Nucleotide-binding oligomerization domain-containing protein 2

Overview
NameNucleotide-binding oligomerization domain-containing protein 2
Smed IDSMED30028420
Length (bp)5295
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Nucleotide-binding oligomerization domain-containing protein 2 (SMED30028420) t-SNE clustered cells

Violin plots show distribution of expression levels for Nucleotide-binding oligomerization domain-containing protein 2 (SMED30028420) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Nucleotide-binding oligomerization domain-containing protein 2 (SMED30028420) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Nucleotide-binding oligomerization domain-containing protein 2 (SMED30028420) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30028420

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 17

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30028420SMESG000018415.1 dd_Smed_v4_10594_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30028420SMESG000018415.1 dd_Smed_v4_10594_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30028420SMESG000018415.1 dd_Smed_v4_10594_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30028420SMESG000018415.1 dd_Smed_v4_10594_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30028420SMESG000018415.1 dd_Smed_v4_10594_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30028420SMESG000018415.1 dd_Smed_v4_10594_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30028420SMESG000018415.1 dd_Smed_v4_10594_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30028420SMESG000018415.1 dd_Smed_v4_10594_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30028420SMESG000018415.1 dd_Smed_v4_10594_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30028420SMESG000001279.1 Contig24229newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30028420SMESG000055699.1 SMESG000055695.1 SMESG000055671.1 SMESG000055665.1 SMESG000055657.1 SMESG000055647.1 SMESG000018415.1 Contig45695newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30028420SMESG000055699.1 SMESG000055695.1 SMESG000055671.1 SMESG000055665.1 SMESG000055657.1 SMESG000055647.1 SMESG000018415.1 Contig45695uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30028420 Contig25814newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
neoblastSMED30028420SMESG000018415.1 dd_Smed_v6_10594_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
zeta neoblastSMED30028420SMESG000018415.1 dd_Smed_v4_10594_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30028420SMESG000018415.1 SMED_33297_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30028420SMESG000018415.1 SMED_33297_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Nucleotide-binding oligomerization domain-containing protein 2 vs. UniProt/SwissProt
Match: sp|P07796|H1G_STRPU (Histone H1-gamma, late OS=Strongylocentrotus purpuratus OX=7668 PE=3 SV=1)

HSP 1 Score: 53.9138 bits (128), Expect = 2.557e-6
Identity = 28/68 (41.18%), Postives = 38/68 (55.88%), Query Frame = 3
Query: 4014 DMVKSTILAAKSRKGLSLSLIKKYLIDTHKIDIEKYGPFLRRSIVAGVEKGILVRM------GIFKLA 4199
             MV + + A K R G S   IKKY+   + +D+ K GPF+RR++V GV  G LV+       G FKL 
Sbjct:   23 QMVVAAVTALKERGGSSTQAIKKYIAANYTVDMTKQGPFIRRALVKGVASGALVQTKGKGASGSFKLG 90          
BLAST of Nucleotide-binding oligomerization domain-containing protein 2 vs. TrEMBL
Match: A0A2B4RC04 (Uncharacterized protein OS=Stylophora pistillata OX=50429 GN=AWC38_SpisGene20623 PE=4 SV=1)

HSP 1 Score: 144.05 bits (362), Expect = 8.694e-31
Identity = 105/332 (31.63%), Postives = 175/332 (52.71%), Query Frame = 3
Query: 2316 ISLRTIPIILENNEKKLHVNALLDDASTTSFVSEVDTSDLNLSGKETDASVKVIGGRTETISSQI*----------RRQFKALALKTLKCNMKVFNLNKASFLWPNLKGIRFSSLVWKQTVDVLIETDYLDLYXXXXXXXXXXXXXXARLTPLRWTCIGGPGVGQPFIHQANFVHTYFTKQENI---NFDIQKFL*LEET--QEASTSFSAKDKLIIDMTKSNLTSKDNRYEVGIPWKTEKWRC-----XXXXXXXXXD*KCCRKGSLWIQNSKFNILM*LKTTRNYIREITKMEEFERK-WLLP-----QKDRESTNVRIVFDAAARFDGM 3233
            I+LR +P+IL+N  +KL VNA LDDAST ++V+    ++L L G+    +V V+ G+ +T  + +             +  A   K +  NMK  N  + +  W +LK + F  L  +  VD+LI+ DY DL+  IK++ G   E +ARLTPL WTCIG P +     ++ NF+ TY   +++I      I+KF  +E+   Q    +   +DK+ ++  K ++  +D RYEVG+PWK EK          +   +  +   CR   +      ++ ++     +  IR++ +M++   + W LP     + D+E+T  RIVFDA+A+ DG+
Sbjct:  490 IALRAVPVILKNGGRKLVVNAPLDDASTKTYVNSDVAAELGLQGESRKVTVNVLNGQEDTFETPVECGIESLDGRISIRITAFTAKRVTGNMKTVNWARYAKNWTHLKDVNFPYLGPRPIVDILIDIDYADLHYSIKDVRGRLGELVARLTPLGWTCIGHPSLCLELNYRTNFIRTYSVYEDSIVELGNAIRKFWEIEDDGLQAKIKTLKPEDKVALEALKKSIKCEDGRYEVGVPWKEEKPFMPDNYETALRRLQNTEKHFCRYPEI---GKCYSDVINQYQAKGCIRKVPEMDKKPSESWYLPHFAVIRPDKETTKTRIVFDASAKSDGI 818          
BLAST of Nucleotide-binding oligomerization domain-containing protein 2 vs. TrEMBL
Match: A0A2B4R8W4 (Uncharacterized protein OS=Stylophora pistillata OX=50429 GN=AWC38_SpisGene23338 PE=4 SV=1)

HSP 1 Score: 105.916 bits (263), Expect = 4.668e-19
Identity = 75/238 (31.51%), Postives = 127/238 (53.36%), Query Frame = 3
Query: 2316 ISLRTIPIILENNEKKLHVNALLDDASTTSFVSEVDTSDLNLSGKETDASVKVIGGRTETISSQI*RRQFKALALKTLK-----------CNMKVFNLNKASFLWPNLKGIRFSSLVWKQTVDVLIETDYLDLYXXXXXXXXXXXXXXARLTPLRWTCIGGPGVGQPFIHQANFVHTYFTKQENINFDIQKFL*LEETQEASTSF-SAKDKLIIDMTKSNLTSKDNRYEVGIPWKTEK 2993
            ++L T+P+ L + ++K+ VNALL D S+ ++++    ++L L G   + +V V+    ET  + +      +L  K  K            N++V    +    W +L+ I F  +  + T+DVLI  D  DL   +K++ G   EPIARLTPL WTCIG P  G+    QANF   + +  + +N  ++++  ++E + + T+  +  +KL  D   ++LTS D  Y VG+PWK+ K
Sbjct:  412 VALTTVPVYLASGKRKMKVNALLGDCSSRTYLNSDIAAELGLEGNPQELTVNVLNDNQETFEATVVEFTISSLNGKVTKQASVYTTERVTGNIEVVGWRRHQSKWKHLQDIEFPQVGPRTTMDVLIGVDQADLLYPLKDVKGRCEEPIARLTPLGWTCIGNPD-GEAERIQANFTF-FLSDSDKLNNLVRRYWDIDEPKNSKTNIVNTNEKLDRDTVANSLTSVDGHYTVGMPWKSGK 647          
BLAST of Nucleotide-binding oligomerization domain-containing protein 2 vs. TrEMBL
Match: A0A2B4S024 (DUF1758 domain-containing protein OS=Stylophora pistillata OX=50429 GN=AWC38_SpisGene13097 PE=4 SV=1)

HSP 1 Score: 98.9821 bits (245), Expect = 2.264e-18
Identity = 73/230 (31.74%), Postives = 117/230 (50.87%), Query Frame = 3
Query: 2316 ISLRTIPIILENNEKKLHVNALLDDASTTSFVSEVDTSDLNLSGKETDASVKVIGGRTETISSQI*RRQFKALALKTLKC-----------NMKVFNLNKASFLWPNLKGIRFSSLVWKQTVDVLIETDYLDLYXXXXXXXXXXXXXXARLTPLRWTCIGGPGVGQPFIHQANFVHTYFTKQENINFDIQKFL*LEETQEASTSFSAKDKLIIDMTKSNLTSKDNRYEVG 2972
            ++L+T+P+ L N  K++ VNALLD+ S+ ++++    ++L L G+    +VKV+    E ++S I      +L  K  K            N++V N N   + W +LK I+F  +  +   D+LI  D  +L   ++++ G   EPIARLTPL WTCIG  G+ Q    Q NF          +N  +++F   EE +E       ++KL       +LT +D RY VG
Sbjct:   55 VALQTVPVYLTNGRKRVQVNALLDEGSSKAYLNSDVAAELGLEGRPHQLTVKVLNDNQEKLNSSIVEFTIHSLDGKVHKSTSAYTAERVTGNIQVVNWNLYKYKWKHLKSIKFPRVGPRPIDDLLIGVDQAELLCSLEDVTGKPGEPIARLTPLGWTCIGRRGL-QTDTVQTNFTFVVNQDSHGLNNLVRRFWDFEEPKEIQI-VKPEEKLAKSTVAESLTFEDGRYSVG 282          
BLAST of Nucleotide-binding oligomerization domain-containing protein 2 vs. TrEMBL
Match: A0A2B4T023 (Uncharacterized protein OS=Stylophora pistillata OX=50429 GN=AWC38_SpisGene666 PE=4 SV=1)

HSP 1 Score: 100.523 bits (249), Expect = 5.930e-18
Identity = 61/193 (31.61%), Postives = 109/193 (56.48%), Query Frame = 3
Query: 2316 ISLRTIPIILENNEKKLHVNALLDDASTTSFVSEVDTSDLNLSGKETDASVKVIGGRTETISSQI*RRQFKAL-----------ALKTLKCNMKVFNLNKASFLWPNLKGIRFSSLVWKQTVDVLIETDYLDLYXXXXXXXXXXXXXXARLTPLRWTCIGGPGVGQPFIHQANFVHTYFTKQENINFDIQKFL 2861
            ++LRT+P+ L+N+ +++ VNALLDDAST ++++    ++L L G     +V V+ G+ ET  +     + ++L             + +  N++V +  K +  + +LKGI+F +   +   D+LI  DY +L+   K++ G   EP+ARLTPL WTC G     +   +Q++F HTYF ++++   +I   L
Sbjct:  291 VALRTVPVFLKNSYRRIKVNALLDDASTKTYLNADVAAELGLQGHPQSVTVNVLNGQVETFDTMPVEVELESLDGNVKVTISTFTAERVTGNLRVIDWGKYAVNYTHLKGIQFPNPGIRPIADLLIGGDYAELHYSFKDVRGQPGEPVARLTPLGWTCTGTVSGFEGDTYQSSFAHTYFVRKQSDTDEISSLL 483          
BLAST of Nucleotide-binding oligomerization domain-containing protein 2 vs. TrEMBL
Match: A0A2B4RGU9 (Uncharacterized protein OS=Stylophora pistillata OX=50429 GN=AWC38_SpisGene20064 PE=4 SV=1)

HSP 1 Score: 88.5817 bits (218), Expect = 1.338e-17
Identity = 82/331 (24.77%), Postives = 149/331 (45.02%), Query Frame = 3
Query: 2343 LENNEKKLHVNALLDDASTTSFVSEVDTSDLNLSGKETDASVKVIGGRTETISS--------QI*RRQFKALALKT----LKCNMKVFNLNKASFLWPNLKGIRFSSLVWKQTVDVLIETDYLDLYXXXXXXXXXXXXXXARLTPLRWTCIGGPGVGQPFIHQANFVHTYFTKQE----------NINFDIQKFL*LEET---QEASTSFSAKDKLIIDMTKSNLTSKDNRYEVGIPWKTEKWRCXXXXXXXXXD*KCC----RKGSLWIQNSKFNILM*LKTTRNYIREITKMEEFERK-WLLP-----QKDRESTNVRIVFDAAARFDG 3230
            ++ N +K+ +NA+LDD S   F++E     L L        V V+    ET  S         +  R  + + +KT    +  + +V N NK    WP++    F        VD+LI +D  + +    ++ G    PIARL PL W+CIG P        +++ + + FT++           +++  +++F  +E++   ++     + +++L +   K++L  K+ RY V +PWK  K      +       +      +K S   +  + NI       + Y+RE++  E+     W LP     + D+ +T VRIVFD AA+ +G
Sbjct:    1 MKANGRKVKINAVLDDTSDEPFLNEEVAGVLGLQEPFKKVQVHVLNDIVETFQSIPLQIEIESVYGRWSQEIGVKTCPQKVTGSYRVVNWNKHQDKWPHMTQCGFPKPANDGLVDLLIGSDNAEFHYSHVDLRGKLGGPIARLGPLGWSCIGAPDESATARTRSHVIRSLFTREPIWSERKESCGDVDNSLKRFWEIEKSGTDRDDRLVLTEEERLALSKVKNSLKYKNGRYCVVVPWKENKPNLPDTKPMARPRLRSTERNLKKNSRVAEEYQANIQA--YVGKGYLREVSSKEQLPANVWYLPHFPVVRMDKSTTKVRIVFDCAAKCNG 329          

HSP 2 Score: 33.8834 bits (76), Expect = 1.338e-17
Identity = 14/27 (51.85%), Postives = 19/27 (70.37%), Query Frame = 1
Query: 3235 LNDLIETGPKLQNDFFDVLIRFRKHKI 3315
            L D+I  GPKL  D F VL+RFR++ +
Sbjct:  332 LYDMIHPGPKLLRDLFKVLVRFRRNPV 358          
BLAST of Nucleotide-binding oligomerization domain-containing protein 2 vs. Planmine SMEST
Match: SMESG000021004.1 (SMESG000021004.1)

HSP 1 Score: 214.542 bits (545), Expect = 5.733e-64
Identity = 136/335 (40.60%), Postives = 199/335 (59.40%), Query Frame = 3
Query: 2289 YLTKSSDRRISLRTIPIILENNEKKLHVNALLDDASTTSFVSEVDTSDLNLSGKETDASVKVIGGRTETISSQ-----------I*RRQFKALALKTLKCNMKVFNLNKASFLWPNLKGIRFSSLVWKQTVDVLIETDYLDLYXXXXXXXXXXXXXXARLTPLRWTCIGGPGVGQPFIHQANFVHTYFTKQENINFDIQKFL*LEETQEASTSFSAKDKLIIDMTKSNLTSKDNRYEVGIPWKTEK-----WRCXXXXXXXXXD*KCCRKGSLWIQNSKFNILM*LKTTRNYIREITKMEEFERKWLLP-----QKDRESTNVRIVFDAAARFDG 3230
            Y    + R ISLR IPIILE   ++L VNALLDD+ST SF+SE   ++LNL G++    +KV+GGRT+ + +               + FKA+ALK++   M+V + N+A+  WP L  ++F S + ++TVDVLI  DYL+L   IKEI G   EPIARLTPL WTCIG  G G  F HQ+NFV TYF    N+NF++QKF  LE+ +   +S S KD+ I++ +   +  +++RYEV +PWK EK      R +  +    +  +  R   L     ++  L+     + YI+EI + +     W+LP     ++D+E+T +RIVFDAAA+ +G
Sbjct:    6 YQLSGNKRWISLRIIPIILEKGNRQLVVNALLDDSSTASFISEQVATELNLIGEKVRIPIKVVGGRTQEVVAHRTEMTLKSLDGSVEKCFKAMALKSVTGEMRVMDWNEAAKSWPYLAELKFPSNLKRKTVDVLIGADYLELQYSIKEIRGGEGEPIARLTPLGWTCIGNTGYGNSFSHQSNFVQTYFVAGNNMNFELQKFWELEDLEMPPSSHSMKDQEILEHSVGAMQFENDRYEVELPWKFEKPHLNSSRRMAEKRLMNLFGRFERDKEL---EREYIKLIDDHERKGYIKEIDEKQMANEGWILPHFPVIKRDKETTKIRIVFDAAAKVEG 337          

HSP 2 Score: 51.9878 bits (123), Expect = 5.733e-64
Identity = 23/28 (82.14%), Postives = 25/28 (89.29%), Query Frame = 1
Query: 3232 CLNDLIETGPKLQNDFFDVLIRFRKHKI 3315
            CLND IETGPKL ND FDVLIRFRK+K+
Sbjct:  339 CLNDNIETGPKLYNDLFDVLIRFRKNKV 366          
BLAST of Nucleotide-binding oligomerization domain-containing protein 2 vs. Planmine SMEST
Match: SMESG000035995.1 (SMESG000035995.1)

HSP 1 Score: 210.305 bits (534), Expect = 1.265e-62
Identity = 140/346 (40.46%), Postives = 196/346 (56.65%), Query Frame = 3
Query: 2289 YLTKSSDRRISLRTIPIILENNEKKLHVNALLDDASTTSFVSEVDTSDLNLSGKETDASVKVIGGRTETISSQ-----------I*RRQFKALALKTLKCNMKVFNLNKASFLWPNLKGIRFSSLVWKQTVDVLIETDYLDLYXXXXXXXXXXXXXXARLTPLRWTCIGGPGVGQPFIHQANFVHTYFTKQENINFDIQKFL*LEETQEASTSFSAKDKLIIDMTKSNLTSKDNRYEVGIPWKTEKWRCXXXXXXXXXD*KCCRKGSLWIQNSKFNILM*LKTTRNYIREITKM-EEFERK---------------WLLP-----QKDRESTNVRIVFDAAARFDG 3230
            Y    + R ISLRTIPIILE   ++L VNALLDDAST SF+SE   ++LNLSG++    +KV+GGRTE + +               + FKA+ALK++   M+V + N+ +  W  L  ++F S + ++TVDVLI  DYL+L   IKEI G   EPIARLTPL WTCIG  G G  F H++NFV TYF    ++NF +QKF  LE+ + + +S S KD+ I+         +++RYEV +PWK EK              K  R+     +N   N+    +  +   RE TK+ ++ ERK               W+LP     ++DRE+T +RIVFDAAA+ +G
Sbjct:  563 YQLSDNKRWISLRTIPIILEKGNRQLIVNALLDDASTASFISEQVATELNLSGEKVRIPIKVVGGRTEEVVAHRTEMTLKSLDGSVEKCFKAMALKSVTGEMRVMDWNEVAKSWAYLVELKFPSYLKRKTVDVLIGADYLELQYSIKEIRGGEGEPIARLTPLGWTCIGNTGYGNSFSHKSNFVQTYFVSGNSMNFKLQKFWELEDLEMSPSSHSMKDREILQHLLEATQFENDRYEVELPWKFEKPHL-----------KSSRR---MAENRLMNLFGRFERGKELEREYTKLIDDHERKGYIEEIKEKQIANEGWILPHFPVIKRDRETTKIRIVFDAAAKVEG 894          

HSP 2 Score: 51.6026 bits (122), Expect = 1.265e-62
Identity = 22/28 (78.57%), Postives = 25/28 (89.29%), Query Frame = 1
Query: 3232 CLNDLIETGPKLQNDFFDVLIRFRKHKI 3315
            CLND I+TGPKL ND FDVLIRFRK+K+
Sbjct:  896 CLNDNIKTGPKLYNDLFDVLIRFRKNKV 923          

HSP 3 Score: 112.849 bits (281), Expect = 1.769e-24
Identity = 53/118 (44.92%), Postives = 77/118 (65.25%), Query Frame = 2
Query: 3443 DDPLTP*VESNARRWLEEAEYLRVIRIPRYLINFAENEWSLHIFSDTSERAHGAFADLSEQAEEGVRTKFIVAKSKVAFVKMVNIPRMEFLGPCVGLKLAKRIAKAMGHNVRKKTKGS 3796
            D+ L   ++  AR W+ EA  +  +R+PR L+    ++W++H+FSD SE  +   A L  ++   ++ KFI AKSKVA VK VNIPR+E LG C+GLKLAK+I K +GHN+ +   GS
Sbjct: 1068 DECLPLNIDQEARLWVNEARAIVSMRVPRNLLESESDDWTIHVFSDASENTYSLVAYLRRRSSGEIQCKFIAAKSKVAPVKTVNIPRLELLGACLGLKLAKKIVKPIGHNINEMNDGS 1185          
BLAST of Nucleotide-binding oligomerization domain-containing protein 2 vs. Planmine SMEST
Match: SMESG000050827.1 (SMESG000050827.1)

HSP 1 Score: 199.134 bits (505), Expect = 2.748e-59
Identity = 133/331 (40.18%), Postives = 191/331 (57.70%), Query Frame = 3
Query: 2301 SSDRRISLRTIPIILENNEKKLHVNALLDDASTTSFVSEVDTSDLNLSGKETDASVKVIGGRTETISSQ-----------I*RRQFKALALKTLKCNMKVFNLNKASFLWPNLKGIRFSSLVWKQTVDVLIETDYLDLYXXXXXXXXXXXXXXARLTPLRWTCIGGPGVGQPFIHQANFVHTYFTKQENINFDIQKFL*LEETQEASTSFSAKDKLIIDMTKSNLTSKDNRYEVGIPWKTEK-----WRCXXXXXXXXXD*KCCRKGSLWIQNSKFNILM*LKTTRNYIREITKMEEFERKWLLP-----QKDRESTNVRIVFDAAARFDG 3230
            ++ R ISLRTIPIILE   ++  VNALLDDAST SF+SE+               +K++GGRTE + +               + FKA+ALK++   M++ + N+A+  WP L  ++F S + ++TVDVLIE DYL+L   IKEI G   EPIARLT L WTCIG  G G  F HQ+NFV TYF    +INF++QKF  LE+ +   +S S KD+ I+  +   +  +++RYEV +PWK EK      R +  +    +  +  R   L  + +K   L+     + YI EI + +     W+LP     ++DRE+T +RIVFDAAA+ +G
Sbjct:  133 ANKRWISLRTIPIILEKGNRQSAVNALLDDASTASFISEI--------------PIKLVGGRTEEVVAHRTEITLKSLDGSVEKCFKAMALKSVTGEMRIMDWNEAAKSWPYLAELKFPSYLKRKTVDVLIEADYLELQYSIKEIRGGEGEPIARLTTLGWTCIGNTGYGNSFSHQSNFVQTYFVSGNSINFELQKFWELEDLKMPPSSHSMKDREILQHSLEAMQFENDRYEVELPWKFEKPNLKSSRLMAEKRLMNLFSRFERDKELEREYAK---LIDDHERKGYIEEIDENQLANEGWILPHFPVIKRDRETTKIRIVFDAAAKVEG 446          

HSP 2 Score: 51.6026 bits (122), Expect = 2.748e-59
Identity = 23/29 (79.31%), Postives = 26/29 (89.66%), Query Frame = 1
Query: 3229 ECLNDLIETGPKLQNDFFDVLIRFRKHKI 3315
            +CLND IETGPKL ND FDVLIRFRK+K+
Sbjct:  447 KCLNDNIETGPKLYNDLFDVLIRFRKNKV 475          
BLAST of Nucleotide-binding oligomerization domain-containing protein 2 vs. Planmine SMEST
Match: SMESG000060899.1 (SMESG000060899.1)

HSP 1 Score: 201.445 bits (511), Expect = 5.016e-59
Identity = 125/318 (39.31%), Postives = 185/318 (58.18%), Query Frame = 3
Query: 2358 KKLHVNALLDDASTTSFVSEVDTSDLNLSGKETDASVKVIGGRTETISSQ-----------I*RRQFKALALKTLKCNMKVFNLNKASFLWPNLKGIRFSSLVWKQTVDVLIETDYLDLYXXXXXXXXXXXXXXARLTPLRWTCIGGPGVGQPFIHQANFVHTYFTKQENINFDIQKFL*LEETQEASTSFSAKDKLIIDMTKSNLTSKDNRYEVGIPWKTEK-----------WRCXXXXXXXXXD*KCCRKGSLWIQNSKFNILM*LKTTRNYIREITKMEEFERKWLLP-----QKDRESTNVRIVFDAAARFDG 3230
            ++L VNALLDDAST SF+SE   ++LNLSG++    +KV+GGRTE + +               + FKA+ALK++   M+V + N+A+  WP L G++F S + ++TVDVLI  DYL+L   I+E+ G   E IARLTPL WTCIG  G G    HQ+NFV TYF    ++NF++QKF  LE+ +   +S S KD+ I+  +   +  +++RYEV +PWK EK            R + +    E D +  R+ +  I+N +          + YI EI + +     W+ P     ++DRE+T +RIVFDAAA+ +G
Sbjct:  516 RQLVVNALLDDASTASFISEKVATELNLSGEKVRIPIKVVGGRTEEVVAHRTEMTLKSLDGSVEKCFKAMALKSVTGEMRVMDWNEAAKSWPYLAGLKFPSYLKRKTVDVLIGADYLELQYSIQEVRGGEGELIARLTPLGWTCIGNTGYGDSLSHQSNFVQTYFVSGNSMNFELQKFWKLEDLEMPPSSHSMKDREILQHSLEAMQFENDRYEVELPWKFEKPHLKSSRRMAEKRLMNLFGRFERDKELEREYTKLIENHE---------RKGYIEEIDEKQMANEGWISPHFPVIKRDRETTKIRIVFDAAAKVEG 824          

HSP 2 Score: 48.521 bits (114), Expect = 5.016e-59
Identity = 22/28 (78.57%), Postives = 24/28 (85.71%), Query Frame = 1
Query: 3232 CLNDLIETGPKLQNDFFDVLIRFRKHKI 3315
            CLND IETG KL ND FDVLIRFRK+K+
Sbjct:  826 CLNDNIETGSKLYNDLFDVLIRFRKNKV 853          
BLAST of Nucleotide-binding oligomerization domain-containing protein 2 vs. Planmine SMEST
Match: SMESG000053778.1 (SMESG000053778.1)

HSP 1 Score: 192.586 bits (488), Expect = 5.890e-55
Identity = 125/333 (37.54%), Postives = 183/333 (54.95%), Query Frame = 3
Query: 2301 SSDRRISLRTIPIILENNEKKLHVNALLDDASTTSFVSEVDTSDLNLSGKETDASVKVIGGRTETISSQI*R-----------RQFKALALKTLKCNMKVFNLNKASFLWPNLKGIRFSSLVWKQTVDVLIETDYLDLYXXXXXXXXXXXXXXARLTPLRWTCIGGPGVGQPFIHQANFVHTYFTKQENINFDIQKFL*LEETQEASTSFSAKDKLIIDMTKSNLTSKDNRYEVGIPWKTEKWRCXXXXXXXXXD*KCCRKGSLWIQNSK-------FNILM*LKTTRNYIREITKMEEFERKWLLP-----QKDRESTNVRIVFDAAARFDG 3230
            ++ R ISLRTIPIILE   ++L VNALLDDAST SF+SE   + LNLSG++   S+KV+GGRT+ + +               + FKA+ALK++   M+V + N+A+  WP L  ++F S + ++TV                       EPI RLTPL WTCIG  G G  F HQ+NFV TYF    ++NF++QKF  LE+ +   +S S KD+ I+  +   +  K++RYEV +PWK EK          E      R  +L+ +  K       +  L+    ++  I+EI + +     W+LP     ++DRE+T +RIVFD AA+ +G
Sbjct:  362 ANKRWISLRTIPIILEKGNRQLVVNALLDDASTASFISEQVAAGLNLSGEKVRISIKVVGGRTKEVVAHRTEMTLKSLDGSIVKDFKAMALKSVTGEMRVMDWNEAAKSWPYLAELKFPSYLKRKTV----------------INKRREGEPIVRLTPLGWTCIGNTGYGNSFSHQSNFVQTYFVSGNSMNFELQKFWELEDLEMPPSSHSMKDREILQHSLEAMQFKNDRYEVELPWKFEKPHLKSSRRMAEK-----RLMNLFGKFEKDKELEREYTKLIDDHESKGCIKEIDEKQMANEGWILPHFPAIKRDRETTKIRIVFDPAAKVEG 673          

HSP 2 Score: 43.8986 bits (102), Expect = 5.890e-55
Identity = 20/27 (74.07%), Postives = 23/27 (85.19%), Query Frame = 1
Query: 3235 LNDLIETGPKLQNDFFDVLIRFRKHKI 3315
            LN+ IET PKL ND FDVLIRFRK+K+
Sbjct:  676 LNEKIETEPKLYNDLFDVLIRFRKNKV 702          

HSP 3 Score: 76.2554 bits (186), Expect = 2.127e-13
Identity = 37/66 (56.06%), Postives = 49/66 (74.24%), Query Frame = 2
Query: 3578 DTSERAHGAFADLSEQAEEGVRTKFIVAKSKVAFVKMVNIPRMEFLGPCVGLKLAKRIAKAMGHNV 3775
            + SE+A+G+ A    Q+   ++ KFIVAKSKVA VK VNIPR+E LG C+GLKLAK+I K +G N+
Sbjct:  843 NASEKAYGSVAYFRRQSSGEIQCKFIVAKSKVAPVKTVNIPRLELLGVCLGLKLAKKIVKPIGCNI 908          
The following BLAST results are available for this feature:
BLAST of Nucleotide-binding oligomerization domain-containing protein 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Nucleotide-binding oligomerization domain-containing protein 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Nucleotide-binding oligomerization domain-containing protein 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Nucleotide-binding oligomerization domain-containing protein 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Nucleotide-binding oligomerization domain-containing protein 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Nucleotide-binding oligomerization domain-containing protein 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Nucleotide-binding oligomerization domain-containing protein 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 1
Match NameE-valueIdentityDescription
sp|P07796|H1G_STRPU2.557e-641.18Histone H1-gamma, late OS=Strongylocentrotus purpu... [more]
back to top
BLAST of Nucleotide-binding oligomerization domain-containing protein 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2B4RC048.694e-3131.63Uncharacterized protein OS=Stylophora pistillata O... [more]
A0A2B4R8W44.668e-1931.51Uncharacterized protein OS=Stylophora pistillata O... [more]
A0A2B4S0242.264e-1831.74DUF1758 domain-containing protein OS=Stylophora pi... [more]
A0A2B4T0235.930e-1831.61Uncharacterized protein OS=Stylophora pistillata O... [more]
A0A2B4RGU91.338e-1724.77Uncharacterized protein OS=Stylophora pistillata O... [more]
back to top
BLAST of Nucleotide-binding oligomerization domain-containing protein 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Nucleotide-binding oligomerization domain-containing protein 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Nucleotide-binding oligomerization domain-containing protein 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Nucleotide-binding oligomerization domain-containing protein 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Nucleotide-binding oligomerization domain-containing protein 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Nucleotide-binding oligomerization domain-containing protein 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000021004.15.733e-6440.60SMESG000021004.1[more]
SMESG000035995.11.265e-6240.46SMESG000035995.1[more]
SMESG000050827.12.748e-5940.18SMESG000050827.1[more]
SMESG000060899.15.016e-5939.31SMESG000060899.1[more]
SMESG000053778.15.890e-5537.54SMESG000053778.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30028420 ID=SMED30028420|Name=Nucleotide-binding oligomerization domain-containing protein 2|organism=Schmidtea mediterranea sexual|type=transcript|length=5295bp
CAGGGAATTCGATGTCAAAACAAAATCGTTGCTATGATTCCTAACTTCTT
AACTTGAATTTACTAAATTTACAAAATTCATACATTATTTAACTTTGATG
CGAGTGTTACTTCAAAAAATGGTTATCACTAGTAAATTAAGAATAAGAAA
CGTTTAAGGGTGTAATTTCAATTCCCTAATAACTTATCTGACCATGATTT
AACTGCTAACATTAGGGGCAAAAAGCAGATGGATTTATAGATTTCAATTC
CGTTCAGCATGTCGAATCCCTAAGATTCTAATATCAAGCGTTTATAAACT
TGATAACACCCAAAACTTTTTAAATATCCGTTTTGTTCGCCCCAAACCCG
TCGAACCATTGAGCAATCACACATCAGACCCACCATTAATAACTTATTAA
ATAATAGTCCATACCTTTATGAATTTCCCGCCCATAAATTATACAAGTTA
CAAAACTCCAATTAGATAACCGCATAAGTAAAAATTTACTTATTTATTCT
CACTCTGACATTAAAGGAAAACAATTTGGCAATTTTAATCACGAGAAATT
TGCATTTGATAAATTTGAGTCAAATACGTCGAGCTAGTGATATACGGCAT
AACTACGTAAATCCAAAGTCATTAACGAACAACATAATATATTTAATAAA
TTTAAGATGCCATGAACACATAATATATTTAGTAAATTTGAGATGCCACG
AACACATAATATATTCAGTAAATTTGGGATATCATAAACTTGAATTGATA
AACCAACGAAGGTACAGTAGTACACGAACAATAATAATCATGATTCGCTA
ACTGATCCCAAATGAAGCCAACGAAGAACGCGAACCATTTGTTTTTTTTT
GTTTTGTCTGAACAAAGAACCGGATCCGGAATGTCCCTCACTCGTAGAAC
TCCTCGAAAGCCGATCTGATTTTTCATCATCCCGATAATGAACTATAAAA
TAAATATTTAAGTGAAATCCTGATCATTACTATTAAATAATAGTATTTCC
ATCCATGAACAAACAAACTGGCACGACATCACGTACACTATCAATATAAT
CTCGCTGCCGAAGTAAAAATCTGTGCACGGACAAGCCACATAAATTTCTC
CACCCCAAAACGTGCACACCAACATGTATAAATTTCACTGAACAACTTGA
TTCTATCATTTGTTTTCTTTGCAAGTATGACTTACAATTTTAAACGTTCA
AACGCCGACGCTCCAGTCAGATTTCAAGAGGACGAAATAATTGTGGAACC
AAAAAAATAGCTCTCAAAATGGTAAGCTCCATTCCTTAGTTTATTAATGC
AAATATGAGACCTCGTTAATTCACGTTAATTCACAATCCAAATGCCAGTT
TCCCGAATTGAGAACAGATCTTTCTTATTAAAATTTTTGCCAACCTTAGA
GAGGAAACACTCACGAGACCATATTTTTTTGACTTACTCAGTTCAAGGCG
AAATACCAATCATTAATCCAAACATTGTAATACTACCTGATATTGTCACC
CAACCCGCAACGATGCCGAAATCTATGATATGGACGAAATTCCATGTTTA
TCATAATATTAGACGTGGAACCCCGGCGTCACCTTGACCAACTTGTAATG
GGACGGTAATTCGAGAGACAATATGATTAAAAAATGATTAGCTAGTATAC
CAAAATTCTAAATTTAAAGAATAGTTAAATATTACCATTGTTAATGATAT
ACATCCATGTCCAAGAGAGATTTAACTTCAGGTTACTATTTATTTAATTC
ATTAATTTTAATAATTTAAATAAAATGTCATTTATTAGTATAGTATAAAG
TGTGGGGTTTATAGGTACTCGGCATGCATGACCTTGACCACAATCATAAA
CTTTCTTCTACCTGCCACTGGTTACCCGTTGCTAGGCAACGTTGGTACTG
TAACCAATGGTTCTGTGACCGTCAAAGGTGAGCTTTGTTTCCAAAACTGC
TAAGACCCGGTCTACAGCTGGTTCAGCGAGCTACCGATAGAAGGTATATG
CTTTTATGTCCCTTATTTTCTGCGCATCTTTCAACTTGAAGTTTATTTTC
TCGAACGAAAATTTATTGTCACTAACTCAATAATCGAATCAAAAACACAA
CTAAGTTGAACATAAGCATTTATTAAGACATCAAGGAAAAACCATTTTTA
ATTACAAACGAAAATAGTCAAAATGATTCGAACAACGTTCGCTACAAAAT
TATTTACAGCTACCTCTATTCTGCTCTTTGCTGTTGGAGCTTCCTGCGCT
CTCTTTCGGCTCGTCCTGGCCTTGTGGATTTTTTGGTTTACCTAACAAAA
AGTTCAGACAGACGGATCAGTTTGAGAACGATTCCAATCATCCTAGAAAA
TAATGAAAAGAAACTACATGTAAATGCATTGCTGGATGATGCGAGTACAA
CAAGCTTTGTGAGTGAAGTAGACACTTCGGATCTTAATCTCAGTGGAAAA
GAGACAGATGCATCTGTAAAGGTTATTGGAGGGAGAACAGAGACGATTTC
ATCCCAAATTTAAAGGAGGCAATTTAAAGCATTAGCTCTCAAAACTCTAA
AGTGTAACATGAAGGTCTTTAATTTGAATAAAGCATCTTTTTTATGGCCT
AATTTAAAAGGCATTCGCTTTTCATCCTTAGTATGGAAACAAACGGTTGA
CGTTTTAATTGAAACTGATTATCTAGACCTTTATATAGGAATCAAAGAAA
TTATTGGAAATAATAATGAACCAATTGCGAGGCTTACACCATTAAGGTGG
ACTTGTATCGGAGGACCTGGAGTAGGGCAACCTTTTATTCATCAGGCAAA
CTTCGTGCACACCTACTTTACTAAGCAGGAAAATATTAATTTTGATATAC
AGAAGTTTTTGTAACTTGAGGAAACCCAGGAGGCATCGACATCATTCTCA
GCAAAAGACAAACTAATTATAGACATGACGAAGAGCAATTTAACATCCAA
AGATAACAGGTATGAAGTTGGAATACCTTGGAAGACTGAAAAATGGAGAT
GTATTTGAATAGAAGAATAGCGGGAAATCGATTAAAAATGTTGCAGGAAG
GGTTCCCTATGGATCCAGAATTCAAAATTTAATATTCTAATGTGATTGAA
GACCACAAGAAATTACATAAGAGAAATCACCAAGATGGAAGAATTTGAAA
GAAAATGGTTGTTACCACAAAAAGACAGAGAATCAACAAATGTAAGAATT
GTTTTTGATGCAGCGGCTAGGTTTGATGGAATGTTTAAATGACCTAATCG
AAACTGGACCAAAATTGCAAAATGACTTTTTTGACGTCCTAATTCGATTT
AGGAAACACAAGATCGACACTAACTAAAAAGAATTTTACTAAATTGGATA
GCTAGAGTATTTGATCCGTTGGGTTTTCAAGTGCCTTCGTTGCAAGAGAG
AAAATGATCATGCAGGCAGCTTGGTTGTCTGGAGCATAATCGGATGATCC
ATTAACACCATGAGTCGAATCAAACGCCAGACGTTGGTTGGAAGAAGCTG
AATATTTAAGGGTGATAAGAATACCTCGATATTTGATCAATTTTGCTGAA
AACGAGTGGAGCTTACATATATTTTCCGATACTTCTGAAAGAGCACACGG
CGCTTTCGCTGATTTAAGTGAACAGGCGGAGGAAGGTGTTAGAACAAAAT
TCATAGTAGCCAAATCGAAAGTGGCTTTTGTTAAAATGGTCAATATCCCG
AGAATGGAATTTCTAGGACCTTGTGTTGGATTAAAATTGGCCAAGAGGAT
TGCAAAAGCAATGGGCCATAATGTTAGAAAGAAGACAAAGGGATCAAGGT
TGGAGGTGTCTTGAGGTTGTTGGAACAAAATGTAATGGAAGGTCGCTGGC
CGTTAGCGAGGATCAAAGAGCTGTTTCCTGGGAAAGACGGAAATTTTAGA
GTAGTGAAAGTCGATTGCAAAGAGGTTAAAAATTCCTAATGAGTGAATCA
AAACAGACTATTGTAGCTAAAGTTTCAGCACCTAAAGCTAAACCCAGTCA
TCCACCTGCAATTGATATGGTTAAATCAACCATTTTAGCTGCAAAAAGTA
GAAAAGGTTTATCTTTAAGTTTAATTAAGAAGTATTTGATTGATACCCAT
AAAATTGATATTGAAAAGTATGGACCATTCTTGAGAAGGTCAATTGTTGC
TGGAGTTGAAAAAGGAATTCTAGTTAGAATGGGAATCTTTAAATTAGCCC
CAGCAGATAAGGTATCGAAAAAAGAAACTAGTGATGAAGCTAAGCCAAAG
CTTGTGAAGAAAGTAGAAACTAAAGAAAAGAAAGCTAAGACTACCAAAGA
ACCAATCAAAAAAGTAGAACCTAGGAAAGCTGCTGTTAAGAAAGTTGTAT
CTAAAAAAGTTGAAAAGAAAGTTGCAGAAAAGCCAGTTAAGTTAGCTACC
AAAACTTCACCGGTTAAAGCAAAGAAAGCTGCTGTAACAAAAGCTAAAAT
AAATAAAGTCGTTAAAACTGTCACTAAACCTTCTCCAAAGAAGGTTGTTC
CAAAGAAAACTGCGAAGAAAGCAGTTGAAATTTTCCCACTTGAACTAGAC
CAAGAAGAATTCAAGAAACTGGCAGAAGAAATCAATAGTTTTCCAGATTT
GACAAGGTGTCAAATGGGCGGGTTGAGGAATAAGAGGTATAAATTTTATA
ATTTTATATGTAAAAATGATTGAATTAAATTTTGTAAATTAGTAAATTAA
TTGTATATTTTTTGGTATTTAAAATTGTAAGGTAAATTAAAAAGATTTAA
AATAAGCTTGGAAATTTTGTTTATAAAATAAATATATGAATTTGTACAAA
AATTTGTCTTTGAAATTGATTTAAAATTTTAAATATTACTATTACTGATT
ATATTGTCTTATTGGAGATATTGTCTTATTGAAAACTTATGGCGCAGCAC
CATATACTCCAACTTTATTGGATTTAGCCGCTGATAAGGCTAAATGATAT
TAATCGTGTACCAAAGGGGTATCTATAAGACGACAGATGATGGAATTCTA
ACAACTTCTCCCAAACGAAAATATGTTGTGTTCAATGATTCCGTGATTCC
GTAAAAGAATGCCGTGATTTCAAATCCTTTAAGAATAATTCAAATTCTTT
AGTCGATTCTTCTCAATTTGTGAAATAATAAATTCCTAAACTTTCTCTCG
TTGTTTTATCTCACTTCTGACACCGATTGCGGGGAAACAATAATAACATC
AAAAGTGTATTCAAAATAAATCCAATAAGTTGATTTGATCAGTTGAACTT
TGTATTCGATTGTTGGCCAGTTGATCACGGAGCATGAGATATCAA
back to top

protein sequence of SMED30028420-orf-1

>SMED30028420-orf-1 ID=SMED30028420-orf-1|Name=SMED30028420-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=102bp
MKVFNLNKASFLWPNLKGIRFSSLVWKQTVDVLIETDYLDLYIGIKEIIG
NNNEPIARLTPLRWTCIGGPGVGQPFIHQANFVHTYFTKQENINFDIQKF
L*
back to top

protein sequence of SMED30028420-orf-2

>SMED30028420-orf-2 ID=SMED30028420-orf-2|Name=SMED30028420-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=101bp
MNFVLTPSSACSLKSAKAPCALSEVSENICKLHSFSAKLIKYRGILITLK
YSASSNQRLAFDSTHGVNGSSDYAPDNQAACMIIFSLATKALENPTDQIL
*
back to top

protein sequence of SMED30028420-orf-3

>SMED30028420-orf-3 ID=SMED30028420-orf-3|Name=SMED30028420-orf-3|organism=Schmidtea mediterranea sexual|type=polypeptide|length=245bp
MSESKQTIVAKVSAPKAKPSHPPAIDMVKSTILAAKSRKGLSLSLIKKYL
IDTHKIDIEKYGPFLRRSIVAGVEKGILVRMGIFKLAPADKVSKKETSDE
AKPKLVKKVETKEKKAKTTKEPIKKVEPRKAAVKKVVSKKVEKKVAEKPV
KLATKTSPVKAKKAAVTKAKINKVVKTVTKPSPKKVVPKKTAKKAVEIFP
LELDQEEFKKLAEEINSFPDLTRCQMGGLRNKRYKFYNFICKND*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0015074DNA integration
GO:0006334nucleosome assembly
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000429neoblast
Vocabulary: INTERPRO
TermDefinition
IPR008042Retrotrans_Pao
IPR005819Histone_H5
IPR005818Histone_H1/H5_H15
IPR011991WHTH_DNA-bd_dom
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
Vocabulary: cellular component
TermDefinition
GO:0000786nucleosome
GO:0005634nucleus
GO:0005694chromosome