SMED30028437
Overview
Neoblast Clusters
Zeng et. al., 2018▻ Overview▻ Neoblast Population▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population
Overview
Single cell RNA-seq of pluripotent neoblasts and its early progeniesWe isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)Explore this single cell expression dataset with our NB Cluster Shiny App
Neoblast Population
Sub-lethal Irradiated Surviving X1 and X2 Cell Population
Embryonic Expression
Davies et. al., 2017
Hover the mouse over a column in the graph to view average RPKM values per sample. Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult. back to top Anatomical Expression
PAGE et. al., 2020SMED30028437 has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGEPAGE Curations: 6
Homology
BLAST of SMED30028437 vs. Ensembl Human
Match: SETMAR (SET domain and mariner transposase fusion gene [Source:HGNC Symbol;Acc:HGNC:10762]) HSP 1 Score: 52.373 bits (124), Expect = 3.170e-8 Identity = 25/57 (43.86%), Postives = 35/57 (61.40%), Query Frame = 2 Query: 341 LKNHDLRLFYLYEWKSKNNSVEAERNINNAFGSDTANEGTIRLWF*KIDEGEIYLEN 511 L +R +L+E+K + E RNINNAFG TANE T++ WF K +G+ LE+ Sbjct: 110 LDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLED 166
BLAST of SMED30028437 vs. Ensembl Human
Match: SETMAR (SET domain and mariner transposase fusion gene [Source:HGNC Symbol;Acc:HGNC:10762]) HSP 1 Score: 53.1434 bits (126), Expect = 4.199e-8 Identity = 25/57 (43.86%), Postives = 35/57 (61.40%), Query Frame = 2 Query: 341 LKNHDLRLFYLYEWKSKNNSVEAERNINNAFGSDTANEGTIRLWF*KIDEGEIYLEN 511 L +R +L+E+K + E RNINNAFG TANE T++ WF K +G+ LE+ Sbjct: 346 LDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLED 402
BLAST of SMED30028437 vs. Ensembl Human
Match: SETMAR (SET domain and mariner transposase fusion gene [Source:HGNC Symbol;Acc:HGNC:10762]) HSP 1 Score: 52.7582 bits (125), Expect = 4.859e-8 Identity = 25/57 (43.86%), Postives = 35/57 (61.40%), Query Frame = 2 Query: 341 LKNHDLRLFYLYEWKSKNNSVEAERNINNAFGSDTANEGTIRLWF*KIDEGEIYLEN 511 L +R +L+E+K + E RNINNAFG TANE T++ WF K +G+ LE+ Sbjct: 207 LDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLED 263
BLAST of SMED30028437 vs. UniProt/SwissProt
Match: sp|Q53H47|SETMR_HUMAN (Histone-lysine N-methyltransferase SETMAR OS=Homo sapiens OX=9606 GN=SETMAR PE=1 SV=2) HSP 1 Score: 53.1434 bits (126), Expect = 2.017e-7 Identity = 25/57 (43.86%), Postives = 35/57 (61.40%), Query Frame = 2 Query: 341 LKNHDLRLFYLYEWKSKNNSVEAERNINNAFGSDTANEGTIRLWF*KIDEGEIYLEN 511 L +R +L+E+K + E RNINNAFG TANE T++ WF K +G+ LE+ Sbjct: 346 LDKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLED 402
BLAST of SMED30028437 vs. TrEMBL
Match: A0A0L7QRG0 (Histone-lysine N-methyltransferase SETMAR OS=Habropoda laboriosa OX=597456 GN=WH47_06699 PE=4 SV=1) HSP 1 Score: 59.6918 bits (143), Expect = 1.289e-8 Identity = 26/52 (50.00%), Postives = 35/52 (67.31%), Query Frame = 2 Query: 341 LKNHDLRLFYLYEWKSKNNSVEAERNINNAFGSDTANEGTIRLWF*KIDEGE 496 + D R+ +LYEWKS +N+ A RNIN AFG+DT NE +R WF K + G+ Sbjct: 1 MNQRDFRVIFLYEWKSGHNAAVAARNINAAFGNDTVNERAVRRWFEKFEAGD 52
BLAST of SMED30028437 vs. TrEMBL
Match: A0A016TST4 (HTH_48 domain-containing protein OS=Ancylostoma ceylanicum OX=53326 GN=Acey_s0082.g1596 PE=4 SV=1) HSP 1 Score: 57.7658 bits (138), Expect = 2.027e-7 Identity = 24/57 (42.11%), Postives = 36/57 (63.16%), Query Frame = 2 Query: 341 LKNHDLRLFYLYEWKSKNNSVEAERNINNAFGSDTANEGTIRLWF*KIDEGEIYLEN 511 + D R+ LYE+K +++ EA RN+ FG+D+ EGT+R WF KI G+ LE+ Sbjct: 2 VSRRDFRVIMLYEFKLSHSAAEAARNMALVFGTDSPPEGTVRCWFAKISPGDFDLED 58
BLAST of SMED30028437 vs. TrEMBL
Match: A0A016TM03 (HTH_48 domain-containing protein OS=Ancylostoma ceylanicum OX=53326 GN=Acey_s0092.g2564 PE=4 SV=1) HSP 1 Score: 55.8398 bits (133), Expect = 4.544e-7 Identity = 24/53 (45.28%), Postives = 35/53 (66.04%), Query Frame = 2 Query: 353 DLRLFYLYEWKSKNNSVEAERNINNAFGSDTANEGTIRLWF*KIDEGEIYLEN 511 D R+ LYE+K +++ EA RNI AFG+D+ +EGT+R WF K G+ E+ Sbjct: 6 DFRVIMLYEFKLSHSAAEAARNIALAFGTDSPSEGTVRCWFAKFSSGDFDFED 58
BLAST of SMED30028437 vs. TrEMBL
Match: A0A016TF96 (HTH_48 domain-containing protein OS=Ancylostoma ceylanicum OX=53326 GN=Acey_s0108.g49 PE=4 SV=1) HSP 1 Score: 55.8398 bits (133), Expect = 1.167e-6 Identity = 25/57 (43.86%), Postives = 36/57 (63.16%), Query Frame = 2 Query: 341 LKNHDLRLFYLYEWKSKNNSVEAERNINNAFGSDTANEGTIRLWF*KIDEGEIYLEN 511 + D R+ LYE+K +++ EA RN+ AFGSD+ +E T+R WF KI G LE+ Sbjct: 2 VSRRDFRVIMLYEFKLSHSAAEAARNMALAFGSDSPSETTVRCWFAKISSGNFDLED 58
BLAST of SMED30028437 vs. TrEMBL
Match: A0A016V6Q7 (HTH_48 domain-containing protein OS=Ancylostoma ceylanicum OX=53326 GN=Acey_s0016.g3034 PE=4 SV=1) HSP 1 Score: 55.0694 bits (131), Expect = 1.457e-6 Identity = 24/57 (42.11%), Postives = 37/57 (64.91%), Query Frame = 2 Query: 341 LKNHDLRLFYLYEWKSKNNSVEAERNINNAFGSDTANEGTIRLWF*KIDEGEIYLEN 511 + D R+ LYE+K +++ EA RN+ AFG+D+A+E T+R WF K G+ LE+ Sbjct: 2 VSRRDFRVIMLYEFKLSHSAAEAARNMALAFGTDSASERTVRCWFAKFSSGDFDLED 58 The following BLAST results are available for this feature:
BLAST of SMED30028437 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99) Total hits: 3
BLAST of SMED30028437 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99) Total hits: 0
BLAST of SMED30028437 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99) Total hits: 0
BLAST of SMED30028437 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99) Total hits: 0
BLAST of SMED30028437 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99) Total hits: 0
BLAST of SMED30028437 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99) Total hits: 0
BLAST of SMED30028437 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt) Total hits: 1
BLAST of SMED30028437 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL) Total hits: 5
BLAST of SMED30028437 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99) Total hits: 0
BLAST of SMED30028437 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99) Total hits: 0
BLAST of SMED30028437 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46) Total hits: 0
BLAST of SMED30028437 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46) Total hits: 0
BLAST of SMED30028437 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99) Total hits: 0
BLAST of SMED30028437 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST) Total hits: 0
Analyses
This transcript is derived from or has results from the following analyses Sequences
The following sequences are available for this feature:
transcript sequence >SMED30028437 ID=SMED30028437|Name=SMED30028437|organism=Schmidtea mediterranea sexual|type=transcript|length=511bpback to top Annotated Terms
The following terms have been associated with this transcript:
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
|