TATA-box-binding protein

Overview
NameTATA-box-binding protein
Smed IDSMED30028419
Length (bp)974
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of TATA-box-binding protein (SMED30028419) t-SNE clustered cells

Violin plots show distribution of expression levels for TATA-box-binding protein (SMED30028419) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of TATA-box-binding protein (SMED30028419) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for TATA-box-binding protein (SMED30028419) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30028419

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30028419SMESG000068211.1 dd_Smed_v4_17006_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of TATA-box-binding protein vs. Ensembl Human
Match: TBPL2 (TATA-box binding protein like 2 [Source:HGNC Symbol;Acc:HGNC:19841])

HSP 1 Score: 201.06 bits (510), Expect = 3.678e-61
Identity = 94/173 (54.34%), Postives = 124/173 (71.68%), Query Frame = 1
Query:  349 PVIQNIACFFDLNCGLDLSHIAKSALNTKYDAKCFPAVIMRIRKPKTTANIFKNGKIICAGAKTEEDAKKATRKISRIIQKLGYKIRYNNFKILNMVASCDVRFQIGLDPLNLLHSSFTTYDPEQFPGLFYKMADPLITILIFKSGKIILTGGKDKSNIDEAYNKILPVLKMF 867
            P +QNI    +L C LDL  IA  A N +Y+ K F AVIMRIR+P+TTA IF +GK++C GAK+EE ++ A RK +R++QKLG+  R+ +FKI NMV SCDVRF I L+ L L H  F++Y+PE FPGL Y+M  P I +LIF SGK++LTG K++S I EA+  I P+LK F
Sbjct:  200 PQLQNIVSTVNLACKLDLKKIALHAKNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPARFLDFKIQNMVGSCDVRFPIRLEGLVLTHQQFSSYEPELFPGLIYRMVKPRIVLLIFVSGKVVLTGAKERSEIYEAFENIYPILKGF 372          
BLAST of TATA-box-binding protein vs. Ensembl Human
Match: TBP (TATA-box binding protein [Source:HGNC Symbol;Acc:HGNC:11588])

HSP 1 Score: 194.897 bits (494), Expect = 8.204e-60
Identity = 91/173 (52.60%), Postives = 123/173 (71.10%), Query Frame = 1
Query:  349 PVIQNIACFFDLNCGLDLSHIAKSALNTKYDAKCFPAVIMRIRKPKTTANIFKNGKIICAGAKTEEDAKKATRKISRIIQKLGYKIRYNNFKILNMVASCDVRFQIGLDPLNLLHSSFTTYDPEQFPGLFYKMADPLITILIFKSGKIILTGGKDKSNIDEAYNKILPVLKMF 867
            P +QNI    +L C LDL  IA  A N +Y+ K F AVIMRIR+P+TTA IF +GK++C GAK+EE ++ A RK +R++QKLG+  ++ +FKI NMV SCDV+F I L+ L L H  F++Y+PE FPGL Y+M  P I +LIF SGK++LTG K ++ I EA+  I P+LK F
Sbjct:  112 PQLQNIVSTVNLGCKLDLKTIALRARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRIVLLIFVSGKVVLTGAKVRAEIYEAFENIYPILKGF 284          
BLAST of TATA-box-binding protein vs. Ensembl Human
Match: TBP (TATA-box binding protein [Source:HGNC Symbol;Acc:HGNC:11588])

HSP 1 Score: 194.512 bits (493), Expect = 2.649e-59
Identity = 91/173 (52.60%), Postives = 123/173 (71.10%), Query Frame = 1
Query:  349 PVIQNIACFFDLNCGLDLSHIAKSALNTKYDAKCFPAVIMRIRKPKTTANIFKNGKIICAGAKTEEDAKKATRKISRIIQKLGYKIRYNNFKILNMVASCDVRFQIGLDPLNLLHSSFTTYDPEQFPGLFYKMADPLITILIFKSGKIILTGGKDKSNIDEAYNKILPVLKMF 867
            P +QNI    +L C LDL  IA  A N +Y+ K F AVIMRIR+P+TTA IF +GK++C GAK+EE ++ A RK +R++QKLG+  ++ +FKI NMV SCDV+F I L+ L L H  F++Y+PE FPGL Y+M  P I +LIF SGK++LTG K ++ I EA+  I P+LK F
Sbjct:  143 PQLQNIVSTVNLGCKLDLKTIALRARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRIVLLIFVSGKVVLTGAKVRAEIYEAFENIYPILKGF 315          
BLAST of TATA-box-binding protein vs. Ensembl Human
Match: TBP (TATA-box binding protein [Source:HGNC Symbol;Acc:HGNC:11588])

HSP 1 Score: 194.512 bits (493), Expect = 4.741e-59
Identity = 91/173 (52.60%), Postives = 123/173 (71.10%), Query Frame = 1
Query:  349 PVIQNIACFFDLNCGLDLSHIAKSALNTKYDAKCFPAVIMRIRKPKTTANIFKNGKIICAGAKTEEDAKKATRKISRIIQKLGYKIRYNNFKILNMVASCDVRFQIGLDPLNLLHSSFTTYDPEQFPGLFYKMADPLITILIFKSGKIILTGGKDKSNIDEAYNKILPVLKMF 867
            P +QNI    +L C LDL  IA  A N +Y+ K F AVIMRIR+P+TTA IF +GK++C GAK+EE ++ A RK +R++QKLG+  ++ +FKI NMV SCDV+F I L+ L L H  F++Y+PE FPGL Y+M  P I +LIF SGK++LTG K ++ I EA+  I P+LK F
Sbjct:  163 PQLQNIVSTVNLGCKLDLKTIALRARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRIVLLIFVSGKVVLTGAKVRAEIYEAFENIYPILKGF 335          
BLAST of TATA-box-binding protein vs. Ensembl Human
Match: TBP (TATA-box binding protein [Source:HGNC Symbol;Acc:HGNC:11588])

HSP 1 Score: 194.512 bits (493), Expect = 4.741e-59
Identity = 91/173 (52.60%), Postives = 123/173 (71.10%), Query Frame = 1
Query:  349 PVIQNIACFFDLNCGLDLSHIAKSALNTKYDAKCFPAVIMRIRKPKTTANIFKNGKIICAGAKTEEDAKKATRKISRIIQKLGYKIRYNNFKILNMVASCDVRFQIGLDPLNLLHSSFTTYDPEQFPGLFYKMADPLITILIFKSGKIILTGGKDKSNIDEAYNKILPVLKMF 867
            P +QNI    +L C LDL  IA  A N +Y+ K F AVIMRIR+P+TTA IF +GK++C GAK+EE ++ A RK +R++QKLG+  ++ +FKI NMV SCDV+F I L+ L L H  F++Y+PE FPGL Y+M  P I +LIF SGK++LTG K ++ I EA+  I P+LK F
Sbjct:  163 PQLQNIVSTVNLGCKLDLKTIALRARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRIVLLIFVSGKVVLTGAKVRAEIYEAFENIYPILKGF 335          
BLAST of TATA-box-binding protein vs. Ensembl Celegans
Match: tbp-1 (TATA-box-binding protein [Source:UniProtKB/Swiss-Prot;Acc:P32085])

HSP 1 Score: 199.519 bits (506), Expect = 1.638e-61
Identity = 91/173 (52.60%), Postives = 124/173 (71.68%), Query Frame = 1
Query:  349 PVIQNIACFFDLNCGLDLSHIAKSALNTKYDAKCFPAVIMRIRKPKTTANIFKNGKIICAGAKTEEDAKKATRKISRIIQKLGYKIRYNNFKILNMVASCDVRFQIGLDPLNLLHSSFTTYDPEQFPGLFYKMADPLITILIFKSGKIILTGGKDKSNIDEAYNKILPVLKMF 867
            P +QNI    +L   LDL  IA  A N +Y+ K F AVIMRIR+P+TTA IF +GK++C GAK+EE ++ A RK +RI+QKLG++ ++  F + NMV SCDVRF I L+ L + HS F+TY+PE FPGL Y+M  P + +LIF SGK+++TG K K +IDEA+ +I P+LK F
Sbjct:  166 PALQNIVSTVNLGVQLDLKKIALHARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEASRLAARKYARIVQKLGFQAKFTEFMVQNMVGSCDVRFPIQLEGLCITHSQFSTYEPELFPGLIYRMVKPRVVLLIFVSGKVVITGAKTKRDIDEAFGQIYPILKGF 338          
BLAST of TATA-box-binding protein vs. Ensembl Celegans
Match: tlf-1 (TBP-like factor [Source:UniProtKB/TrEMBL;Acc:G5EC52])

HSP 1 Score: 93.9745 bits (232), Expect = 3.408e-21
Identity = 50/176 (28.41%), Postives = 98/176 (55.68%), Query Frame = 1
Query:  355 IQNIACFFDLNCGLDLSHIAKSALNTKYDAKCFPAVIMRI-RKPKTTANIFKNGKIICAGAKTEEDAKKATRKISRIIQKLGYK----IRYNNFKILNMVASCDVRFQIGLDPLNLLHSSFTTYDPEQFPGLFYKMADPLITILIFKSGKIILTGGKDKSNIDEAYNKILPVLKMF 867
            I+N+ C + L   +DL  +A +  N  Y+ +    V+M+  R P     ++ +GK+   G ++E D K+A R I+R +Q++  K    +   N+++ N++A+C + F I ++ +   + S +TY+PE   GL ++   P  T+ I  +G I +TG + ++++ E  +KI P++  F
Sbjct:  270 IRNVVCNYTLPLHIDLRKLAMNTHNVTYEREK--GVMMKQKRSPGCYIKVYSSGKVYIVGCRSEADCKRAARSIARHVQRVMGKTKERVSIRNYRVNNVLATCRLPFGIKIEEVAAKYPSESTYEPELSVGLVWRSVTPKATLRIHTTGSITVTGAQSEADVLEVLSKIYPIVLEF 443          
BLAST of TATA-box-binding protein vs. Ensembl Celegans
Match: tlf-1 (TBP-like factor [Source:UniProtKB/TrEMBL;Acc:G5EC52])

HSP 1 Score: 93.9745 bits (232), Expect = 3.505e-21
Identity = 50/176 (28.41%), Postives = 98/176 (55.68%), Query Frame = 1
Query:  355 IQNIACFFDLNCGLDLSHIAKSALNTKYDAKCFPAVIMRI-RKPKTTANIFKNGKIICAGAKTEEDAKKATRKISRIIQKLGYK----IRYNNFKILNMVASCDVRFQIGLDPLNLLHSSFTTYDPEQFPGLFYKMADPLITILIFKSGKIILTGGKDKSNIDEAYNKILPVLKMF 867
            I+N+ C + L   +DL  +A +  N  Y+ +    V+M+  R P     ++ +GK+   G ++E D K+A R I+R +Q++  K    +   N+++ N++A+C + F I ++ +   + S +TY+PE   GL ++   P  T+ I  +G I +TG + ++++ E  +KI P++  F
Sbjct:  267 IRNVVCNYTLPLHIDLRKLAMNTHNVTYEREK--GVMMKQKRSPGCYIKVYSSGKVYIVGCRSEADCKRAARSIARHVQRVMGKTKERVSIRNYRVNNVLATCRLPFGIKIEEVAAKYPSESTYEPELSVGLVWRSVTPKATLRIHTTGSITVTGAQSEADVLEVLSKIYPIVLEF 440          
BLAST of TATA-box-binding protein vs. Ensembl Fly
Match: Tbp (gene:FBgn0003687 transcript:FBtr0071679)

HSP 1 Score: 194.897 bits (494), Expect = 1.999e-59
Identity = 93/173 (53.76%), Postives = 126/173 (72.83%), Query Frame = 1
Query:  349 PVIQNIACFFDLNCGLDLSHIAKSALNTKYDAKCFPAVIMRIRKPKTTANIFKNGKIICAGAKTEEDAKKATRKISRIIQKLGYKIRYNNFKILNMVASCDVRFQIGLDPLNLLHSSFTTYDPEQFPGLFYKMADPLITILIFKSGKIILTGGKDKSNIDEAYNKILPVLKMF 867
            P +QNI    +L C LDL  IA  A N +Y+ K F AVIMRIR+P+TTA IF +GK++C GAK+E+D++ A RK +RIIQKLG+  ++ +FKI NMV SCDV+F I L+ L L H +F++Y+PE FPGL Y+M  P I +LIF SGK++LTG K +  I +A++KI P+LK F
Sbjct:  177 PQLQNIVSTVNLCCKLDLKKIALHARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEDDSRLAARKYARIIQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHCNFSSYEPELFPGLIYRMVRPRIVLLIFVSGKVVLTGAKVRQEIYDAFDKIFPILKKF 349          
BLAST of TATA-box-binding protein vs. Ensembl Fly
Match: Trf (gene:FBgn0010287 transcript:FBtr0079542)

HSP 1 Score: 167.548 bits (423), Expect = 2.506e-50
Identity = 76/171 (44.44%), Postives = 112/171 (65.50%), Query Frame = 1
Query:  355 IQNIACFFDLNCGLDLSHIAKSALNTKYDAKCFPAVIMRIRKPKTTANIFKNGKIICAGAKTEEDAKKATRKISRIIQKLGYKIRYNNFKILNMVASCDVRFQIGLDPLNLLHSSFTTYDPEQFPGLFYKMADPLITILIFKSGKIILTGGKDKSNIDEAYNKILPVLKMF 867
            +QNI   F +NC LDL  I     N++Y  K F  VIMR+  P+ TA IF+ GK+IC GA+ E +A   +RK +RI+QKLG+ +++  +K+ N+VA+ D+RF I L+ LN +H  F++Y+PE FPGL Y+M  P I +LIF +GK++ TG K + +I +    I P+L  F
Sbjct:   51 LQNIVATFSVNCELDLKAINSRTRNSEYSPKRFRGVIMRMHSPRCTALIFRTGKVICTGARNEIEADIGSRKFARILQKLGFPVKFMEYKLQNIVATVDLRFPIRLENLNHVHGQFSSYEPEMFPGLIYRMVKPRIVLLIFVNGKVVFTGAKSRKDIMDCLEAISPILLSF 221          
BLAST of TATA-box-binding protein vs. Ensembl Fly
Match: Trf2 (gene:FBgn0261793 transcript:FBtr0333811)

HSP 1 Score: 115.931 bits (289), Expect = 1.868e-28
Identity = 60/171 (35.09%), Postives = 98/171 (57.31%), Query Frame = 1
Query:  352 VIQNIACFFDLNCGLDLSHIAKSALNTKYDAKCFPAVIMRIRKPKTTANIFKNGKIICAGAKTEEDAKKATRKISRIIQKLGYKIRYNNFKILNMVASCDVRFQIGLDPLNLLHSSFTTYDPEQFPGLFYKMA--DPLITILIFKSGKIILTGGKDKSNIDEAYNKILPVL 858
            VI N+ C F + C L L  IA    N +Y  +    V M++R P TTA+I+ +G+I C GA +E  AK A R+ +R + KLG+  R+ NF+I+N++ +C + + I +   +  H    +Y+PE  PG+ YKM   DP  T+ IF +G + +T     ++++ A   I P++
Sbjct:  203 VINNVVCSFSVGCHLKLREIALQGSNVEYRREN-GMVTMKLRHPYTTASIWSSGRITCTGATSESMAKVAARRYARCLGKLGFPTRFLNFRIVNVLGTCSMPWAIKIVNFSERHRENASYEPELHPGVTYKMRDPDPKATLKIFSTGSVTVTAA-SVNHVESAIQHIYPLV 371          
BLAST of TATA-box-binding protein vs. Ensembl Fly
Match: Trf2 (gene:FBgn0261793 transcript:FBtr0330106)

HSP 1 Score: 115.931 bits (289), Expect = 1.868e-28
Identity = 60/171 (35.09%), Postives = 98/171 (57.31%), Query Frame = 1
Query:  352 VIQNIACFFDLNCGLDLSHIAKSALNTKYDAKCFPAVIMRIRKPKTTANIFKNGKIICAGAKTEEDAKKATRKISRIIQKLGYKIRYNNFKILNMVASCDVRFQIGLDPLNLLHSSFTTYDPEQFPGLFYKMA--DPLITILIFKSGKIILTGGKDKSNIDEAYNKILPVL 858
            VI N+ C F + C L L  IA    N +Y  +    V M++R P TTA+I+ +G+I C GA +E  AK A R+ +R + KLG+  R+ NF+I+N++ +C + + I +   +  H    +Y+PE  PG+ YKM   DP  T+ IF +G + +T     ++++ A   I P++
Sbjct:  203 VINNVVCSFSVGCHLKLREIALQGSNVEYRREN-GMVTMKLRHPYTTASIWSSGRITCTGATSESMAKVAARRYARCLGKLGFPTRFLNFRIVNVLGTCSMPWAIKIVNFSERHRENASYEPELHPGVTYKMRDPDPKATLKIFSTGSVTVTAA-SVNHVESAIQHIYPLV 371          
BLAST of TATA-box-binding protein vs. Ensembl Fly
Match: Trf2 (gene:FBgn0261793 transcript:FBtr0333750)

HSP 1 Score: 110.153 bits (274), Expect = 3.391e-26
Identity = 60/171 (35.09%), Postives = 98/171 (57.31%), Query Frame = 1
Query:  352 VIQNIACFFDLNCGLDLSHIAKSALNTKYDAKCFPAVIMRIRKPKTTANIFKNGKIICAGAKTEEDAKKATRKISRIIQKLGYKIRYNNFKILNMVASCDVRFQIGLDPLNLLHSSFTTYDPEQFPGLFYKM--ADPLITILIFKSGKIILTGGKDKSNIDEAYNKILPVL 858
            VI N+ C F + C L L  IA    N +Y  +    V M++R P TTA+I+ +G+I C GA +E  AK A R+ +R + KLG+  R+ NF+I+N++ +C + + I +   +  H    +Y+PE  PG+ YKM   DP  T+ IF +G + +T     ++++ A   I P++
Sbjct: 1285 VINNVVCSFSVGCHLKLREIALQGSNVEYRREN-GMVTMKLRHPYTTASIWSSGRITCTGATSESMAKVAARRYARCLGKLGFPTRFLNFRIVNVLGTCSMPWAIKIVNFSERHRENASYEPELHPGVTYKMRDPDPKATLKIFSTGSVTVTAAS-VNHVESAIQHIYPLV 1453          
BLAST of TATA-box-binding protein vs. Ensembl Zebrafish
Match: tbpl2 (TATA box binding protein like 2 [Source:NCBI gene;Acc:407713])

HSP 1 Score: 195.667 bits (496), Expect = 3.855e-60
Identity = 92/173 (53.18%), Postives = 123/173 (71.10%), Query Frame = 1
Query:  349 PVIQNIACFFDLNCGLDLSHIAKSALNTKYDAKCFPAVIMRIRKPKTTANIFKNGKIICAGAKTEEDAKKATRKISRIIQKLGYKIRYNNFKILNMVASCDVRFQIGLDPLNLLHSSFTTYDPEQFPGLFYKMADPLITILIFKSGKIILTGGKDKSNIDEAYNKILPVLKMF 867
            P +QNI    +L C LDL  IA  A N +Y+ K F AVIMRIR+P+TTA IF +GK++C GAK+EE ++ A RK +R++QKLG+  ++ +FKI NMV SCDV F I L+ L L H  F++Y+PE FPGL Y+M  P I +LIF SGK++LTG K++S I EA+  I P+LK F
Sbjct:  137 PQLQNIVSTVNLACPLDLKSIALQARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPAKFLDFKIQNMVGSCDVCFPIRLEGLVLTHQQFSSYEPELFPGLIYRMVKPRIVLLIFVSGKVVLTGAKERSEIYEAFENIYPILKGF 309          
BLAST of TATA-box-binding protein vs. Ensembl Zebrafish
Match: tbp (TATA box binding protein [Source:NCBI gene;Acc:368882])

HSP 1 Score: 194.512 bits (493), Expect = 1.067e-59
Identity = 91/173 (52.60%), Postives = 122/173 (70.52%), Query Frame = 1
Query:  349 PVIQNIACFFDLNCGLDLSHIAKSALNTKYDAKCFPAVIMRIRKPKTTANIFKNGKIICAGAKTEEDAKKATRKISRIIQKLGYKIRYNNFKILNMVASCDVRFQIGLDPLNLLHSSFTTYDPEQFPGLFYKMADPLITILIFKSGKIILTGGKDKSNIDEAYNKILPVLKMF 867
            P +QNI    +L C LDL  IA  A N +Y+ K F AVIMRIR+P+TTA IF +GK++C GAK+EE ++ A RK +R++QKLG+  ++ +FKI NMV SCDV+F I L+ L L H  F++Y+PE FPGL Y+M  P I +LIF SGK++LTG K +  I EA+  I P+LK F
Sbjct:  126 PQLQNIVSTVNLGCKLDLKTIALRARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRIVLLIFVSGKVVLTGAKVRGEIYEAFENIYPILKGF 298          
BLAST of TATA-box-binding protein vs. Ensembl Zebrafish
Match: tbp (TATA box binding protein [Source:NCBI gene;Acc:368882])

HSP 1 Score: 194.512 bits (493), Expect = 1.067e-59
Identity = 91/173 (52.60%), Postives = 122/173 (70.52%), Query Frame = 1
Query:  349 PVIQNIACFFDLNCGLDLSHIAKSALNTKYDAKCFPAVIMRIRKPKTTANIFKNGKIICAGAKTEEDAKKATRKISRIIQKLGYKIRYNNFKILNMVASCDVRFQIGLDPLNLLHSSFTTYDPEQFPGLFYKMADPLITILIFKSGKIILTGGKDKSNIDEAYNKILPVLKMF 867
            P +QNI    +L C LDL  IA  A N +Y+ K F AVIMRIR+P+TTA IF +GK++C GAK+EE ++ A RK +R++QKLG+  ++ +FKI NMV SCDV+F I L+ L L H  F++Y+PE FPGL Y+M  P I +LIF SGK++LTG K +  I EA+  I P+LK F
Sbjct:  126 PQLQNIVSTVNLGCKLDLKTIALRARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRIVLLIFVSGKVVLTGAKVRGEIYEAFENIYPILKGF 298          
BLAST of TATA-box-binding protein vs. Ensembl Zebrafish
Match: tbpl1 (TBP-like 1 [Source:NCBI gene;Acc:403035])

HSP 1 Score: 122.479 bits (306), Expect = 2.132e-33
Identity = 59/169 (34.91%), Postives = 102/169 (60.36%), Query Frame = 1
Query:  352 VIQNIACFFDLNCGLDLSHIAKSALNTKYDAKCFPAVIMRIRKPKTTANIFKNGKIICAGAKTEEDAKKATRKISRIIQKLGYKIRYNNFKILNMVASCDVRFQIGLDPLNLLHSSFTTYDPEQFPGLFYKMADPLITILIFKSGKIILTGGKDKSNIDEAYNKILPVL 858
            ++ N+   F   C L+L  I     N  Y  +    V+M++RKP+ TA+I+ +GKIIC GA +EE+AK   R+++R +QK+G+K+R+++FK++N++A C + FQI L      +    +Y+PE  P   Y++ +   T+ +F +G I +TG   +S +  A  +I P+L
Sbjct:   12 IVTNVVSVFRTRCHLNLRTIGLEGTNVIYKPE-VGKVLMKLRKPRITASIWSSGKIICTGATSEEEAKLGARRLARCLQKMGFKVRFSDFKVVNVLAVCSMPFQIRLIEFTKNNRPIASYEPELHPAASYRIKNLRSTVQVFSTGNITVTGPNVQS-VASAVEEIYPLL 178          
BLAST of TATA-box-binding protein vs. Ensembl Zebrafish
Match: tbpl1 (TBP-like 1 [Source:NCBI gene;Acc:403035])

HSP 1 Score: 122.479 bits (306), Expect = 2.132e-33
Identity = 59/169 (34.91%), Postives = 102/169 (60.36%), Query Frame = 1
Query:  352 VIQNIACFFDLNCGLDLSHIAKSALNTKYDAKCFPAVIMRIRKPKTTANIFKNGKIICAGAKTEEDAKKATRKISRIIQKLGYKIRYNNFKILNMVASCDVRFQIGLDPLNLLHSSFTTYDPEQFPGLFYKMADPLITILIFKSGKIILTGGKDKSNIDEAYNKILPVL 858
            ++ N+   F   C L+L  I     N  Y  +    V+M++RKP+ TA+I+ +GKIIC GA +EE+AK   R+++R +QK+G+K+R+++FK++N++A C + FQI L      +    +Y+PE  P   Y++ +   T+ +F +G I +TG   +S +  A  +I P+L
Sbjct:   12 IVTNVVSVFRTRCHLNLRTIGLEGTNVIYKPE-VGKVLMKLRKPRITASIWSSGKIICTGATSEEEAKLGARRLARCLQKMGFKVRFSDFKVVNVLAVCSMPFQIRLIEFTKNNRPIASYEPELHPAASYRIKNLRSTVQVFSTGNITVTGPNVQS-VASAVEEIYPLL 178          
BLAST of TATA-box-binding protein vs. Ensembl Xenopus
Match: pa2g4 (proliferation-associated 2G4 [Source:Xenbase;Acc:XB-GENE-943133])

HSP 1 Score: 198.364 bits (503), Expect = 7.615e-61
Identity = 93/173 (53.76%), Postives = 124/173 (71.68%), Query Frame = 1
Query:  349 PVIQNIACFFDLNCGLDLSHIAKSALNTKYDAKCFPAVIMRIRKPKTTANIFKNGKIICAGAKTEEDAKKATRKISRIIQKLGYKIRYNNFKILNMVASCDVRFQIGLDPLNLLHSSFTTYDPEQFPGLFYKMADPLITILIFKSGKIILTGGKDKSNIDEAYNKILPVLKMF 867
            P +QNI    +L C LDL  IA  A N +Y+ K F AVIMRIR+P+TTA IF +GK++C GAK+EE ++ A RK +R++QKLG+  ++ +FKI NMV SCDVRF I L+ L L H  F++Y+PE FPGL Y+M  P I +LIF SGK++LTG K++S I EA+  I P+LK F
Sbjct:  146 PQLQNIVSTVNLACKLDLKKIALHARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPAKFLDFKIQNMVGSCDVRFPIRLEGLVLTHQQFSSYEPELFPGLIYRMVKPRIVLLIFVSGKVVLTGAKERSEIYEAFENIYPILKGF 318          
BLAST of TATA-box-binding protein vs. Ensembl Xenopus
Match: tbp (TATA-box binding protein [Source:NCBI gene;Acc:549093])

HSP 1 Score: 194.126 bits (492), Expect = 1.548e-59
Identity = 91/173 (52.60%), Postives = 123/173 (71.10%), Query Frame = 1
Query:  349 PVIQNIACFFDLNCGLDLSHIAKSALNTKYDAKCFPAVIMRIRKPKTTANIFKNGKIICAGAKTEEDAKKATRKISRIIQKLGYKIRYNNFKILNMVASCDVRFQIGLDPLNLLHSSFTTYDPEQFPGLFYKMADPLITILIFKSGKIILTGGKDKSNIDEAYNKILPVLKMF 867
            P +QNI    +L C LDL  IA  A N +Y+ K F AVIMRIR+P+TTA IF +GK++C GAK+EE ++ A RK +R++QKLG+  ++ +FKI NMV SCDV+F I L+ L L H  F++Y+PE FPGL Y+M  P I +LIF SGK++LTG K ++ I EA+  I P+LK F
Sbjct:  121 PQLQNIVSTVNLGCKLDLKTIALRARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRIVLLIFVSGKVVLTGAKVRAEIYEAFENIYPILKGF 293          
BLAST of TATA-box-binding protein vs. Ensembl Xenopus
Match: tbp (TATA-box binding protein [Source:NCBI gene;Acc:549093])

HSP 1 Score: 193.741 bits (491), Expect = 2.321e-59
Identity = 91/173 (52.60%), Postives = 123/173 (71.10%), Query Frame = 1
Query:  349 PVIQNIACFFDLNCGLDLSHIAKSALNTKYDAKCFPAVIMRIRKPKTTANIFKNGKIICAGAKTEEDAKKATRKISRIIQKLGYKIRYNNFKILNMVASCDVRFQIGLDPLNLLHSSFTTYDPEQFPGLFYKMADPLITILIFKSGKIILTGGKDKSNIDEAYNKILPVLKMF 867
            P +QNI    +L C LDL  IA  A N +Y+ K F AVIMRIR+P+TTA IF +GK++C GAK+EE ++ A RK +R++QKLG+  ++ +FKI NMV SCDV+F I L+ L L H  F++Y+PE FPGL Y+M  P I +LIF SGK++LTG K ++ I EA+  I P+LK F
Sbjct:  121 PQLQNIVSTVNLGCKLDLKTIALRARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRIVLLIFVSGKVVLTGAKVRAEIYEAFENIYPILKGF 293          
BLAST of TATA-box-binding protein vs. Ensembl Xenopus
Match: tbp (TATA-box binding protein [Source:NCBI gene;Acc:549093])

HSP 1 Score: 177.563 bits (449), Expect = 2.092e-53
Identity = 82/152 (53.95%), Postives = 110/152 (72.37%), Query Frame = 1
Query:  349 PVIQNIACFFDLNCGLDLSHIAKSALNTKYDAKCFPAVIMRIRKPKTTANIFKNGKIICAGAKTEEDAKKATRKISRIIQKLGYKIRYNNFKILNMVASCDVRFQIGLDPLNLLHSSFTTYDPEQFPGLFYKMADPLITILIFKSGKIILTG 804
            P +QNI    +L C LDL  IA  A N +Y+ K F AVIMRIR+P+TTA IF +GK++C GAK+EE ++ A RK +R++QKLG+  ++ +FKI NMV SCDV+F I L+ L L H  F++Y+PE FPGL Y+M  P I +LIF SGK++LTG
Sbjct:  121 PQLQNIVSTVNLGCKLDLKTIALRARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRIVLLIFVSGKVVLTG 272          
BLAST of TATA-box-binding protein vs. Ensembl Xenopus
Match: pa2g4 (proliferation-associated 2G4 [Source:Xenbase;Acc:XB-GENE-943133])

HSP 1 Score: 137.117 bits (344), Expect = 1.458e-37
Identity = 70/145 (48.28%), Postives = 95/145 (65.52%), Query Frame = 1
Query:  349 PVIQNIACFFDLNCGLDLSHIAKSALNTKYDAKCFPAVIMRIRKPKTTANIFKNGKIICAGAKTEEDAKKATRKISRIIQKLGYKIRYNNFKILNMVASCDVRFQIGLDPLNLLHSSFTTYDPEQF-PGLFYKMADPLITILIFK 780
            P +QNI    +L C LDL  IA  A N +Y+ K F AVIMRIR+P+TTA IF +GK++C GAK+EE ++ A RK +R++QKLG+  ++ +FKI NMV SCDVRF I L+ L L H  F+ Y  E F PG   +      T+ ++K
Sbjct:  145 PQLQNIVSTVNLACKLDLKKIALHARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPAKFLDFKIQNMVGSCDVRFPIRLEGLVLTHQQFSRYISEIFWPGKKLRAHVGQATVCVYK 289          
BLAST of TATA-box-binding protein vs. Ensembl Mouse
Match: Tbpl2 (TATA box binding protein like 2 [Source:MGI Symbol;Acc:MGI:2684058])

HSP 1 Score: 202.601 bits (514), Expect = 2.349e-62
Identity = 92/173 (53.18%), Postives = 128/173 (73.99%), Query Frame = 1
Query:  349 PVIQNIACFFDLNCGLDLSHIAKSALNTKYDAKCFPAVIMRIRKPKTTANIFKNGKIICAGAKTEEDAKKATRKISRIIQKLGYKIRYNNFKILNMVASCDVRFQIGLDPLNLLHSSFTTYDPEQFPGLFYKMADPLITILIFKSGKIILTGGKDKSNIDEAYNKILPVLKMF 867
            P +QN+    +L C LDL  IA +A NT+Y+ K F AVIMRIR+P+TTA IF +GK++C GAK+EE+++ A RK +R++QKLG+ +R+ NFKI NMV SCDV+F I L+ L L H  F++Y+PE FPGL YKM  P + +LIF SGK++LTG K++S I EA+  + P+L+ F
Sbjct:  173 PQLQNVVSTANLACKLDLRKIALNAKNTEYNPKRFAAVIMRIREPRTTALIFSSGKVVCTGAKSEEESRLAARKYARVVQKLGFPVRFFNFKIQNMVGSCDVKFPIRLEILALTHRQFSSYEPELFPGLIYKMVKPQVVLLIFASGKVVLTGAKERSEIYEAFENMYPILESF 345          
BLAST of TATA-box-binding protein vs. Ensembl Mouse
Match: Tbpl2 (TATA box binding protein like 2 [Source:MGI Symbol;Acc:MGI:2684058])

HSP 1 Score: 197.978 bits (502), Expect = 1.561e-60
Identity = 92/174 (52.87%), Postives = 128/174 (73.56%), Query Frame = 1
Query:  349 PVIQNIACFFDLNCGLDLSHIAKSALNTKYDAKCFPAVIMRIRKPKTTANIFKNGKIICAGAKTEEDAKKATRKISRIIQKLGYKIRYNNFKILNMVASCDVRFQIGLDPLNLLHSSF-TTYDPEQFPGLFYKMADPLITILIFKSGKIILTGGKDKSNIDEAYNKILPVLKMF 867
            P +QN+    +L C LDL  IA +A NT+Y+ K F AVIMRIR+P+TTA IF +GK++C GAK+EE+++ A RK +R++QKLG+ +R+ NFKI NMV SCDV+F I L+ L L H  F ++Y+PE FPGL YKM  P + +LIF SGK++LTG K++S I EA+  + P+L+ F
Sbjct:  174 PQLQNVVSTANLACKLDLRKIALNAKNTEYNPKRFAAVIMRIREPRTTALIFSSGKVVCTGAKSEEESRLAARKYARVVQKLGFPVRFFNFKIQNMVGSCDVKFPIRLEILALTHRQFSSSYEPELFPGLIYKMVKPQVVLLIFASGKVVLTGAKERSEIYEAFENMYPILESF 347          
BLAST of TATA-box-binding protein vs. Ensembl Mouse
Match: Tbp (TATA box binding protein [Source:MGI Symbol;Acc:MGI:101838])

HSP 1 Score: 194.512 bits (493), Expect = 1.379e-59
Identity = 91/173 (52.60%), Postives = 123/173 (71.10%), Query Frame = 1
Query:  349 PVIQNIACFFDLNCGLDLSHIAKSALNTKYDAKCFPAVIMRIRKPKTTANIFKNGKIICAGAKTEEDAKKATRKISRIIQKLGYKIRYNNFKILNMVASCDVRFQIGLDPLNLLHSSFTTYDPEQFPGLFYKMADPLITILIFKSGKIILTGGKDKSNIDEAYNKILPVLKMF 867
            P +QNI    +L C LDL  IA  A N +Y+ K F AVIMRIR+P+TTA IF +GK++C GAK+EE ++ A RK +R++QKLG+  ++ +FKI NMV SCDV+F I L+ L L H  F++Y+PE FPGL Y+M  P I +LIF SGK++LTG K ++ I EA+  I P+LK F
Sbjct:  140 PQLQNIVSTVNLGCKLDLKTIALRARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRIVLLIFVSGKVVLTGAKVRAEIYEAFENIYPILKGF 312          
BLAST of TATA-box-binding protein vs. Ensembl Mouse
Match: Tbp (TATA box binding protein [Source:MGI Symbol;Acc:MGI:101838])

HSP 1 Score: 194.512 bits (493), Expect = 1.379e-59
Identity = 91/173 (52.60%), Postives = 123/173 (71.10%), Query Frame = 1
Query:  349 PVIQNIACFFDLNCGLDLSHIAKSALNTKYDAKCFPAVIMRIRKPKTTANIFKNGKIICAGAKTEEDAKKATRKISRIIQKLGYKIRYNNFKILNMVASCDVRFQIGLDPLNLLHSSFTTYDPEQFPGLFYKMADPLITILIFKSGKIILTGGKDKSNIDEAYNKILPVLKMF 867
            P +QNI    +L C LDL  IA  A N +Y+ K F AVIMRIR+P+TTA IF +GK++C GAK+EE ++ A RK +R++QKLG+  ++ +FKI NMV SCDV+F I L+ L L H  F++Y+PE FPGL Y+M  P I +LIF SGK++LTG K ++ I EA+  I P+LK F
Sbjct:  140 PQLQNIVSTVNLGCKLDLKTIALRARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRIVLLIFVSGKVVLTGAKVRAEIYEAFENIYPILKGF 312          
BLAST of TATA-box-binding protein vs. Ensembl Mouse
Match: Tbp (TATA box binding protein [Source:MGI Symbol;Acc:MGI:101838])

HSP 1 Score: 194.512 bits (493), Expect = 1.379e-59
Identity = 91/173 (52.60%), Postives = 123/173 (71.10%), Query Frame = 1
Query:  349 PVIQNIACFFDLNCGLDLSHIAKSALNTKYDAKCFPAVIMRIRKPKTTANIFKNGKIICAGAKTEEDAKKATRKISRIIQKLGYKIRYNNFKILNMVASCDVRFQIGLDPLNLLHSSFTTYDPEQFPGLFYKMADPLITILIFKSGKIILTGGKDKSNIDEAYNKILPVLKMF 867
            P +QNI    +L C LDL  IA  A N +Y+ K F AVIMRIR+P+TTA IF +GK++C GAK+EE ++ A RK +R++QKLG+  ++ +FKI NMV SCDV+F I L+ L L H  F++Y+PE FPGL Y+M  P I +LIF SGK++LTG K ++ I EA+  I P+LK F
Sbjct:  140 PQLQNIVSTVNLGCKLDLKTIALRARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRIVLLIFVSGKVVLTGAKVRAEIYEAFENIYPILKGF 312          
BLAST of TATA-box-binding protein vs. UniProt/SwissProt
Match: sp|A6H909|TBPL2_RAT (TATA box-binding protein-like protein 2 OS=Rattus norvegicus OX=10116 GN=Tbpl2 PE=2 SV=1)

HSP 1 Score: 202.986 bits (515), Expect = 1.213e-61
Identity = 92/173 (53.18%), Postives = 129/173 (74.57%), Query Frame = 1
Query:  349 PVIQNIACFFDLNCGLDLSHIAKSALNTKYDAKCFPAVIMRIRKPKTTANIFKNGKIICAGAKTEEDAKKATRKISRIIQKLGYKIRYNNFKILNMVASCDVRFQIGLDPLNLLHSSFTTYDPEQFPGLFYKMADPLITILIFKSGKIILTGGKDKSNIDEAYNKILPVLKMF 867
            P +QN+    +L C LDL  IA +A NT+Y+ K F AVIMRIR+P+TTA IF +GK++C GAK+E++++ A RK +R++QKLG+ +R+ NFKI NMVASCDV+F I L+ L L H  F++Y+PE FPGL YKM  P + +LIF SGK++LTG K++S I EA+  + P+L+ F
Sbjct:  169 PQLQNVVSTANLACKLDLRKIALNAKNTEYNPKRFAAVIMRIREPRTTALIFSSGKVVCTGAKSEDESRLAARKYARVVQKLGFPVRFFNFKIQNMVASCDVKFPIRLEILALTHRQFSSYEPELFPGLIYKMVKPQVVLLIFASGKVVLTGAKERSEIYEAFENMYPILESF 341          
BLAST of TATA-box-binding protein vs. UniProt/SwissProt
Match: sp|P53361|TBP_SPOFR (TATA-box-binding protein OS=Spodoptera frugiperda OX=7108 GN=Tbp PE=2 SV=1)

HSP 1 Score: 200.29 bits (508), Expect = 4.233e-61
Identity = 95/173 (54.91%), Postives = 125/173 (72.25%), Query Frame = 1
Query:  349 PVIQNIACFFDLNCGLDLSHIAKSALNTKYDAKCFPAVIMRIRKPKTTANIFKNGKIICAGAKTEEDAKKATRKISRIIQKLGYKIRYNNFKILNMVASCDVRFQIGLDPLNLLHSSFTTYDPEQFPGLFYKMADPLITILIFKSGKIILTGGKDKSNIDEAYNKILPVLKMF 867
            P +QNI    +LNC LDL  IA  A N +Y+ K F AVIMRIR+P+TTA IF +GK++C GAK+EED++ A RK +RIIQKLG+  ++ +FKI NMV SCDV+F I L+ L L H  F++Y+PE FPGL Y+M  P I +LIF SGK++LTG K +  I EA++ I P+LK F
Sbjct:  132 PQLQNIVSTVNLNCKLDLKKIALHARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEDSRLAARKYARIIQKLGFTAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHGQFSSYEPELFPGLIYRMVKPRIVLLIFVSGKVVLTGAKVREEIYEAFDNIYPILKSF 304          
BLAST of TATA-box-binding protein vs. UniProt/SwissProt
Match: sp|Q6SJ96|TBPL2_HUMAN (TATA box-binding protein-like protein 2 OS=Homo sapiens OX=9606 GN=TBPL2 PE=2 SV=1)

HSP 1 Score: 201.06 bits (510), Expect = 1.766e-60
Identity = 94/173 (54.34%), Postives = 124/173 (71.68%), Query Frame = 1
Query:  349 PVIQNIACFFDLNCGLDLSHIAKSALNTKYDAKCFPAVIMRIRKPKTTANIFKNGKIICAGAKTEEDAKKATRKISRIIQKLGYKIRYNNFKILNMVASCDVRFQIGLDPLNLLHSSFTTYDPEQFPGLFYKMADPLITILIFKSGKIILTGGKDKSNIDEAYNKILPVLKMF 867
            P +QNI    +L C LDL  IA  A N +Y+ K F AVIMRIR+P+TTA IF +GK++C GAK+EE ++ A RK +R++QKLG+  R+ +FKI NMV SCDVRF I L+ L L H  F++Y+PE FPGL Y+M  P I +LIF SGK++LTG K++S I EA+  I P+LK F
Sbjct:  200 PQLQNIVSTVNLACKLDLKKIALHAKNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPARFLDFKIQNMVGSCDVRFPIRLEGLVLTHQQFSSYEPELFPGLIYRMVKPRIVLLIFVSGKVVLTGAKERSEIYEAFENIYPILKGF 372          
BLAST of TATA-box-binding protein vs. UniProt/SwissProt
Match: sp|O45211|TBP_BOMMO (TATA-box-binding protein OS=Bombyx mori OX=7091 GN=Tbp PE=2 SV=1)

HSP 1 Score: 198.749 bits (504), Expect = 2.038e-60
Identity = 106/231 (45.89%), Postives = 144/231 (62.34%), Query Frame = 1
Query:  175 NQNAPMVNKYNLNNELYCSNHYDVPEEVDDYIVEYFKREQIKDIIISPELSQDVGSSHPVIQNIACFFDLNCGLDLSHIAKSALNTKYDAKCFPAVIMRIRKPKTTANIFKNGKIICAGAKTEEDAKKATRKISRIIQKLGYKIRYNNFKILNMVASCDVRFQIGLDPLNLLHSSFTTYDPEQFPGLFYKMADPLITILIFKSGKIILTGGKDKSNIDEAYNKILPVLKMF 867
            N  +PM+   NL+++   S     P                    ++P LS D G   P +QNI    +L+C LDL  IA  A N +Y+ K F AVIMRIR+P+TTA IF +GK++C GAK+EED++ A RK +RIIQKLG+  ++ +FKI NMV SCDV+F I L+ L L H  F++Y+PE FPGL Y+M  P I +LIF SGK++LTG K +  I EA++ I P+LK F
Sbjct:   93 NMMSPMIAAGNLSSQQMLSQASPAPMTP-----------------LTP-LSADPGI-LPQLQNIVSTVNLDCKLDLKKIALHARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEDSRLAARKYARIIQKLGFTAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHGQFSSYEPELFPGLIYRMVKPRIVLLIFVSGKVVLTGAKVREEIYEAFDNIYPILKSF 304          
BLAST of TATA-box-binding protein vs. UniProt/SwissProt
Match: sp|P32085|TBP_CAEEL (TATA-box-binding protein OS=Caenorhabditis elegans OX=6239 GN=tbp-1 PE=1 SV=1)

HSP 1 Score: 199.519 bits (506), Expect = 2.083e-60
Identity = 91/173 (52.60%), Postives = 124/173 (71.68%), Query Frame = 1
Query:  349 PVIQNIACFFDLNCGLDLSHIAKSALNTKYDAKCFPAVIMRIRKPKTTANIFKNGKIICAGAKTEEDAKKATRKISRIIQKLGYKIRYNNFKILNMVASCDVRFQIGLDPLNLLHSSFTTYDPEQFPGLFYKMADPLITILIFKSGKIILTGGKDKSNIDEAYNKILPVLKMF 867
            P +QNI    +L   LDL  IA  A N +Y+ K F AVIMRIR+P+TTA IF +GK++C GAK+EE ++ A RK +RI+QKLG++ ++  F + NMV SCDVRF I L+ L + HS F+TY+PE FPGL Y+M  P + +LIF SGK+++TG K K +IDEA+ +I P+LK F
Sbjct:  166 PALQNIVSTVNLGVQLDLKKIALHARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEASRLAARKYARIVQKLGFQAKFTEFMVQNMVGSCDVRFPIQLEGLCITHSQFSTYEPELFPGLIYRMVKPRVVLLIFVSGKVVITGAKTKRDIDEAFGQIYPILKGF 338          
BLAST of TATA-box-binding protein vs. TrEMBL
Match: A0A172RVY0 (Telomere repeat binding factor 2-3 (Fragment) OS=Schmidtea mediterranea OX=79327 GN=TRF2-3 PE=2 SV=1)

HSP 1 Score: 345.895 bits (886), Expect = 1.550e-117
Identity = 169/170 (99.41%), Postives = 170/170 (100.00%), Query Frame = 1
Query:  358 QNIACFFDLNCGLDLSHIAKSALNTKYDAKCFPAVIMRIRKPKTTANIFKNGKIICAGAKTEEDAKKATRKISRIIQKLGYKIRYNNFKILNMVASCDVRFQIGLDPLNLLHSSFTTYDPEQFPGLFYKMADPLITILIFKSGKIILTGGKDKSNIDEAYNKILPVLKMF 867
            +NIACFFDLNCGLDLSHIAKSALNTKYDAKCFPAVIMRIRKPKTTANIFKNGKIICAGAKTEEDAKKATRKISRIIQKLGYKIRYNNFKILNMVASCDVRFQIGLDPLNLLHSSFTTYDPEQFPGLFYKMADPLITILIFKSGKIILTGGKDKSNIDEAYNKILPVLKMF
Sbjct:    3 RNIACFFDLNCGLDLSHIAKSALNTKYDAKCFPAVIMRIRKPKTTANIFKNGKIICAGAKTEEDAKKATRKISRIIQKLGYKIRYNNFKILNMVASCDVRFQIGLDPLNLLHSSFTTYDPEQFPGLFYKMADPLITILIFKSGKIILTGGKDKSNIDEAYNKILPVLKMF 172          
BLAST of TATA-box-binding protein vs. TrEMBL
Match: A0A2T7NZD8 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_14183 PE=3 SV=1)

HSP 1 Score: 206.838 bits (525), Expect = 7.824e-62
Identity = 102/187 (54.55%), Postives = 131/187 (70.05%), Query Frame = 1
Query:  310 ISPELSQDVGSS-HPVIQNIACFFDLNCGLDLSHIAKSALNTKYDAKCFPAVIMRIRKPKTTANIFKNGKIICAGAKTEEDAKKATRKISRIIQKLGYKIRYNNFKILNMVASCDVRFQIGLDPLNLLHSSFTTYDPEQFPGLFYKMADPLITILIFKSGKIILTGGKDKSNIDEAYNKILPVLKMF 867
            ISP      GS   P +QNI C  +L+C LDL  IA  A N +Y+ K F AVIMRIR+P+TTA IF +GK++C GAK+EE AK A RK +RI+QKLG+  R+ +FKI NMV SCDV+F I L+ L L HS F++Y+PE FPGL Y+M  P I +LIF SGK++LTG K ++ I EA+  I P+LK F
Sbjct:   62 ISPATPASEGSGIRPQLQNIVCTVNLDCKLDLKKIALHARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEMAKLAARKYARIVQKLGFPARFLDFKIQNMVGSCDVKFPIRLESLVLTHSQFSSYEPELFPGLIYRMVKPRIVLLIFVSGKVVLTGAKVRTEIYEAFENIYPILKGF 248          
BLAST of TATA-box-binding protein vs. TrEMBL
Match: A0A0X3PQT5 (Uncharacterized protein OS=Schistocephalus solidus OX=70667 GN=SSLN_LOCUS7726 PE=3 SV=1)

HSP 1 Score: 205.297 bits (521), Expect = 4.102e-61
Identity = 99/183 (54.10%), Postives = 125/183 (68.31%), Query Frame = 1
Query:  313 SPELSQDVGSSHPVIQNIACFFDLNCGLDLSHIAKSALNTKYDAKCFPAVIMRIRKPKTTANIFKNGKIICAGAKTEEDAKKATRKISRIIQKLGYKIRYNNFKILNMVASCDVRFQIGLDPLNLLHSSFTTYDPEQFPGLFYKMADPLITILIFKSGKIILTGGKDKSNIDEAYNKILPVLK 861
            +P   +D G   P +QNI C   L C LDL  IA  A N +Y+ K F AVIMRIR+P+TTA IF +GK++C GAK+EE A+ A RK +RI+QKLG++  +  FKI NMV SCDVRF I L+ L + H  F TY+PE FPGL Y+M  P I ILIF SGKI+LTG K +  I EA++ I P+LK
Sbjct:   51 TPLHERDSGIPRPQLQNIVCTVYLGCKLDLKQIALKARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEQARLAARKYARIVQKLGFEAHFKEFKIQNMVGSCDVRFHIRLEGLGVSHEEFVTYEPEIFPGLIYRMTKPKIVILIFVSGKIVLTGAKVREEIYEAFDNIYPILK 233          
BLAST of TATA-box-binding protein vs. TrEMBL
Match: A0A0B6YAJ1 (Uncharacterized protein (Fragment) OS=Arion vulgaris OX=1028688 GN=ORF16791 PE=3 SV=1)

HSP 1 Score: 204.142 bits (518), Expect = 6.465e-61
Identity = 102/186 (54.84%), Postives = 128/186 (68.82%), Query Frame = 1
Query:  313 SPELSQDVGSS-HPVIQNIACFFDLNCGLDLSHIAKSALNTKYDAKCFPAVIMRIRKPKTTANIFKNGKIICAGAKTEEDAKKATRKISRIIQKLGYKIRYNNFKILNMVASCDVRFQIGLDPLNLLHSSFTTYDPEQFPGLFYKMADPLITILIFKSGKIILTGGKDKSNIDEAYNKILPVLKMF 867
            SP      GS   P +QNI C  +LNC LDL  IA  A N +Y+ K F AVIMRIR P+TTA IF +GK++C GAK+EE AK A RK +RI+QKLG+  ++ +FKI NMV SCDVRF I L+ L L H  F++Y+PE FPGL Y+M  P I +LIF SGK++LTG K +S I EA+  I P+LK F
Sbjct:   54 SPATPASEGSGIRPQLQNIVCTVNLNCKLDLKTIALRARNAEYNPKRFAAVIMRIRDPRTTALIFSSGKMVCTGAKSEELAKLAARKYARIVQKLGFPAKFLDFKIQNMVGSCDVRFPIRLEGLVLTHGQFSSYEPELFPGLIYRMVKPRIVLLIFVSGKVVLTGAKVRSEIYEAFENIYPILKGF 239          
BLAST of TATA-box-binding protein vs. TrEMBL
Match: A0A421JGS1 (TATA-box-binding protein OS=Meyerozyma sp. JA9 OX=2028340 GN=JA9_004182 PE=3 SV=1)

HSP 1 Score: 204.142 bits (518), Expect = 6.908e-61
Identity = 106/233 (45.49%), Postives = 147/233 (63.09%), Query Frame = 1
Query:  181 NAPMVNKYNLNNELYCSNHYDVPEEVDDYIVEYFKREQIK-DIIISPELSQDVGSSH---PVIQNIACFFDLNCGLDLSHIAKSALNTKYDAKCFPAVIMRIRKPKTTANIFKNGKIICAGAKTEEDAKKATRKISRIIQKLGYKIRYNNFKILNMVASCDVRFQIGLDPLNLLHSSFTTYDPEQFPGLFYKMADPLITILIFKSGKIILTGGKDKSNIDEAYNKILPVLKMF 867
             A     Y   N L     +D   + D   V Y K+E+ + D ++ P   QD G++    P +QNI    +L+C LDL  IA  A N +Y+ K F AVIMRIR+PKTTA IF +GK++  GAK+E+D+K A+RK +RIIQKLG+  ++ +FKI N+V SCDV+F I L+ L   H +F++Y+PE FPGL Y+M  P I +LIF SG+I+LTG K +  I +A+  I PVL  F
Sbjct:    9 TAAQAKVYTAPNSLTFPQGFDGESKPD---VGYLKKEEDRSDAVVEPNQHQDDGATSGIVPTLQNIVATVNLDCRLDLKTIALHARNAEYNPKRFAAVIMRIREPKTTALIFASGKMVVTGAKSEDDSKLASRKYARIIQKLGFNAKFTDFKIQNIVGSCDVKFPIRLEGLAFSHGTFSSYEPELFPGLIYRMVKPKIVLLIFVSGRIVLTGAKQREEIYDAFEAIYPVLSEF 238          
BLAST of TATA-box-binding protein vs. Ensembl Cavefish
Match: tbpl2 (TATA box binding protein like 2 [Source:NCBI gene;Acc:407713])

HSP 1 Score: 196.438 bits (498), Expect = 1.841e-60
Identity = 93/173 (53.76%), Postives = 123/173 (71.10%), Query Frame = 1
Query:  349 PVIQNIACFFDLNCGLDLSHIAKSALNTKYDAKCFPAVIMRIRKPKTTANIFKNGKIICAGAKTEEDAKKATRKISRIIQKLGYKIRYNNFKILNMVASCDVRFQIGLDPLNLLHSSFTTYDPEQFPGLFYKMADPLITILIFKSGKIILTGGKDKSNIDEAYNKILPVLKMF 867
            P +QNI    +L C LDL  IA  A N +Y+ K F AVIMRIR+P+TTA IF +GK++C GAK+EE ++ A RK +R++QKLG+  ++ +FKI NMV SCDV F I L+ L L H  F++Y+PE FPGL Y+M  P I +LIF SGK++LTG KD+S I EA+  I P+LK F
Sbjct:  138 PQLQNIVSTVNLACPLDLKSIALQARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPAKFLDFKIQNMVGSCDVCFPIRLEGLVLTHQQFSSYEPELFPGLIYRMVKPRIVLLIFVSGKVVLTGAKDRSEIYEAFENIYPILKGF 310          
BLAST of TATA-box-binding protein vs. Ensembl Cavefish
Match: tbp (TATA box binding protein [Source:NCBI gene;Acc:368882])

HSP 1 Score: 76.2554 bits (186), Expect = 9.302e-16
Identity = 36/67 (53.73%), Postives = 46/67 (68.66%), Query Frame = 1
Query:  349 PVIQNIACFFDLNCGLDLSHIAKSALNTKYDAKCFPAVIMRIRKPKTTANIFKNGKIICAGAKTEED 549
            P +QNI    +L C LDL  IA  A N +Y+ K F AVIMRIR+P+TTA IF +GK++C GAK+ E 
Sbjct:  128 PQLQNIVSTVNLGCKLDLKTIALRARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSYEP 194          

HSP 2 Score: 65.855 bits (159), Expect = 4.857e-12
Identity = 29/54 (53.70%), Postives = 38/54 (70.37%), Query Frame = 1
Query:  706 TYDPEQFPGLFYKMADPLITILIFKSGKIILTGGKDKSNIDEAYNKILPVLKMF 867
            +Y+PE FPGL Y+M  P I +LIF SGK++LTG K +  I EA+  I P+LK F
Sbjct:  191 SYEPELFPGLIYRMIKPRIVLLIFVSGKVVLTGAKVRGEIYEAFENIYPILKGF 244          
BLAST of TATA-box-binding protein vs. Ensembl Sea Lamprey
Match: tbp (TATA box binding protein [Source:NCBI gene;Acc:368882])

HSP 1 Score: 191.43 bits (485), Expect = 2.094e-59
Identity = 90/173 (52.02%), Postives = 122/173 (70.52%), Query Frame = 1
Query:  349 PVIQNIACFFDLNCGLDLSHIAKSALNTKYDAKCFPAVIMRIRKPKTTANIFKNGKIICAGAKTEEDAKKATRKISRIIQKLGYKIRYNNFKILNMVASCDVRFQIGLDPLNLLHSSFTTYDPEQFPGLFYKMADPLITILIFKSGKIILTGGKDKSNIDEAYNKILPVLKMF 867
            P +QNI    +L C LDL  IA  A N +Y+ K F AVIMRIR+P+TTA IF +GK++C GAK+E+ ++ A RK +R++QKLG+  ++ +FKI NMV SCDV+F I L+ L L H  F++Y+PE FPGL Y+M  P I +LIF SGK++LTG K +  I EA+  I P+LK F
Sbjct:  116 PQLQNIVSTVNLCCKLDLKKIALHARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEDQSRLAARKYARVVQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYRMVKPRIVLLIFVSGKVVLTGAKVRGEIYEAFENIYPILKGF 288          
BLAST of TATA-box-binding protein vs. Ensembl Sea Lamprey
Match: tbpl1 (TBP-like 1 [Source:NCBI gene;Acc:403035])

HSP 1 Score: 125.946 bits (315), Expect = 1.663e-35
Identity = 67/174 (38.51%), Postives = 101/174 (58.05%), Query Frame = 1
Query:  352 VIQNIACFFDLNCGLDLSHIAKSALNTKY---DAKCFPAVIMRIRKPKTTANIFKNGKIICAGAKTEEDAKKATRKISRIIQKLGYK--IRYNNFKILNMVASCDVRFQIGLDPLNLLHSSFTTYDPEQFPGLFYKMADPLITILIFKSGKIILTGGKDKSNIDEAYNKILPVL 858
            +I N+ C F   C LDL HIA    N  Y   + K    V+M++R+P+ T+ I+ +GK+IC GA +EEDAK   R+ +R +QKLG+K  IR+  FK++N++A C + F+I L      H    +Y+PE  P   YK+     T+ IF +G I LT   + S I +A  +I P++
Sbjct:   14 LITNVVCVFRTRCHLDLRHIALEGANVMYKRDEGK----VLMKLRRPRITSTIWSSGKVICTGATSEEDAKIGARRCARCLQKLGFKTQIRFCAFKVVNVLAVCSMPFEIRLVDFTKTHRPIASYEPELHPAATYKIKSLSATLQIFSTGSITLT-APNVSLIAQAIEQIYPLV 182          
BLAST of TATA-box-binding protein vs. Ensembl Yeast
Match: SPT15 (TATA-binding protein (TBP); general transcription factor that interacts with other factors to form the preinitiation complex at promoters; essential for viability, highly conserved; yeast gene can complement mutations in human homolog TBP [Source:SGD;Acc:S000000950])

HSP 1 Score: 194.512 bits (493), Expect = 1.525e-61
Identity = 93/188 (49.47%), Postives = 128/188 (68.09%), Query Frame = 1
Query:  313 SPELSQDVGSSH---PVIQNIACFFDLNCGLDLSHIAKSALNTKYDAKCFPAVIMRIRKPKTTANIFKNGKIICAGAKTEEDAKKATRKISRIIQKLGYKIRYNNFKILNMVASCDVRFQIGLDPLNLLHSSFTTYDPEQFPGLFYKMADPLITILIFKSGKIILTGGKDKSNIDEAYNKILPVLKMF 867
            +PE  +D  ++    P +QNI     L C LDL  +A  A N +Y+ K F AVIMRIR+PKTTA IF +GK++  GAK+E+D+K A+RK +RIIQK+G+  ++ +FKI N+V SCDV+F I L+ L   H +F++Y+PE FPGL Y+M  P I +LIF SGKI+LTG K +  I +A+  I PVL  F
Sbjct:   50 APESEKDTSATSGIVPTLQNIVATVTLGCRLDLKTVALHARNAEYNPKRFAAVIMRIREPKTTALIFASGKMVVTGAKSEDDSKLASRKYARIIQKIGFAAKFTDFKIQNIVGSCDVKFPIRLEGLAFSHGTFSSYEPELFPGLIYRMVKPKIVLLIFVSGKIVLTGAKQREEIYQAFEAIYPVLSEF 237          
BLAST of TATA-box-binding protein vs. Ensembl Nematostella
Match: EDO44103 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RWY1])

HSP 1 Score: 196.823 bits (499), Expect = 1.304e-62
Identity = 92/173 (53.18%), Postives = 122/173 (70.52%), Query Frame = 1
Query:  349 PVIQNIACFFDLNCGLDLSHIAKSALNTKYDAKCFPAVIMRIRKPKTTANIFKNGKIICAGAKTEEDAKKATRKISRIIQKLGYKIRYNNFKILNMVASCDVRFQIGLDPLNLLHSSFTTYDPEQFPGLFYKMADPLITILIFKSGKIILTGGKDKSNIDEAYNKILPVLKMF 867
            P +QNI    +L C LDL  IA  A N +Y+ K F AVIMRIR+P+TTA IF +GK++C GAK+EE +K A RK +R++QKLG+  ++  FKI NMV SCDV+F I L+ L L H  F++Y+PE FPGL Y+M  P I +LIF SGK++LTG K +  I EA++ I P+LK F
Sbjct:   19 PQLQNIVSTVNLGCKLDLKKIALQARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEQSKLAARKYARVVQKLGFPAKFTEFKIQNMVGSCDVKFPIRLEGLVLAHGQFSSYEPELFPGLIYRMVKPRIVLLIFVSGKVVLTGAKVRQEIYEAFDNIYPILKTF 191          
BLAST of TATA-box-binding protein vs. Ensembl Medaka
Match: tbpl2 (TATA-box binding protein like 2 [Source:NCBI gene;Acc:101165520])

HSP 1 Score: 199.519 bits (506), Expect = 4.863e-61
Identity = 93/173 (53.76%), Postives = 124/173 (71.68%), Query Frame = 1
Query:  349 PVIQNIACFFDLNCGLDLSHIAKSALNTKYDAKCFPAVIMRIRKPKTTANIFKNGKIICAGAKTEEDAKKATRKISRIIQKLGYKIRYNNFKILNMVASCDVRFQIGLDPLNLLHSSFTTYDPEQFPGLFYKMADPLITILIFKSGKIILTGGKDKSNIDEAYNKILPVLKMF 867
            P +QNI     L C LDL  IA+ A N +Y+ K F AVIMRIR+P+TTA IF +GK++C GAK+EE+++ A RK +R++QKLG+  R+  FKI NMVASCDV F I L+ L L H  F++Y+PE FPGL Y+M  P I +LIF SGK++LTG K+++ I EA+  I P+LK F
Sbjct:  192 PQLQNIVSTVTLGCPLDLKFIARQARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEESRLAARKYARVVQKLGFSARFLEFKIQNMVASCDVCFPIRLEGLVLTHQQFSSYEPELFPGLIYRMVKPRIVLLIFVSGKVVLTGAKERAEIYEAFENIYPILKGF 364          
BLAST of TATA-box-binding protein vs. Ensembl Medaka
Match: tbpl2 (TATA-box binding protein like 2 [Source:NCBI gene;Acc:101165520])

HSP 1 Score: 199.519 bits (506), Expect = 7.739e-60
Identity = 93/173 (53.76%), Postives = 124/173 (71.68%), Query Frame = 1
Query:  349 PVIQNIACFFDLNCGLDLSHIAKSALNTKYDAKCFPAVIMRIRKPKTTANIFKNGKIICAGAKTEEDAKKATRKISRIIQKLGYKIRYNNFKILNMVASCDVRFQIGLDPLNLLHSSFTTYDPEQFPGLFYKMADPLITILIFKSGKIILTGGKDKSNIDEAYNKILPVLKMF 867
            P +QNI     L C LDL  IA+ A N +Y+ K F AVIMRIR+P+TTA IF +GK++C GAK+EE+++ A RK +R++QKLG+  R+  FKI NMVASCDV F I L+ L L H  F++Y+PE FPGL Y+M  P I +LIF SGK++LTG K+++ I EA+  I P+LK F
Sbjct:  177 PQLQNIVSTVTLGCPLDLKFIARQARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEESRLAARKYARVVQKLGFSARFLEFKIQNMVASCDVCFPIRLEGLVLTHQQFSSYEPELFPGLIYRMVKPRIVLLIFVSGKVVLTGAKERAEIYEAFENIYPILKGF 349          
BLAST of TATA-box-binding protein vs. Ensembl Medaka
Match: tbp (TATA-box binding protein [Source:NCBI gene;Acc:100049222])

HSP 1 Score: 193.741 bits (491), Expect = 2.804e-58
Identity = 91/173 (52.60%), Postives = 123/173 (71.10%), Query Frame = 1
Query:  349 PVIQNIACFFDLNCGLDLSHIAKSALNTKYDAKCFPAVIMRIRKPKTTANIFKNGKIICAGAKTEEDAKKATRKISRIIQKLGYKIRYNNFKILNMVASCDVRFQIGLDPLNLLHSSFTTYDPEQFPGLFYKMADPLITILIFKSGKIILTGGKDKSNIDEAYNKILPVLKMF 867
            P +QNI    +L C LDL  IA  A N +Y+ K F AVIMRIR+P+TTA IF +GK++C GAK+EE ++ A RK +R++QKLG+  ++ +FKI NMV SCDV+F I L+ L L H  F++Y+PE FPGL Y+M  P I +LIF SGK++LTG K ++ I EA+  I P+LK F
Sbjct:  231 PQLQNIVSTVNLGCKLDLKTIALRARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRIVLLIFVSGKVVLTGAKVRAEIYEAFENIYPILKGF 403          
BLAST of TATA-box-binding protein vs. Ensembl Medaka
Match: tbpl1 (TATA-box binding protein like 1 [Source:NCBI gene;Acc:101172784])

HSP 1 Score: 120.939 bits (302), Expect = 7.451e-33
Identity = 58/169 (34.32%), Postives = 102/169 (60.36%), Query Frame = 1
Query:  352 VIQNIACFFDLNCGLDLSHIAKSALNTKYDAKCFPAVIMRIRKPKTTANIFKNGKIICAGAKTEEDAKKATRKISRIIQKLGYKIRYNNFKILNMVASCDVRFQIGLDPLNLLHSSFTTYDPEQFPGLFYKMADPLITILIFKSGKIILTGGKDKSNIDEAYNKILPVL 858
            +I N+   F   C L+L  IA   +N  Y  +    V+M++RKP+ TA+I+ +GKIIC GA +E++AK   R+++R +QKLG+K+R++ FK++N++A C + F I L      +    +Y+PE  P   Y++ +   T+ +F +G + +T G +  N+  A  ++ P+L
Sbjct:   12 IITNVVATFRTRCHLNLRTIALEGINVIYKPE-VGKVLMKLRKPRITASIWSSGKIICTGATSEDEAKLGARRLARCLQKLGFKVRFSAFKVVNVLAVCSMPFSIHLVDFTKNNRPIASYEPELHPAATYRIKNIKATVQVFSTGSLTIT-GPNVQNVATAVEQVYPLL 178          
BLAST of TATA-box-binding protein vs. Ensembl Medaka
Match: ENSORLT00000034235.1 (TATA-box-binding protein [Source:NCBI gene;Acc:101174576])

HSP 1 Score: 120.553 bits (301), Expect = 7.387e-32
Identity = 64/172 (37.21%), Postives = 104/172 (60.47%), Query Frame = 1
Query:  355 IQNIACFFDLNCGLDLSHIAKSALNTKYDAKCFPAVIMRIRKPKTTANIFKNGKIICAGAKTEEDAKKATRKISRIIQKLGYKIRYNNFKILNMVASCDVR-FQIGLDPLNLLHSSFTTYDPEQFPGLFYKMADPLITILIFKSGKIILTGGKDKSNIDEAYNKILPVLKMF 867
            I+N+    DL C LDL  I K+  NT+Y+ K +  +IMRIRKP+TTANI+  GK+IC  A + E++++A R+ +RI+QK G+ +R+ NF+++N V  C V+ F + L+ L   +    +++PE  P +F + + P     I ++G +I+ G        E    + PVLK+F
Sbjct:   93 IKNVVSVVDLGCRLDLGAIGKALWNTQYNPKTYTGLIMRIRKPRTTANIYSTGKMICTAACSIEESRQAARRHARILQKAGFPVRFLNFRVINCV--CMVKTFCLNLEGLTRSNPQGFSFEPELNPAVFLRKS-PGGFASIHRNGTVIIMGLSSPKACKELLQLMYPVLKVF 261          
BLAST of TATA-box-binding protein vs. Planmine SMEST
Match: SMESG000068211.1 (SMESG000068211.1)

HSP 1 Score: 515.383 bits (1326), Expect = 0.000e+0
Identity = 251/251 (100.00%), Postives = 251/251 (100.00%), Query Frame = 1
Query:  115 MHFQSKNYINYFDNNQPIIYNQNAPMVNKYNLNNELYCSNHYDVPEEVDDYIVEYFKREQIKDIIISPELSQDVGSSHPVIQNIACFFDLNCGLDLSHIAKSALNTKYDAKCFPAVIMRIRKPKTTANIFKNGKIICAGAKTEEDAKKATRKISRIIQKLGYKIRYNNFKILNMVASCDVRFQIGLDPLNLLHSSFTTYDPEQFPGLFYKMADPLITILIFKSGKIILTGGKDKSNIDEAYNKILPVLKMF 867
            MHFQSKNYINYFDNNQPIIYNQNAPMVNKYNLNNELYCSNHYDVPEEVDDYIVEYFKREQIKDIIISPELSQDVGSSHPVIQNIACFFDLNCGLDLSHIAKSALNTKYDAKCFPAVIMRIRKPKTTANIFKNGKIICAGAKTEEDAKKATRKISRIIQKLGYKIRYNNFKILNMVASCDVRFQIGLDPLNLLHSSFTTYDPEQFPGLFYKMADPLITILIFKSGKIILTGGKDKSNIDEAYNKILPVLKMF
Sbjct:    1 MHFQSKNYINYFDNNQPIIYNQNAPMVNKYNLNNELYCSNHYDVPEEVDDYIVEYFKREQIKDIIISPELSQDVGSSHPVIQNIACFFDLNCGLDLSHIAKSALNTKYDAKCFPAVIMRIRKPKTTANIFKNGKIICAGAKTEEDAKKATRKISRIIQKLGYKIRYNNFKILNMVASCDVRFQIGLDPLNLLHSSFTTYDPEQFPGLFYKMADPLITILIFKSGKIILTGGKDKSNIDEAYNKILPVLKMF 251          
BLAST of TATA-box-binding protein vs. Planmine SMEST
Match: SMESG000068211.1 (SMESG000068211.1)

HSP 1 Score: 462.996 bits (1190), Expect = 1.830e-166
Identity = 226/226 (100.00%), Postives = 226/226 (100.00%), Query Frame = 1
Query:  190 MVNKYNLNNELYCSNHYDVPEEVDDYIVEYFKREQIKDIIISPELSQDVGSSHPVIQNIACFFDLNCGLDLSHIAKSALNTKYDAKCFPAVIMRIRKPKTTANIFKNGKIICAGAKTEEDAKKATRKISRIIQKLGYKIRYNNFKILNMVASCDVRFQIGLDPLNLLHSSFTTYDPEQFPGLFYKMADPLITILIFKSGKIILTGGKDKSNIDEAYNKILPVLKMF 867
            MVNKYNLNNELYCSNHYDVPEEVDDYIVEYFKREQIKDIIISPELSQDVGSSHPVIQNIACFFDLNCGLDLSHIAKSALNTKYDAKCFPAVIMRIRKPKTTANIFKNGKIICAGAKTEEDAKKATRKISRIIQKLGYKIRYNNFKILNMVASCDVRFQIGLDPLNLLHSSFTTYDPEQFPGLFYKMADPLITILIFKSGKIILTGGKDKSNIDEAYNKILPVLKMF
Sbjct:    1 MVNKYNLNNELYCSNHYDVPEEVDDYIVEYFKREQIKDIIISPELSQDVGSSHPVIQNIACFFDLNCGLDLSHIAKSALNTKYDAKCFPAVIMRIRKPKTTANIFKNGKIICAGAKTEEDAKKATRKISRIIQKLGYKIRYNNFKILNMVASCDVRFQIGLDPLNLLHSSFTTYDPEQFPGLFYKMADPLITILIFKSGKIILTGGKDKSNIDEAYNKILPVLKMF 226          
BLAST of TATA-box-binding protein vs. Planmine SMEST
Match: SMESG000064519.1 (SMESG000064519.1)

HSP 1 Score: 201.445 bits (511), Expect = 4.826e-63
Identity = 97/185 (52.43%), Postives = 128/185 (69.19%), Query Frame = 1
Query:  313 SPELSQDVGSSHPVIQNIACFFDLNCGLDLSHIAKSALNTKYDAKCFPAVIMRIRKPKTTANIFKNGKIICAGAKTEEDAKKATRKISRIIQKLGYKIRYNNFKILNMVASCDVRFQIGLDPLNLLHSSFTTYDPEQFPGLFYKMADPLITILIFKSGKIILTGGKDKSNIDEAYNKILPVLKMF 867
            +P + +++    P +QNI C  +L C LDL  IA  A N +Y+ K F AVIMRIR P+TTA IF +GK++C GAK+E++AK A RK +RIIQKL +  ++ NFKI NMV SCDV+F I L+ + L H+ F TY+PE FPGL Y+M  P I +LIF SGKI+LTG K +  I EA+  I P+LK F
Sbjct:   81 TPMIDKEIVMPTPQLQNIVCTVNLGCKLDLKSIALHARNAEYNPKRFAAVIMRIRTPRTTALIFSSGKMVCTGAKSEDEAKLAARKFARIIQKLDFDAKFMNFKIQNMVGSCDVKFPIRLEGICLSHTQFATYEPELFPGLIYRMGKPKIVLLIFVSGKIVLTGAKVREEIYEAFKNIYPILKTF 265          
BLAST of TATA-box-binding protein vs. Planmine SMEST
Match: SMESG000019971.1 (SMESG000019971.1)

HSP 1 Score: 124.02 bits (310), Expect = 7.693e-34
Identity = 64/173 (36.99%), Postives = 102/173 (58.96%), Query Frame = 1
Query:  349 PVIQNIACFFDLNCGLDLSHIAKSALNTKYDAKCFPAVIMRIRKPKTTANIFKNGKIICAGAKTEEDAKKATRKISRIIQKLGYKIRYNNFKILNMVASCDVRFQIGLDPLNLLHSSFTTYDPEQFPGLFYKMADPLITILIFKSGKIILTGGKDKSNIDEAYNKILPVLKMF 867
            P I N+ C   LNC L+L+ ++    N++Y  K F  +++RIR+PK T  +F  G ++  G   E DAK ATRKI+R I K G  +R ++FKI N+  + DV  Q+ L      HS F T + E FP L Y++ +P +T ++F++GK+ + G K  + + EA+ K   +++ F
Sbjct:   40 PSITNVVCSSKLNCKLNLNLLSSQVRNSEYSPKLFTGLVIRIRQPKATGIVFSTGSLVVTGIGVETDAKTATRKIARTIMKAGNNVRLSHFKIDNVCGTVDVNGQVHLHHFQNKHSFFATLELELFPSLVYRLLEPKVTFMVFRNGKVNIVGAKSTAILHEAFQKFYLIMREF 212          
BLAST of TATA-box-binding protein vs. Planmine SMEST
Match: SMESG000017008.1 (SMESG000017008.1)

HSP 1 Score: 116.316 bits (290), Expect = 5.853e-31
Identity = 60/187 (32.09%), Postives = 102/187 (54.55%), Query Frame = 1
Query:  307 IISPELSQDVGSSHPVIQNIACFFDLNCGLDLSHIAKSALNTKYDAKCFPAVIMRIRKPKTTANIFKNGKIICAGAKTEEDAKKATRKISRIIQKLGYKIRYNNFKILNMVASCDVRFQIGLDPLNLLHSSFTTYDPEQFPGLFYKMADPLITILIFKSGKIILTGGKDKSNIDEAYNKILPVLKMF 867
            I  P +     +  P I N+   F     L L +I       +Y+   F   I+++  PK T+ IF  G I+  GA++EE      R++ R++  +   ++  NFK +N+VA  +++F I L+ +   ++    Y+PE FP +FY++  P +T LIF +G+II+TG K KS + +A+N + PVL+ F
Sbjct:   16 ITRPIVDNHFQTPIPKITNVVAKFSTGIELKLDYIIAKVNGAEYNPARFSGCILKLVSPKITSMIFNTGIILITGARSEESCYLGARRLIRMLTLINLPVKLVNFKYINIVAQVNLKFPIRLEGIVDSNAQRINYEPELFPAVFYRIFSPKMTFLIFVNGQIIITGAKSKSQLIKAFNNVYPVLRQF 202          
The following BLAST results are available for this feature:
BLAST of TATA-box-binding protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TBPL23.678e-6154.34TATA-box binding protein like 2 [Source:HGNC Symbo... [more]
TBP8.204e-6052.60TATA-box binding protein [Source:HGNC Symbol;Acc:H... [more]
TBP2.649e-5952.60TATA-box binding protein [Source:HGNC Symbol;Acc:H... [more]
TBP4.741e-5952.60TATA-box binding protein [Source:HGNC Symbol;Acc:H... [more]
TBP4.741e-5952.60TATA-box binding protein [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of TATA-box-binding protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
tbp-11.638e-6152.60TATA-box-binding protein [Source:UniProtKB/Swiss-... [more]
tlf-13.408e-2128.41TBP-like factor [Source:UniProtKB/TrEMBL;Acc:G5EC... [more]
tlf-13.505e-2128.41TBP-like factor [Source:UniProtKB/TrEMBL;Acc:G5EC... [more]
back to top
BLAST of TATA-box-binding protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tbp1.999e-5953.76gene:FBgn0003687 transcript:FBtr0071679[more]
Trf2.506e-5044.44gene:FBgn0010287 transcript:FBtr0079542[more]
Trf21.868e-2835.09gene:FBgn0261793 transcript:FBtr0333811[more]
Trf21.868e-2835.09gene:FBgn0261793 transcript:FBtr0330106[more]
Trf23.391e-2635.09gene:FBgn0261793 transcript:FBtr0333750[more]
back to top
BLAST of TATA-box-binding protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tbpl23.855e-6053.18TATA box binding protein like 2 [Source:NCBI gene;... [more]
tbp1.067e-5952.60TATA box binding protein [Source:NCBI gene;Acc:368... [more]
tbp1.067e-5952.60TATA box binding protein [Source:NCBI gene;Acc:368... [more]
tbpl12.132e-3334.91TBP-like 1 [Source:NCBI gene;Acc:403035][more]
tbpl12.132e-3334.91TBP-like 1 [Source:NCBI gene;Acc:403035][more]
back to top
BLAST of TATA-box-binding protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pa2g47.615e-6153.76proliferation-associated 2G4 [Source:Xenbase;Acc:X... [more]
tbp1.548e-5952.60TATA-box binding protein [Source:NCBI gene;Acc:549... [more]
tbp2.321e-5952.60TATA-box binding protein [Source:NCBI gene;Acc:549... [more]
tbp2.092e-5353.95TATA-box binding protein [Source:NCBI gene;Acc:549... [more]
pa2g41.458e-3748.28proliferation-associated 2G4 [Source:Xenbase;Acc:X... [more]
back to top
BLAST of TATA-box-binding protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tbpl22.349e-6253.18TATA box binding protein like 2 [Source:MGI Symbol... [more]
Tbpl21.561e-6052.87TATA box binding protein like 2 [Source:MGI Symbol... [more]
Tbp1.379e-5952.60TATA box binding protein [Source:MGI Symbol;Acc:MG... [more]
Tbp1.379e-5952.60TATA box binding protein [Source:MGI Symbol;Acc:MG... [more]
Tbp1.379e-5952.60TATA box binding protein [Source:MGI Symbol;Acc:MG... [more]
back to top
BLAST of TATA-box-binding protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A6H909|TBPL2_RAT1.213e-6153.18TATA box-binding protein-like protein 2 OS=Rattus ... [more]
sp|P53361|TBP_SPOFR4.233e-6154.91TATA-box-binding protein OS=Spodoptera frugiperda ... [more]
sp|Q6SJ96|TBPL2_HUMAN1.766e-6054.34TATA box-binding protein-like protein 2 OS=Homo sa... [more]
sp|O45211|TBP_BOMMO2.038e-6045.89TATA-box-binding protein OS=Bombyx mori OX=7091 GN... [more]
sp|P32085|TBP_CAEEL2.083e-6052.60TATA-box-binding protein OS=Caenorhabditis elegans... [more]
back to top
BLAST of TATA-box-binding protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A172RVY01.550e-11799.41Telomere repeat binding factor 2-3 (Fragment) OS=S... [more]
A0A2T7NZD87.824e-6254.55Uncharacterized protein OS=Pomacea canaliculata OX... [more]
A0A0X3PQT54.102e-6154.10Uncharacterized protein OS=Schistocephalus solidus... [more]
A0A0B6YAJ16.465e-6154.84Uncharacterized protein (Fragment) OS=Arion vulgar... [more]
A0A421JGS16.908e-6145.49TATA-box-binding protein OS=Meyerozyma sp. JA9 OX=... [more]
back to top
BLAST of TATA-box-binding protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
tbpl21.841e-6053.76TATA box binding protein like 2 [Source:NCBI gene;... [more]
tbp9.302e-1653.73TATA box binding protein [Source:NCBI gene;Acc:368... [more]
back to top
BLAST of TATA-box-binding protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
tbp2.094e-5952.02TATA box binding protein [Source:NCBI gene;Acc:368... [more]
tbpl11.663e-3538.51TBP-like 1 [Source:NCBI gene;Acc:403035][more]
back to top
BLAST of TATA-box-binding protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
SPT151.525e-6149.47TATA-binding protein (TBP); general transcription ... [more]
back to top
BLAST of TATA-box-binding protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO441031.304e-6253.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of TATA-box-binding protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tbpl24.863e-6153.76TATA-box binding protein like 2 [Source:NCBI gene;... [more]
tbpl27.739e-6053.76TATA-box binding protein like 2 [Source:NCBI gene;... [more]
tbp2.804e-5852.60TATA-box binding protein [Source:NCBI gene;Acc:100... [more]
tbpl17.451e-3334.32TATA-box binding protein like 1 [Source:NCBI gene;... [more]
ENSORLT00000034235.17.387e-3237.21TATA-box-binding protein [Source:NCBI gene;Acc:101... [more]
back to top
BLAST of TATA-box-binding protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000068211.10.000e+0100.00SMESG000068211.1[more]
SMESG000068211.11.830e-166100.00SMESG000068211.1[more]
SMESG000064519.14.826e-6352.43SMESG000064519.1[more]
SMESG000019971.17.693e-3436.99SMESG000019971.1[more]
SMESG000017008.15.853e-3132.09SMESG000017008.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30028419 ID=SMED30028419|Name=TATA-box-binding protein|organism=Schmidtea mediterranea sexual|type=transcript|length=974bp
GGATTCCTTAAATTTCACACTAAACCAGGAATTTTAAATAAATCTTGCAG
CATTTTCTTTTCCGTATAATACATCTAATTTTTGTTTGTAAATCATTTCA
TATATTTGCAAATAATGCATTTCCAATCAAAAAATTATATTAATTATTTT
GACAACAACCAACCAATCATATATAATCAAAATGCTCCAATGGTGAATAA
ATACAATTTGAACAACGAATTATATTGCTCAAACCATTATGATGTTCCAG
AAGAAGTAGATGATTATATCGTAGAATACTTTAAAAGAGAACAAATCAAA
GATATAATAATATCTCCAGAACTTAGTCAAGATGTGGGTTCTTCACATCC
AGTTATTCAAAATATCGCCTGCTTTTTCGACTTGAACTGCGGATTGGATC
TAAGTCATATAGCCAAATCAGCTCTAAATACAAAATATGATGCAAAATGT
TTTCCGGCGGTAATAATGAGAATAAGAAAACCGAAAACTACAGCGAATAT
ATTTAAAAATGGAAAAATAATTTGCGCTGGTGCTAAAACAGAAGAAGATG
CTAAAAAAGCAACGAGAAAAATCTCTAGGATTATTCAAAAATTAGGCTAC
AAAATTAGATATAATAATTTTAAAATTCTTAACATGGTTGCGTCGTGCGA
CGTAAGATTTCAAATTGGTTTAGATCCTTTGAATTTGCTCCATAGTTCAT
TTACAACTTATGATCCAGAACAGTTTCCCGGTCTCTTTTACAAAATGGCA
GATCCATTAATTACAATTTTAATTTTTAAATCTGGGAAAATTATTTTGAC
CGGAGGAAAAGATAAGAGCAATATTGATGAAGCTTATAATAAGATCTTGC
CTGTTTTAAAAATGTTTAAGAAGGAAATACCTAATCAAAATATTATAAAA
CAATAGAAGATTTTTAAATAATATTTCAATTGTGAATGTCGAAATGTTAA
AAATTGATTGATCTTACAAGTCAC
back to top

protein sequence of SMED30028419-orf-1

>SMED30028419-orf-1 ID=SMED30028419-orf-1|Name=SMED30028419-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=264bp
MHFQSKNYINYFDNNQPIIYNQNAPMVNKYNLNNELYCSNHYDVPEEVDD
YIVEYFKREQIKDIIISPELSQDVGSSHPVIQNIACFFDLNCGLDLSHIA
KSALNTKYDAKCFPAVIMRIRKPKTTANIFKNGKIICAGAKTEEDAKKAT
RKISRIIQKLGYKIRYNNFKILNMVASCDVRFQIGLDPLNLLHSSFTTYD
PEQFPGLFYKMADPLITILIFKSGKIILTGGKDKSNIDEAYNKILPVLKM
FKKEIPNQNIIKQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0000995transcription factor activity, core RNA polymerase III binding
GO:0003677DNA binding
GO:0003700transcription factor activity, sequence-specific DNA binding
Vocabulary: cellular component
TermDefinition
GO:0005669transcription factor TFIID complex
GO:0005634nucleus
GO:0005737cytoplasm
Vocabulary: biological process
TermDefinition
GO:0006366transcription from RNA polymerase II promoter
GO:0006383transcription from RNA polymerase III promoter
GO:0006352DNA-templated transcription, initiation
GO:0006351transcription, DNA-templated
GO:0006355regulation of transcription, DNA-templated
GO:0007275multicellular organism development
GO:0045892negative regulation of transcription, DNA-templated
Vocabulary: INTERPRO
TermDefinition
IPR000814TBP
IPR012295TBP_dom_sf
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000814TATA-box binding proteinPRINTSPR00686TIFACTORIIDcoord: 81..96
score: 46.41
coord: 195..210
score: 55.98
coord: 105..124
score: 56.49
coord: 214..230
score: 62.83
coord: 124..142
score: 56.66
coord: 171..187
score: 55.94
IPR000814TATA-box binding proteinPFAMPF00352TBPcoord: 168..249
e-value: 2.4E-24
score: 85.1
coord: 80..159
e-value: 1.5E-26
score: 92.2
IPR000814TATA-box binding proteinPANTHERPTHR10126TATA-BOX BINDING PROTEINcoord: 74..253
IPR012295TBP domain superfamilyGENE3DG3DSA:3.30.310.10coord: 86..171
e-value: 5.8E-65
score: 220.0
IPR012295TBP domain superfamilyGENE3DG3DSA:3.30.310.10coord: 82..251
e-value: 5.8E-65
score: 220.0
NoneNo IPR availablePANTHERPTHR10126:SF6TATA BOX-BINDING PROTEIN-LIKE PROTEIN 2-RELATEDcoord: 74..253
NoneNo IPR availableSUPERFAMILYSSF55945TATA-box binding protein-likecoord: 76..171
NoneNo IPR availableSUPERFAMILYSSF55945TATA-box binding protein-likecoord: 163..257