Leishmanolysin-like peptidase

Overview
NameLeishmanolysin-like peptidase
Smed IDSMED30028423
Length (bp)2031
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Leishmanolysin-like peptidase (SMED30028423) t-SNE clustered cells

Violin plots show distribution of expression levels for Leishmanolysin-like peptidase (SMED30028423) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Leishmanolysin-like peptidase (SMED30028423) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Leishmanolysin-like peptidase (SMED30028423) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30028423

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30028423SMESG000008405.1 SmedASXL_014232SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30028423SMESG000008405.1 SmedASXL_072960SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
protonephridiaSMED30028423SMESG000008405.1 dd_Smed_v4_2320_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30028423SMESG000008405.1 dd_Smed_v4_2320_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30028423SMESG000008405.1 Contig40014newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30028423SMESG000008405.1 Contig40014uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30028423SMESG000008405.1 dd_Smed_v6_2320_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30028423SMESG000008405.1 dd_Smed_v4_2320_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30028423SMESG000008405.1 dd_Smed_v4_2320_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30028423SMESG000008405.1 dd_Smed_v4_2320_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Leishmanolysin-like peptidase vs. Ensembl Human
Match: LMLN (leishmanolysin like peptidase [Source:HGNC Symbol;Acc:HGNC:15991])

HSP 1 Score: 248.825 bits (634), Expect = 3.349e-72
Identity = 157/467 (33.62%), Postives = 229/467 (49.04%), Query Frame = 1
Query:  193 CDHKIPPVSELVVGIEPGPLPPNARLKRATSQNLRIYFDYQSSFTS--SSFAEALKTNLMEPAKNVLQSIITPKSPNNGLLLVDRSCTNSMMRLNSKNQKGCAYGCT-QTECLGIVVPSVYLKACKIVDSLGNFQTTGS----DGAGISDIDIVL----LVTYTNCSANTLAYAGSCFMENVLDRPILGVVNLCSNMIDPYTNTQSYTKV---IIHEIIHSLGFSVDKYAFYRYQDGSPIVPRNAYGFPNLGVSANGYYNWNENIIKPIVRQ---RNSVNSAYTVNFYGFVLPNVLAAARVHFDCPTLEAVDLEDYGGASSAYSHFDEYFLFNELMTPQSNGAMDFLSRITLALLQDTGWYNVDFSAVGNFDYGRKKGCVLPEKGCYNYMQMRESKSLTLDPLCNTALVYGNILGCSIYRNYFYRCNLIKYTS-VPPNLQYFKSLPGIPSADVQFYAGLSPYNEYCP 1539
            C H +P  +E++  +    L  N  +KR   ++LRI   Y  S           +K  L   A + L+     + P   +LL  +  TN  +R  +   + C   C   T+C  ++VP  +L+ C++    G     G+    D  GISD D VL    L T      N ++YA  C  E  +DRPI G  NLC NMI   T  Q +  +   + HE+IH+LGFS   +AFY  +DG+P+  R A G P    S  G Y W++ +++ + R    R++    +TV  Y  V P V+  AR HFDCP LE ++LE+ GG  +  +H+++  L NE MT  S+     LSRITLAL++DTGWY  ++S     D+GR  GC    K C  ++  +  K   L P C+T       L C   +     CNL K+   +P   QYF  L GIP+ D+ +Y G     +YCP
Sbjct:   64 CRHHVPSDTEVINKVH---LKANHVVKRDVDEHLRIKTVYDKSVEELLPEKKNLVKNKLFPQAISYLEKTFQVRRPAGTILLSRQCATNQYLRKENDPHRYCTGECAAHTKCGPVIVPEEHLQQCRVYR--GGKWPHGAVGVPDQEGISDADFVLYVGALATERCSHENIISYAAYCQQEANMDRPIAGYANLCPNMIS--TQPQEFVGMLSTVKHEVIHALGFSAGLFAFYHDKDGNPLTSRFADGLPPFNYSL-GLYQWSDKVVRKVERLWDVRDNKIVRHTV--YLLVTPRVVEEARKHFDCPVLEGMELENQGGVGTELNHWEKRLLENEAMT-GSHTQNRVLSRITLALMEDTGWYKANYSMAEKLDWGRGMGCDFVRKSCKFWIDQQRQKRQMLSPYCDTLRSNPLQLTCRQDQRAVAVCNLQKFPKPLPQEYQYFDELSGIPAEDLPYYGGSVEIADYCP 519          
BLAST of Leishmanolysin-like peptidase vs. Ensembl Human
Match: LMLN (leishmanolysin like peptidase [Source:HGNC Symbol;Acc:HGNC:15991])

HSP 1 Score: 245.358 bits (625), Expect = 1.835e-71
Identity = 157/469 (33.48%), Postives = 227/469 (48.40%), Query Frame = 1
Query:  226 VVGIEPGPLP-------------PNARLKRATSQNLRIYFDYQSSFTS--SSFAEALKTNLMEPAKNVLQSIITPKSPNNGLLLVDRSCTNSMMRLNSKNQKGCAYGCT-QTECLGIVVPSVYLKACKIVDSLGNFQTTGS----DGAGISDIDIVL----LVTYTNCSANTLAYAGSCFMENVLDRPILGVVNLCSNMIDPYTNTQSYTKV---IIHEIIHSLGFSVDKYAFYRYQDGSPIVPRNAYGFPNLGVSANGYYNWNENIIKPIVRQ---RNSVNSAYTVNFYGFVLPNVLAAARVHFDCPTLEAVDLEDYGGASSAYSHFDEYFLFNELMTPQSNGAMDFLSRITLALLQDTGWYNVDFSAVGNFDYGRKKGCVLPEKGCYNYMQMRESKSLTLDPLCNTALVYGNILGCSIYRNYFYRCNLIKYTS-VPPNLQYFKSLPGIPSADVQFYAGLSPYNEYCP 1539
            ++G+ PGP P              N  +KR   ++LRI   Y  S           +K  L   A + L+     + P   +LL  +  TN  +R  +   + C   C   T+C  ++VP  +L+ C++    G     G+    D  GISD D VL    L T      N ++YA  C  E  +DRPI G  NLC NMI   T  Q +  +   + HE+IH+LGFS   +AFY  +DG+P+  R A G P    S  G Y W++ +++ + R    R++    +TV  Y  V P V+  AR HFDCP LE ++LE+ GG  +  +H+++  L NE MT  S+     LSRITLAL++DTGWY  ++S     D+GR  GC    K C  ++  +  K   L P C+T       L C   +     CNL K+   +P   QYF  L GIP+ D+ +Y G     +YCP
Sbjct:    7 LLGLRPGPEPVALERVINKVHLKANHVVKRDVDEHLRIKTVYDKSVEELLPEKKNLVKNKLFPQAISYLEKTFQVRRPAGTILLSRQCATNQYLRKENDPHRYCTGECAAHTKCGPVIVPEEHLQQCRVYR--GGKWPHGAVGVPDQEGISDADFVLYVGALATERCSHENIISYAAYCQQEANMDRPIAGYANLCPNMIS--TQPQEFVGMLSTVKHEVIHALGFSAGLFAFYHDKDGNPLTSRFADGLPPFNYSL-GLYQWSDKVVRKVERLWDVRDNKIVRHTV--YLLVTPRVVEEARKHFDCPVLEGMELENQGGVGTELNHWEKRLLENEAMT-GSHTQNRVLSRITLALMEDTGWYKANYSMAEKLDWGRGMGCDFVRKSCKFWIDQQRQKRQMLSPYCDTLRSNPLQLTCRQDQRAVAVCNLQKFPKPLPQEYQYFDELSGIPAEDLPYYGGSVEIADYCP 467          
BLAST of Leishmanolysin-like peptidase vs. Ensembl Human
Match: LMLN (leishmanolysin like peptidase [Source:HGNC Symbol;Acc:HGNC:15991])

HSP 1 Score: 204.142 bits (518), Expect = 3.007e-56
Identity = 148/467 (31.69%), Postives = 214/467 (45.82%), Query Frame = 1
Query:  193 CDHKIPPVSELVVGIEPGPLPPNARLKRATSQNLRIYFDYQSSFTS--SSFAEALKTNLMEPAKNVLQSIITPKSPNNGLLLVDRSCTNSMMRLNSKNQKGCAYGCT-QTECLGIVVPSVYLKACKIVDSLGNFQTTGS----DGAGISDIDIVL----LVTYTNCSANTLAYAGSCFMENVLDRPILGVVNLCSNMIDPYTNTQSYTKV---IIHEIIHSLGFSVDKYAFYRYQDGSPIVPRNAYGFPNLGVSANGYYNWNENIIKPIVRQ---RNSVNSAYTVNFYGFVLPNVLAAARVHFDCPTLEAVDLEDYGGASSAYSHFDEYFLFNELMTPQSNGAMDFLSRITLALLQDTGWYNVDFSAVGNFDYGRKKGCVLPEKGCYNYMQMRESKSLTLDPLCNTALVYGNILGCSIYRNYFYRCNLIKYTS-VPPNLQYFKSLPGIPSADVQFYAGLSPYNEYCP 1539
            C H +P  +E++  +    L  N  +KR   ++LRI   Y  S           +K  L   A + L+     + P   +LL  +  TN  +R  +   + C   C   T+C  ++VP  +L+ C++    G     G+    D  GISD D VL    L T      N ++YA  C  E  +DRPI G  NLC NMI   T  Q +  +   + HE+IH+LGFS   +AFY  +DG+P+  R A G P    S  G Y W++ +++ + R    R++    +TV  Y  V P V+  AR HFDCP LE ++LE+ GG  +  +H+++  L NE MT  S+     LSRITLAL++DTG                               QM       L P C+T       L C   +     CNL K+   +P   QYF  L GIP+ D+ +Y G     +YCP
Sbjct:   64 CRHHVPSDTEVINKVH---LKANHVVKRDVDEHLRIKTVYDKSVEELLPEKKNLVKNKLFPQAISYLEKTFQVRRPAGTILLSRQCATNQYLRKENDPHRYCTGECAAHTKCGPVIVPEEHLQQCRVYR--GGKWPHGAVGVPDQEGISDADFVLYVGALATERCSHENIISYAAYCQQEANMDRPIAGYANLCPNMIS--TQPQEFVGMLSTVKHEVIHALGFSAGLFAFYHDKDGNPLTSRFADGLPPFNYSL-GLYQWSDKVVRKVERLWDVRDNKIVRHTV--YLLVTPRVVEEARKHFDCPVLEGMELENQGGVGTELNHWEKRLLENEAMT-GSHTQNRVLSRITLALMEDTG------------------------------RQM-------LSPYCDTLRSNPLQLTCRQDQRAVAVCNLQKFPKPLPQEYQYFDELSGIPAEDLPYYGGSVEIADYCP 482          
BLAST of Leishmanolysin-like peptidase vs. Ensembl Human
Match: LMLN (leishmanolysin like peptidase [Source:HGNC Symbol;Acc:HGNC:15991])

HSP 1 Score: 201.06 bits (510), Expect = 1.682e-55
Identity = 148/469 (31.56%), Postives = 212/469 (45.20%), Query Frame = 1
Query:  226 VVGIEPGPLP-------------PNARLKRATSQNLRIYFDYQSSFTS--SSFAEALKTNLMEPAKNVLQSIITPKSPNNGLLLVDRSCTNSMMRLNSKNQKGCAYGCT-QTECLGIVVPSVYLKACKIVDSLGNFQTTGS----DGAGISDIDIVL----LVTYTNCSANTLAYAGSCFMENVLDRPILGVVNLCSNMIDPYTNTQSYTKV---IIHEIIHSLGFSVDKYAFYRYQDGSPIVPRNAYGFPNLGVSANGYYNWNENIIKPIVRQ---RNSVNSAYTVNFYGFVLPNVLAAARVHFDCPTLEAVDLEDYGGASSAYSHFDEYFLFNELMTPQSNGAMDFLSRITLALLQDTGWYNVDFSAVGNFDYGRKKGCVLPEKGCYNYMQMRESKSLTLDPLCNTALVYGNILGCSIYRNYFYRCNLIKYTS-VPPNLQYFKSLPGIPSADVQFYAGLSPYNEYCP 1539
            ++G+ PGP P              N  +KR   ++LRI   Y  S           +K  L   A + L+     + P   +LL  +  TN  +R  +   + C   C   T+C  ++VP  +L+ C++    G     G+    D  GISD D VL    L T      N ++YA  C  E  +DRPI G  NLC NMI   T  Q +  +   + HE+IH+LGFS   +AFY  +DG+P+  R A G P    S  G Y W++ +++ + R    R++    +TV  Y  V P V+  AR HFDCP LE ++LE+ GG  +  +H+++  L NE MT  S+     LSRITLAL++DTG                               QM       L P C+T       L C   +     CNL K+   +P   QYF  L GIP+ D+ +Y G     +YCP
Sbjct:    7 LLGLRPGPEPVALERVINKVHLKANHVVKRDVDEHLRIKTVYDKSVEELLPEKKNLVKNKLFPQAISYLEKTFQVRRPAGTILLSRQCATNQYLRKENDPHRYCTGECAAHTKCGPVIVPEEHLQQCRVYR--GGKWPHGAVGVPDQEGISDADFVLYVGALATERCSHENIISYAAYCQQEANMDRPIAGYANLCPNMIS--TQPQEFVGMLSTVKHEVIHALGFSAGLFAFYHDKDGNPLTSRFADGLPPFNYSL-GLYQWSDKVVRKVERLWDVRDNKIVRHTV--YLLVTPRVVEEARKHFDCPVLEGMELENQGGVGTELNHWEKRLLENEAMT-GSHTQNRVLSRITLALMEDTG------------------------------RQM-------LSPYCDTLRSNPLQLTCRQDQRAVAVCNLQKFPKPLPQEYQYFDELSGIPAEDLPYYGGSVEIADYCP 430          
BLAST of Leishmanolysin-like peptidase vs. Ensembl Human
Match: LMLN2 (leishmanolysin like peptidase 2 [Source:HGNC Symbol;Acc:HGNC:53647])

HSP 1 Score: 79.7221 bits (195), Expect = 7.460e-15
Identity = 71/267 (26.59%), Postives = 110/267 (41.20%), Query Frame = 1
Query:  517 CLGIVVPSVYLKACKIVDSLGNFQTTGSDGAGISDIDIVLLVTYTNCSA-----NTLAYAGSCFMENVLDRPILGVVNLCS-NMIDPYTNTQSYTKVIIHEIIHSLGFSVDKYAFYRYQDGSPIVPRNAYGFPNLGVSANGYYNWNENIIKPIVRQRNSVNSAYTVNFYGFVLPNVLAAARVHFDCPTLEAVDLEDYGGASSAYSHFDEYFLFNELMTPQSNGAMDF-LSRITLALLQDTGWYNVDFSAVGNFDYGRKKGCVLPEKG 1296
            CLG  +P  +L+   +    G  Q    DG G+ + D +L V   + S      + +AYA  C +++  DRP+ G +  C+ ++  P  +        +HE++H+LGFS     F +++D          GF             N +  + + RQ        T       L   L  +      P      LE+  G  S  SH++   L   LMT   +GA    L  ITLA  +D+GWY V+ SA     +G+  G   PE G
Sbjct:  124 CLGAKIPDTHLRGYALWPEQGPPQLVQPDGPGVQNTDFLLYVRVAHTSKCHQEPSVIAYAACCQLDSE-DRPLAGTIVYCAQHLTSPSLSHSDIVMATLHELLHALGFS--GQLFKKWRD-------CPSGF---------SVRENCSTRQLVTRQDEWGQLLLTTPAVSLSLAKHLGVSGASLGVP------LEEEEGLLS--SHWEARLLQGSLMTATFDGAQRTRLDPITLAAFKDSGWYQVNHSAAEELLWGQGSG---PEFG 360          
BLAST of Leishmanolysin-like peptidase vs. Ensembl Celegans
Match: Y43F4A.1 (Leishmanolysin-like peptidase [Source:UniProtKB/Swiss-Prot;Acc:O62446])

HSP 1 Score: 202.601 bits (514), Expect = 4.485e-56
Identity = 133/433 (30.72%), Postives = 205/433 (47.34%), Query Frame = 1
Query:  292 LRIYFDYQSSFT--SSSFAEALKTNLMEPAKNVLQSIITPKSPNNGLLLVDRSCTNSMMRLNSKNQK-GCAYGCTQ-TECLGIVVPSVYLKACKIVDSLGNFQTTGSDGAGISDIDIVLLVTYTN---CSA-NTLAYAGSCFMENVLDRPILGVVNLCSNMIDPYTNT-QSYTKVIIHEIIHSLGFSVDKYAFYRYQDGSPIVPRNAYGFPNLGVSANGYYNWNENIIKPIVRQRNSVNSAYTVN-FYGFVLPNVLAAARVHFDCPTLEAVDLEDYGGASSAYSHFDEYFLFNELMTPQSNGAMDFLSRITLALLQDTGWYNVDFSAVGNFDYGRKKGCVLPEKGCYNYMQMRESKSLTLD--PLCNTALVYGN----ILGCSIYRNYFYRCNLIKY-TSVPPNLQYFKSLPGIPSADVQFYAGLSPYNEYCP 1539
            LRI   Y  S    ++     + T L+  A    ++ +  + P    + + R C +S        +   C  GC + T C    +P  +L  C   ++  + +TTG  G G+ D D +L VT  +   C    TL+YA  C  E   DRPI G VNLC + +  + +  +  T  + HEI+H+LGFSV  YAF+R  +G P   RN YG P       GYY+W+ N I  ++R+         ++  +  V P V   AR HF C  LE  +LE+ GG  +  +H+++    NE MT  ++      SR+TLA L+DTGWY  ++    +  +G++ GC    K C  ++   E K L  D  P C+     G+    I  C+  R+    CNL+ +   +P   + F SLPG+     ++Y G     +YCP
Sbjct:   70 LRIQLHYDKSIQNLTAEVQNFVNTTLLPEAVGYWENALRVR-PMTTPIRLRRKCISSFYYYKQGMRNVACDKGCRERTTCGEADIPRDHLLDCLACNNTDDCKTTGELGEGVKDTDFILYVTAHDSKRCEGPETLSYAAHCQQEADFDRPIAGNVNLCPSALSVHNHDYEILTSTVKHEILHALGFSVGLYAFFRDSEGKPRTKRNRYGRPTSLNKQKGYYDWDSNTITTVLRENWWTGEGKVIHPIHMMVTPKVREEARRHFGCDKLEGAELENQGGEGTYLTHWEKRAYENEAMT-GTHTQNPVYSRLTLAFLEDTGWYQPNYEVAEDLHWGKQLGCDFAMKSCGEWIH--EKKILGEDAYPYCSDIKHDGSKSMAITRCTTQRDSLALCNLVPFQKELPSQYRNFMSLPGVNPDGAKYYGGSVEMADYCP 498          
BLAST of Leishmanolysin-like peptidase vs. Ensembl Celegans
Match: T13B5.9 (pep chromosome:WBcel235:II:1101371:1104509:-1 gene:WBGene00020476.1 transcript:T13B5.9.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:T13B5.9)

HSP 1 Score: 62.003 bits (149), Expect = 5.097e-10
Identity = 54/232 (23.28%), Postives = 100/232 (43.10%), Query Frame = 1
Query:  709 DRPILGVVNLCSNMIDPYTNTQSYTKVIIHEIIHSLGFSVDKYAFYRYQDGSPIVPRNAYGFPNLGVSANGYYNWNENIIKPIVRQRNSVNSAYTVNFYGFVLPNVLAAARVHFDCPTLEAVDLEDYGGASSAYSHFDEYFLFNELMTPQSNGAMDFLSRITLALLQDT-----GWYNVDFSAVG----NFDYGRKKGCVLPEKGCYNYMQMRESKS--LTLDPLCNTALVY 1371
            +RP L V+++C        N+  +  +  HEI+H LG+ +         D S +  + +  +   G +       N+ I  P +R        + ++F    L     AA++HF+C  +  V  +         +H +EY   NELMT       +  S I++ +++ T      WY+++ + +      + YG+K GC   E  C +++++ E     L L P C  +L Y
Sbjct:  132 NRPPLAVMSICLQNSPRPRNSGFFFDLFRHEILHGLGYGL-------IIDKSKLTEKKSEKYIWHGAN-------NQKI--PSIR--------HFLDFDELSL----KAAKIHFNCQNMAGVQAD-----GELKNHLNEYIFGNELMTTHLEPHGNVFSWISVGIIERTFNGEKQWYHINGTFISTEANQYSYGKKFGCEFLENSCEDFLKIAEKHKIGLKLAPFCRKSLCY 330          
BLAST of Leishmanolysin-like peptidase vs. Ensembl Fly
Match: Invadolysin (gene:FBgn0086359 transcript:FBtr0082181)

HSP 1 Score: 215.312 bits (547), Expect = 2.549e-60
Identity = 140/477 (29.35%), Postives = 217/477 (45.49%), Query Frame = 1
Query:  187 HVCDHKIPPVSELVVGI---------EPGPLPPNARLKR---ATSQNLRIYFDYQSS---FTSSSFAEALKTNLMEPAKNVLQSIITPKSPNNGLLLVDRSCTNSMMRLNSKNQKGCAYGCTQTECLGIVVPSVYLKACKIVDSLGN---FQTTGSDGAGISDIDIVLLVTYTNCS----ANTLAYAGSCFMENVLDRPILGVVNLCSNMIDPY-TNTQSYTKVIIHEIIHSLGFSVDKYAFYRYQDGSPIVPRNA-YGFPNLGVSANGYYNWNENIIKPIVRQRNSVNSAYTVNFYGF-VLPNVLAAARVHFDCPTLEAVDLEDYGGASSAYSHFDEYFLFNELMTPQSNGAMDFLSRITLALLQDTGWYNVDFSAVGNFDYGRKKGCVLPEKGCYNYMQMRESKSLTLDPLCNTALVYGNILGCSIYRNYFYRCNLIKYT-SVPPNLQYFKSLPGIPSADVQFYAGLSPYNEYCP 1539
            H C H+ P   E+V G+         +    P    ++R   A  Q LRI   Y  S        F     T L E  +   Q+++  ++   G++ ++R C ++ + + + +     +    T C  + VP  +L  C++ ++ G      +    G GI + D V  V+           T+AYA  C  E  LDRPI G  NLC   I       Q+    + HEI+H+LGFSV  YAF+R  DG P  PR    G P L       + W+   I+ +VR+  SV   +        V P V+A  R HF+C  LE  +LED GG  +A +H+++  L NE MT     +  F SRITLAL++D+GWY  ++S      +G+  GC    + C +++Q   ++  ++ P C+          C+  RN    CNLI++   +P   Q F SL  +   +  FY G     ++CP
Sbjct:   33 HNCQHQHPKAHEVVHGVRIQLADSEDDSAGDPARHSVRRRSVAAEQPLRILLVYDESVYRLEEEKFNLINDTVLPEAVQFWEQALMVRET--KGVIRLNRKCDSTQVYVKNGHTHCIDHCKATTMCGEVQVPDAHLDVCRVCNATGQNCRIDSNTQPGEGIENADFVFYVSARQTQRCFKGLTVAYAAHCQQEAALDRPIAGHANLCPESISTKPQELQTLISTVKHEILHALGFSVSLYAFFRDDDGKPRTPRKLDTGKPYLNEKLQ-IHQWSNETIRKVVRENWSVRGGHVNKVVDMMVTPRVIAEVRAHFNCNKLEGAELEDQGGEGTALTHWEKRILENEAMTGTHTQSPVF-SRITLALMEDSGWYRANYSMATPLTWGKGLGCAFAMRSCKDWIQYNHARGRSIHPFCSKVKQDPLQTECTDDRNSVALCNLIRHEFELPKGYQNFDSLNHVKDGEEGFYGGSVSLADHCP 505          
BLAST of Leishmanolysin-like peptidase vs. Ensembl Zebrafish
Match: lmln (leishmanolysin-like (metallopeptidase M8 family) [Source:ZFIN;Acc:ZDB-GENE-081104-298])

HSP 1 Score: 269.626 bits (688), Expect = 2.203e-80
Identity = 167/475 (35.16%), Postives = 241/475 (50.74%), Query Frame = 1
Query:  169 STGIQCHVCDHKIPPVSELVVGIEPGPLPPNARLKRATSQNLRIYFDYQSSFTSSSFAEA--LKTNLMEPAKNVLQSIITPKSPNNGLLLVDRSCTNSMMRLNSKNQKGCAYGCTQ-TECLGIVVPSVYLKACKIVDSLGNFQTTGS----DGAGISDIDIVLLV---TYTNC-SANTLAYAGSCFMENVLDRPILGVVNLCSNMIDPYTNTQSYTKV---IIHEIIHSLGFSVDKYAFYRYQDGSPIVPRNAYGFPNLGVSANGYYNWNENIIKPIVRQ---RNSVNSAYTVNFYGFVLPNVLAAARVHFDCPTLEAVDLEDYGGASSAYSHFDEYFLFNELMTPQSNGAMDFLSRITLALLQDTGWYNVDFSAVGNFDYGRKKGCVLPEKGCYNYMQMRESKSLTLDPLCNTALVYGNILGCSIYRNYFYRCNLIKYT-SVPPNLQYFKSLPGIPSADVQFYAGLSPYNEYCP 1539
            STG Q H CDHK+P  +E++  +    L P+   KR+T Q L I  +Y SS      A++  +K  L+  A + LQ     +  +  +LL  +  TN  +R      + C   C   T+C  +VVP  +L+ C++    G  ++ G     DG G++  D VL V   T   C   N +AYA  C +E+ LDRPI G  NLC NMI   T  Q +  +   + HEIIH+LGFS   +AFY    G P+ PR+A G P    S  G Y W++ +IK   R    R      +TV+      P V+  AR HF+CP LE ++LE+ GGA +  +H+++  L NE MT  S+      SRITLA+++DTGWY  ++S   N  +GR  GC    K C  ++     K  TL P C++       L C   +     CNL K++ ++P   QYF  +PG+P  D+  Y G     +YCP
Sbjct:   28 STGAQTHTCDHKVPLHTEVIHKVF---LKPDRLTKRSTDQQLNIKIEYDSSLDGLDEAKSSLVKDKLLPQAIDYLQKAFRVRRQSGPILLSRQCATNQYLRKRDDPHRYCQGPCANVTKCGPVVVPEHHLQQCRVCSESG--KSCGPVGPPDGEGVARADFVLYVSAMTTERCGQENIVAYAAYCQLESELDRPIAGYANLCPNMIS--TQPQEFEGMLSTVKHEIIHALGFSAGLFAFYHDDGGKPLTPRSASGLPAYNESL-GLYQWSDKVIKRATRLWDIRGGQMVRHTVHL--LATPRVVEEARRHFNCPILEGMELENQGGAGTELNHWEKRLLENEAMT-GSHTQNRVFSRITLAIMEDTGWYRANYSMAENLQWGRGLGCDFVMKSCKFWIDQHRHKRPTLSPYCDSVRSAPLQLTCRQDQLAVAVCNLQKFSNALPAEYQYFDHIPGVPKEDLSAYGGAVEIADYCP 491          
BLAST of Leishmanolysin-like peptidase vs. Ensembl Zebrafish
Match: lmln (leishmanolysin-like (metallopeptidase M8 family) [Source:ZFIN;Acc:ZDB-GENE-081104-298])

HSP 1 Score: 246.899 bits (629), Expect = 2.213e-72
Identity = 156/448 (34.82%), Postives = 225/448 (50.22%), Query Frame = 1
Query:  250 LPPNARLKRATSQNLRIYFDYQSSFTSSSFAEA--LKTNLMEPAKNVLQSIITPKSPNNGLLLVDRSCTNSMMRLNSKNQKGCAYGCTQ-TECLGIVVPSVYLKACKIVDSLGNFQTTGS----DGAGISDIDIVLLV---TYTNC-SANTLAYAGSCFMENVLDRPILGVVNLCSNMIDPYTNTQSYTKV---IIHEIIHSLGFSVDKYAFYRYQDGSPIVPRNAYGFPNLGVSANGYYNWNENIIKPIVRQ---RNSVNSAYTVNFYGFVLPNVLAAARVHFDCPTLEAVDLEDYGGASSAYSHFDEYFLFNELMTPQSNGAMDFLSRITLALLQDTGWYNVDFSAVGNFDYGRKKGCVLPEKGCYNYMQMRESKSLTLDPLCNTALVYGNILGCSIYRNYFYRCNLIKYT-SVPPNLQYFKSLPGIPSADVQFYAGLSPYNEYCP 1539
            L P+   KR+T Q L I  +Y SS      A++  +K  L+  A + LQ     +  +  +LL  +  TN  +R      + C   C   T+C  +VVP  +L+ C++    G  ++ G     DG G++  D VL V   T   C   N +AYA  C +E+ LDRPI G  NLC NMI   T  Q +  +   + HEIIH+LGFS   +AFY    G P+ PR+A G P    S  G Y W++ +IK   R    R      +TV+      P V+  AR HF+CP LE ++LE+ GGA +  +H+++  L NE MT  S+      SRITLA+++DTGWY  ++S   N  +GR  GC    K C  ++     K  TL P C++       L C   +     CNL K++ ++P   QYF  +PG+P  D+  Y G     +YCP
Sbjct:    8 LKPDRLTKRSTDQQLNIKIEYDSSLDGLDEAKSSLVKDKLLPQAIDYLQKAFRVRRQSGPILLSRQCATNQYLRKRDDPHRYCQGPCANVTKCGPVVVPEHHLQQCRVCSESG--KSCGPVGPPDGEGVARADFVLYVSAMTTERCGQENIVAYAAYCQLESELDRPIAGYANLCPNMIS--TQPQEFEGMLSTVKHEIIHALGFSAGLFAFYHDDGGKPLTPRSASGLPAYNESL-GLYQWSDKVIKRATRLWDIRGGQMVRHTVHL--LATPRVVEEARRHFNCPILEGMELENQGGAGTELNHWEKRLLENEAMT-GSHTQNRVFSRITLAIMEDTGWYRANYSMAENLQWGRGLGCDFVMKSCKFWIDQHRHKP-TLSPYCDSVRSAPLQLTCRQDQLAVAVCNLQKFSNALPAEYQYFDHIPGVPKEDLSAYGGAVEIADYCP 446          
BLAST of Leishmanolysin-like peptidase vs. Ensembl Zebrafish
Match: si:ch211-216p19.5 (si:ch211-216p19.5 [Source:ZFIN;Acc:ZDB-GENE-160728-97])

HSP 1 Score: 76.2554 bits (186), Expect = 4.978e-14
Identity = 86/347 (24.78%), Postives = 141/347 (40.63%), Query Frame = 1
Query:  289 NLRIYFDYQSSFTSSSFAEALKTNLMEPAKNVLQSIITPKSPNNGLLL---VDRSCTNSMMRLNSKNQKGCAYGCTQ---TECLGIVVPSVYLKACKIVDSLGNFQTT--GSDGAGISDIDIVLLVTYTN---CSANT--LAYAGSCFMENVLDRPILGVVNLCSNMIDPYTNT-QSYTKVIIHEIIHSLGFSVDKYAFYRYQDGSPIVPRNAYGFPNLGVSAN-GYYNWNENIIKPIVRQRNSVNSAYTVNFYGFVLPNVLAAARVHFDCPTLE-AVDLEDYGGASSAYS-HFDEYFLFNELMTPQ-SNGAMDFLSRITLALLQDTGWYNVDFSAVGNFDYGRKKG 1275
             ++I+   +S   S    E L + + E    V  S+++ K   + LLL   V++ C       ++ N   C           CLG+++P  +L  C +  +  +   T     G G+ D D +L V   N   C A +  LAY   C       RP+ G + +C   +     T Q + K +IHE+ H LGFS +  + ++                +  VS+  G   W+         Q  S +    V  Y    P V+ A + HF+    +    LE+   A    S H++   L   +M       ++  +  ITLA LQDTGWY+V+ S   +  +G  +G
Sbjct:   40 RIKIWIPSESPALSDWEREKLMSAVGEAVSEV-SSLLSVKRVKDRLLLNRDVNKYCKFIWRNSSTLNHMKCGRAHENYRFESCLGVIIPDEHLDGCSVYPNPEHPVPTVLRPRGPGVPDADFLLYVFTHNTEKCRAESSVLAYTAHC-QTGSDGRPLAGTMVICRETLKKERYTYQHFVKTVIHELFHVLGFSKELLSNWK----------------DCTVSSQIGVDCWSHG-------QVTSTDQTGQVRLYS---PTVIRAMQKHFNSTHTDLGAPLENKDAALDGLSSHWEARVLQGSIMAASLVEASLVRIDAITLAALQDTGWYSVNHSRAQSLVWGEGEG 358          
BLAST of Leishmanolysin-like peptidase vs. Ensembl Xenopus
Match: LMLN (leishmanolysin-like (metallopeptidase M8 family) [Source:NCBI gene;Acc:100487583])

HSP 1 Score: 85.5001 bits (210), Expect = 5.655e-17
Identity = 62/169 (36.69%), Postives = 87/169 (51.48%), Query Frame = 1
Query:  424 LLLVDRSC-TNSMMRLNSKNQKGCAYGCTQTECLG-IVVPSVYLKACKIVDS--LGNFQTTGSDGAGISDIDIVLLV---TYTNCS-ANTLAYAGSCFMENVLDRPILGVVNLCSNMIDPYTNTQSYTKV---IIHEIIHSLGFSVDKYAFYRYQDGSPIVPRNAYGFP 897
            +L  +R C TN  ++      + C   C+++   G ++VP  +L+ C++          +   DG GI D D VL V   T   CS  N +AYA  C +E  +DRPI G  NLC NMI   T  Q +  +   + HEIIH+LGFS   +AFY   DG+P+ PR   G P
Sbjct:   10 ILCHNRQCATNQYLKKRDDPHRYCHGACSESTRSGPVIVPEEHLQQCRVCSETQWHCGPSGPPDGPGIPDTDFVLYVSAMTTERCSQENIVAYAAYCQLEAEMDRPIAGYANLCPNMIS--TQPQEFVGMLSTVKHEIIHALGFSAGLFAFYYDDDGNPLTPRYINGLP 176          

HSP 2 Score: 65.0846 bits (157), Expect = 1.835e-10
Identity = 32/108 (29.63%), Postives = 52/108 (48.15%), Query Frame = 1
Query: 1219 WYNVDFSAVGNFDYGRKKGCVLPEKGCYNYMQMRESKSLTLDPLCNTALVYGNILGCSIYRNYFYRCNLIKYTS-VPPNLQYFKSLPGIPSADVQFYAGLSPYNEYCP 1539
            WY  ++S     D+GR++GC    K C  ++   + K+  L P C+T       L C   +     CNL ++ S +P   QYF  +PG+ + D+  Y G     ++CP
Sbjct:  182 WYRANYSMAERLDWGRRQGCDFAMKSCKFWIDKLKRKNQRLSPFCDTVRSNPLQLTCRQDQKAVAICNLQRFASPLPQEYQYFDDIPGVLADDLPHYGGAVEIADFCP 289          
BLAST of Leishmanolysin-like peptidase vs. Ensembl Mouse
Match: Lmln (leishmanolysin-like (metallopeptidase M8 family) [Source:MGI Symbol;Acc:MGI:2444736])

HSP 1 Score: 239.195 bits (609), Expect = 5.491e-69
Identity = 151/464 (32.54%), Postives = 221/464 (47.63%), Query Frame = 1
Query:  193 CDHKIPPVSELVVGIEPGPLPPNARLKRATSQNLRIYFDYQSSFTS--SSFAEALKTNLMEPAKNVLQSIITPKSPNNGLLLVDRSCTNSMMRLNSKNQKGCAYGCT-QTECLGIVVPSVYLKACKIVDSLGNFQTTGS---DGAGISDIDIVL----LVTYTNCSANTLAYAGSCFMENVLDRPILGVVNLCSNMIDPYTNTQSYTKV---IIHEIIHSLGFSVDKYAFYRYQDGSPIVPRNAYGFPNLGVSANGYYNWNENIIKPIVRQRN-SVNSAYTVNFYGFVLPNVLAAARVHFDCPTLEAVDLEDYGGASSAYSHFDEYFLFNELMTPQSNGAMDFLSRITLALLQDTGWYNVDFSAVGNFDYGRKKGCVLPEKGCYNYMQMRESKSLTLDPLCNTALVYGNILGCSIYRNYFYRCNLIKYTS-VPPNLQYFKSLPGIPSADVQFYAGLSPYNEYCP 1539
            C H +   +E++  +    L  N   KR    +LRI   Y  S           +K  L   A + L+     + P   +LL  +  TN  +R  +   + C   C   T+C  ++VP  +L+ C++    G +        D  G+ D D VL    L T      N ++YA  C  E  +DRPI G  NLC NMI   T  Q +  +   + HEIIH+LGFS   +AFY  QDG+P+  R+A G P    S  G Y W++ +++ + R  N   N       Y  V P V+  AR HF+CP LE ++LE+ GG  +  +H+++  L NE MT  S+     LSRITLAL++DTGWY  ++S     D+GR  GC    K C  ++     +     P C+T       L C   +     CNL ++ + +PP  QYF  L GIP+ D+ +Y G     +YCP
Sbjct:   53 CRHHVLSDTEVINKVH---LKTNHVTKRDADGHLRIKTIYDQSIEELLPEKRYLVKNKLFPQAISYLEKTFQVRRPAGRILLSRQCATNQYLRKENDPHRYCTGECAVHTKCGPVIVPEEHLQQCRVCRE-GKWPCGAVGVLDPEGVRDADFVLYVGALATERCSHENIISYAAYCQQEAKMDRPIAGYANLCPNMIS--TQPQEFIGMLSTVKHEIIHALGFSAGLFAFYHDQDGNPLTSRSADGLPPFNYSL-GLYQWSDKVVRKVERLWNVRDNKIVRHTVYLLVTPRVVEEARKHFNCPVLEGMELENQGGMGTELNHWEKRLLENEAMT-GSHTQNRVLSRITLALMEDTGWYKANYSMAEKLDWGRGLGCEFVRKSCKFWIDQHRQRRQVPSPYCDTLRSNPLQLTCRQDQRAVAVCNLQRFPNPLPPEYQYFDELTGIPAEDLPYYGGSVEIADYCP 508          
BLAST of Leishmanolysin-like peptidase vs. Ensembl Mouse
Match: Gm29776 (predicted gene, 29776 [Source:MGI Symbol;Acc:MGI:5588935])

HSP 1 Score: 85.8853 bits (211), Expect = 7.610e-17
Identity = 79/303 (26.07%), Postives = 126/303 (41.58%), Query Frame = 1
Query:  412 PNNGLLLVDRS----CTNSMMRLNSKNQKGCAY---GCTQTECLGIVVPSVYLKACKIVDSLGNFQTTGSDGAGISDIDIVLLVTYTNCSA-----NTLAYAGSCFMENVLDRPILGVVNLCSNMI-DPYTNTQSYTKVIIHEIIHSLGFSVDKYAFYRYQDGSPIVPRNAYGFPNLGVSANGYYNWNENIIKPIVRQRNSVNSAYTVNFYGFVLPNVLAAARVHFDCP-TLEAVDLEDYGGASSAYSHFDEYFLFNELMTPQSNGAMDF-LSRITLALLQDTGWYNVDFSAVGNFDYGRKKG 1275
            P  G LL+ R     C       ++ N + C+    G     CLG  +P  +L+   +    G  Q    DG G+ + D +L V   + S      + +AYA  C +++  DRP+ G +  C   +  P  +        +HE++H+LGFS   +  +R               P+ G+SA      N +  K + R+        T        P V  +   H   P TL+   LE+  G+ S  SH++   L   +MT   +GA    L  +TLA  +D+GWY V+ SA     +G+  G
Sbjct:   98 PVQGPLLLSRDPAQYCHAVWGDPDTPNYQRCSILNPGYKGESCLGAKIPDAHLRGYSLWPEHGLPQLIQPDGPGVQNADFLLYVQVAHTSKCHKEPSVIAYAACCQLDSE-DRPLAGTIVYCGQHLRSPTLSHDDIVMATLHELLHALGFSGQLFKMWR-------------DCPS-GLSARE----NCSTRKQVTRRDERGQLLLTT-------PAVSHSLAKHLGVPGTLQGAPLEEKQGSLS--SHWESRLLQGSIMTATFHGAQHTRLDPVTLAAFEDSGWYQVNHSAAEELLWGQGSG 372          
BLAST of Leishmanolysin-like peptidase vs. UniProt/SwissProt
Match: sp|Q8BMN4|LMLN_MOUSE (Leishmanolysin-like peptidase OS=Mus musculus OX=10090 GN=Lmln PE=2 SV=1)

HSP 1 Score: 239.195 bits (609), Expect = 3.841e-68
Identity = 151/464 (32.54%), Postives = 221/464 (47.63%), Query Frame = 1
Query:  193 CDHKIPPVSELVVGIEPGPLPPNARLKRATSQNLRIYFDYQSSFTS--SSFAEALKTNLMEPAKNVLQSIITPKSPNNGLLLVDRSCTNSMMRLNSKNQKGCAYGCT-QTECLGIVVPSVYLKACKIVDSLGNFQTTGS---DGAGISDIDIVL----LVTYTNCSANTLAYAGSCFMENVLDRPILGVVNLCSNMIDPYTNTQSYTKV---IIHEIIHSLGFSVDKYAFYRYQDGSPIVPRNAYGFPNLGVSANGYYNWNENIIKPIVRQRN-SVNSAYTVNFYGFVLPNVLAAARVHFDCPTLEAVDLEDYGGASSAYSHFDEYFLFNELMTPQSNGAMDFLSRITLALLQDTGWYNVDFSAVGNFDYGRKKGCVLPEKGCYNYMQMRESKSLTLDPLCNTALVYGNILGCSIYRNYFYRCNLIKYTS-VPPNLQYFKSLPGIPSADVQFYAGLSPYNEYCP 1539
            C H +   +E++  +    L  N   KR    +LRI   Y  S           +K  L   A + L+     + P   +LL  +  TN  +R  +   + C   C   T+C  ++VP  +L+ C++    G +        D  G+ D D VL    L T      N ++YA  C  E  +DRPI G  NLC NMI   T  Q +  +   + HEIIH+LGFS   +AFY  QDG+P+  R+A G P    S  G Y W++ +++ + R  N   N       Y  V P V+  AR HF+CP LE ++LE+ GG  +  +H+++  L NE MT  S+     LSRITLAL++DTGWY  ++S     D+GR  GC    K C  ++     +     P C+T       L C   +     CNL ++ + +PP  QYF  L GIP+ D+ +Y G     +YCP
Sbjct:   53 CRHHVLSDTEVINKVH---LKTNHVTKRDADGHLRIKTIYDQSIEELLPEKRYLVKNKLFPQAISYLEKTFQVRRPAGRILLSRQCATNQYLRKENDPHRYCTGECAVHTKCGPVIVPEEHLQQCRVCRE-GKWPCGAVGVLDPEGVRDADFVLYVGALATERCSHENIISYAAYCQQEAKMDRPIAGYANLCPNMIS--TQPQEFIGMLSTVKHEIIHALGFSAGLFAFYHDQDGNPLTSRSADGLPPFNYSL-GLYQWSDKVVRKVERLWNVRDNKIVRHTVYLLVTPRVVEEARKHFNCPVLEGMELENQGGMGTELNHWEKRLLENEAMT-GSHTQNRVLSRITLALMEDTGWYKANYSMAEKLDWGRGLGCEFVRKSCKFWIDQHRQRRQVPSPYCDTLRSNPLQLTCRQDQRAVAVCNLQRFPNPLPPEYQYFDELTGIPAEDLPYYGGSVEIADYCP 508          
BLAST of Leishmanolysin-like peptidase vs. UniProt/SwissProt
Match: sp|Q29AK2|LMLN_DROPS (Leishmanolysin-like peptidase OS=Drosophila pseudoobscura pseudoobscura OX=46245 GN=GA17800 PE=3 SV=1)

HSP 1 Score: 215.698 bits (548), Expect = 1.866e-59
Identity = 143/481 (29.73%), Postives = 220/481 (45.74%), Query Frame = 1
Query:  187 HVCDHKIPPVSELVVGIE---------------PGPLPPNARLKRATSQNLRIYFDYQSS---FTSSSFAEALKTNLMEPAKNVLQSIITPKSPNNGLLLVDRSCTNSMMRLNSKNQKGCAYGCTQTE-CLGIVVPSVYLKACKIVDSLGN---FQTTGSDGAGISDIDIVLLVTYTNCS----ANTLAYAGSCFMENVLDRPILGVVNLCSNMIDPY-TNTQSYTKVIIHEIIHSLGFSVDKYAFYRYQDGSPIVPRNAY-GFPNLGVSANGYYNWNENIIKPIVRQRNSVNSAYT-VNFYGFVLPNVLAAARVHFDCPTLEAVDLEDYGGASSAYSHFDEYFLFNELMTPQSNGAMDFLSRITLALLQDTGWYNVDFSAVGNFDYGRKKGCVLPEKGCYNYMQMRESKSLTLDPLCNTALVYGNILGCSIYRNYFYRCNLIKYT-SVPPNLQYFKSLPGIPSADVQFYAGLSPYNEYCP 1539
            H C H+ P   E+V G+                   +    R      Q LRI   Y  S        F     T L E  +   Q+++  ++   G++ ++R C ++ + + + +   C   C  T  C  + VP+ +L  C++ ++ G      +    G GI + D V  V+           T+AYA  C  E  LDRPI G  NLC   I       Q+    + HEI+H+LGFSV  YAF+R  +G P  PR +  G P L       + W+   I+ +VR+  SV   +        V P V+A AR HFDC  LE  +LED GG  +A +H+++  L NE MT     +  F SRITLAL++D+GWY  ++S      +G+  GC    + C +++QM  ++  ++ P C+          C+  RN    CNLI++   +P + Q F SL  + S +  FY G     ++CP
Sbjct:   30 HNCQHQHPKAHEVVHGVRIQLADSDDDDAAGSSDAAVHSVRRRSVTAEQPLRILLVYDDSVYRLEEEKFNLINDTVLPEAVQFWEQALMVRET--KGIIRLNRKCDSTQVYVKNGHTH-CIDQCKATTMCGEVQVPNEHLDVCRVCNATGQNCRIDSNTQPGDGIQNADFVFYVSARQTQRCFKGLTVAYAAHCQQEAALDRPIAGHANLCPESISTKPQELQTLISTVKHEILHALGFSVSLYAFFRDDEGRPRTPRKSETGKPFLNEKLQ-IHQWSNETIRKVVRENWSVRGGHVNKEVDMMVTPRVVAEARAHFDCDKLEGAELEDQGGEGTALTHWEKRILENEAMTGTHTQSPVF-SRITLALMEDSGWYRANYSMATPLSWGKGLGCSFAMRSCKDWIQMNHARGRSIHPFCSKVKQDPLQTECTDDRNSVALCNLIRHDYELPKSYQNFDSLQNVKSGEEGFYGGSVSLADHCP 505          
BLAST of Leishmanolysin-like peptidase vs. UniProt/SwissProt
Match: sp|Q9VH19|LMLN_DROME (Leishmanolysin-like peptidase OS=Drosophila melanogaster OX=7227 GN=Invadolysin PE=2 SV=2)

HSP 1 Score: 215.312 bits (547), Expect = 2.555e-59
Identity = 140/477 (29.35%), Postives = 217/477 (45.49%), Query Frame = 1
Query:  187 HVCDHKIPPVSELVVGI---------EPGPLPPNARLKR---ATSQNLRIYFDYQSS---FTSSSFAEALKTNLMEPAKNVLQSIITPKSPNNGLLLVDRSCTNSMMRLNSKNQKGCAYGCTQTECLGIVVPSVYLKACKIVDSLGN---FQTTGSDGAGISDIDIVLLVTYTNCS----ANTLAYAGSCFMENVLDRPILGVVNLCSNMIDPY-TNTQSYTKVIIHEIIHSLGFSVDKYAFYRYQDGSPIVPRNA-YGFPNLGVSANGYYNWNENIIKPIVRQRNSVNSAYTVNFYGF-VLPNVLAAARVHFDCPTLEAVDLEDYGGASSAYSHFDEYFLFNELMTPQSNGAMDFLSRITLALLQDTGWYNVDFSAVGNFDYGRKKGCVLPEKGCYNYMQMRESKSLTLDPLCNTALVYGNILGCSIYRNYFYRCNLIKYT-SVPPNLQYFKSLPGIPSADVQFYAGLSPYNEYCP 1539
            H C H+ P   E+V G+         +    P    ++R   A  Q LRI   Y  S        F     T L E  +   Q+++  ++   G++ ++R C ++ + + + +     +    T C  + VP  +L  C++ ++ G      +    G GI + D V  V+           T+AYA  C  E  LDRPI G  NLC   I       Q+    + HEI+H+LGFSV  YAF+R  DG P  PR    G P L       + W+   I+ +VR+  SV   +        V P V+A  R HF+C  LE  +LED GG  +A +H+++  L NE MT     +  F SRITLAL++D+GWY  ++S      +G+  GC    + C +++Q   ++  ++ P C+          C+  RN    CNLI++   +P   Q F SL  +   +  FY G     ++CP
Sbjct:   33 HNCQHQHPKAHEVVHGVRIQLADSEDDSAGDPARHSVRRRSVAAEQPLRILLVYDESVYRLEEEKFNLINDTVLPEAVQFWEQALMVRET--KGVIRLNRKCDSTQVYVKNGHTHCIDHCKATTMCGEVQVPDAHLDVCRVCNATGQNCRIDSNTQPGEGIENADFVFYVSARQTQRCFKGLTVAYAAHCQQEAALDRPIAGHANLCPESISTKPQELQTLISTVKHEILHALGFSVSLYAFFRDDDGKPRTPRKLDTGKPYLNEKLQ-IHQWSNETIRKVVRENWSVRGGHVNKVVDMMVTPRVIAEVRAHFNCNKLEGAELEDQGGEGTALTHWEKRILENEAMTGTHTQSPVF-SRITLALMEDSGWYRANYSMATPLTWGKGLGCAFAMRSCKDWIQYNHARGRSIHPFCSKVKQDPLQTECTDDRNSVALCNLIRHEFELPKGYQNFDSLNHVKDGEEGFYGGSVSLADHCP 505          
BLAST of Leishmanolysin-like peptidase vs. UniProt/SwissProt
Match: sp|Q61YG1|LMLN_CAEBR (Leishmanolysin-like peptidase OS=Caenorhabditis briggsae OX=6238 GN=CBG03556 PE=3 SV=2)

HSP 1 Score: 212.231 bits (539), Expect = 2.264e-58
Identity = 133/446 (29.82%), Postives = 212/446 (47.53%), Query Frame = 1
Query:  241 PGPLPPNARLKRATSQNLRIYFDYQSSFTSSSFAEALKTNLMEPAKNVLQSIITPKSPNNGLLLVDRSCTNSMMRLNSKNQK-GCAYGCTQ-TECLGIVVPSVYLKACKIVDSLGNFQTTGSDGAGISDIDIVLLVTYTN---CSA-NTLAYAGSCFMENVLDRPILGVVNLCSNMIDPYTNT-QSYTKVIIHEIIHSLGFSVDKYAFYRYQDGSPIVPRNAYGFPNLGVSANGYYNWNENIIKPIVRQRNSVNSAYTVN-FYGFVLPNVLAAARVHFDCPTLEAVDLEDYGGASSAYSHFDEYFLFNELMTPQSNGAMDFLSRITLALLQDTGWYNVDFSAVGNFDYGRKKGCVLPEKGCYNYMQMRESKSLTLDPLCNTALVYGN----ILGCSIYRNYFYRCNLIKY-TSVPPNLQYFKSLPGIPSADVQFYAGLSPYNEYCP 1539
            P   PP+  L++     +++++D      ++     + T L+  A    ++ +  + P    + + R C +S        +   C  GC + T C    +P+ +L  C   ++  + QTTG  G G+ + D +L VT  N   C    TL+YA  C  E   DRPI G VNLC + +  + +  +  T  + HEI+H+LGFSV  YAF+R +DG P   RN YG P       GYY+W++N I  ++R+         ++     V P V   AR HF C  LE  +LE+ GG  +  +H+++    NE MT  ++      SR+TLA L+DTGWY  ++    +  +G++ GC    K C  ++  +        P C+     G     I  C+  R+    CNLI +   +PP  + F SLPG+     ++Y G     +YCP
Sbjct:   57 PTETPPD--LQKFAPLRIQLHYDKSIQNLTAEVQHFVNTTLLPEAVGYWENALRVR-PMKTPIRLRRKCISSFYYYKQGMRNVACDKGCRERTTCGEADIPNDHLLDCLACNNTDDCQTTGEMGEGVKESDFILYVTAHNSKRCEGPETLSYAAHCQQEADFDRPIAGNVNLCPSALSVHNHDYEILTSTVKHEILHALGFSVGLYAFFRDKDGKPRTKRNRYGRPTSLNKQRGYYDWDKNTITTVLREEWWTGEGKVIHPIQMMVTPKVREEARRHFGCDKLEGAELENQGGEGTVLTHWEKRAYENEAMT-GTHTQNPVYSRLTLAFLEDTGWYQPNYEVAEDLHWGKQLGCDFAMKSCGEWIHQKRILGEDAYPYCSDIKHDGTKSMAITRCTSQRDSLALCNLIPFQKELPPQYRNFMSLPGVNPDGAKYYGGSVEMADYCP 498          
BLAST of Leishmanolysin-like peptidase vs. UniProt/SwissProt
Match: sp|Q96KR4|LMLN_HUMAN (Leishmanolysin-like peptidase OS=Homo sapiens OX=9606 GN=LMLN PE=2 SV=2)

HSP 1 Score: 204.142 bits (518), Expect = 1.444e-55
Identity = 148/467 (31.69%), Postives = 214/467 (45.82%), Query Frame = 1
Query:  193 CDHKIPPVSELVVGIEPGPLPPNARLKRATSQNLRIYFDYQSSFTS--SSFAEALKTNLMEPAKNVLQSIITPKSPNNGLLLVDRSCTNSMMRLNSKNQKGCAYGCT-QTECLGIVVPSVYLKACKIVDSLGNFQTTGS----DGAGISDIDIVL----LVTYTNCSANTLAYAGSCFMENVLDRPILGVVNLCSNMIDPYTNTQSYTKV---IIHEIIHSLGFSVDKYAFYRYQDGSPIVPRNAYGFPNLGVSANGYYNWNENIIKPIVRQ---RNSVNSAYTVNFYGFVLPNVLAAARVHFDCPTLEAVDLEDYGGASSAYSHFDEYFLFNELMTPQSNGAMDFLSRITLALLQDTGWYNVDFSAVGNFDYGRKKGCVLPEKGCYNYMQMRESKSLTLDPLCNTALVYGNILGCSIYRNYFYRCNLIKYTS-VPPNLQYFKSLPGIPSADVQFYAGLSPYNEYCP 1539
            C H +P  +E++  +    L  N  +KR   ++LRI   Y  S           +K  L   A + L+     + P   +LL  +  TN  +R  +   + C   C   T+C  ++VP  +L+ C++    G     G+    D  GISD D VL    L T      N ++YA  C  E  +DRPI G  NLC NMI   T  Q +  +   + HE+IH+LGFS   +AFY  +DG+P+  R A G P    S  G Y W++ +++ + R    R++    +TV  Y  V P V+  AR HFDCP LE ++LE+ GG  +  +H+++  L NE MT  S+     LSRITLAL++DTG                               QM       L P C+T       L C   +     CNL K+   +P   QYF  L GIP+ D+ +Y G     +YCP
Sbjct:   64 CRHHVPSDTEVINKVH---LKANHVVKRDVDEHLRIKTVYDKSVEELLPEKKNLVKNKLFPQAISYLEKTFQVRRPAGTILLSRQCATNQYLRKENDPHRYCTGECAAHTKCGPVIVPEEHLQQCRVYR--GGKWPHGAVGVPDQEGISDADFVLYVGALATERCSHENIISYAAYCQQEANMDRPIAGYANLCPNMIS--TQPQEFVGMLSTVKHEVIHALGFSAGLFAFYHDKDGNPLTSRFADGLPPFNYSL-GLYQWSDKVVRKVERLWDVRDNKIVRHTV--YLLVTPRVVEEARKHFDCPVLEGMELENQGGVGTELNHWEKRLLENEAMT-GSHTQNRVLSRITLALMEDTG------------------------------RQM-------LSPYCDTLRSNPLQLTCRQDQRAVAVCNLQKFPKPLPQEYQYFDELSGIPAEDLPYYGGSVEIADYCP 482          
BLAST of Leishmanolysin-like peptidase vs. TrEMBL
Match: W5M4S7 (Leishmanolysin-like peptidase OS=Lepisosteus oculatus OX=7918 PE=3 SV=1)

HSP 1 Score: 273.478 bits (698), Expect = 1.625e-78
Identity = 163/466 (34.98%), Postives = 227/466 (48.71%), Query Frame = 1
Query:  178 IQCHVCDHKIPPVSELVVGIEPGPLPPNARLKRATSQNLRIYFDYQSSFTS--SSFAEALKTNLMEPAKNVLQSIITPKSPNNGLLLVDRSCTNSMMRLNSKNQKGCAYGCTQ-TECLGIVVPSVYLKACKIVDSLGNFQTTGSDGAGISDIDIVLLV---TYTNC-SANTLAYAGSCFMENVLDRPILGVVNLCSNMIDPYTNTQSYTKV---IIHEIIHSLGFSVDKYAFYRYQDGSPIVPRNAYGFPNLGVSANGYYNWNENIIKPIVRQRN-SVNSAYTVNFYGFVLPNVLAAARVHFDCPTLEAVDLEDYGGASSAYSHFDEYFLFNELMTPQSNGAMDFLSRITLALLQDTGWYNVDFSAVGNFDYGRKKGCVLPEKGCYNYMQMRESKSLTLDPLCNTALVYGNILGCSIYRNYFYRCNLIKY-TSVPPNLQYFKSLPGIPSADVQFYAGLSPYNEYCP 1539
            + CH+C H++P  SE+V  +   PL     +KR+T   LRI   Y  S     +     +K  L   A + LQ     + P   +LL  +  TN  +R      + C   C + T C  +VVP  +L+ C++  + G       DG G+ D D VL V   T   C   N +AYA  C +E  LDRPI G  NLC NMI   T  Q Y  +   + HEIIH+LGFS   +AFY   +G P+  R   G P    S  G Y W+E  ++   R  +   N     N    V P V+  AR HFDCP LE ++LE+ GG  +  +H+++  L NE MT  S+      SRITLA+++DTGWY  ++S     D+G   GC    K C  +M+ R  +  T+ P C+        L C   +     CNL KY T++P   QYF  +PGIP  D+ +Y G     +YCP
Sbjct:   29 VSCHICKHRVPDSSEVVYQV---PLETERVVKRSTDHRLRIKLIYDRSLDELHADKRRLVKDKLFPQATDYLQKAFQVRRPTGPILLSRQCSTNQYLRKKDDPHRYCQGACAEITRCGPVVVPEEHLQQCRVWKARGA--AGRPDGVGVQDTDFVLYVSGVTTERCGQENIVAYAAYCQLEAELDRPIAGYANLCPNMIS--TQAQDYVGMLSTVKHEIIHALGFSAGLFAFYHDDEGKPLTQRYEGGLPPFNESL-GLYQWSEKTVRKTTRLWDIRGNQMVRHNVLLLVTPRVVEEARKHFDCPILEGMELENQGGLGTELNHWEKRLLENEAMT-GSHTQNRVFSRITLAIMEDTGWYRANYSMAERLDWGSGMGCDFVMKSCKFWMEQRRQQKQTVAPYCDELRSMPLQLTCRQDQLALAVCNLQKYPTNLPREYQYFDGIPGIPVQDLPYYGGSVEIADYCP 485          
BLAST of Leishmanolysin-like peptidase vs. TrEMBL
Match: A0A3N0YWA0 (Leishmanolysin-like peptidase OS=Anabarilius grahami OX=495550 GN=DPX16_21020 PE=3 SV=1)

HSP 1 Score: 272.322 bits (695), Expect = 3.384e-78
Identity = 167/472 (35.38%), Postives = 244/472 (51.69%), Query Frame = 1
Query:  172 TGIQCHVCDHKIPPVSELVVGIEPGPLPPNARLKRATSQNLRIYFDYQSSFTSSSFAEA--LKTNLMEPAKNVLQSIITPKSPNNGLLLVDRSC-TNSMMRLNSKNQKGCAYGCTQ-TECLGIVVPSVYLKACKIVDSLGNFQTTGS--DGAGISDIDIVLLV---TYTNC-SANTLAYAGSCFMENVLDRPILGVVNLCSNMIDPYTNTQSYTKV---IIHEIIHSLGFSVDKYAFYRYQDGSPIVPRNAYGFPNLGVSANGYYNWNENIIKPIVRQRNSVNSAYTVNFYGFVL--PNVLAAARVHFDCPTLEAVDLEDYGGASSAYSHFDEYFLFNELMTPQSNGAMDFLSRITLALLQDTGWYNVDFSAVGNFDYGRKKGCVLPEKGCYNYMQMRESKSLTLDPLCNTALVYGNILGCSIYRNYFYRCNLIKY-TSVPPNLQYFKSLPGIPSADVQFYAGLSPYNEYCP 1539
            TG Q H CDHK+P ++E++  +    L P+  +KR+T Q L+I  +Y SS      A+   +K  L+  A + LQ     +   +G +L+ R C TN  +R      + C   C   T+C  +VVP  +L+ C++    G         DG G++  D VL V   T   C   N +AYA  C +E+ LDRPI G  NLC NMI   T  Q +  +   + HEIIH+LGFS   +AFY   DG P+ PR+A G P    S  G Y W++ +IK   R  + +   + V     +L  P V+  AR HF+CP LE ++LE+ GGA + ++H+++  L NE MT  S+      SRITLA+++DTGWY  ++S   N ++GR  GC    K C  ++        TL P C++       L C   +     CNL K+  S+P   QYF ++PG+P  D+  Y G     +YCP
Sbjct:   27 TGAQTHTCDHKVPLLTEVIHKVF---LKPDRLIKRSTDQQLKIQIEYDSSLDGLDEAKCSLVKYKLLPQAIDYLQKAFRVRR-QSGPILLSRQCETNQYLRKRDDPHRYCQGPCAGITKCGPVVVPEQHLQQCRVCSESGKSCGPAGPPDGEGVARADFVLYVSAMTTERCGQENIVAYAAYCQLESELDRPIAGYANLCPNMIS--TQPQEFEGMLSTVKHEIIHALGFSAGLFAFYHDDDGKPLTPRSASGLPAYNESL-GLYQWSDKVIKRATRLWD-IRGGHMVRHTVHLLSTPRVVEEARRHFNCPILEGMELENQGGAGTEFNHWEKRLLENEAMT-GSHTQNRVFSRITLAIMEDTGWYRANYSMAENLEWGRGLGCDFVMKSCKFWIDQHRHTRPTLSPYCDSVRSAPLQLTCRQDQLAVAVCNLQKFPHSLPVEYQYFDNIPGVPEEDLSAYGGAVEIADYCP 489          
BLAST of Leishmanolysin-like peptidase vs. TrEMBL
Match: F1Q5N1 (Leishmanolysin-like peptidase OS=Danio rerio OX=7955 GN=lmln PE=3 SV=1)

HSP 1 Score: 269.626 bits (688), Expect = 4.928e-77
Identity = 167/475 (35.16%), Postives = 241/475 (50.74%), Query Frame = 1
Query:  169 STGIQCHVCDHKIPPVSELVVGIEPGPLPPNARLKRATSQNLRIYFDYQSSFTSSSFAEA--LKTNLMEPAKNVLQSIITPKSPNNGLLLVDRSCTNSMMRLNSKNQKGCAYGCTQ-TECLGIVVPSVYLKACKIVDSLGNFQTTGS----DGAGISDIDIVLLV---TYTNC-SANTLAYAGSCFMENVLDRPILGVVNLCSNMIDPYTNTQSYTKV---IIHEIIHSLGFSVDKYAFYRYQDGSPIVPRNAYGFPNLGVSANGYYNWNENIIKPIVRQ---RNSVNSAYTVNFYGFVLPNVLAAARVHFDCPTLEAVDLEDYGGASSAYSHFDEYFLFNELMTPQSNGAMDFLSRITLALLQDTGWYNVDFSAVGNFDYGRKKGCVLPEKGCYNYMQMRESKSLTLDPLCNTALVYGNILGCSIYRNYFYRCNLIKYT-SVPPNLQYFKSLPGIPSADVQFYAGLSPYNEYCP 1539
            STG Q H CDHK+P  +E++  +    L P+   KR+T Q L I  +Y SS      A++  +K  L+  A + LQ     +  +  +LL  +  TN  +R      + C   C   T+C  +VVP  +L+ C++    G  ++ G     DG G++  D VL V   T   C   N +AYA  C +E+ LDRPI G  NLC NMI   T  Q +  +   + HEIIH+LGFS   +AFY    G P+ PR+A G P    S  G Y W++ +IK   R    R      +TV+      P V+  AR HF+CP LE ++LE+ GGA +  +H+++  L NE MT  S+      SRITLA+++DTGWY  ++S   N  +GR  GC    K C  ++     K  TL P C++       L C   +     CNL K++ ++P   QYF  +PG+P  D+  Y G     +YCP
Sbjct:   28 STGAQTHTCDHKVPLHTEVIHKVF---LKPDRLTKRSTDQQLNIKIEYDSSLDGLDEAKSSLVKDKLLPQAIDYLQKAFRVRRQSGPILLSRQCATNQYLRKRDDPHRYCQGPCANVTKCGPVVVPEHHLQQCRVCSESG--KSCGPVGPPDGEGVARADFVLYVSAMTTERCGQENIVAYAAYCQLESELDRPIAGYANLCPNMIS--TQPQEFEGMLSTVKHEIIHALGFSAGLFAFYHDDGGKPLTPRSASGLPAYNESL-GLYQWSDKVIKRATRLWDIRGGQMVRHTVHL--LATPRVVEEARRHFNCPILEGMELENQGGAGTELNHWEKRLLENEAMT-GSHTQNRVFSRITLAIMEDTGWYRANYSMAENLQWGRGLGCDFVMKSCKFWIDQHRHKRPTLSPYCDSVRSAPLQLTCRQDQLAVAVCNLQKFSNALPAEYQYFDHIPGVPKEDLSAYGGAVEIADYCP 491          
BLAST of Leishmanolysin-like peptidase vs. TrEMBL
Match: A0A5A9P385 (Leishmanolysin-like peptidase OS=Triplophysa tibetana OX=1572043 GN=E1301_Tti010063 PE=3 SV=1)

HSP 1 Score: 266.544 bits (680), Expect = 6.065e-76
Identity = 162/473 (34.25%), Postives = 239/473 (50.53%), Query Frame = 1
Query:  172 TGIQCHVCDHKIPPVSELVVGIEPGPLPPNARLKRATSQNLRIYFDYQSSFT--SSSFAEALKTNLMEPAKNVLQSIITPKSPNNGLLLVDRSCTNSMMRLNSKNQKGCAYGCTQ-TECLGIVVPSVYLKACKIVDSLGNFQTTG----SDGAGISDIDIVLLV---TYTNC-SANTLAYAGSCFMENVLDRPILGVVNLCSNMIDPYTNTQSYTKV---IIHEIIHSLGFSVDKYAFYRYQDGSPIVPRNAYGFPNLGVSANGYYNWNENIIKPIVRQRNSVNSAYTV--NFYGFVLPNVLAAARVHFDCPTLEAVDLEDYGGASSAYSHFDEYFLFNELMTPQSNGAMDFLSRITLALLQDTGWYNVDFSAVGNFDYGRKKGCVLPEKGCYNYMQMRESKSLTLDPLCNTALVYGNILGCSIYRNYFYRCNLIKYT-SVPPNLQYFKSLPGIPSADVQFYAGLSPYNEYCP 1539
            TG Q H C+HK+P  +E++  +    L P    KR+T Q L I  +Y SS        +  +K  L+  A + LQ     +  +  +LL  +  TN  +R      + C   C   T+C  ++VP  +L+ C++    G  ++ G    SDG G+   D  L V   T   C   N +AYA  C +E+ LDRPI G  NLC NMI   T  Q +  +   + HEIIH+LGFS   +AFY   DG P+ PR+A G P    S  G Y W++ +IK   R  + +     V  N +  V P V+  AR HF+CP LE ++LE+ GGA + ++H+++  L NE MT  S+      SRITLA+++DTGWY  ++S   N ++GR  GC    K C  ++    +   TL P C++       L C   +     CNL  ++ ++PP  QYF  + G+P  D+  Y G     +YCP
Sbjct:   32 TGTQAHTCNHKVPLHTEVIHKVF---LKPERLTKRSTEQQLNIQIEYDSSLDGLDEDKSSLVKDKLLPHAIDYLQKAFRVRRQSGPILLSRQCATNQYLRKRDDPHRYCQGPCADITKCGPVIVPERHLQQCRVCSESG--KSCGPAGPSDGEGVERADFALYVSAMTTERCGQENIVAYAAYCQLESELDRPIAGYANLCPNMIS--TQAQEFEGMLSTVKHEIIHALGFSAGLFAFYHDDDGKPLTPRSASGLPAYNESL-GLYQWSDKVIKRATRLWD-IRGGRMVRHNVHLLVTPRVVEEARKHFNCPILEGMELENQGGAGTEFNHWEKRLLENEAMT-GSHTQNRVFSRITLAIMEDTGWYRANYSMAENLEWGRGLGCDFVMKSCKFWIDQHSNTRPTLSPYCDSVRSAPLQLTCRQDQLAVAVCNLQNFSRALPPEYQYFDHIAGVPEEDLSAYGGAVEIADYCP 494          
BLAST of Leishmanolysin-like peptidase vs. TrEMBL
Match: A0A4W4FFJ2 (Leishmanolysin-like peptidase OS=Electrophorus electricus OX=8005 PE=3 SV=1)

HSP 1 Score: 255.758 bits (652), Expect = 4.551e-73
Identity = 161/471 (34.18%), Postives = 231/471 (49.04%), Query Frame = 1
Query:  181 QCHVCDHKIPPVSELV--VGIEPGPLPPNARLKRATSQNLRIYFDYQSSFT--SSSFAEALKTNLMEPAKNVLQSIITPKSPNNGLLLVDRSCTNSMMRLNSKNQKGCAYGCTQ-TECLGIVVPSVYLKACKIVDSLGNF--QTTGSDGAGISDIDIVLLV---TYTNC-SANTLAYAGSCFMENVLDRPILGVVNLCSNMIDPYTNTQSYTKV---IIHEIIHSLGFSVDKYAFYRYQDGSPIVPRNAYGFPNLGVSANGYYNWNENIIKPIVRQ---RNSVNSAYTVNFYGFVLPNVLAAARVHFDCPTLEAVDLEDYGGASSAYSHFDEYFLFNELMTPQSNGAMDFLSRITLALLQDTGWYNVDFSAVGNFDYGRKKGCVLPEKGCYNYMQMRESKSLTLDPLCNTALVYGNILGCSIYRNYFYRCNLIKYTS-VPPNLQYFKSLPGIPSADVQFYAGLSPYNEYCP 1539
             CH C+HK+P  SE++  V ++PG L      KR+T Q L++   Y SS        +  +K  L   A + LQ     +     +LL  +  TN  +R      + C   C   T C  ++VP  +L+ C++   +G         DG G+   D +L V   T   C   N +AYA  C +E  LDRPI G  NLC NMI   T  Q +  +   + HEIIH+LGFS   +AFY   DG P+ PR A G P    S  G Y W++ +IK   R    R      + V+    V P V+A AR HF CP LE ++LE+ GG  +  +H+++  L NE MT  S+      SRITLA+++DTGWY  ++S   N ++G+  GC    K C  ++   + ++ T  P CN+       L C   +     CNL KY   +P   QYF S+PG+P  D+  Y G     ++CP
Sbjct:   28 HCHTCNHKVPLPSEVIHEVYLKPGRL-----TKRSTEQQLKVQIVYDSSLDVLDEDKSSLVKDKLFPQAIDYLQRAFKVRRQTGTVLLSRQCATNQYLRKKDDPHRYCQGACAGITRCGPVIVPEQHLQQCRVCSEMGKSCGPVGAPDGEGVESADFLLYVSGVTTERCGQENIVAYAAYCQLEAELDRPIAGYANLCPNMIS--TQLQEFEGMLSTVKHEIIHALGFSAGLFAFYHDDDGKPLTPRFASGLPAFNESL-GLYQWSDKVIKRAARLWDLRGGRMVQHEVHL--MVTPRVVAEARRHFKCPILEGMELENQGGIGTELNHWEKRLLENEAMT-GSHTQNRVFSRITLAIMEDTGWYTANYSMAENLEWGKDLGCDFVMKSCKFWI---DRQNPTRTPYCNSVRGTPLQLSCRQDQLAVAVCNLQKYGQPLPHEYQYFDSIPGVPEEDLPLYGGAVQIADFCP 484          
BLAST of Leishmanolysin-like peptidase vs. Ensembl Cavefish
Match: lmln (leishmanolysin like peptidase [Source:NCBI gene;Acc:103047341])

HSP 1 Score: 256.529 bits (654), Expect = 2.578e-75
Identity = 156/470 (33.19%), Postives = 231/470 (49.15%), Query Frame = 1
Query:  181 QCHVCDHKIPPVSELVVGIEPGPLPPNARLKRATSQNLRIYFDYQSSFT--SSSFAEALKTNLMEPAKNVLQSIITPKSPNNGLLLVDRSCTNSMMRLNSKNQKGCAYGCTQ-TECLGIVVPSVYLKACKIVDSLGNFQTTGS----DGAGISDIDIVL---LVTYTNC-SANTLAYAGSCFMENVLDRPILGVVNLCSNMIDPYTNTQSYTKV---IIHEIIHSLGFSVDKYAFYRYQDGSPIVPRNAYGFPNLGVSANGYYNWNENIIKPIVRQRNSVNSAYTVNF--YGFVLPNVLAAARVHFDCPTLEAVDLEDYGGASSAYSHFDEYFLFNELMTPQSNGAMDFLSRITLALLQDTGWYNVDFSAVGNFDYGRKKGCVLPEKGCYNYMQMRESKSLTLDPLCNTALVYGNILGCSIYRNYFYRCNLIKYTS-VPPNLQYFKSLPGIPSADVQFYAGLSPYNEYCP 1539
             CH C+HK+P  +E++  +    L P    KR+T Q L+I   Y SS        +  +K  L   A + LQ     +     +LL  +  TN  +R      + C   C   T C  ++VP  +L+ C++    G  ++ G     DG G+   D +L    VT   C   N +AYA  C +E  LDRPI G  NLC NMI   T  Q +  +   + HEIIH+LGFS   +AFY   DG P+ PR A G P    +  G Y W++ +I+   R  + +   + V    +  V P V+  AR HF+CP LE ++LE+ GG  +  +H+++  L NE MT  S+      SRITLA+++DTGWY  ++S   N ++G+  GC    K C  ++  +    L+L P C +       L C   +     CNL KY+  +P   QYF S+PG+P  D+  Y G     ++CP
Sbjct:   58 HCHSCNHKVPLPTEVIHNVH---LKPGRLTKRSTEQQLKIQIFYDSSLDVLDEDKSSLVKDKLFPQAIDYLQRAFRVRRQTGPVLLSRQCSTNQYLRKKDDPHRYCQGACADITRCGPVIVPDEHLQQCRVCSETG--KSCGPVGPPDGEGVDRADFLLYVSAVTTERCGQENIVAYAAYCQLEAELDRPIAGYANLCPNMIS--TQLQEFEGMLSTVKHEIIHALGFSAGLFAFYHDDDGKPLTPRFASGLPAFNETL-GLYQWSDRVIRRSTRLWD-IRGRHMVRHEVHLMVTPRVVEEARRHFNCPILEGMELENQGGMGTELNHWEKRLLENEAMT-GSHTQNRVFSRITLAIMEDTGWYRANYSMAENLEWGKGLGCDFVMKSCKFWIDQQRHARLSLTPYCESVRGTPLQLSCRQDQLAVAVCNLQKYSQPLPTEYQYFDSIPGVPEEDLSMYGGAVEIADFCP 517          
BLAST of Leishmanolysin-like peptidase vs. Ensembl Cavefish
Match: lmln (leishmanolysin like peptidase [Source:NCBI gene;Acc:103047341])

HSP 1 Score: 256.144 bits (653), Expect = 3.860e-75
Identity = 156/470 (33.19%), Postives = 231/470 (49.15%), Query Frame = 1
Query:  181 QCHVCDHKIPPVSELVVGIEPGPLPPNARLKRATSQNLRIYFDYQSSFT--SSSFAEALKTNLMEPAKNVLQSIITPKSPNNGLLLVDRSCTNSMMRLNSKNQKGCAYGCTQ-TECLGIVVPSVYLKACKIVDSLGNFQTTGS----DGAGISDIDIVL---LVTYTNC-SANTLAYAGSCFMENVLDRPILGVVNLCSNMIDPYTNTQSYTKV---IIHEIIHSLGFSVDKYAFYRYQDGSPIVPRNAYGFPNLGVSANGYYNWNENIIKPIVRQRNSVNSAYTVNF--YGFVLPNVLAAARVHFDCPTLEAVDLEDYGGASSAYSHFDEYFLFNELMTPQSNGAMDFLSRITLALLQDTGWYNVDFSAVGNFDYGRKKGCVLPEKGCYNYMQMRESKSLTLDPLCNTALVYGNILGCSIYRNYFYRCNLIKYTS-VPPNLQYFKSLPGIPSADVQFYAGLSPYNEYCP 1539
             CH C+HK+P  +E++  +    L P    KR+T Q L+I   Y SS        +  +K  L   A + LQ     +     +LL  +  TN  +R      + C   C   T C  ++VP  +L+ C++    G  ++ G     DG G+   D +L    VT   C   N +AYA  C +E  LDRPI G  NLC NMI   T  Q +  +   + HEIIH+LGFS   +AFY   DG P+ PR A G P    +  G Y W++ +I+   R  + +   + V    +  V P V+  AR HF+CP LE ++LE+ GG  +  +H+++  L NE MT  S+      SRITLA+++DTGWY  ++S   N ++G+  GC    K C  ++  +    L+L P C +       L C   +     CNL KY+  +P   QYF S+PG+P  D+  Y G     ++CP
Sbjct:   58 HCHSCNHKVPLPTEVIHNVH---LKPGRLTKRSTEQQLKIQIFYDSSLDVLDEDKSSLVKDKLFPQAIDYLQRAFRVRRQTGPVLLSRQCSTNQYLRKKDDPHRYCQGACADITRCGPVIVPDEHLQQCRVCSETG--KSCGPVGPPDGEGVDRADFLLYVSAVTTERCGQENIVAYAAYCQLEAELDRPIAGYANLCPNMIS--TQLQEFEGMLSTVKHEIIHALGFSAGLFAFYHDDDGKPLTPRFASGLPAFNETL-GLYQWSDRVIRRSTRLWD-IRGRHMVRHEVHLMVTPRVVEEARRHFNCPILEGMELENQGGMGTELNHWEKRLLENEAMT-GSHTQNRVFSRITLAIMEDTGWYRANYSMAENLEWGKGLGCDFVMKSCKFWIDQQRHARLSLTPYCESVRGTPLQLSCRQDQLAVAVCNLQKYSQPLPTEYQYFDSIPGVPEEDLSMYGGAVEIADFCP 517          
BLAST of Leishmanolysin-like peptidase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004358.1 (pep scaffold:Pmarinus_7.0:GL476418:369102:375246:1 gene:ENSPMAG00000003980.1 transcript:ENSPMAT00000004358.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 117.857 bits (294), Expect = 6.176e-30
Identity = 80/262 (30.53%), Postives = 117/262 (44.66%), Query Frame = 1
Query:  286 QNLRIYFDYQSSFTS--SSFAEALKTNLMEPAKNVLQSIITPKSPNNGLLLVDRSCTNSMMRLNSKNQKGCAYGCTQT-ECLGIVVPSVYLKACKIVDSLG-NFQTTG-SDGAGISDIDIVLLVTYTNC----SANTLAYAGSCFMENVLDRPILGVVNLCSNMIDPYTNTQ-SYTKVIIHEIIHSLGFSVDKYAFYRYQDGSPIVPRNAYGFPNLGVSANGYYNWNENIIKPIVRQRNSVNSAYTVNFYGFVLPNVLAAAR 1041
            Q LR+   Y SS  S  +   + +K  L   A + +QS +  +SP   +LL     TN     +    + C   C +T  C  + VP  +L+ C++ D  G N  + G + G G  D D VL V+            +AYA  C +E  LDRPI G  NLC + +      Q      + HE+IH+LGFS   +AFYR  DG P+ PR   G P       G Y W+E + + + R+        +      V P V+  +R
Sbjct:    1 QRLRVRLIYDSSVDSLPNEKRDFIKMRLFPEAVDYIQSALFVRSPGAKILLNRYCATNHYFMKHRDPHRYCQSACAETTRCGPVTVPDEHLQQCRVCDEGGRNCGSIGPAGGPGEPDADYVLYVSALGTDRCQQEGVVAYAAYCQLEAQLDRPIAGYANLCPDKVSLDAGEQPDMLSTVKHEVIHALGFSAGLFAFYRDDDGQPLTPRYGNGLPPFN-DTTGLYQWSERVARRVSRRWAVRGGELSHLVTLLVTPRVVVRSR 261          
BLAST of Leishmanolysin-like peptidase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002113.1 (pep scaffold:Pmarinus_7.0:GL501047:4779:9283:1 gene:ENSPMAG00000001917.1 transcript:ENSPMAT00000002113.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 102.834 bits (255), Expect = 2.667e-24
Identity = 54/137 (39.42%), Postives = 73/137 (53.28%), Query Frame = 1
Query: 1132 LFNELMTPQSNGAMDFLSRITLALLQDTGWYNVDFSAVGNFDYGRKKGCVLPEKGCYNYMQMRESKSLTLDPLCNTALVYGNILGCSIYRNYFYRCNLIKYTS-VPPNLQYFKSLPGIPSADVQFYAGLSPYNEYCP 1539
            L NE MT  S+      SR TLAL++DTGWY+ ++S      +GR  GCV   + C  +M  R    L + P C     +   LGC   R+    CNL +YT+ +P + QY   LPG+ SAD+Q Y GL    +YCP
Sbjct:    1 LQNEAMT-GSHTQRRIFSRFTLALMEDTGWYHANYSHAEALGWGRGLGCVFAMQSCKAWMDHRSDSGLNVAPFCKEVRGHPLRLGCGAGRSALVLCNLQRYTNPLPTHYQYLDFLPGVSSADMQLYGGLVEIADYCP 136          
BLAST of Leishmanolysin-like peptidase vs. Ensembl Nematostella
Match: EDO44382 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RW33])

HSP 1 Score: 213.386 bits (542), Expect = 1.958e-60
Identity = 155/505 (30.69%), Postives = 240/505 (47.52%), Query Frame = 1
Query:  259 NARLKRATSQNLRIYFDYQSSFTSSSFA--EALKTNLMEPAKNVLQSIITPKSPNNGLLLVDRSCTNSMMRLNSKNQKG--------CAYGCTQTECLGIVVPSVYLKACKIVDSLG--NFQTTGSD---GAGISDIDIVLLVT---YTNCS-ANTLAYAGSCFMENVLDRPILGVVNLCSNMIDPYTNTQSYTKVI---IHEIIHSLGFSVDKYAFYRYQDGSPIVPRNAYGFPNLGVSANGYYNWNENIIKPIVRQRNSVNSAYTVNFYGFVL-PNVLAAARVHFDCPTLEAVDLEDYGGASSAYSHFDEYFLFNELMTPQSNGAMDFLSRITLALLQDTGWYNVDFSAVGNFDYGRKKGCVLPEKGCYNYMQMRESKSLTLDPLCNTALVYGNILGCSIYRNYFYRCNLIKYTS-VPPNLQYFKSLPGIPS--------ADVQFYAGLSPYNEYCPGYWV-------SSKPNFVCNDMQNNNVITGYNSIPSYFGSDSMCIN 1656
            +A  K   +Q LR    Y  S  S S    + +   L+  A +      + + P    + + R+C N+   L  K++ G        C   C  T C  + VP+ +L  C++ D+ G    +  G +   G GI+  D VL V+    ++CS AN +AYA  C  E++LDRP+ G  NLC + +D  T+ + Y+ +I    HE+ H+LGFS   YAFYR + G+P+  R  +G P      N  Y W+  ++K + R++  V   +  +    ++ P V+  AR HF+C TLE  ++E+ GG  +  +H+++    NE MT        F SR+TLAL++DTGWY  ++S     D+GR  GCV  ++ C  +MQ   + + + +P C T       + C+  +     CNL KY   +PP  QYF  LP   S        AD   Y G  P  +YCP Y          +K    C   +N     G  ++ SY G+ S C  
Sbjct:    9 HAHSKHPINQPLRFEVVYDESIESLSAEKNQLVTEKLIPEAVHYFHYTFSVR-PIKIPIKLQRTCKNNAYFL--KDETGTKLGDVQYCKEECVTTRCGPVTVPARHLDQCRVCDARGLECVRMPGDEWASGPGITRRDFVLYVSSIQTSHCSVANAVAYASYCQQEHMLDRPVAGFANLCPDRLD--TDPRHYSNLISTVKHEVYHALGFSAGLYAFYRDKQGAPLTQRRKHGLPVYNDKTN-LYQWSNKVVKKVTRKKWQVRHGHVTHSVSMIVTPRVVRVAREHFNCATLEGAEIENQGGTGTELTHWEKRLFENEAMTGTYTQNPVF-SRLTLALMEDTGWYKANYSMAETLDWGRNLGCVFAKESCRTWMQSHVAHNKSSEPFCYTLKQAPLRMRCTHSKLSIALCNLRKYPQPLPPEYQYFSHLPKESSRKTREAVFADTDSYGGAVPLADYCPFYQKFTLTGMDGTKRETTCTVSENGPPAHGNYALESY-GATSRCFE 505          
BLAST of Leishmanolysin-like peptidase vs. Ensembl Nematostella
Match: EDO33070 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7ST90])

HSP 1 Score: 187.963 bits (476), Expect = 8.997e-52
Identity = 132/440 (30.00%), Postives = 202/440 (45.91%), Query Frame = 1
Query:  427 LLVDRSCTNSMMRLNSKNQKG------CAYGCTQTE--CLGIVVPSVYLKACKIVDSLG---NFQTTGSDGAGISDIDIVLLVTYT--NCSA-NTLAYAGSCFMENVLDRPILGVVNLCSNMIDPYTNTQSYTKVIIHEIIHSLGFSVDKYAFYRYQDGSPIVPRNAYGFPNLGVSANGYYNWNENIIKPIVRQRNSVNS--------AYTVNFYGFVLPNVLAAARVHFDCPTLEAVDLEDYGGASSAYSHFDEYFLFNELMTPQSNGAMDFLSRITLALLQDTGWYNVDFSAVGNFDYGRKKGCVLPEKGCYNYMQMRESKSLTLDPLCNTAL--VYGNILGCSIYRNYFYRCNLIKYTS-VPPNLQYFKSLPGIPSADVQFYAGLSPYNEYCPGY----WVSSKPNFVCN--DMQNNNVITGYNSIPSYFGSDSMCI 1653
            +++DR C N    L +    G      C   C  ++  C    VP   + AC++ +  G   + +   S G G +D D VL VT +   C    TLAYA  C  E  +DRP+ G +N+C + ++   + +       HEI H+LGFS   YAF+RY +G+ I PR+  G P   + A G Y W++  IK I R+   + +        ++TV     V P V    + HF+C +LE  +LE+ GG  +  +H+++    NE MT        F SR+TLAL++DTGWY  +F       +G+  GC+     C  ++  ++       P C T           CS  +     CNL +YT  +P   QYF+SL GI +  +  Y G     ++CP Y    W S     + +     +N      N    Y+GSD+ C 
Sbjct:   53 IILDRRCLNDSYFLKNATGDGPGKVRFCKVACDASKPLCGPRNVPRSDVAACRVCNEHGEDCHAENNSSSGVGKNDTDFVLYVTASMEKCEKRETLAYAAVCQQEGNVDRPVAGFLNICPDKMNVSNDQKELLATFKHEIFHALGFSPSLYAFFRYDNGTAITPRSDTGMPPYDL-ALGRYTWSDRTIKTIERKDWMIRTDKGNNGMVSHTVQL--MVTPRVQQEVQDHFNCSSLEGAELENQGGPGTELAHWEKRVFENEGMTGAFTQNAVF-SRVTLALMEDTGWYRSNFKMAETLRWGKNLGCLFVNNSCKAWLTQQQRLKEKAYPFCQTLKNSTEAQRTYCSNDKTSVAMCNLAQYTQPLPVEYQYFESLAGINNPGL--YGGSVDLADFCPYYQGFVWTSKGAGLLGSYCLSSSNQKTEEKNYGLEYYGSDAKCF 486          
BLAST of Leishmanolysin-like peptidase vs. Ensembl Medaka
Match: lmln (leishmanolysin like peptidase [Source:NCBI gene;Acc:101175034])

HSP 1 Score: 229.18 bits (583), Expect = 1.959e-65
Identity = 154/463 (33.26%), Postives = 221/463 (47.73%), Query Frame = 1
Query:  193 CDHKIPPVSELVVGIEPGPLPPNARLKRATSQ--NLRIYFDYQSSFTSSSFAEALKTNLMEPAKNVLQSIITPKSPNNGLLLVDRSCTNSMMRLNSKNQKGCAYGCTQ-TECLGIVVPSVYLKACKIVDSLGN--FQTTGSDGAGISDIDIVLLV---TYTNC-SANTLAYAGSCFMENVLDRPILGVVNLCSNMIDPYTNT-QSYTKVIIHEIIHSLGFSVDKYAFYRYQDGSPIVPRNAYGFPNLGVSANGYYNWNENIIKPIVRQ---RNSVNSAYTVNFYGFVLPNVLAAARVHFDCPTLEAVDLEDYGGASSAYSHFDEYFLFNELMTPQSNGAMDFLSRITLALLQDTGWYNVDFSAVGNFDYGRKKGCVLPEKGCYNYMQMRESKSLTLDPLCNTALVYGNILGCSIYRNYFYRCNLIKY-TSVPPNLQYFKSLPGIPSADVQFYAGLSPYNEYCP 1539
            C+H++P  +E++  +    L P    KR++     L+I   Y SS     F  +L+  L   A + LQ   + K     +LL     TN  MR  +   + C   C   T C  ++VP  +L+ CK+    G     T   DG G+   D VL V   T   C   N +AYA  C +E  LDRPI G  NLC  MI       +     + HEIIH+LGFS   +AFY   +G P+ PR A G P    S  G Y W+E +I+ + R    R  V   + V+    V P V+  AR HF+CP LE ++LE+ GGA +  +H+++  L NE MT  S+      SR+TLA+++D+GWY  ++S     D+GR  GC    K C  +M  +  +   + P CNT       L C   +     CNL KY   +P   QYF  +  + +  + FY G     +YCP
Sbjct:   38 CNHRVPSPAEVIHHVY---LKPERLTKRSSPDVLQLKIKIIYDSSRCYKLFC-SLQDKLFPQAIDFLQRAFSVKHRVGPILLSRLCATNQYMRKRNDPHRYCQESCADVTRCGPVIVPHHHLQQCKVCSEFGKSCGPTGPPDGPGVEGSDFVLYVSGITTERCGQENIVAYAAYCQLEAELDRPIAGYANLCPTMISSQPQEFEGMLSTVKHEIIHALGFSAGLFAFYHDDEGKPLTPRFASGLPAFNESL-GLYQWSEAVIRRVSRLWDIRGGVMVRHHVHV--MVTPRVVEEARNHFNCPILEGMELENQGGAGTELNHWEKRLLENEAMT-GSHTQNRVFSRLTLAIMEDSGWYRANYSLAQRLDWGRGLGCDFVMKSCKLWMDKQSQRRHAVTPYCNTVRSSPLQLTCRQDQLAVAVCNLQKYPEKLPLEYQYFDQISDVAADQLSFYGGAVEIADYCP 492          
BLAST of Leishmanolysin-like peptidase vs. Planmine SMEST
Match: SMESG000008405.1 (SMESG000008405.1)

HSP 1 Score: 1196.42 bits (3094), Expect = 0.000e+0
Identity = 596/598 (99.67%), Postives = 596/598 (99.67%), Query Frame = 1
Query:  169 STGIQCHVCDHKIPPVSELVVGIEPGPLPPNARLKRATSQNLRIYFDYQSSFTSSSFAEALKTNLMEPAKNVLQSIITPKSPNNGLLLVDRSCTNSMMRLNSKNQKGCAYGCTQTECLGIVVPSVYLKACKIVDSLGNFQTTGSDGAGISDIDIVLLVTYTNCSANTLAYAGSCFMENVLDRPILGVVNLCSNMIDPYTNTQSYTKVIIHEIIHSLGFSVDKYAFYRYQDGSPIVPRNAYGFPNLGVSANGYYNWNENIIKPIVRQRNSVNSAYTVNFYGFVLPNVLAAARVHFDCPTLEAVDLEDYGGASSAYSHFDEYFLFNELMTPQSNGAMDFLSRITLALLQDTGWYNVDFSAVGNFDYGRKKGCVLPEKGCYNYMQMRESKSLTLDPLCNTALVYGNILGCSIYRNYFYRCNLIKYTSVPPNLQYFKSLPGIPSADVQFYAGLSPYNEYCPGYWVSSKPNFVCNDMQNNNVITGYNSIPSYFGSDSMCINTYINNGLNTSIYGASCQKXXXXXXXXXXXXIGNSILKCPSNVIQNFTTSNGSLAYVDCITFNIESSSPDLWNVRSSSFSKKTNLITYETVICFIILMIFKRT 1962
            STGIQCHVCDHKIPPVSELVVGIEPGPLPPNARLKRATSQNLRIYFDYQSSFTSSSFAEALKTNLMEPAKNVLQSIITPKSPNNGLLLVDRSCTNSMMRLNSKNQKGCAYGCTQTECLGIVVPSVYLKACKIVDSLGNFQTTGSDGAGISDIDIVLLVTYTNCSANTLAYAGSCFMENVLDRPILGVVNLCSNMIDPYTNTQSYTKVIIHEIIHSLGFSVDKYAFYRYQDGSPIVPRNAYGFPNLGVSANGYYNWNENIIKPIVRQRNSVNSAYTVNFYGFVLPNVLAAARVHFDCPTLEAVDLEDYGGASSAYSHFDEYFLFNELMTPQSNGAMDFLSRITLALLQDTGWYNVDFSAVGNFDYGRKKGCVLPEKGCYNYMQMRESKSLTLDPLCNTALVYGNILGCSIYRNYFYRCNL KYTSVPPNLQYFKSLPGIPSADVQFYAGLSPYNEYCPGYWVSSKPNFVCNDMQNNNVITGYNSIPSYFGSDSMCINTYINNGLNTSIYGASCQKFSYNPSSSYSFFIGNSILKCPSNVIQNFTTSNGSLAYVDCITFNIESSSPDLWNVRSSSFSKKTNLITYETVICFII MIFKRT
Sbjct:   19 STGIQCHVCDHKIPPVSELVVGIEPGPLPPNARLKRATSQNLRIYFDYQSSFTSSSFAEALKTNLMEPAKNVLQSIITPKSPNNGLLLVDRSCTNSMMRLNSKNQKGCAYGCTQTECLGIVVPSVYLKACKIVDSLGNFQTTGSDGAGISDIDIVLLVTYTNCSANTLAYAGSCFMENVLDRPILGVVNLCSNMIDPYTNTQSYTKVIIHEIIHSLGFSVDKYAFYRYQDGSPIVPRNAYGFPNLGVSANGYYNWNENIIKPIVRQRNSVNSAYTVNFYGFVLPNVLAAARVHFDCPTLEAVDLEDYGGASSAYSHFDEYFLFNELMTPQSNGAMDFLSRITLALLQDTGWYNVDFSAVGNFDYGRKKGCVLPEKGCYNYMQMRESKSLTLDPLCNTALVYGNILGCSIYRNYFYRCNLFKYTSVPPNLQYFKSLPGIPSADVQFYAGLSPYNEYCPGYWVSSKPNFVCNDMQNNNVITGYNSIPSYFGSDSMCINTYINNGLNTSIYGASCQKFSYNPSSSYSFFIGNSILKCPSNVIQNFTTSNGSLAYVDCITFNIESSSPDLWNVRSSSFSKKTNLITYETVICFIIFMIFKRT 616          
BLAST of Leishmanolysin-like peptidase vs. Planmine SMEST
Match: SMESG000008414.1 (SMESG000008414.1)

HSP 1 Score: 634.795 bits (1636), Expect = 0.000e+0
Identity = 322/545 (59.08%), Postives = 390/545 (71.56%), Query Frame = 1
Query:  187 HVCDHKIPPVSELVVGIEPGPLPPNARLKRATSQNLRIYFDYQSSFTSSSFAEALKTNLMEPAKNVLQSIITPKSPNNGLLLVDRSCTNSMMRLNSKNQKGCAYGCTQTECLGIVVPSVYLKACKIVDSLGNFQTTGSDGAGISDIDIVLLVTYTNCSANTLAYAGSCFMENVLDRPILGVVNLCSNMIDPYTNTQSYTKVIIHEIIHSLGFSVDKYAFYRYQDGSPIVPRNAYGFPNLGVSANGYYNWNENIIKPIVRQRNSVNSAYTVNFYGFVLPNVLAAARVHFDCPTLEAVDLEDYG--GASSAYSHFDEYFLFNELMTPQSNGAMDFLSRITLALLQDTGWYNVDFSAVGNFDYGRKKGCVLPEKGCYNYMQMRESKSLTLDPLCNTALVYGNILGCSIYRNYFYRCNLIKYTSVPPNLQYFKSLPGIPSADVQFYAGLSPYNEYCPGYWVSSKPNFVCNDMQNNNVITGYNSIPSYFGSDSMCINTYINNGLNTSIYGASCQK-XXXXXXXXXXXXIGNSILKCPSNVIQNFTTSNGS 1812
            HVC+H IP +SE+V GI   PLP + R KR+ S NLRIY+DYQSSFT+  +AE LKT +MEPA+N+LQS+I PK+ N GLLLVDR C  S  R+N++N KGC++GC    CLG  VP  YLK C  ++  G    +GS G+G++D DIVLLVTYT+C   TLAYAGSCF E  LDRPILGV+NLCSN I   +  +   K+I HEIIH+LGFSVDKYAFYRY +G PIV RN +GFPN GV +N YY WN+ II  I R R SV S+Y++ F GFVLPNVL AAR HF+CPTL AVDLEDYG     SA SHFDEYFL+NELMTP SN  +DF+S ITLALL DTGWY V++SAVGN DYG +KGC+LPEKGCY+YMQ +     +LDP CN     G  L CS++R YFY CNL K + + P  QYF SL G+  ADVQ+Y+G SPYNEYCP Y V + P+FVCN+  NNNV   YN +PSYFG DSMC + YI N  + S YGASCQK    + +  Y+ +I NS+  CPS   Q +T S+GS
Sbjct:   47 HVCNHPIPHISEIVTGITSEPLPSHIRRKRSISPNLRIYYDYQSSFTNYPYAELLKTTVMEPARNLLQSLIFPKAQNTGLLLVDRPCQQSSYRINTENIKGCSFGCENATCLGFPVPDKYLKVCTTINGTGGVIQSGSQGSGVADADIVLLVTYTSCGGATLAYAGSCFGEATLDRPILGVINLCSNTIQVNSKVKENVKIITHEIIHALGFSVDKYAFYRYPNGDPIVSRNIFGFPNSGVVSNSYYMWNDKIITTITRSRTSVTSSYSLQFNGFVLPNVLTAARNHFNCPTLIAVDLEDYGTDTGGSALSHFDEYFLYNELMTPVSNNGIDFISNITLALLNDTGWYTVNYSAVGNLDYGYQKGCILPEKGCYSYMQSQSQSQ-SLDPFCNVPFARGRTLACSLFREYFYLCNLNKISGLNPTYQYFTSLAGVNPADVQYYSGSSPYNEYCPTYMVFTDPSFVCNNELNNNVPNLYNVVPSYFGPDSMCFSNYIQNPSSGSYYGASCQKYTKNSLTGGYTVYIANSVFSCPSPTRQTYTLSDGS 590          
BLAST of Leishmanolysin-like peptidase vs. Planmine SMEST
Match: SMESG000008414.1 (SMESG000008414.1)

HSP 1 Score: 634.795 bits (1636), Expect = 0.000e+0
Identity = 322/545 (59.08%), Postives = 390/545 (71.56%), Query Frame = 1
Query:  187 HVCDHKIPPVSELVVGIEPGPLPPNARLKRATSQNLRIYFDYQSSFTSSSFAEALKTNLMEPAKNVLQSIITPKSPNNGLLLVDRSCTNSMMRLNSKNQKGCAYGCTQTECLGIVVPSVYLKACKIVDSLGNFQTTGSDGAGISDIDIVLLVTYTNCSANTLAYAGSCFMENVLDRPILGVVNLCSNMIDPYTNTQSYTKVIIHEIIHSLGFSVDKYAFYRYQDGSPIVPRNAYGFPNLGVSANGYYNWNENIIKPIVRQRNSVNSAYTVNFYGFVLPNVLAAARVHFDCPTLEAVDLEDYG--GASSAYSHFDEYFLFNELMTPQSNGAMDFLSRITLALLQDTGWYNVDFSAVGNFDYGRKKGCVLPEKGCYNYMQMRESKSLTLDPLCNTALVYGNILGCSIYRNYFYRCNLIKYTSVPPNLQYFKSLPGIPSADVQFYAGLSPYNEYCPGYWVSSKPNFVCNDMQNNNVITGYNSIPSYFGSDSMCINTYINNGLNTSIYGASCQK-XXXXXXXXXXXXIGNSILKCPSNVIQNFTTSNGS 1812
            HVC+H IP +SE+V GI   PLP + R KR+ S NLRIY+DYQSSFT+  +AE LKT +MEPA+N+LQS+I PK+ N GLLLVDR C  S  R+N++N KGC++GC    CLG  VP  YLK C  ++  G    +GS G+G++D DIVLLVTYT+C   TLAYAGSCF E  LDRPILGV+NLCSN I   +  +   K+I HEIIH+LGFSVDKYAFYRY +G PIV RN +GFPN GV +N YY WN+ II  I R R SV S+Y++ F GFVLPNVL AAR HF+CPTL AVDLEDYG     SA SHFDEYFL+NELMTP SN  +DF+S ITLALL DTGWY V++SAVGN DYG +KGC+LPEKGCY+YMQ +     +LDP CN     G  L CS++R YFY CNL K + + P  QYF SL G+  ADVQ+Y+G SPYNEYCP Y V + P+FVCN+  NNNV   YN +PSYFG DSMC + YI N  + S YGASCQK    + +  Y+ +I NS+  CPS   Q +T S+GS
Sbjct:   25 HVCNHPIPHISEIVTGITSEPLPSHIRRKRSISPNLRIYYDYQSSFTNYPYAELLKTTVMEPARNLLQSLIFPKAQNTGLLLVDRPCQQSSYRINTENIKGCSFGCENATCLGFPVPDKYLKVCTTINGTGGVIQSGSQGSGVADADIVLLVTYTSCGGATLAYAGSCFGEATLDRPILGVINLCSNTIQVNSKVKENVKIITHEIIHALGFSVDKYAFYRYPNGDPIVSRNIFGFPNSGVVSNSYYMWNDKIITTITRSRTSVTSSYSLQFNGFVLPNVLTAARNHFNCPTLIAVDLEDYGTDTGGSALSHFDEYFLYNELMTPVSNNGIDFISNITLALLNDTGWYTVNYSAVGNLDYGYQKGCILPEKGCYSYMQSQSQSQ-SLDPFCNVPFARGRTLACSLFREYFYLCNLNKISGLNPTYQYFTSLAGVNPADVQYYSGSSPYNEYCPTYMVFTDPSFVCNNELNNNVPNLYNVVPSYFGPDSMCFSNYIQNPSSGSYYGASCQKYTKNSLTGGYTVYIANSVFSCPSPTRQTYTLSDGS 568          
BLAST of Leishmanolysin-like peptidase vs. Planmine SMEST
Match: SMESG000036783.1 (SMESG000036783.1)

HSP 1 Score: 502.286 bits (1292), Expect = 5.901e-171
Identity = 252/562 (44.84%), Postives = 349/562 (62.10%), Query Frame = 1
Query:  214 VSELVVGIEPGPLPPNARLKRATSQNLRIYFDYQSSFTSSSFAEALKTNLMEPAKNVLQSIITPKSPNNGLLLVDRSCTNSMMRLNSKNQKGCAYGC-TQTECLGIVVPSVYLKACKIVDSLGNFQTTGSDGAGISDIDIVLLVTYTNCSANTLAYAGSCFMENVLDRPILGVVNLCSNMIDPYTNTQSYTKVIIHEIIHSLGFSVDKYAFYRYQDGSPIVPRNAYGFPNLGVS-ANGYYNWNENIIKPIVRQRNSVNSAYTVNFYGFVLPNVLAAARVHFDCPTLEAVDLEDYGGASSAYSHFDEYFLFNELMTPQSNGAMDFLSRITLALLQDTGWYNVDFSAVGNFDYGRKKGCVLPEKGCYNYMQMRESKSLTLDPLCNTALVYGNILGCSIYRNYFYRCNLIKYTSVPPNLQYFKSLPGIPSADVQFYAGLSPYNEYCPGYWVSSKPNFVCNDMQNNNVITGYNSIPSYFGSDSMCINTYINNGLNTSIYGASCQK-XXXXXXXXXXXXIGNSILKCPSNVIQNFTTSNGSLAYVDCITFNIESSSPDLWNVRSSSF 1890
            + E+V GIE      N R ++++S +LRI++ Y  SF S   ++A+K  +MEP+K  ++ ++  K+P NG+L VDR C N   R N+   +GC  GC   T+CLGI +P  YLK C+ +   G    + S+G GI+++DI+++V +T+C+ +T A A SCF+E  LDRPILGV+ +C        N     K+I HEIIH+LGF+++KYA++R  +G PIVPR+ +G P LG +    YY WN+ IIK + R R SVN  Y      FVL N++  A+ HF CP ++AVDLED GG+ SA +HFDEY L N++MTPQ+N A+D +S+ TLALLQDTGWY VD+S   ++DYG+ KGC LP KGCY YM+ +  K+  LDP C+    YGNI  CS  RNY+  C+L  Y  V    QYF+ + GI   D QFYAG S +NE+CP   + S PN  CND+ N+ +   YN + SY+G DS+CI   + N ++T  YGASCQK      S  Y  FIG + L CPSNV  +F   N     V C  F ++S+S       S +F
Sbjct:   24 LDEMVTGIEIDQNLQNYRTRKSSS-HLRIHYHYTDSFGSYPNSDAIKKQIMEPSKEEIERMLKAKNPINGVLRVDRRCINGRSRTNADGIRGCIEGCVAATKCLGITIPEEYLKRCRKILPSGEIIYSQSEGPGIANVDIIIVVAFTHCNDHTKASAASCFIEKQLDRPILGVIEMCIGKFQVNVNVIESVKIIQHEIIHALGFALNKYAYFRQSNGLPIVPRDEFGVPALGKNNIERYYLWNDKIIKKVQRTRESVNGIYKKTMDAFVLENIVKVAQEHFGCPDIDAVDLEDAGGSGSALTHFDEYLLHNDIMTPQTNNALDVISKFTLALLQDTGWYEVDYSKAQDYDYGKGKGCTLPLKGCYRYMEEQRQKNAPLDPFCDRVFQYGNIARCSKKRNYYDYCHLTYYNEVSKENQYFREIHGIKKEDAQFYAGQSEFNEFCPFKVIFSAPNSFCNDITNSYLQDKYNILTSYYGKDSLCIENTLENSIDTVYYGASCQKYSYNATSKEYQIFIGPNSLTCPSNVASHFVIDNFYKISVKCPEFMMKSNSESQMLRNSKNF 584          
BLAST of Leishmanolysin-like peptidase vs. Planmine SMEST
Match: SMESG000008407.1 (SMESG000008407.1)

HSP 1 Score: 320.087 bits (819), Expect = 5.671e-106
Identity = 155/173 (89.60%), Postives = 160/173 (92.49%), Query Frame = 1
Query:  169 STGIQCHVCDHKIPPVSELVVGIEPGPLPPNARLKRATSQNLRIYFDYQSSFTSSSFAEALKTNLMEPAKNVLQSIITPKSPNNGLLLVDRSCTNSMMRLNSKNQKGCAYGCTQTECLGIVVPSVYLKACKIVDSLGNFQTTGSDGAGISDIDIVLLVTYTNCSANTLAYAGS 687
            S GIQCHVCDHKIP +SELVVGIEPGPLPPNARLKRATSQNLRIYFDYQSSFTSS FAEALKTNLMEPAKN+LQSIITPKSPNNGLLLVDRSCTNSMMRLN  NQKGCA GC QT+C GIVVPSVYLKACKI+D  GN QTTGSDGAGISDIDIVLLVTYTNCS N LA+AGS
Sbjct:   19 SAGIQCHVCDHKIPLISELVVGIEPGPLPPNARLKRATSQNLRIYFDYQSSFTSSPFAEALKTNLMEPAKNLLQSIITPKSPNNGLLLVDRSCTNSMMRLNLNNQKGCATGCAQTKCFGIVVPSVYLKACKIIDPYGNVQTTGSDGAGISDIDIVLLVTYTNCSGNLLAHAGS 191          
The following BLAST results are available for this feature:
BLAST of Leishmanolysin-like peptidase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LMLN3.349e-7233.62leishmanolysin like peptidase [Source:HGNC Symbol;... [more]
LMLN1.835e-7133.48leishmanolysin like peptidase [Source:HGNC Symbol;... [more]
LMLN3.007e-5631.69leishmanolysin like peptidase [Source:HGNC Symbol;... [more]
LMLN1.682e-5531.56leishmanolysin like peptidase [Source:HGNC Symbol;... [more]
LMLN27.460e-1526.59leishmanolysin like peptidase 2 [Source:HGNC Symbo... [more]
back to top
BLAST of Leishmanolysin-like peptidase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Y43F4A.14.485e-5630.72Leishmanolysin-like peptidase [Source:UniProtKB/S... [more]
T13B5.95.097e-1023.28pep chromosome:WBcel235:II:1101371:1104509:-1 gene... [more]
back to top
BLAST of Leishmanolysin-like peptidase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Invadolysin2.549e-6029.35gene:FBgn0086359 transcript:FBtr0082181[more]
back to top
BLAST of Leishmanolysin-like peptidase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
lmln2.203e-8035.16leishmanolysin-like (metallopeptidase M8 family) [... [more]
lmln2.213e-7234.82leishmanolysin-like (metallopeptidase M8 family) [... [more]
si:ch211-216p19.54.978e-1424.78si:ch211-216p19.5 [Source:ZFIN;Acc:ZDB-GENE-160728... [more]
back to top
BLAST of Leishmanolysin-like peptidase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
LMLN5.655e-1736.69leishmanolysin-like (metallopeptidase M8 family) [... [more]
back to top
BLAST of Leishmanolysin-like peptidase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Lmln5.491e-6932.54leishmanolysin-like (metallopeptidase M8 family) [... [more]
Gm297767.610e-1726.07predicted gene, 29776 [Source:MGI Symbol;Acc:MGI:5... [more]
back to top
BLAST of Leishmanolysin-like peptidase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8BMN4|LMLN_MOUSE3.841e-6832.54Leishmanolysin-like peptidase OS=Mus musculus OX=1... [more]
sp|Q29AK2|LMLN_DROPS1.866e-5929.73Leishmanolysin-like peptidase OS=Drosophila pseudo... [more]
sp|Q9VH19|LMLN_DROME2.555e-5929.35Leishmanolysin-like peptidase OS=Drosophila melano... [more]
sp|Q61YG1|LMLN_CAEBR2.264e-5829.82Leishmanolysin-like peptidase OS=Caenorhabditis br... [more]
sp|Q96KR4|LMLN_HUMAN1.444e-5531.69Leishmanolysin-like peptidase OS=Homo sapiens OX=9... [more]
back to top
BLAST of Leishmanolysin-like peptidase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
W5M4S71.625e-7834.98Leishmanolysin-like peptidase OS=Lepisosteus ocula... [more]
A0A3N0YWA03.384e-7835.38Leishmanolysin-like peptidase OS=Anabarilius graha... [more]
F1Q5N14.928e-7735.16Leishmanolysin-like peptidase OS=Danio rerio OX=79... [more]
A0A5A9P3856.065e-7634.25Leishmanolysin-like peptidase OS=Triplophysa tibet... [more]
A0A4W4FFJ24.551e-7334.18Leishmanolysin-like peptidase OS=Electrophorus ele... [more]
back to top
BLAST of Leishmanolysin-like peptidase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
lmln2.578e-7533.19leishmanolysin like peptidase [Source:NCBI gene;Ac... [more]
lmln3.860e-7533.19leishmanolysin like peptidase [Source:NCBI gene;Ac... [more]
back to top
BLAST of Leishmanolysin-like peptidase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000004358.16.176e-3030.53pep scaffold:Pmarinus_7.0:GL476418:369102:375246:1... [more]
ENSPMAT00000002113.12.667e-2439.42pep scaffold:Pmarinus_7.0:GL501047:4779:9283:1 gen... [more]
back to top
BLAST of Leishmanolysin-like peptidase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Leishmanolysin-like peptidase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO443821.958e-6030.69Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO330708.997e-5230.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Leishmanolysin-like peptidase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
lmln1.959e-6533.26leishmanolysin like peptidase [Source:NCBI gene;Ac... [more]
back to top
BLAST of Leishmanolysin-like peptidase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000008405.10.000e+099.67SMESG000008405.1[more]
SMESG000008414.10.000e+059.08SMESG000008414.1[more]
SMESG000008414.10.000e+059.08SMESG000008414.1[more]
SMESG000036783.15.901e-17144.84SMESG000036783.1[more]
SMESG000008407.15.671e-10689.60SMESG000008407.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30028423 ID=SMED30028423|Name=Leishmanolysin-like peptidase|organism=Schmidtea mediterranea sexual|type=transcript|length=2031bp
TTTTGGTAGTCAAGTTAAAATATTTCTATGCATTGGTGCTATTTTCATTA
TATGTTTGAACTATAAAATAGTCCAAGTATTTAAACAATGAAAATTATAC
GATATTAAAACAAAATGATCGCCAGATTCAAATTCATAGCAATATGTTTT
GCAATTGCGGAGATTTTCTCAACCGGGATCCAATGTCACGTATGCGACCA
CAAAATCCCCCCAGTTTCAGAGCTAGTAGTCGGTATTGAGCCAGGACCAT
TGCCACCAAATGCTAGACTTAAAAGAGCTACATCACAAAACTTAAGAATT
TATTTTGATTACCAAAGTTCCTTTACATCTTCGTCCTTTGCTGAAGCATT
GAAAACTAATTTAATGGAGCCGGCTAAAAACGTGCTGCAGTCTATTATTA
CTCCGAAAAGTCCAAACAATGGATTACTTCTGGTTGACAGATCCTGTACA
AATTCTATGATGAGACTAAATTCAAAAAATCAAAAAGGTTGCGCATACGG
ATGCACGCAAACCGAATGTCTAGGTATAGTGGTTCCTTCTGTTTATTTAA
AGGCATGCAAAATTGTTGATTCACTGGGCAATTTTCAGACAACAGGATCA
GATGGGGCAGGAATATCTGACATAGACATTGTATTACTTGTTACATATAC
AAATTGTAGTGCAAACACTTTGGCTTATGCCGGATCATGCTTTATGGAAA
ATGTTCTTGACAGACCCATTCTTGGGGTTGTCAATCTCTGTTCAAACATG
ATAGATCCGTATACTAATACACAGTCGTATACAAAAGTTATCATTCATGA
AATTATTCATAGTTTGGGATTTAGCGTGGATAAATACGCATTTTATCGTT
ATCAGGATGGGAGTCCTATTGTTCCTAGAAATGCATATGGTTTCCCTAAT
TTGGGAGTATCTGCAAATGGATATTATAATTGGAATGAAAATATCATCAA
GCCAATTGTAAGGCAGAGAAACTCAGTAAATTCAGCTTATACTGTAAACT
TTTATGGTTTTGTACTGCCCAATGTCTTGGCAGCAGCTCGTGTTCATTTT
GATTGTCCAACGTTAGAAGCGGTTGATCTAGAAGATTACGGGGGTGCCTC
TTCTGCATACAGCCATTTTGATGAATATTTTCTATTTAATGAATTAATGA
CTCCTCAATCTAACGGTGCGATGGACTTCTTATCAAGAATCACTTTGGCT
CTCCTACAAGATACAGGATGGTATAACGTTGATTTTTCGGCAGTTGGAAA
TTTCGACTATGGACGCAAAAAAGGCTGCGTACTTCCAGAAAAGGGATGTT
ACAACTATATGCAAATGAGAGAATCAAAATCTCTTACACTCGATCCACTT
TGCAATACTGCTTTAGTCTACGGCAATATCCTTGGCTGTTCAATATACAG
AAATTATTTTTACAGGTGTAATCTAATTAAATATACCTCGGTTCCTCCAA
ATTTACAATATTTTAAATCTCTTCCTGGAATTCCTTCTGCTGATGTTCAA
TTTTATGCTGGTCTGTCACCTTATAACGAATATTGCCCAGGCTACTGGGT
AAGTAGCAAACCGAATTTTGTTTGTAATGATATGCAAAATAACAATGTAA
TCACTGGTTATAACTCGATTCCATCTTATTTTGGGTCTGATTCAATGTGC
ATAAATACATATATCAACAACGGGTTAAATACATCTATTTATGGAGCCTC
TTGCCAGAAGTTTAGTTATAATCCGTCATCAAGTTATTCATTTTTTATTG
GGAATTCAATATTGAAATGTCCATCAAATGTTATTCAAAATTTTACTACT
TCTAATGGATCTTTGGCATATGTAGATTGTATAACTTTTAATATTGAGAG
TTCTTCTCCTGATTTATGGAATGTGAGATCTTCATCTTTTTCTAAGAAAA
CGAATTTAATCACATATGAAACAGTCATATGTTTCATAATATTAATGATT
TTCAAAAGAACATGAAAACAAATACAAAACAGACACTAAATAATTAACTT
TTAGAAATTTTTATTAGATTTCATTTGCTAT
back to top

protein sequence of SMED30028423-orf-1

>SMED30028423-orf-1 ID=SMED30028423-orf-1|Name=SMED30028423-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=617bp
MIARFKFIAICFAIAEIFSTGIQCHVCDHKIPPVSELVVGIEPGPLPPNA
RLKRATSQNLRIYFDYQSSFTSSSFAEALKTNLMEPAKNVLQSIITPKSP
NNGLLLVDRSCTNSMMRLNSKNQKGCAYGCTQTECLGIVVPSVYLKACKI
VDSLGNFQTTGSDGAGISDIDIVLLVTYTNCSANTLAYAGSCFMENVLDR
PILGVVNLCSNMIDPYTNTQSYTKVIIHEIIHSLGFSVDKYAFYRYQDGS
PIVPRNAYGFPNLGVSANGYYNWNENIIKPIVRQRNSVNSAYTVNFYGFV
LPNVLAAARVHFDCPTLEAVDLEDYGGASSAYSHFDEYFLFNELMTPQSN
GAMDFLSRITLALLQDTGWYNVDFSAVGNFDYGRKKGCVLPEKGCYNYMQ
MRESKSLTLDPLCNTALVYGNILGCSIYRNYFYRCNLIKYTSVPPNLQYF
KSLPGIPSADVQFYAGLSPYNEYCPGYWVSSKPNFVCNDMQNNNVITGYN
SIPSYFGSDSMCINTYINNGLNTSIYGASCQKFSYNPSSSYSFFIGNSIL
KCPSNVIQNFTTSNGSLAYVDCITFNIESSSPDLWNVRSSSFSKKTNLIT
YETVICFIILMIFKRT*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0008233peptidase activity
GO:0008237metallopeptidase activity
GO:0016787hydrolase activity
GO:0046872metal ion binding
GO:0004222metalloendopeptidase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000106ciliated epithelial cell
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR032367Quaking_NLS
IPR001577Peptidase_M8
Vocabulary: biological process
TermDefinition
GO:0007155cell adhesion
GO:0006508proteolysis
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:3.90.132.10coord: 273..395
e-value: 3.9E-28
score: 100.1
NoneNo IPR availableGENE3DG3DSA:3.10.170.20coord: 137..233
e-value: 9.2E-12
score: 46.9
NoneNo IPR availablePANTHERPTHR10942:SF0LEISHMANOLYSIN-LIKE PEPTIDASEcoord: 55..582
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..24
score: 0.599
NoneNo IPR availableSUPERFAMILYSSF55486Metalloproteases ("zincins"), catalytic domaincoord: 60..555
IPR001577Peptidase M8, leishmanolysinPFAMPF01457Peptidase_M8coord: 165..524
e-value: 9.1E-42
score: 143.4
IPR001577Peptidase M8, leishmanolysinPANTHERPTHR10942LEISHMANOLYSIN-LIKE PEPTIDASEcoord: 55..582