFYPFSRNHNAVSNRDQDPAAWSPAATEAIRTVLLTRYSLLPYYSTLLFRASISGHTVVRPLFFEFAHDKRTYSIDAQFLIGSSVMLSPVTTPNTTKILAYLPEGRWFDFYSLKKI-SDKGGEWIELDAPLDKVNVHLREGGIVPMQKPEVTTGKTRQNPIDLVVMLDKTGKACGEVYWDDGEQMDVLQKGDFSLVQFEMKNGKLKSTVVNDKYKDVPAMGSVRVVGLE-RTVKKVVWNGGEEVDFVFNDHT 1035          
BLAST of Lysosomal alpha-glucosidase vs. TrEMBL
Match: tr|H2KPA9|H2KPA9_CLOSI (Lysosomal alpha-glucosidase OS=Clonorchis sinensis GN=CLF_101613 PE=3 SV=1)

HSP 1 Score: 748.043 bits (1930), Expect = 0.000e+0
Identity = 386/869 (44.42%), Postives = 524/869 (60.30%), Query Frame = 3
Query:  321 QCQIANNNERLDCYPESGANQDSCIARGCCWSEPMRLSNKLQGVPLS---IPYCYYPTDYSNYMIKSLRKSSRGIKAKLVRESPSYLPYEVAMLDLEVIYETKSRTRVRITDPKQ-KRYEVPMKLSPPDLKPPTDREYEVIIPSDGSFSIEIKRKSDDRS-LFKSFGPL----LYSDQFLQISSIMSTDQIYGIGEQNRPFLHQLSNGWERIGLWARDNPIETFMNLYGAHPFYIGMPDDGKAFGVFHFNSNGQEFALQPAPAVTYRTIGGILDFFIFTGGSPEETVKQYLELVGKPMLPPYWSLGFHLSKWGYKNIEQLSEIFQRNINAGFPIGTQWSDIDYMENYKDFTVDKEKFNGLGRFVRE-IKQKYNSRFVAIVDPGISCTSGNEYPPYYEGVFMDIFIKDSQTNQPIVGKVWPGETVYPDFTHPNISMYWYKQIQRFYNDVPIDGLWIDMNEPSNFYDGSKRGCQGNSKYDNPFFVPDIRDQSLISKTICSSALHYNNEKHYNLHNLYGYTESVTTNKALLKTIHGKRPFILSRSTFSGSGKYTFHWTGDNQASWDQLRNSIRQVLNFNMFGIPMTGADICGFNGNSDEELCIRWMQLGAFYPFMRNHNAINQRDQDPASWNTEAQKIMKTAISNRYAMLPLFYTLLVKSHMNGGTVMRPMSFEFFSDKVTHSIELQFMIGSSIMATPVVYPGARSVDAYFPAGVWYDFHSGKLLHSDAEGAWLTLDAPLDKINIALRGGHIVPLLDSNRNSKSNIPNKMTLYCGMA---------QDMSASGDLYWDDGESIDSYSRNRYSYVSFNASPEQLLITPVYFGYDLLPVLN------KIVILGFENKSITKFLLNDNDIPFHYN 2852
            QC     +ERLDCYPE+GAN+D+CI +GCCWS          G+  +   IP CY+P DY  Y ++++ ++ RG  A + + +  Y   E   + +EV++ETK+R RVR T P    R+E P+ L  PD+  P   +Y V +     F I + R    R  L  S G +    ++SDQFLQ S  +  +  +G GE    F H L   W R+GLW RDN      NLYG H F++G+  DG AFGVF  NSN QE  L P PA+TYRTIGGILDFFIFTG  P +   QYL L+G P+LPPYWSLGFHL ++GY++ E+++   +RNI AG P+  QW DIDYM+ Y+ +TVD  KF GL   +++ +  KY  R V IVDP +S      Y P+ +G    IFI DS+T  PI G VWPG+TV+PDF+HP    + Y     F+  VP DGLWIDMNEP++F  GSK  C   +  DNP FVP I D+SL +KT+C SALH+++  HYN HNLYGY  +  T+  L +   GKRPF+LSRSTFSGSG YT HWTGDN +SW  +R SI Q++NFN+FGIPM GADICGF GN+ EELC+RW QLGAFYPF RNHN +    QDPA W+  A + ++ AI  RY +LP  Y+L  ++H+NG TV R +SFEF  D  TH+++ QFM+GS I+ TPV+  G   V  Y PAG W +  +G+  +S  +  +    APL+ I I +RGG +VP   S   +K +    + L   ++         Q  +A G+L+WDDGE+        Y YV+F  +  +L I P     D +  ++      K +++   ++   + LLN   + + ++
Sbjct:   28 QCGPFPISERLDCYPEAGANKDACINKGCCWS----------GITFTEPHIPMCYFPKDYRTYTVRNVTQNPRGFVADMEKITSPYGVNEFQNVRVEVLHETKTRLRVRFTIPSDPNRWEPPIPLGKPDVNAPEPTDYAVEL-EKSPFGIRVVRNDPIRQMLLDSTGDMSVSTIFSDQFLQTSFRLGAEHGFGPGEVRADFPHWLRRTWLRMGLWTRDNAPMKEANLYGVHNFFMGLSPDGSAFGVFLINSNAQEVVLTPLPAITYRTIGGILDFFIFTGPDPMDVTAQYLSLIGHPLLPPYWSLGFHLCRFGYRDSEEVANTVERNIKAGIPVDAQWIDIDYMDAYRVWTVDPTKFGGLPSLIQDTLHSKYGIRNVLIVDPAVSAKDDPTYAPFLDGFKRGIFINDSRTGSPIEGVVWPGDTVFPDFSHPEAEAWLYNLASEFHKSVPFDGLWIDMNEPASFAAGSKTNCDQTNPLDNPPFVPPILDRSLYAKTVCPSALHHDS-THYNRHNLYGYDHARVTHNVLKQLFAGKRPFLLSRSTFSGSGLYTIHWTGDNLSSWPDMRASIAQIINFNLFGIPMVGADICGFRGNTTEELCVRWSQLGAFYPFARNHNDLASIPQDPAVWSKAATEAIRDAIKLRYLLLPYMYSLFYRAHLNGTTVARALSFEFPRDTNTHTVKEQFMLGSCILVTPVLDEGRTDVTGYVPAGYWINLSTGRRDYSTGQVKY--FQAPLNVIPILVRGGCVVPFQTSFEVTKISRKKGIALLVVLSTTDDGTLIPQTGTAKGELFWDDGEA----DPLNYVYVNFTVANRELHIVPKPLNADTIRSIDPQETQIKSILINGLSQEPKQVLLNKAPVAYTFD 878          
BLAST of Lysosomal alpha-glucosidase vs. TrEMBL
Match: tr|G4V8C4|G4V8C4_SCHMA (Putative alpha-glucosidase OS=Schistosoma mansoni GN=Smp_020340 PE=3 SV=1)

HSP 1 Score: 739.954 bits (1909), Expect = 0.000e+0
Identity = 380/872 (43.58%), Postives = 527/872 (60.44%), Query Frame = 3
Query:  321 QCQIANNNERLDCYPESGANQDSCIARGCCWSEPMRLSNKLQGVPLS----IPYCYYPTDYSNYMIKSLRKSSRGIKAKLVRESPSYLPYEVAMLDLEVIYETKSRTRVRITDPKQ-KRYEVPMKLSPPDLKPPTDREYEVIIPSDGSFSIEIKRKSDDRS-LFKSFG----PLLYSDQFLQISSIMSTDQIYGIGEQNRPFLHQLSNGWERIGLWARDNPIETFMNLYGAHPFYIGMPDDGKAFGVFHFNSNGQEFALQPAPAVTYRTIGGILDFFIFTGGSPEETVKQYLELVGKPMLPPYWSLGFHLSKWGYKNIEQLSEIFQRNINAGFPIGTQWSDIDYMENYKDFTVDKEKFNGLGRFVREI-KQKYNSRFVAIVDPGISCTSGNEYPPYYEGVFMDIFIKDSQTNQPIVGKVWPGETVYPDFTHPNISMYWYKQIQRFYNDVPIDGLWIDMNEPSNFYDGSKRGCQGNSKYDNPFFVPDIRDQSLISKTICSSALHYNNEKHYNLHNLYGYTESVTTNKALLKTIHGKRPFILSRSTFSGSGKYTFHWTGDNQASWDQLRNSIRQVLNFNMFGIPMTGADICGFNGNSDEELCIRWMQLGAFYPFMRNHNAINQRDQDPASWNTEAQKIMKTAISNRYAMLPLFYTLLVKSHMNGGTVMRPMSFEFFSDKVTHSIELQFMIGSSIMATPVVYPGARSVDAYFPAGVWYDFHSGKLLHSDAEGAWLTLDAPLDKINIALRGGHIVPLLDSNRNSKSNIPNKMTLYC----------GMAQDMSASGDLYWDDGESIDSYSRNRYSYVSFNASPEQLLITPVYFGYDLLPVLN-------KIVILGFENKSITKFLLNDNDIPFHYN 2852
            QC    N +RLDCYP  G+N+  CI RGCCW            VP S    +PYCY+P DYS Y++ S  K+  G   +L + SP+Y   E+  + +E+  ET +R R+R T P Q  R+E P+ L   D     D +Y+V +     F ++I R ++++  L  S G     L++S+QFLQIS  ++    +G GE  + + +   + W R  LW  D   +++ NLYG H F++G+   G AFG+F  NSN QE A+ P PA+TYRTIGGILDFF+FTG  P + + QY  L+G P +PPYWSLGFH+ ++G KN+++  E+ +RN++AG PI  QW DIDYM+ YK ++VD ++F G+  +VR++ ++KY+ R V I+DP +S   G  Y PY +G+   IFI DS+T  PI+G VWPGETV+PDF+HP+   +W+K    F+  +  DGLWIDMNEP+NF  GS  GC  ++  DNP +VP I   SL  KTIC SALHYN   HYN+HN+YGY  +  T+  L +    KRPFIL+RS+F+GSG Y  HWTGD  ++WD L+ S+ Q++NFNMFGIPM GADICGF GN+ EELCIRW QLGAFYPF RNHNA    +QDPA W+ E  K +K AI  RY +LP  YTL  +S++NG TV R ++FEF  D  TH +  QFM+GS I+ TPV+  G   V+ Y P+G W +  SGK   S   G W   DAPL+ I I++R G I+P+  S   +         L+              Q ++ASG+L+WD+G+         Y +V F      L +T        L  ++        I+I+GF  K  T+ L+N+  + F ++
Sbjct:   24 QCSNITNVQRLDCYPNVGSNEGVCIERGCCW------------VPESGHDGLPYCYFPKDYSAYVVVSAEKTEHGFIGQLSKPSPTYYLDEIKSIAVEIREETSTRLRIRFTVPSQPDRWEPPIPLGKVDDARVKDVQYKVDM-EKSPFGLKIMRNTEEQDVLLDSTGQLASSLIFSNQFLQISFRVNAQVSFGPGEIEQKYPNTF-DTWMRAALWGHDGNPQSYANLYGTHNFFMGLKYGGTAFGIFFLNSNAQEVAITPLPAITYRTIGGILDFFVFTGPKPLDVINQYYRLIGHPPIPPYWSLGFHICRYGMKNLDEAKEVLKRNVDAGIPIDAQWFDIDYMDAYKIWSVDTKRFGGIDVYVRDVLRKKYSVRTVLIIDPAVSTKGGTGYRPYEDGMRHGIFINDSRTGTPILGTVWPGETVFPDFSHPSAEDWWFKSASDFHKVINFDGLWIDMNEPANFNSGSLSGCPSSNTLDNPPYVPKILGNSLYDKTICPSALHYNT-THYNMHNIYGYDMARVTHNVLTRMFPDKRPFILTRSSFAGSGLYAAHWTGDVLSNWDSLKTSVVQIINFNMFGIPMVGADICGFTGNTTEELCIRWSQLGAFYPFARNHNAHGSNNQDPACWSEETTKAIKQAIRLRYHLLPYMYTLFYRSYLNGTTVARALAFEFPEDLATHKVNAQFMLGSCILVTPVLDEGRTFVEGYVPSGEWINLSSGKRYFS--RGTWKYFDAPLNVIPISIRCGCIIPMQVSAETTDIARKKGFGLFVILSSTDDGSDAAGQRITASGELFWDNGDD----GNLNYIHVKFEVRDRTLTVTSTPSSVGSLEKIDFQELDVKTILIVGFIKKP-TEILVNNKPVDFMFD 873          
BLAST of Lysosomal alpha-glucosidase vs. TrEMBL
Match: tr|O73626|O73626_COTJA (Acid alpha glucosidase OS=Coturnix coturnix japonica GN=GAAI PE=2 SV=1)

HSP 1 Score: 732.25 bits (1889), Expect = 0.000e+0
Identity = 369/849 (43.46%), Postives = 530/849 (62.43%), Query Frame = 3
Query:  318 AQCQIANNNERLDCYPESGA--NQDSCIARGCCWSEPMRLSNKLQGVPLSIPYCYYPTDYSNYMIKSLRKSSRGIKAKLVRESPSYLPYEVAMLDLEVIYETKSRTRVRITDPKQKRYEVPMKLSPPDLKPPTDREYEVIIPSDGSFSIEIKRKSDDRSLF-KSFGPLLYSDQFLQISSIMSTDQIYGIGEQNRPFLHQLSNGWERIGLWARD-NPIETFMNLYGAHPFYIGMPDDGKAFGVFHFNSNGQEFALQPAPAVTYRTIGGILDFFIFTGGSPEETVKQYLELVGKPMLPPYWSLGFHLSKWGYKNIEQLSEIFQRNINAGFPIGTQWSDIDYMENYKDFTVDKEKFNGLGRFVREIKQKYNSRFVAIVDPGISCTS-GNEYPPYYEGVFMDIFIKDSQTNQPIVGKVWPGETVYPDFTHPNISMYWYKQIQRFYNDVPIDGLWIDMNEPSNFYDGSKRGCQGNSKYDNPFFVPDIRDQSLISKTICSSALHYNNEKHYNLHNLYGYTESVTTNKALLKTIHGKRPFILSRSTFSGSGKYTFHWTGDNQASWDQLRNSIRQVLNFNMFGIPMTGADICGFNGNSDEELCIRWMQLGAFYPFMRNHNAINQRDQDPASWNTEAQKIMKTAISNRYAMLPLFYTLLVKSHMNGGTVMRPMSFEFFSDKVTHSIELQFMIGSSIMATPVVYPGARSVDAYFPAGVWYDFHSGKLLHSDAEGAWLTLDAPLDKINIALRGGHIVPLLDSNRNSKSNIPNKMTLYCGMAQDMSASGDLYWDDGESIDSYSRNRYSYVSFNASPEQLLITPVYFGYDLLPVLNKIVILGFENKSITKFLLNDNDIPFHY 2849
            AQC +   + R DCYPE      Q+ C +RGCC+ + +      +GVP    +C+YP D+ +Y+++SL ++  G+   LVR   +Y P ++ ML ++V ++T +R  ++ITD    RYEVP+++ P   K   +  Y + I  D  F + ++R+     L   +  PL+++DQFLQIS+ + +  +YG+GE     LH L   W  + LWARD  P E+F NLYGAHPFY+ M + G A GVF  NSN  E ALQPAP +T+RTIGG+LDF+IF G  P   ++QY E++G P +PP W+LGFHL +WGY +  +  +  +   N   P   QW+DIDYM+ Y+DFT D +KF  L   V ++  K+   +V I+DPGIS TS    Y P+ EG+   +F+  +Q  Q ++G+VWPG T YPDF++ +   +W + +QRF+  VP DGLWIDMNEPSNF DGS+ GC    + D+P + P +   SL +KT+C+SA   N   HYNLHNLYG  E+  T  AL++ I GKRPF++SRSTF   G+Y+ HW GDN++ W  +  SI  +L+F++FGIP+ GADICGF+G++ EELC RWMQLGAFYPF RNHN  N++ QDP +++  A+  MK A+  RY++LP  YTL  ++H+ G TV RP+ FEF  D  T+ ++ QF+ G S++ TPV+ PGA SV  YFP GVWYDF++G  ++S  E   L L APLD +N+ LR G I+P       SK+   N + L   ++   +A GDL+WDDGES+D++ +  YSY+ FNA+        ++   +   V    V      +  +K LL+  + PF Y
Sbjct:   76 AQCHLVPESHRYDCYPERNVVVTQELCESRGCCFIQTLPAVGGKRGVP----WCFYPPDFPSYVVQSLNQTVLGMTGLLVRREKAYYPKDIQMLRMDVEFQTNTRLHIKITDAANPRYEVPLEV-PRVTKRAENPIYSLEISQD-PFGVLLRRQGTGTVLLNTTVAPLIFADQFLQISTTLPSRFLYGLGEHRSTLLHSLD--WNTLTLWARDVAPTESF-NLYGAHPFYLLMEEGGDAHGVFLLNSNAMEVALQPAPGLTWRTIGGVLDFYIFLGPDPNMVIQQYQEVIGFPAMPPLWALGFHLCRWGYGSSNETWQTAKAMRNFQIPQDAQWNDIDYMDGYRDFTFDPQKFASLPSLVEDL-HKHGQHYVIILDPGISSTSPRGSYWPFDEGLRRGLFLNTTQ-GQTLIGQVWPGYTAYPDFSNTDTHQWWLENLQRFHTHVPFDGLWIDMNEPSNFMDGSEEGCP-PGELDSPPYTPAVLGNSLTAKTVCASA-EQNASVHYNLHNLYGLKEAEATASALIR-IRGKRPFVISRSTFPSQGRYSGHWLGDNRSQWKDMYYSIPGMLSFSLFGIPLVGADICGFSGSTSEELCTRWMQLGAFYPFSRNHNNQNEKAQDPTAFSPSARTAMKDALLTRYSLLPFLYTLFHRAHLQGETVARPLFFEFPWDVATYGLDRQFLWGQSLLVTPVLEPGADSVLGYFPQGVWYDFYTGSSVNSSGE--MLKLSAPLDHLNLHLREGSILPTQKPGITSKATRGNPLHLIVALSTRATAWGDLFWDDGESLDTFEQGNYSYLVFNATENIFTSNVLHASTEATDVTIDAVSFYGVQEPPSKVLLDGQEKPFSY 908          
BLAST of Lysosomal alpha-glucosidase vs. TrEMBL
Match: tr|A0A087Y6E1|A0A087Y6E1_POEFO (Uncharacterized protein OS=Poecilia formosa PE=3 SV=1)

HSP 1 Score: 731.865 bits (1888), Expect = 0.000e+0
Identity = 368/800 (46.00%), Postives = 498/800 (62.25%), Query Frame = 3
Query:  324 CQIANNNERLDCYPESGA--NQDSCIARGCCWSEPMRLSNKLQGVPLSIPYCYYPTDYSNYMIKSLRKSSRGIKAKLVRESPSYLPYEVAMLDLEVIYETKSRTRVRITDPKQKRYEVPMKLSPPDLKPPTDREYEVIIPSDGSFSIEIKRKSDDRSLFKS-FGPLLYSDQFLQISSIMSTDQIYGIGEQNRPFLHQLSNGWERIGLWARDNPIETFMNLYGAHPFYIGMPDDGKAFGVFHFNSNGQEFALQPAPAVTYRTIGGILDFFIFTGGSPEETVKQYLELVGKPMLPPYWSLGFHLSKWGYKNIEQLSEIFQRNINAGFPIGTQWSDIDYMENYKDFTVDKEKFNGLGRFVREIKQKYNSRFVAIVDPGISCTS-GNEYPPYYEGVFMDIFIKDSQTNQPIVGKVWPGETVYPDFTHPNISMYWYKQIQRFYNDVPIDGLWIDMNEPSNFYDGSKRGCQGNSKYDNPFFVPDIRDQSLISKTICSSALHYNNEKHYNLHNLYGYTESVTTNKALLKTIHGKRPFILSRSTFSGSGKYTFHWTGDNQASWDQLRNSIRQVLNFNMFGIPMTGADICGFNGNSDEELCIRWMQLGAFYPFMRNHNAINQRDQDPASWNTEAQKIMKTAISNRYAMLPLFYTLLVKSHMNGGTVMRPMSFEFFSDKVTHSIELQFMIGSSIMATPVVYPGARSVDAYFPAGVWYDFHSGKLLHSDAEGAWLTLDAPLDKINIALRGGHIVPLLDSNRNSKSNIPNKMTLYCGMAQDMSASGDLYWDDGESIDSYSRNRYSYVSFNAS 2711
            C     + R DCYPE      Q+ C AR CC+  P   S + +     IP+C+YP D+ +Y + S + +S G+K  LV++  +Y P ++  L++E+ +ET +R RVRITDP   R+EVP+ + P   K   + EY V + S   F + +KRKS    L  +   PL Y+DQFLQ S+ + +  IYG+GE    FLH +   W  + +WARD P     NLYG HPFY+ M D G A G F  NSN  + ALQP PA+T+RTIGGILDF++F G  P   V+QY+E++G+P +P YW+LG+HL +WGYK      E+ +R  N G P   QW+DIDYM+  KDFT D   FN L   VR++   +N  +V ++DPGIS T     Y P+ EG+   +FIKD++  + ++GKVWPG T +PDF+      +WY+ +QRF+  VP DGLWIDMNEPSNF DGS  GC  NS  +NP + P +    L SKT+C+SA       HYNLH+LYG  E+  T  AL K I  KRPF++SRSTF   G Y+ HW GDN++ W  L  SI  +L FN+ GIP+ GADICGF+    EELC+RW QLGAFYPF RNHN+++   QDP +++  A+  MK A+  RY+  P  YTL   +H+ G TV RP+ FEF  D  T+ I+ QF+ G S++ TPV+ PG   VD YFP G+WYDF++G  + S  E   L L AP+DKIN+ LR G I+P  + N     +    + L   ++ D SASGDL+WDDGE+ID+Y   RY+YV+FN S
Sbjct:  115 CSAIPESWRFDCYPEKAVVVTQELCEARSCCFI-PASGSTRGRSRKNGIPWCFYPPDFPSYSLVSSKDTSMGLKGTLVKDVKTYYPGDILTLEMEIRHETDTRLRVRITDPSSSRFEVPLSV-PTATKKAENPEYVVEL-SKQPFGLVVKRKSTGTVLLNTTVAPLFYADQFLQFSTALPSRFIYGLGEHRSTFLHDVQ--WNTLTMWARDVPPTEQTNLYGVHPFYLAMEDGGDAHGFFLLNSNAMDVALQPGPALTWRTIGGILDFYVFLGPDPGSVVQQYVEVIGQPAMPIYWALGYHLCRWGYKTSNATWEVVKRMRNYGIPQDVQWNDIDYMDQAKDFTFDPMNFNTLPDLVRDL-HAHNQTYVMMMDPGISSTQPEGSYWPFDEGLKRGVFIKDAE-GKTLIGKVWPGLTAFPDFSDEATHEWWYENLQRFHEKVPFDGLWIDMNEPSNFLDGSTVGCPSNS-LENPPYTPGVLGGLLRSKTVCASA-QQKLSTHYNLHSLYGLMEAKATASAL-KRILAKRPFVISRSTFPSHGSYSGHWLGDNRSHWKDLYTSIAGMLTFNLLGIPLVGADICGFSEEPQEELCVRWTQLGAFYPFARNHNSLDMNPQDPTAFSPSARTAMKQALLLRYSFFPFLYTLFHHAHIKGHTVARPLMFEFPKDVKTYGIDSQFLWGRSLLVTPVLEPGVDYVDGYFPEGLWYDFYTGDSVSSKGEE--LRLSAPMDKINLHLRQGSIIPTQEPNVTLWISSGQPLHLVSALSDDGSASGDLFWDDGETIDTYETERYTYVAFNVS 902          
The following BLAST results are available for this feature:
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Human)
Total hits: 5
Match NameE-valueIdentityDescription
GAA0.000e+041.17glucosidase alpha, acid [Source:HGNC Symbol;Acc:HG... [more]
GAA0.000e+041.17glucosidase alpha, acid [Source:HGNC Symbol;Acc:HG... [more]
MGAM0.000e+040.88maltase-glucoamylase [Source:HGNC Symbol;Acc:HGNC:... [more]
MGAM0.000e+040.88maltase-glucoamylase [Source:HGNC Symbol;Acc:HGNC:... [more]
SI0.000e+041.78sucrase-isomaltase [Source:HGNC Symbol;Acc:HGNC:10... [more]
back to top
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Celegans
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Celegan)
Total hits: 5
Match NameE-valueIdentityDescription
aagr-17.387e-15435.18Acid Alpha Glucosidase Relate [Source:RefSeq pept... [more]
aagr-17.387e-15435.18Acid Alpha Glucosidase Relate [Source:RefSeq pept... [more]
aagr-17.387e-15435.18Acid Alpha Glucosidase Relate [Source:RefSeq pept... [more]
aagr-26.917e-14534.28Acid Alpha Glucosidase Relate [Source:RefSeq pept... [more]
aagr-43.053e-8330.73Acid Alpha Glucosidase Relate [Source:RefSeq pept... [more]
back to top
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Fly
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Drosophila)
Total hits: 5
Match NameE-valueIdentityDescription
CG144761.717e-7628.69pep:known chromosome:BDGP6:X:21600600:21604680:-1 ... [more]
CG144761.717e-7628.69pep:known chromosome:BDGP6:X:21600600:21604936:-1 ... [more]
CG144761.717e-7628.69pep:known chromosome:BDGP6:X:21600502:21605264:-1 ... [more]
CG144761.717e-7628.69pep:known chromosome:BDGP6:X:21600600:21605264:-1 ... [more]
CG144761.717e-7628.69pep:known chromosome:BDGP6:X:21600600:21605264:-1 ... [more]
back to top
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Zebrafish)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch73-12o23.10.000e+044.84si:ch73-12o23.1 [Source:ZFIN;Acc:ZDB-GENE-130530-7... [more]
gaa0.000e+040.54glucosidase, alpha; acid (Pompe disease, glycogen ... [more]
MGAM2.632e-17035.70maltase-glucoamylase [Source:HGNC Symbol;Acc:HGNC:... [more]
ENSDART00000167477.14.037e-8134.36pep:novel chromosome:GRCz10:18:2211054:2233382:1 g... [more]
ganab4.446e-8028.85glucosidase, alpha; neutral AB [Source:ZFIN;Acc:ZD... [more]
back to top
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Xenopus
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Xenopus)
Total hits: 5
Match NameE-valueIdentityDescription
gaa0.000e+043.80glucosidase, alpha; acid [Source:Xenbase;Acc:XB-GE... [more]
mgam0.000e+041.19maltase-glucoamylase [Source:Xenbase;Acc:XB-GENE-9... [more]
ganab2.433e-8832.30glucosidase, alpha; neutral AB [Source:Xenbase;Acc... [more]
ganc6.411e-8532.73glucosidase, alpha; neutral C [Source:Xenbase;Acc:... [more]
kiaa11616.341e-1422.56KIAA1161 [Source:Xenbase;Acc:XB-GENE-6047570][more]
back to top
BLAST of Lysosomal alpha-glucosidase vs. Ensembl Mouse
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Mouse)
Total hits: 5
Match NameE-valueIdentityDescription
Gaa0.000e+041.70glucosidase, alpha, acid [Source:MGI Symbol;Acc:MG... [more]
Gaa0.000e+041.70glucosidase, alpha, acid [Source:MGI Symbol;Acc:MG... [more]
Mgam0.000e+041.89maltase-glucoamylase [Source:MGI Symbol;Acc:MGI:12... [more]
Mgam0.000e+041.89maltase-glucoamylase [Source:MGI Symbol;Acc:MGI:12... [more]
Sis0.000e+040.24sucrase isomaltase (alpha-glucosidase) [Source:MGI... [more]
back to top
BLAST of Lysosomal alpha-glucosidase vs. UniProt
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6P7A9|LYAG_RAT0.000e+041.91Lysosomal alpha-glucosidase OS=Rattus norvegicus G... [more]
sp|P70699|LYAG_MOUSE0.000e+041.70Lysosomal alpha-glucosidase OS=Mus musculus GN=Gaa... [more]
sp|Q5R7A9|LYAG_PONAB0.000e+041.03Lysosomal alpha-glucosidase OS=Pongo abelii GN=GAA... [more]
sp|P10253|LYAG_HUMAN0.000e+041.17Lysosomal alpha-glucosidase OS=Homo sapiens GN=GAA... [more]
sp|Q9MYM4|LYAG_BOVIN0.000e+041.30Lysosomal alpha-glucosidase OS=Bos taurus GN=GAA P... [more]
back to top
BLAST of Lysosomal alpha-glucosidase vs. TrEMBL
Analysis Date: 2017-05-17 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
tr|A0A1D1VXK3|A0A1D1VXK3_RAMVA0.000e+044.12Uncharacterized protein OS=Ramazzottius varieornat... [more]
tr|H2KPA9|H2KPA9_CLOSI0.000e+044.42Lysosomal alpha-glucosidase OS=Clonorchis sinensis... [more]
tr|G4V8C4|G4V8C4_SCHMA0.000e+043.58Putative alpha-glucosidase OS=Schistosoma mansoni ... [more]
tr|O73626|O73626_COTJA0.000e+043.46Acid alpha glucosidase OS=Coturnix coturnix japoni... [more]
tr|A0A087Y6E1|A0A087Y6E1_POEFO0.000e+046.00Uncharacterized protein OS=Poecilia formosa PE=3 S... [more]
back to top
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2016-09-29
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableTMHMMTMhelixcoord: 10..32
NoneNo IPR availableTMHMMTMhelixcoord: 10..27
NoneNo IPR availableTMHMMTMhelixcoord: 48..70
NoneNo IPR availableTMHMMTMhelixcoord: 5..27
NoneNo IPR availableTMHMMTMhelixcoord: 49..71
NoneNo IPR availableTMHMMTMhelixcoord: 15..37
NoneNo IPR availableSUPERFAMILYSSF51011Glycosyl hydrolase domaincoord: 693..774
NoneNo IPR availableTMHMMTMhelixcoord: 12..34
NoneNo IPR availableTMHMMTMhelixcoord: 4..26
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..23
score: 0.757
NoneNo IPR availableTMHMMTMhelixcoord: 4..21
NoneNo IPR availableTMHMMTMhelixcoord: 45..67
IPR000519P-type trefoil domainSMARTSM00018P_2coord: 39..97
e-value: 2.0E-8
score: 44.0
IPR000519P-type trefoil domainPFAMPF00088Trefoilcoord: 41..93
e-value: 1.9E-11
score: 43.5
IPR000519P-type trefoil domainGENE3DG3DSA:4.10.110.10coord: 38..104
e-value: 1.7E-12
score: 45.9
IPR000519P-type trefoil domainPROSITEPS51448P_TREFOIL_2coord: 39..94
score: 15.612
IPR000519P-type trefoil domainSUPERFAMILYSSF57492Trefoilcoord: 38..99
IPR025887Glycoside hydrolase family 31, N-terminal domainPFAMPF13802Gal_mutarotas_2coord: 219..282
e-value: 2.0E-8
score: 34.3
IPR000322Glycoside hydrolase family 31PFAMPF01055Glyco_hydro_31coord: 306..779
e-value: 4.8E-146
score: 487.2
IPR031727Galactose mutarotase, N-terminal barrelPFAMPF16863NtCtMGAM_Ncoord: 111..215
e-value: 1.6E-21
score: 76.5
IPR030459Glycosyl hydrolases family 31, conserved sitePROSITEPS00707GLYCOSYL_HYDROL_F31_2coord: 613..643
IPR030458Glycosyl hydrolases family 31, active sitePROSITEPS00129GLYCOSYL_HYDROL_F31_1coord: 481..488
IPR011013Galactose mutarotase-like domainSUPERFAMILYSSF74650Galactose mutarotase-likecoord: 87..313
IPR017853Glycoside hydrolase superfamilySUPERFAMILYSSF51445(Trans)glycosidasescoord: 525..690
coord: 315..489

Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR000519P_trefoil_dom
IPR025887Glyco_hydro_31_N_dom
IPR000322Glyco_hydro_31
IPR031727Gal_mutarotase_N
IPR030459Glyco_hydro_31_CS
IPR030458Glyco_hydro_31_AS
IPR011013Gal_mutarotase_SF_dom
IPR017853Glycoside_hydrolase_SF
Vocabulary: molecular function
TermDefinition
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0003824catalytic activity
GO:0030246carbohydrate binding
GO:0004558alpha-1,4-glucosidase activity
GO:0016787hydrolase activity
GO:0016798hydrolase activity, acting on glycosyl bonds
GO:0032450maltose alpha-glucosidase activity
Vocabulary: biological process
TermDefinition
GO:0005975carbohydrate metabolic process
GO:0000023maltose metabolic process
GO:0005980glycogen catabolic process
GO:0008152metabolic process
Vocabulary: cellular component
TermDefinition
GO:0005764lysosome
GO:0005765lysosomal membrane
GO:0016020membrane
Vocabulary: Schmidtea mediterranea Developmental Stages
TermDefinition
PLANA:0000002Stage 2
PLANA:0000006Stage 6
PLANA:0000005Stage 5
PLANA:0000003Stage 3
PLANA:0000004Stage 4
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000023temporary embryonic pharynx
PLANA:0000058embryonic digestive system
PLANA:0000059embryonic gut cell
PLANA:0000085primitive gut cell
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30028442 ID=SMED30028442|Name=Lysosomal alpha-glucosidase|organism=Schmidtea mediterranea sexual|type=transcript|length=2946bp
ATTGTTATGCAAAATTATTTTAGCAAAAATTCCGATAGGTTTTATCTAAT
TAGTAATTAAGTAGATACTTCATGCTCTTGAACTTGATTTTATTTTAAAA
TGGAGGTGTGTCGCTGATCTGGAAAAGTTTAATTTCAAATTATCTTTAAT
TAGATCATCACACCTATTTTAGTTGTTGTAGAGAGTCAAAGTTCAGCTTT
TAATTAATATATATTCAATTAAAAATTTGCAAAAAATTATTTCCATTTCA
AATGAAATTAATAATATTAATAAGTTTTATTAATTTGATTTCGTTATTCA
ACTTTTCCAACGCGACAGCACAATGTCAAATAGCCAATAACAATGAGAGA
CTTGATTGCTACCCAGAATCCGGAGCCAATCAAGATTCATGTATAGCAAG
GGGGTGTTGCTGGTCCGAACCAATGAGATTGTCCAATAAATTGCAAGGTG
TTCCACTATCAATCCCATATTGCTATTATCCAACTGATTATTCCAACTAT
ATGATTAAATCCTTAAGAAAATCTTCAAGAGGGATCAAAGCAAAATTAGT
CAGGGAATCACCAAGTTATTTACCCTATGAAGTTGCAATGTTAGATCTTG
AGGTAATTTATGAAACAAAATCTAGAACTCGAGTCAGAATAACAGATCCT
AAACAAAAAAGATATGAAGTTCCAATGAAACTCAGTCCTCCAGATTTGAA
GCCACCGACTGATCGAGAATATGAAGTCATAATCCCATCTGATGGTTCAT
TTTCTATTGAAATTAAACGAAAATCAGATGATCGTTCACTTTTCAAATCA
TTTGGGCCACTTTTATATTCTGATCAATTTTTACAAATATCTTCAATAAT
GTCAACTGATCAAATCTATGGAATAGGAGAACAAAATAGACCCTTTCTTC
ATCAATTATCCAATGGCTGGGAAAGAATTGGATTGTGGGCAAGAGACAAT
CCGATTGAAACATTTATGAATCTTTATGGAGCTCATCCATTTTATATCGG
TATGCCAGACGATGGAAAAGCTTTCGGTGTTTTTCACTTTAATAGTAATG
GTCAAGAATTCGCTTTACAACCGGCACCAGCAGTAACTTATAGAACAATC
GGTGGAATTTTAGATTTCTTTATTTTTACCGGAGGCAGCCCTGAAGAAAC
AGTAAAACAATACCTAGAATTGGTAGGAAAGCCAATGCTTCCTCCATATT
GGTCTCTTGGATTCCATCTGTCAAAATGGGGTTACAAAAATATTGAGCAA
TTGTCTGAAATATTTCAAAGAAATATTAATGCCGGTTTCCCAATCGGTAC
TCAGTGGAGTGATATAGATTATATGGAAAATTATAAAGATTTTACTGTCG
ACAAAGAGAAATTTAATGGATTGGGAAGATTTGTCAGAGAGATTAAACAA
AAATATAACTCTAGATTTGTTGCAATTGTTGATCCAGGAATAAGCTGCAC
AAGTGGTAACGAATATCCACCTTATTATGAAGGAGTATTTATGGATATTT
TCATCAAAGATTCACAGACCAATCAACCAATTGTTGGCAAGGTTTGGCCC
GGAGAAACAGTTTATCCAGACTTCACTCATCCGAACATTTCTATGTATTG
GTATAAACAAATTCAACGCTTTTATAATGATGTTCCAATTGATGGGCTTT
GGATTGATATGAATGAGCCATCTAATTTCTACGATGGTTCCAAAAGAGGC
TGTCAAGGAAATAGTAAATATGACAATCCATTTTTTGTACCGGATATTCG
AGATCAGTCATTAATATCTAAAACTATTTGTTCTTCAGCACTCCATTACA
ATAACGAAAAGCATTATAATTTGCACAATCTCTACGGCTATACGGAATCA
GTAACAACAAATAAAGCATTATTAAAAACGATACACGGAAAAAGACCTTT
TATTTTATCCCGGTCAACTTTCAGTGGATCTGGTAAATATACCTTCCATT
GGACCGGGGATAATCAAGCAAGTTGGGATCAGTTAAGAAATTCCATTAGA
CAAGTGCTTAATTTCAACATGTTTGGTATTCCGATGACTGGTGCTGACAT
TTGTGGATTTAACGGTAACAGTGATGAAGAACTCTGTATTAGATGGATGC
AATTGGGCGCTTTTTATCCATTCATGAGGAACCACAATGCAATCAACCAG
AGAGATCAAGATCCAGCTTCATGGAATACGGAAGCCCAGAAAATAATGAA
AACAGCTATTTCTAATCGTTATGCAATGTTGCCTTTATTTTATACATTAT
TAGTCAAATCCCATATGAATGGTGGCACCGTAATGAGACCAATGAGCTTT
GAATTCTTTTCAGATAAAGTAACGCATTCTATAGAATTACAGTTTATGAT
TGGATCCTCGATTATGGCAACTCCAGTTGTTTATCCTGGGGCCAGATCTG
TAGATGCATATTTTCCAGCTGGAGTCTGGTACGATTTTCACAGTGGAAAA
TTGTTACATTCAGATGCTGAAGGAGCTTGGTTGACTTTGGATGCTCCTTT
GGACAAAATTAATATTGCATTACGCGGCGGTCATATAGTTCCTCTATTGG
ATTCCAATAGAAATTCTAAATCAAACATACCAAATAAAATGACATTGTAT
TGCGGAATGGCACAAGATATGAGTGCTTCTGGAGATTTATATTGGGACGA
TGGCGAGAGCATTGACTCCTACTCACGCAATAGATATAGCTATGTATCAT
TCAATGCTAGCCCTGAGCAACTGTTAATAACACCGGTTTACTTTGGCTAC
GACTTGTTGCCGGTCTTAAACAAAATCGTAATCCTTGGGTTTGAGAATAA
GTCAATTACTAAATTTCTATTAAATGACAATGATATTCCTTTCCATTATA
ATCCGGAGACTTCATCTGTGGTGCTCAGCAGTTTAAATGCCAATTTAAAT
TCCGAAATAAAAATTCAATGGATGTGAATAATTTTTTGTATTTTAT
back to top

protein sequence of SMED30028442-orf-1

>SMED30028442-orf-1 ID=SMED30028442-orf-1|Name=SMED30028442-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=892bp
MKLIILISFINLISLFNFSNATAQCQIANNNERLDCYPESGANQDSCIAR
GCCWSEPMRLSNKLQGVPLSIPYCYYPTDYSNYMIKSLRKSSRGIKAKLV
RESPSYLPYEVAMLDLEVIYETKSRTRVRITDPKQKRYEVPMKLSPPDLK
PPTDREYEVIIPSDGSFSIEIKRKSDDRSLFKSFGPLLYSDQFLQISSIM
STDQIYGIGEQNRPFLHQLSNGWERIGLWARDNPIETFMNLYGAHPFYIG
MPDDGKAFGVFHFNSNGQEFALQPAPAVTYRTIGGILDFFIFTGGSPEET
VKQYLELVGKPMLPPYWSLGFHLSKWGYKNIEQLSEIFQRNINAGFPIGT
QWSDIDYMENYKDFTVDKEKFNGLGRFVREIKQKYNSRFVAIVDPGISCT
SGNEYPPYYEGVFMDIFIKDSQTNQPIVGKVWPGETVYPDFTHPNISMYW
YKQIQRFYNDVPIDGLWIDMNEPSNFYDGSKRGCQGNSKYDNPFFVPDIR
DQSLISKTICSSALHYNNEKHYNLHNLYGYTESVTTNKALLKTIHGKRPF
ILSRSTFSGSGKYTFHWTGDNQASWDQLRNSIRQVLNFNMFGIPMTGADI
CGFNGNSDEELCIRWMQLGAFYPFMRNHNAINQRDQDPASWNTEAQKIMK
TAISNRYAMLPLFYTLLVKSHMNGGTVMRPMSFEFFSDKVTHSIELQFMI
GSSIMATPVVYPGARSVDAYFPAGVWYDFHSGKLLHSDAEGAWLTLDAPL
DKINIALRGGHIVPLLDSNRNSKSNIPNKMTLYCGMAQDMSASGDLYWDD
GESIDSYSRNRYSYVSFNASPEQLLITPVYFGYDLLPVLNKIVILGFENK
SITKFLLNDNDIPFHYNPETSSVVLSSLNANLNSEIKIQWM*
back to top