Voltage dependent L type calcium channel subunit

Overview
NameVoltage dependent L type calcium channel subunit
Smed IDSMED30028403
Length (bp)7253
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Voltage dependent L type calcium channel subunit (SMED30028403) t-SNE clustered cells

Violin plots show distribution of expression levels for Voltage dependent L type calcium channel subunit (SMED30028403) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Voltage dependent L type calcium channel subunit (SMED30028403) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Voltage dependent L type calcium channel subunit (SMED30028403) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30028403

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30028403SMESG000047442.1 SMESG000028290.1 SMESG000028279.1 SmedASXL_018217SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30028403SMESG000047442.1 SMESG000028290.1 SMESG000028279.1 dd_Smed_v4_13295_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30028403SMESG000047442.1 SMESG000028290.1 SMESG000028279.1 dd_Smed_v6_13295_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
oocyteSMED30028403SMESG000028279.1 Contig42952uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
vitelline glandSMED30028403SMESG000028279.1 Contig42952uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30028403SMESG000028279.1 Contig42952uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
oocyteSMED30028403SMESG000028279.1 Contig42952newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
vitelline glandSMED30028403SMESG000028279.1 Contig42952newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30028403SMESG000028279.1 Contig42952newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Voltage dependent L type calcium channel subunit vs. Ensembl Human
Match: CACNA1S (calcium voltage-gated channel subunit alpha1 S [Source:HGNC Symbol;Acc:HGNC:1397])

HSP 1 Score: 1231.47 bits (3185), Expect = 0.000e+0
Identity = 741/1613 (45.94%), Postives = 1011/1613 (62.68%), Query Frame = 2
Query:  641 SLAKRTINLSFPGMQTSTSKSLFIFSEENVIRKYAKIIIEWGPFEYMVLLTILANCIVLSMERHLPKKDKTLLAGQLELTEKYFLGIFCVEALLKIVALGFCCHKEAYLRNVWNIMDFVVVVTGFLMMFLN----IDNH-----SDSSTVDLRTLRAVRVLRPLKLVAGFPSLQVVLKSIIRAMAPLLQIGLLVLFAITIFAIIGLEFYSGAFHYTCFKANSDKLPLPIPTEKSLVPCSNSKNGSGLGAYTCPEDYQCKAYWEGPNYGITSFDNIGYAMLTVFQCITMEGWTDIMYHTNDAIGNRFNWLYFVPLIILGSFFMLNLVLGVLSGXXXXXXXXXXXXXXXLKLRRQQQTEKEFNGYMEWIQKAEEVLLNEATTTSEDKMRIIAARRRAEKQKYKLLGKNQSIPDFEYEDTELYSETKSMKGNIFIRSYAGIRRRRKERCTSFWRT-EKHFRFSVRRLVKSQPFYWAVIILVFFNTVCVAIEHYEQGKWLTLFLNYAEYVFLCLFMMEMMIKMYGLSIRVYFQSSFNIFDCVVIAGSLFEIIYGIFVQDSSFGLSVLRALRLLRIFKVTRYWAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMQLFGGEFNFEEGKPPQ-NFDTFVKALLTVFQILTGEDWNTVMYNGIQSKGGVKERGTVFSIYFVLLVVFGNYTLLNVFLAIAVDNLANXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSSDNFIGRLPLSIDPPMVQVCPPSPQTANSLISKNFSFDHNQVEVNDKGCLLNTNKPNGKLGMLGHDNTNFNSLESDPVPNKIEPETIQRK--PVLPYSAMFIFSPLNSLRRFCHFVVNLRYFDLFIMIVICASSIALAAEDPVKEKSLKNNILEFFDYAFTGVFTVEMILKIIDLGIILHPGSYCRDLWNILDATVVICALVAFIMGQKPSPTGNKLRGSSAKNLNTIKSLRVLRVLRPLKTINRVPKLKAVFDCVVSSLKNVFNILIVYILFQFIFAVIAVQLFQGKFFYCNDASKSSRETCRGYFFDYAGRS--TPETKKRLWQHHDFHFDNILYAMLTLFTVTTGEGWPTVLKNSMESTNIDNGPIADYRQEMAXXXXXXXXXXXXXXXXXXXALIIITFQEQGENELIDLDLDKNQKQCIDFAINEKPLCRYMPKDKTTIKYRVWRLVVSTPFEYFIMVMIALNTLILMMKYYREEKKASSAATHDREQQAYLNYCNTLIFLNSAFTVMFSIECVLKIMAFGPKNYFRDPWNIFDFITVIGSITDVLVSELQDXXXXXXXXXX---XXXXXXXXXXXXQGYTIRILLWTFIQSFKALPYVCLLIAMLFFIYSIIGMQVFGNIKLISEYQINRHNNFQTFTNGLLLLFRCATGESWQEIMLACDNNKPC--EKDIENTNNFDCGSNFTYIYFVSFIFLCSFLMLNLFVAVIMDNFDYLTRDSSILGPHHLDEYIRVWAEYDPGAIGRIHHSEMYEMLRNMEPPVGFGKKCPYRLAYRKLIRMNMPVDENGTVNFTTTLFALIRESLNIKMSTAEYMDIKDMELRQTICKMWPVQAKKKLNLIVPPDSELVFHKMTVGKIYAGYLIVENWRAYKNSQEQ 5419
             L K+      P +     ++LF  + EN +RK    I+EW PFE ++LLTI ANC+ L++   +P+ D   L   LE  E +FL +F +EA +KI+A GF  H++AYLR+ WN++DF +V  G   + L     I +H     S  + +D++ LRA RVLRPL+LV+G PSLQVVL SI +AM PL  I LLVLF + I+AIIGLE + G  H TC+   +D +      E S  PC+ +    G G        +C+  W GPN+GIT FDN G++MLTV+QCITMEGWTD++Y  NDAIGN + W+YFV LI+LGSFF+LNLVLGVLSGEF KERE+ + R  F KLR +QQ +++  GYM WI + E   + +     E K+ +       E   Y++ G N+ I                     FIR                WR   + FR+    +VKS+ FYW VI++V  NT+ +A EH+ Q  WLT   + A  V L LF  EM++KMYGL +R YF S FN FDC V+   + EI+       +  G+SVLR +RLLRIFK+T+YW SL NLV SLLNS+RSI SLL LLFLFI+IFALLGMQLFGG ++FE+ +  + NFD F +AL++VFQ+LTGEDW ++MYNGI + GG    G +  IYF++L V GNY LLNVFLAIAVDNLA A+ LT+A++ KA E +R   +  L ++ +   + + +  L   P    +    P TA   I +   F+ N  EV D         P       G D  +   +   P P  +    ++ K  P+   S+ FIFSP N +R  CH +VN  +F  FI++ I  SS ALAAEDP++  S++N IL+ FD  FT VFTVE++LK+   G  LH GS+CR+ +N+LD  VV  +L++               G  +  ++ +K LRVLRVLRPL+ INR   LK V  C+  ++  + NI++V  L QF+FA I VQLF+GKFF C D SK + E CRGY++ Y        E + R W H DFHFDN+L AM++LFTV+T EGWP +L  +++S   D GPI + R EMAIF+I++ I+  FF +NIFV  +I+TFQEQGE E  + +LDKNQ+QC+ +A+  +PL  Y+PK+    +Y+VW +V S+ FEY +  +I LNT+ L M++Y + ++              +N+ + +  LN AFT++F++E +LK+MAF  + YF DPWN+FDF+ VIGSI DV++SE+ D    +        LFR  RLIKLL +   +R LLWTFI+SF+ALPYV LLI MLFFIY++IGMQ+FG I L+   QINR+NNFQTF   +LLLFRCATGE+WQEI+LAC   K C  E D      + CG+NF Y YF+SF  LC+FL++NLFVAVIMDNFDYLTRD SILGPHHLDE+  +WAEYDP A GRI H ++  +LR ++PP+GFGK CP+R+A ++L+ MNMP++ +GTV F  TLFAL+R +L IK  T    +  + ELR  I K+W   + K L+ ++PP  +    ++TVGK YA +LI E++R +   QE+
Sbjct:   10 GLRKKQPKKPVPEILPRPPRALFCLTLENPLRKACISIVEWKPFETIILLTIFANCVALAVYLPMPEDDNNSLNLGLEKLEYFFLIVFSIEAAMKIIAYGFLFHQDAYLRSGWNVLDFTIVFLGVFTVILEQVNVIQSHTAPMSSKGAGLDVKALRAFRVLRPLRLVSGVPSLQVVLNSIFKAMLPLFHIALLVLFMVIIYAIIGLELFKGKMHKTCYFIGTDIVATVENEEPS--PCART----GSGRRCTINGSECRGGWPGPNHGITHFDNFGFSMLTVYQCITMEGWTDVLYWVNDAIGNEWPWIYFVTLILLGSFFILNLVLGVLSGEFTKEREKAKSRGTFQKLREKQQLDEDLRGYMSWITQGE---VMDVEDFREGKLSLDEGGSDTESL-YEIAGLNKIIQ--------------------FIRH---------------WRQWNRIFRWKCHDIVKSKVFYWLVILIVALNTLSIASEHHNQPLWLTRLQDIANRVLLSLFTTEMLMKMYGLGLRQYFMSIFNRFDCFVVCSGILEILLVESGAMTPLGISVLRCIRLLRIFKITKYWTSLSNLVASLLNSIRSIASLLLLLFLFIVIFALLGMQLFGGRYDFEDTEVRRSNFDNFPQALISVFQVLTGEDWTSMMYNGIMAYGGPSYPGMLVCIYFIILFVCGNYILLNVFLAIAVDNLAEAESLTSAQKAKAEEKKRRKMSKGLPDKSEEEKSTMAK-KLEQKPKGEGI----PTTAKLKIDE---FESNVNEVKD---------PYPSADFPGDDEEDEPEIPLSPRPRPLAELQLKEKAVPIPEASSFFIFSPTNKIRVLCHRIVNATWFTNFILLFILLSSAALAAEDPIRADSMRNQILKHFDIGFTSVFTVEIVLKMTTYGAFLHKGSFCRNYFNMLDLLVVAVSLISM--------------GLESSAISVVKILRVLRVLRPLRAINRAKGLKHVVQCMFVAISTIGNIVLVTTLLQFMFACIGVQLFKGKFFRCTDLSKMTEEECRGYYYVYKDGDPMQIELRHREWVHSDFHFDNVLSAMMSLFTVSTFEGWPQLLYKAIDSNAEDVGPIYNNRVEMAIFFIIYIILIAFFMMNIFVGFVIVTFQEQGETEYKNCELDKNQRQCVQYALKARPLRCYIPKNP--YQYQVWYIVTSSYFEYLMFALIMLNTICLGMQHYNQSEQ--------------MNHISDI--LNVAFTIIFTLEMILKLMAFKARGYFGDPWNVFDFLIVIGSIIDVILSEIDDPDESARISSAFFRLFRVMRLIKLLSRAEGVRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQMFGKIALVDGTQINRNNNFQTFPQAVLLLFRCATGEAWQEILLACSYGKLCDPESDYAPGEEYTCGTNFAYYYFISFYMLCAFLVINLFVAVIMDNFDYLTRDWSILGPHHLDEFKAIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKFCPHRVACKRLVGMNMPLNSDGTVTFNATLFALVRTALKIK--TEGNFEQANEELRAIIKKIWKRTSMKLLDQVIPPIGD---DEVTVGKFYATFLIQEHFRKFMKRQEE 1523          
BLAST of Voltage dependent L type calcium channel subunit vs. Ensembl Human
Match: CACNA1C (calcium voltage-gated channel subunit alpha1 C [Source:HGNC Symbol;Acc:HGNC:1390])

HSP 1 Score: 1230.7 bits (3183), Expect = 0.000e+0
Identity = 768/1688 (45.50%), Postives = 1042/1688 (61.73%), Query Frame = 2
Query:  599 VMSIDDGSKTTSMRSLAKRTINLSFPGMQTSTS-----KSLFIFSEENVIRKYAKIIIEWGPFEYMVLLTILANCIVLSMERHLPKKDKTLLAGQLELTEKYFLGIFCVEALLKIVALGFCCHKEAYLRNVWNIMDFVVVVTGFLMMFLNIDNHSDSSTV--------DLRTLRAVRVLRPLKLVAGFPSLQVVLKSIIRAMAPLLQIGLLVLFAITIFAIIGLEFYSGAFHYTCFKANSDKLPLPIPTEKSLVPCSNSKNGSGLGAYTCPEDYQCKAYWEGPNYGITSFDNIGYAMLTVFQCITMEGWTDIMYHTNDAIGNRFNWLYFVPLIILGSFFMLNLVLGVLSGXXXXXXXXXXXXXXXLKLRRQQQTEKEFNGYMEWIQKAEEV-LLNEATTTSEDKMRIIAARRRAEKQKYKLLGKNQSIPDFEYEDTELYSETKSMKGNIFIRSYAGIR---RRRKERCTSFWRTEKHF-RFSVRRLVKSQPFYWAVIILVFFNTVCVAIEHYEQGKWLTLFLNYAEYVFLCLFMMEMMIKMYGLSIRVYFQSSFNIFDCVVIAGSLFEIIYGIFVQDSSFGLSVLRALRLLRIFKVTRYWAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMQLFGGEFNFEEGKPPQN-FDTFVKALLTVFQILTGEDWNTVMYNGIQSKGGVKERGTVFSIYFVLLVVFGNYTLLNVFLAIAVDNLANXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSSDNFIGRLPLSIDPPMVQVCPPSPQTANSLISKNFSFDHNQVEVNDKGCLLNTNK-PNGKLGMLGHDNTNFNSLESDPVPNKIEPETIQRK--PVLPYSAMFIFSPLNSLRRFCHFVVNLRYFDLFIMIVICASSIALAAEDPVKEKSLKNNILEFFDYAFTGVFTVEMILKIIDLGIILHPGSYCRDLWNILDATVVICALVAFIMGQKPSPTGNKLRGSSAKNLNTIKSLRVLRVLRPLKTINRVPKLKAVFDCVVSSLKNVFNILIVYILFQFIFAVIAVQLFQGKFFYCNDASKSSRETCRGYFFDYAGRST--PETKKRLWQHHDFHFDNILYAMLTLFTVTTGEGWPTVLKNSMESTNIDNGPIADYRQEMAXXXXXXXXXXXXXXXXXXXALIIITFQEQGENELIDLDLDKNQKQCIDFAINEKPLCRYMPKDKTTIKYRVWRLVVSTPFEYFIMVMIALNTLILMMKYYREEKKASSAATHDREQQAYLNYCNTLIFLNSAFTVMFSIECVLKIMAFGPKNYFRDPWNIFDFITVIGSITDVLVSE--------------LQDXXXXXXXXXXXXXXXXXXXXXXQGYTIRILLWTFIQSFKALPYVCLLIAMLFFIYSIIGMQVFGNIKLISEYQINRHNNFQTFTNGLLLLFRCATGESWQEIMLACDNNKPCEKDIENTNNFD----CGSNFTYIYFVSFIFLCSFLMLNLFVAVIMDNFDYLTRDSSILGPHHLDEYIRVWAEYDPGAIGRIHHSEMYEMLRNMEPPVGFGKKCPYRLAYRKLIRMNMPVDENGTVNFTTTLFALIRESLNIKMSTAEYMDIKDMELRQTICKMWPVQAKKKLNLIVPPDSELVFHKMTVGKIYAGYLIVENWRAYKNSQEQG----PRSSPAVSIKSVTK------PVVKEEKSANLLAK 5506
            +M     +  +++ S  ++      P  Q ST+     ++L   + +N IR+    I+EW PFE ++LLTI ANC+ L++    P+ D       LE  E  FL IF VEA LK++A G   H  AYLRN WN++DF++VV G     L     +D +          D++ LRA RVLRPL+LV+G PSLQVVL SII+AM PLL I LLVLF I I+AIIGLE + G  H TC+  N + +   +P E    PC+  + G G     C     CK  W+GP +GIT+FDN  +AMLTVFQCITMEGWTD++Y  NDA+G  + W+YFV LII+GSFF+LNLVLGVLSGEF+KERE+ + R  F KLR +QQ E++  GY++WI +AE++   NE     E+K R                  N S+P  E E       T+++ G        G R   R  K + + +WR    F R   R  VKS  FYW VI LVF NT+ +A EHY Q  WLT   + A    L LF  EM++KMY L ++ YF S FN FDC V+ G + E I       S  G+SVLR +RLLRIFK+TRYW SL NLV SLLNS+RSI SLL LLFLFI+IF+LLGMQLFGG+FNF+E +  ++ FD F ++LLTVFQILTGEDWN+VMY+GI + GG    G +  IYF++L + GNY LLNVFLAIAVDNLA+A+ LT+A++E+  E +R   A     E+K            ++ P V           S+ +   S    ++ ++D     N +K P       G ++     +   P P  +    ++ K  P+   SA FIFS  N  R  CH +VN   F   I+  I  SSI+LAAEDPV+  S +N+IL   DY FT +FT+E+ILK+   G  LH GS+CR+ +NILD  VV  +L++F              G  +  +N +K LRVLRVLRPL+ INR   LK V  CV  +++ + NI+IV  L QF+FA I VQLF+GK + C+D+SK +   C+G +  Y       P  + R W++  F FDN+L AM+ LFTV+T EGWP +L  S++S   D GPI +YR E++IF+I++ I+  FF +NIFV  +I+TFQEQGE E  + +LDKNQ+QC+++A+  +PL RY+PK++   +Y+VW +V ST FEY + V+I LNT+ L M++Y                Q+ L +   +  LN  FT +F++E +LK++AF PK YF DPWN+FDF+ VIGSI DV++SE               +++S +S+ F RLFR  RL+KLL +G  IR LLWTFI+SF+ALPYV LLI MLFFIY++IGMQVFG I L    +INR+NNFQTF   +LLLFRCATGE+WQ+IMLAC   K C  + E +N+ +    CGS+F   YF+SF  LC+FL++NLFVAVIMDNFDYLTRD SILGPHHLDE+ R+WAEYDP A GRI H ++  +LR ++PP+GFGK CP+R+A ++L+ MNMP++ +GTV F  TLFAL+R +L IK  T   ++  + ELR  I K+W   + K L+ +VPP  +    ++TVGK YA +LI E +R +K  +EQG    P    A+S+++  +      P ++   S +L A+
Sbjct:   64 LMGSAGNATISTVSSTQRKRQQYGKPKKQGSTTATRPPRALLCLTLKNPIRRACISIVEWKPFEIIILLTIFANCVALAIYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIAYGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKADGANALGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFMGKMHKTCY--NQEGIA-DVPAEDDPSPCA-LETGHG---RQCQNGTVCKPGWDGPKHGITNFDNFAFAMLTVFQCITMEGWTDVLYWVNDAVGRDWPWIYFVTLIIIGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPENEDEGMDEEKPR------------------NMSMPTSETESV----NTENVAGGDIEGENCGARLAHRISKSKFSRYWRRWNRFCRRKCRAAVKSNVFYWLVIFLVFLNTLTIASEHYNQPNWLTEVQDTANKALLALFTAEMLLKMYSLGLQAYFVSLFNRFDCFVVCGGILETILVETKIMSPLGISVLRCVRLLRIFKITRYWNSLSNLVASLLNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDEMQTRRSTFDNFPQSLLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYILLNVFLAIAVDNLADAESLTSAQKEEEEEKERKKLARTASPEKKQE---------LVEKPAVGESKEEKIELKSITADGESPPATKINMDDLQPNENEDKSPYPNPETTGEEDEEEPEMPVGPRPRPLSELHLKEKAVPMPEASAFFIFSSNNRFRLQCHRIVNDTIFTNLILFFILLSSISLAAEDPVQHTSFRNHILGNADYVFTSIFTLEIILKMTAYGAFLHKGSFCRNYFNILDLLVVSVSLISF--------------GIQSSAINVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTTLLQFMFACIGVQLFKGKLYTCSDSSKQTEAECKGNYITYKDGEVDHPIIQPRSWENSKFDFDNVLAAMMALFTVSTFEGWPELLYRSIDSHTEDKGPIYNYRVEISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEQEYKNCELDKNQRQCVEYALKARPLRRYIPKNQH--QYKVWYVVNSTYFEYLMFVLILLNTICLAMQHY---------------GQSCL-FKIAMNILNMLFTGLFTVEMILKLIAFKPKGYFSDPWNVFDFLIVIGSIIDVILSETNPAEHTQCSPSMNAEENSRISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQVFGKIALNDTTEINRNNNFQTFPQAVLLLFRCATGEAWQDIMLACMPGKKCAPESEPSNSTEGETPCGSSFAVFYFISFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVSMNMPLNSDGTVMFNATLFALVRTALRIK--TEGNLEQANEELRAIIKKIWKRTSMKLLDQVVPPAGD---DEVTVGKFYATFLIQEYFRKFKKRKEQGLVGKPSQRNALSLQAGLRTLHDIGPEIRRAISGDLTAE 1676          
BLAST of Voltage dependent L type calcium channel subunit vs. Ensembl Human
Match: CACNA1C (calcium voltage-gated channel subunit alpha1 C [Source:HGNC Symbol;Acc:HGNC:1390])

HSP 1 Score: 1230.7 bits (3183), Expect = 0.000e+0
Identity = 768/1688 (45.50%), Postives = 1042/1688 (61.73%), Query Frame = 2
Query:  599 VMSIDDGSKTTSMRSLAKRTINLSFPGMQTSTS-----KSLFIFSEENVIRKYAKIIIEWGPFEYMVLLTILANCIVLSMERHLPKKDKTLLAGQLELTEKYFLGIFCVEALLKIVALGFCCHKEAYLRNVWNIMDFVVVVTGFLMMFLNIDNHSDSSTV--------DLRTLRAVRVLRPLKLVAGFPSLQVVLKSIIRAMAPLLQIGLLVLFAITIFAIIGLEFYSGAFHYTCFKANSDKLPLPIPTEKSLVPCSNSKNGSGLGAYTCPEDYQCKAYWEGPNYGITSFDNIGYAMLTVFQCITMEGWTDIMYHTNDAIGNRFNWLYFVPLIILGSFFMLNLVLGVLSGXXXXXXXXXXXXXXXLKLRRQQQTEKEFNGYMEWIQKAEEV-LLNEATTTSEDKMRIIAARRRAEKQKYKLLGKNQSIPDFEYEDTELYSETKSMKGNIFIRSYAGIR---RRRKERCTSFWRTEKHF-RFSVRRLVKSQPFYWAVIILVFFNTVCVAIEHYEQGKWLTLFLNYAEYVFLCLFMMEMMIKMYGLSIRVYFQSSFNIFDCVVIAGSLFEIIYGIFVQDSSFGLSVLRALRLLRIFKVTRYWAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMQLFGGEFNFEEGKPPQN-FDTFVKALLTVFQILTGEDWNTVMYNGIQSKGGVKERGTVFSIYFVLLVVFGNYTLLNVFLAIAVDNLANXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSSDNFIGRLPLSIDPPMVQVCPPSPQTANSLISKNFSFDHNQVEVNDKGCLLNTNK-PNGKLGMLGHDNTNFNSLESDPVPNKIEPETIQRK--PVLPYSAMFIFSPLNSLRRFCHFVVNLRYFDLFIMIVICASSIALAAEDPVKEKSLKNNILEFFDYAFTGVFTVEMILKIIDLGIILHPGSYCRDLWNILDATVVICALVAFIMGQKPSPTGNKLRGSSAKNLNTIKSLRVLRVLRPLKTINRVPKLKAVFDCVVSSLKNVFNILIVYILFQFIFAVIAVQLFQGKFFYCNDASKSSRETCRGYFFDYAGRST--PETKKRLWQHHDFHFDNILYAMLTLFTVTTGEGWPTVLKNSMESTNIDNGPIADYRQEMAXXXXXXXXXXXXXXXXXXXALIIITFQEQGENELIDLDLDKNQKQCIDFAINEKPLCRYMPKDKTTIKYRVWRLVVSTPFEYFIMVMIALNTLILMMKYYREEKKASSAATHDREQQAYLNYCNTLIFLNSAFTVMFSIECVLKIMAFGPKNYFRDPWNIFDFITVIGSITDVLVSE--------------LQDXXXXXXXXXXXXXXXXXXXXXXQGYTIRILLWTFIQSFKALPYVCLLIAMLFFIYSIIGMQVFGNIKLISEYQINRHNNFQTFTNGLLLLFRCATGESWQEIMLACDNNKPCEKDIENTNNFD----CGSNFTYIYFVSFIFLCSFLMLNLFVAVIMDNFDYLTRDSSILGPHHLDEYIRVWAEYDPGAIGRIHHSEMYEMLRNMEPPVGFGKKCPYRLAYRKLIRMNMPVDENGTVNFTTTLFALIRESLNIKMSTAEYMDIKDMELRQTICKMWPVQAKKKLNLIVPPDSELVFHKMTVGKIYAGYLIVENWRAYKNSQEQG----PRSSPAVSIKSVTK------PVVKEEKSANLLAK 5506
            +M     +  +++ S  ++      P  Q ST+     ++L   + +N IR+    I+EW PFE ++LLTI ANC+ L++    P+ D       LE  E  FL IF VEA LK++A G   H  AYLRN WN++DF++VV G     L     +D +          D++ LRA RVLRPL+LV+G PSLQVVL SII+AM PLL I LLVLF I I+AIIGLE + G  H TC+  N + +   +P E    PC+  + G G     C     CK  W+GP +GIT+FDN  +AMLTVFQCITMEGWTD++Y  NDA+G  + W+YFV LII+GSFF+LNLVLGVLSGEF+KERE+ + R  F KLR +QQ E++  GY++WI +AE++   NE     E+K R                  N S+P  E E       T+++ G        G R   R  K + + +WR    F R   R  VKS  FYW VI LVF NT+ +A EHY Q  WLT   + A    L LF  EM++KMY L ++ YF S FN FDC V+ G + E I       S  G+SVLR +RLLRIFK+TRYW SL NLV SLLNS+RSI SLL LLFLFI+IF+LLGMQLFGG+FNF+E +  ++ FD F ++LLTVFQILTGEDWN+VMY+GI + GG    G +  IYF++L + GNY LLNVFLAIAVDNLA+A+ LT+A++E+  E +R   A     E+K            ++ P V           S+ +   S    ++ ++D     N +K P       G ++     +   P P  +    ++ K  P+   SA FIFS  N  R  CH +VN   F   I+  I  SSI+LAAEDPV+  S +N+IL   DY FT +FT+E+ILK+   G  LH GS+CR+ +NILD  VV  +L++F              G  +  +N +K LRVLRVLRPL+ INR   LK V  CV  +++ + NI+IV  L QF+FA I VQLF+GK + C+D+SK +   C+G +  Y       P  + R W++  F FDN+L AM+ LFTV+T EGWP +L  S++S   D GPI +YR E++IF+I++ I+  FF +NIFV  +I+TFQEQGE E  + +LDKNQ+QC+++A+  +PL RY+PK++   +Y+VW +V ST FEY + V+I LNT+ L M++Y                Q+ L +   +  LN  FT +F++E +LK++AF PK YF DPWN+FDF+ VIGSI DV++SE               +++S +S+ F RLFR  RL+KLL +G  IR LLWTFI+SF+ALPYV LLI MLFFIY++IGMQVFG I L    +INR+NNFQTF   +LLLFRCATGE+WQ+IMLAC   K C  + E +N+ +    CGS+F   YF+SF  LC+FL++NLFVAVIMDNFDYLTRD SILGPHHLDE+ R+WAEYDP A GRI H ++  +LR ++PP+GFGK CP+R+A ++L+ MNMP++ +GTV F  TLFAL+R +L IK  T   ++  + ELR  I K+W   + K L+ +VPP  +    ++TVGK YA +LI E +R +K  +EQG    P    A+S+++  +      P ++   S +L A+
Sbjct:   64 LMGSAGNATISTVSSTQRKRQQYGKPKKQGSTTATRPPRALLCLTLKNPIRRACISIVEWKPFEIIILLTIFANCVALAIYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIAYGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKADGANALGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFMGKMHKTCY--NQEGIA-DVPAEDDPSPCA-LETGHG---RQCQNGTVCKPGWDGPKHGITNFDNFAFAMLTVFQCITMEGWTDVLYWVNDAVGRDWPWIYFVTLIIIGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPENEDEGMDEEKPR------------------NMSMPTSETESV----NTENVAGGDIEGENCGARLAHRISKSKFSRYWRRWNRFCRRKCRAAVKSNVFYWLVIFLVFLNTLTIASEHYNQPNWLTEVQDTANKALLALFTAEMLLKMYSLGLQAYFVSLFNRFDCFVVCGGILETILVETKIMSPLGISVLRCVRLLRIFKITRYWNSLSNLVASLLNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDEMQTRRSTFDNFPQSLLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYILLNVFLAIAVDNLADAESLTSAQKEEEEEKERKKLARTASPEKKQE---------LVEKPAVGESKEEKIELKSITADGESPPATKINMDDLQPNENEDKSPYPNPETTGEEDEEEPEMPVGPRPRPLSELHLKEKAVPMPEASAFFIFSSNNRFRLQCHRIVNDTIFTNLILFFILLSSISLAAEDPVQHTSFRNHILGNADYVFTSIFTLEIILKMTAYGAFLHKGSFCRNYFNILDLLVVSVSLISF--------------GIQSSAINVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTTLLQFMFACIGVQLFKGKLYTCSDSSKQTEAECKGNYITYKDGEVDHPIIQPRSWENSKFDFDNVLAAMMALFTVSTFEGWPELLYRSIDSHTEDKGPIYNYRVEISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEQEYKNCELDKNQRQCVEYALKARPLRRYIPKNQH--QYKVWYVVNSTYFEYLMFVLILLNTICLAMQHY---------------GQSCL-FKIAMNILNMLFTGLFTVEMILKLIAFKPKGYFSDPWNVFDFLIVIGSIIDVILSETNPAEHTQCSPSMNAEENSRISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQVFGKIALNDTTEINRNNNFQTFPQAVLLLFRCATGEAWQDIMLACMPGKKCAPESEPSNSTEGETPCGSSFAVFYFISFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVSMNMPLNSDGTVMFNATLFALVRTALRIK--TEGNLEQANEELRAIIKKIWKRTSMKLLDQVVPPAGD---DEVTVGKFYATFLIQEYFRKFKKRKEQGLVGKPSQRNALSLQAGLRTLHDIGPEIRRAISGDLTAE 1676          
BLAST of Voltage dependent L type calcium channel subunit vs. Ensembl Human
Match: CACNA1C (calcium voltage-gated channel subunit alpha1 C [Source:HGNC Symbol;Acc:HGNC:1390])

HSP 1 Score: 1230.31 bits (3182), Expect = 0.000e+0
Identity = 767/1688 (45.44%), Postives = 1042/1688 (61.73%), Query Frame = 2
Query:  599 VMSIDDGSKTTSMRSLAKRTINLSFPGMQTSTS-----KSLFIFSEENVIRKYAKIIIEWGPFEYMVLLTILANCIVLSMERHLPKKDKTLLAGQLELTEKYFLGIFCVEALLKIVALGFCCHKEAYLRNVWNIMDFVVVVTGFLMMFLNIDNHSDSSTV--------DLRTLRAVRVLRPLKLVAGFPSLQVVLKSIIRAMAPLLQIGLLVLFAITIFAIIGLEFYSGAFHYTCFKANSDKLPLPIPTEKSLVPCSNSKNGSGLGAYTCPEDYQCKAYWEGPNYGITSFDNIGYAMLTVFQCITMEGWTDIMYHTNDAIGNRFNWLYFVPLIILGSFFMLNLVLGVLSGXXXXXXXXXXXXXXXLKLRRQQQTEKEFNGYMEWIQKAEEV-LLNEATTTSEDKMRIIAARRRAEKQKYKLLGKNQSIPDFEYEDTELYSETKSMKGNIFIRSYAGIR---RRRKERCTSFWRTEKHF-RFSVRRLVKSQPFYWAVIILVFFNTVCVAIEHYEQGKWLTLFLNYAEYVFLCLFMMEMMIKMYGLSIRVYFQSSFNIFDCVVIAGSLFEIIYGIFVQDSSFGLSVLRALRLLRIFKVTRYWAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMQLFGGEFNFEEGKPPQN-FDTFVKALLTVFQILTGEDWNTVMYNGIQSKGGVKERGTVFSIYFVLLVVFGNYTLLNVFLAIAVDNLANXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSSDNFIGRLPLSIDPPMVQVCPPSPQTANSLISKNFSFDHNQVEVNDKGCLLNTNK-PNGKLGMLGHDNTNFNSLESDPVPNKIEPETIQRK--PVLPYSAMFIFSPLNSLRRFCHFVVNLRYFDLFIMIVICASSIALAAEDPVKEKSLKNNILEFFDYAFTGVFTVEMILKIIDLGIILHPGSYCRDLWNILDATVVICALVAFIMGQKPSPTGNKLRGSSAKNLNTIKSLRVLRVLRPLKTINRVPKLKAVFDCVVSSLKNVFNILIVYILFQFIFAVIAVQLFQGKFFYCNDASKSSRETCRGYFFDYAGRST--PETKKRLWQHHDFHFDNILYAMLTLFTVTTGEGWPTVLKNSMESTNIDNGPIADYRQEMAXXXXXXXXXXXXXXXXXXXALIIITFQEQGENELIDLDLDKNQKQCIDFAINEKPLCRYMPKDKTTIKYRVWRLVVSTPFEYFIMVMIALNTLILMMKYYREEKKASSAATHDREQQAYLNYCNTLIFLNSAFTVMFSIECVLKIMAFGPKNYFRDPWNIFDFITVIGSITDVLVSE--------------LQDXXXXXXXXXXXXXXXXXXXXXXQGYTIRILLWTFIQSFKALPYVCLLIAMLFFIYSIIGMQVFGNIKLISEYQINRHNNFQTFTNGLLLLFRCATGESWQEIMLACDNNKPCEKDIENTNNFD----CGSNFTYIYFVSFIFLCSFLMLNLFVAVIMDNFDYLTRDSSILGPHHLDEYIRVWAEYDPGAIGRIHHSEMYEMLRNMEPPVGFGKKCPYRLAYRKLIRMNMPVDENGTVNFTTTLFALIRESLNIKMSTAEYMDIKDMELRQTICKMWPVQAKKKLNLIVPPDSELVFHKMTVGKIYAGYLIVENWRAYKNSQEQG----PRSSPAVSIKSVTK------PVVKEEKSANLLAK 5506
            +M     +  +++ S  ++      P  Q ST+     ++L   + +N IR+    I+EW PFE ++LLTI ANC+ L++    P+ D       LE  E  FL IF VEA LK++A G   H  AYLRN WN++DF++VV G     L     +D +          D++ LRA RVLRPL+LV+G PSLQVVL SII+AM PLL I LLVLF I I+AIIGLE + G  H TC+  N + +   +P E    PC+  + G G     C     CK  W+GP +GIT+FDN  +AMLTVFQCITMEGWTD++Y  NDA+G  + W+YFV LII+GSFF+LNLVLGVLSGEF+KERE+ + R  F KLR +QQ E++  GY++WI +AE++   NE     E+K R                  N S+P  E E       T+++ G        G R   R  K + + +WR    F R   R  VKS  FYW VI LVF NT+ +A EHY Q  WLT   + A    L LF  EM++KMY L ++ YF S FN FDC V+ G + E I       S  G+SVLR +RLLRIFK+TRYW SL NLV SLLNS+RSI SLL LLFLFI+IF+LLGMQLFGG+FNF+E +  ++ FD F ++LLTVFQILTGEDWN+VMY+GI + GG    G +  IYF++L + GNY LLNVFLAIAVDNLA+A+ LT+A++E+  E +R   A     E+K            ++ P V           S+ +   S    ++ ++D     N +K P       G ++     +   P P  +    ++ K  P+   SA FIFS  N  R  CH +VN   F   I+  I  SSI+LAAEDPV+  S +N+IL +FD  FT +FT+E+ LK+   G  LH GS+CR+ +NILD  VV  +L++F              G  +  +N +K LRVLRVLRPL+ INR   LK V  CV  +++ + NI+IV  L QF+FA I VQLF+GK + C+D+SK +   C+G +  Y       P  + R W++  F FDN+L AM+ LFTV+T EGWP +L  S++S   D GPI +YR E++IF+I++ I+  FF +NIFV  +I+TFQEQGE E  + +LDKNQ+QC+++A+  +PL RY+PK++   +Y+VW +V ST FEY + V+I LNT+ L M++Y                Q+ L +   +  LN  FT +F++E +LK++AF PK YF DPWN+FDF+ VIGSI DV++SE               +++S +S+ F RLFR  RL+KLL +G  IR LLWTFI+SF+ALPYV LLI MLFFIY++IGMQVFG I L    +INR+NNFQTF   +LLLFRCATGE+WQ+IMLAC   K C  + E +N+ +    CGS+F   YF+SF  LC+FL++NLFVAVIMDNFDYLTRD SILGPHHLDE+ R+WAEYDP A GRI H ++  +LR ++PP+GFGK CP+R+A ++L+ MNMP++ +GTV F  TLFAL+R +L IK  T   ++  + ELR  I K+W   + K L+ +VPP  +    ++TVGK YA +LI E +R +K  +EQG    P    A+S+++  +      P ++   S +L A+
Sbjct:   64 LMGSAGNATISTVSSTQRKRQQYGKPKKQGSTTATRPPRALLCLTLKNPIRRACISIVEWKPFEIIILLTIFANCVALAIYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIAYGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKADGANALGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFMGKMHKTCY--NQEGIA-DVPAEDDPSPCA-LETGHG---RQCQNGTVCKPGWDGPKHGITNFDNFAFAMLTVFQCITMEGWTDVLYWVNDAVGRDWPWIYFVTLIIIGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPENEDEGMDEEKPR------------------NMSMPTSETESV----NTENVAGGDIEGENCGARLAHRISKSKFSRYWRRWNRFCRRKCRAAVKSNVFYWLVIFLVFLNTLTIASEHYNQPNWLTEVQDTANKALLALFTAEMLLKMYSLGLQAYFVSLFNRFDCFVVCGGILETILVETKIMSPLGISVLRCVRLLRIFKITRYWNSLSNLVASLLNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDEMQTRRSTFDNFPQSLLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYILLNVFLAIAVDNLADAESLTSAQKEEEEEKERKKLARTASPEKKQE---------LVEKPAVGESKEEKIELKSITADGESPPATKINMDDLQPNENEDKSPYPNPETTGEEDEEEPEMPVGPRPRPLSELHLKEKAVPMPEASAFFIFSSNNRFRLQCHRIVNDTIFTNLILFFILLSSISLAAEDPVQHTSFRNHILFYFDIVFTTIFTIEIALKMTAYGAFLHKGSFCRNYFNILDLLVVSVSLISF--------------GIQSSAINVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTTLLQFMFACIGVQLFKGKLYTCSDSSKQTEAECKGNYITYKDGEVDHPIIQPRSWENSKFDFDNVLAAMMALFTVSTFEGWPELLYRSIDSHTEDKGPIYNYRVEISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEQEYKNCELDKNQRQCVEYALKARPLRRYIPKNQH--QYKVWYVVNSTYFEYLMFVLILLNTICLAMQHY---------------GQSCL-FKIAMNILNMLFTGLFTVEMILKLIAFKPKGYFSDPWNVFDFLIVIGSIIDVILSETNPAEHTQCSPSMNAEENSRISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQVFGKIALNDTTEINRNNNFQTFPQAVLLLFRCATGEAWQDIMLACMPGKKCAPESEPSNSTEGETPCGSSFAVFYFISFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVSMNMPLNSDGTVMFNATLFALVRTALRIK--TEGNLEQANEELRAIIKKIWKRTSMKLLDQVVPPAGD---DEVTVGKFYATFLIQEYFRKFKKRKEQGLVGKPSQRNALSLQAGLRTLHDIGPEIRRAISGDLTAE 1676          
BLAST of Voltage dependent L type calcium channel subunit vs. Ensembl Human
Match: CACNA1C (calcium voltage-gated channel subunit alpha1 C [Source:HGNC Symbol;Acc:HGNC:1390])

HSP 1 Score: 1230.31 bits (3182), Expect = 0.000e+0
Identity = 767/1688 (45.44%), Postives = 1042/1688 (61.73%), Query Frame = 2
Query:  599 VMSIDDGSKTTSMRSLAKRTINLSFPGMQTSTS-----KSLFIFSEENVIRKYAKIIIEWGPFEYMVLLTILANCIVLSMERHLPKKDKTLLAGQLELTEKYFLGIFCVEALLKIVALGFCCHKEAYLRNVWNIMDFVVVVTGFLMMFLNIDNHSDSSTV--------DLRTLRAVRVLRPLKLVAGFPSLQVVLKSIIRAMAPLLQIGLLVLFAITIFAIIGLEFYSGAFHYTCFKANSDKLPLPIPTEKSLVPCSNSKNGSGLGAYTCPEDYQCKAYWEGPNYGITSFDNIGYAMLTVFQCITMEGWTDIMYHTNDAIGNRFNWLYFVPLIILGSFFMLNLVLGVLSGXXXXXXXXXXXXXXXLKLRRQQQTEKEFNGYMEWIQKAEEV-LLNEATTTSEDKMRIIAARRRAEKQKYKLLGKNQSIPDFEYEDTELYSETKSMKGNIFIRSYAGIR---RRRKERCTSFWRTEKHF-RFSVRRLVKSQPFYWAVIILVFFNTVCVAIEHYEQGKWLTLFLNYAEYVFLCLFMMEMMIKMYGLSIRVYFQSSFNIFDCVVIAGSLFEIIYGIFVQDSSFGLSVLRALRLLRIFKVTRYWAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMQLFGGEFNFEEGKPPQN-FDTFVKALLTVFQILTGEDWNTVMYNGIQSKGGVKERGTVFSIYFVLLVVFGNYTLLNVFLAIAVDNLANXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSSDNFIGRLPLSIDPPMVQVCPPSPQTANSLISKNFSFDHNQVEVNDKGCLLNTNK-PNGKLGMLGHDNTNFNSLESDPVPNKIEPETIQRK--PVLPYSAMFIFSPLNSLRRFCHFVVNLRYFDLFIMIVICASSIALAAEDPVKEKSLKNNILEFFDYAFTGVFTVEMILKIIDLGIILHPGSYCRDLWNILDATVVICALVAFIMGQKPSPTGNKLRGSSAKNLNTIKSLRVLRVLRPLKTINRVPKLKAVFDCVVSSLKNVFNILIVYILFQFIFAVIAVQLFQGKFFYCNDASKSSRETCRGYFFDYAGRST--PETKKRLWQHHDFHFDNILYAMLTLFTVTTGEGWPTVLKNSMESTNIDNGPIADYRQEMAXXXXXXXXXXXXXXXXXXXALIIITFQEQGENELIDLDLDKNQKQCIDFAINEKPLCRYMPKDKTTIKYRVWRLVVSTPFEYFIMVMIALNTLILMMKYYREEKKASSAATHDREQQAYLNYCNTLIFLNSAFTVMFSIECVLKIMAFGPKNYFRDPWNIFDFITVIGSITDVLVSE--------------LQDXXXXXXXXXXXXXXXXXXXXXXQGYTIRILLWTFIQSFKALPYVCLLIAMLFFIYSIIGMQVFGNIKLISEYQINRHNNFQTFTNGLLLLFRCATGESWQEIMLACDNNKPCEKDIENTNNFD----CGSNFTYIYFVSFIFLCSFLMLNLFVAVIMDNFDYLTRDSSILGPHHLDEYIRVWAEYDPGAIGRIHHSEMYEMLRNMEPPVGFGKKCPYRLAYRKLIRMNMPVDENGTVNFTTTLFALIRESLNIKMSTAEYMDIKDMELRQTICKMWPVQAKKKLNLIVPPDSELVFHKMTVGKIYAGYLIVENWRAYKNSQEQG----PRSSPAVSIKSVTK------PVVKEEKSANLLAK 5506
            +M     +  +++ S  ++      P  Q ST+     ++L   + +N IR+    I+EW PFE ++LLTI ANC+ L++    P+ D       LE  E  FL IF VEA LK++A G   H  AYLRN WN++DF++VV G     L     +D +          D++ LRA RVLRPL+LV+G PSLQVVL SII+AM PLL I LLVLF I I+AIIGLE + G  H TC+  N + +   +P E    PC+  + G G     C     CK  W+GP +GIT+FDN  +AMLTVFQCITMEGWTD++Y  NDA+G  + W+YFV LII+GSFF+LNLVLGVLSGEF+KERE+ + R  F KLR +QQ E++  GY++WI +AE++   NE     E+K R                  N S+P  E E       T+++ G        G R   R  K + + +WR    F R   R  VKS  FYW VI LVF NT+ +A EHY Q  WLT   + A    L LF  EM++KMY L ++ YF S FN FDC V+ G + E I       S  G+SVLR +RLLRIFK+TRYW SL NLV SLLNS+RSI SLL LLFLFI+IF+LLGMQLFGG+FNF+E +  ++ FD F ++LLTVFQILTGEDWN+VMY+GI + GG    G +  IYF++L + GNY LLNVFLAIAVDNLA+A+ LT+A++E+  E +R   A     E+K            ++ P V           S+ +   S    ++ ++D     N +K P       G ++     +   P P  +    ++ K  P+   SA FIFS  N  R  CH +VN   F   I+  I  SSI+LAAEDPV+  S +N+IL +FD  FT +FT+E+ LK+   G  LH GS+CR+ +NILD  VV  +L++F              G  +  +N +K LRVLRVLRPL+ INR   LK V  CV  +++ + NI+IV  L QF+FA I VQLF+GK + C+D+SK +   C+G +  Y       P  + R W++  F FDN+L AM+ LFTV+T EGWP +L  S++S   D GPI +YR E++IF+I++ I+  FF +NIFV  +I+TFQEQGE E  + +LDKNQ+QC+++A+  +PL RY+PK++   +Y+VW +V ST FEY + V+I LNT+ L M++Y                Q+ L +   +  LN  FT +F++E +LK++AF PK YF DPWN+FDF+ VIGSI DV++SE               +++S +S+ F RLFR  RL+KLL +G  IR LLWTFI+SF+ALPYV LLI MLFFIY++IGMQVFG I L    +INR+NNFQTF   +LLLFRCATGE+WQ+IMLAC   K C  + E +N+ +    CGS+F   YF+SF  LC+FL++NLFVAVIMDNFDYLTRD SILGPHHLDE+ R+WAEYDP A GRI H ++  +LR ++PP+GFGK CP+R+A ++L+ MNMP++ +GTV F  TLFAL+R +L IK  T   ++  + ELR  I K+W   + K L+ +VPP  +    ++TVGK YA +LI E +R +K  +EQG    P    A+S+++  +      P ++   S +L A+
Sbjct:   64 LMGSAGNATISTVSSTQRKRQQYGKPKKQGSTTATRPPRALLCLTLKNPIRRACISIVEWKPFEIIILLTIFANCVALAIYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIAYGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKADGANALGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFMGKMHKTCY--NQEGIA-DVPAEDDPSPCA-LETGHG---RQCQNGTVCKPGWDGPKHGITNFDNFAFAMLTVFQCITMEGWTDVLYWVNDAVGRDWPWIYFVTLIIIGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPENEDEGMDEEKPR------------------NMSMPTSETESV----NTENVAGGDIEGENCGARLAHRISKSKFSRYWRRWNRFCRRKCRAAVKSNVFYWLVIFLVFLNTLTIASEHYNQPNWLTEVQDTANKALLALFTAEMLLKMYSLGLQAYFVSLFNRFDCFVVCGGILETILVETKIMSPLGISVLRCVRLLRIFKITRYWNSLSNLVASLLNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDEMQTRRSTFDNFPQSLLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYILLNVFLAIAVDNLADAESLTSAQKEEEEEKERKKLARTASPEKKQE---------LVEKPAVGESKEEKIELKSITADGESPPATKINMDDLQPNENEDKSPYPNPETTGEEDEEEPEMPVGPRPRPLSELHLKEKAVPMPEASAFFIFSSNNRFRLQCHRIVNDTIFTNLILFFILLSSISLAAEDPVQHTSFRNHILFYFDIVFTTIFTIEIALKMTAYGAFLHKGSFCRNYFNILDLLVVSVSLISF--------------GIQSSAINVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTTLLQFMFACIGVQLFKGKLYTCSDSSKQTEAECKGNYITYKDGEVDHPIIQPRSWENSKFDFDNVLAAMMALFTVSTFEGWPELLYRSIDSHTEDKGPIYNYRVEISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEQEYKNCELDKNQRQCVEYALKARPLRRYIPKNQH--QYKVWYVVNSTYFEYLMFVLILLNTICLAMQHY---------------GQSCL-FKIAMNILNMLFTGLFTVEMILKLIAFKPKGYFSDPWNVFDFLIVIGSIIDVILSETNPAEHTQCSPSMNAEENSRISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQVFGKIALNDTTEINRNNNFQTFPQAVLLLFRCATGEAWQDIMLACMPGKKCAPESEPSNSTEGETPCGSSFAVFYFISFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVSMNMPLNSDGTVMFNATLFALVRTALRIK--TEGNLEQANEELRAIIKKIWKRTSMKLLDQVVPPAGD---DEVTVGKFYATFLIQEYFRKFKKRKEQGLVGKPSQRNALSLQAGLRTLHDIGPEIRRAISGDLTAE 1676          
BLAST of Voltage dependent L type calcium channel subunit vs. Ensembl Celegans
Match: unc-2 (High voltage activated calcium channel alpha-1 subunit [Source:UniProtKB/TrEMBL;Acc:Q86G45])

HSP 1 Score: 969.533 bits (2505), Expect = 0.000e+0
Identity = 513/788 (65.10%), Postives = 608/788 (77.16%), Query Frame = 2
Query: 3071 KPVLPYSAMFIFSPLNSLRRFCHFVVNLRYFDLFIMIVICASSIALAAEDPVKEKSLKNNILEFFDYAFTGVFTVEMILKIIDLGIILHPGSYCRDLWNILDATVVICALVAFIMGQKPSPTGNKLRGSSAKNLNTIKSLRVLRVLRPLKTINRVPKLKAVFDCVVSSLKNVFNILIVYILFQFIFAVIAVQLFQGKFFYCNDASKSSRETCRGYFFDYAGRS-TPETKKRLWQHHDFHFDNILYAMLTLFTVTTGEGWPTVLKNSMESTNIDNGPIADYRQEMAXXXXXXXXXXXXXXXXXXXALIIITFQEQGENELIDLDLDKNQKQCIDFAINEKPLCRYMPKDKTTIKYRVWRLVVSTPFEYFIMVMIALNTLILMMKYYREEKKASSAATHDREQQAYLNYCNTLIFLNSAFTVMFSIECVLKIMAFGPKNYFRDPWNIFDFITVIGSITDVLVSELQDXXXXXXXXXXXXXXXXXXXXXXQGYTIRILLWTFIQSFKALPYVCLLIAMLFFIYSIIGMQVFGNIKLISEYQINRHNNFQTFTNGLLLLFRCATGESWQEIMLACDNNKPCEKDIENTNNFD----CGSNFTYIYFVSFIFLCSFLMLNLFVAVIMDNFDYLTRDSSILGPHHLDEYIRVWAEYDPGAIGRIHHSEMYEMLRNMEPPVGFGKKCPYRLAYRKLIRMNMPVDENGTVNFTTTLFALIRESLNIKMSTAEYMDIKDMELRQTICKMWPVQAKKKL-NLIVPPDSELVFHKMTVGKIYAGYLIVENWRAYKNSQE 5416
            KP++PYS+MF  SP N  R   H +V  +YF++ +M VIC SS++LAAEDPV E++ +N +L++ DY FTGVF  EM+LK+ID GI+LHPGSYCRD WNILD  VV CAL AF              GS+ KNLNTIKSLRVLRVLRPLKTI R+PKLKAVFDCVV+SLKNVFNILIVY LFQFIFAVIAVQLF GKFF+C D ++    TC G FF Y  ++  P  ++R W+   F++DN + AMLTLF VTTGEGWP + +NSM++T  D GP   +R E+A+FY++FFIVFPFFFVNIFVALIIITFQEQGE EL + DLDKNQKQCIDFA+N +P   +MP+DK + KYR+WRLV S PFEYFIM MI  NTLILMMKYY                   L Y   L   N+A T +F++E +LKI+AFG +NYFRD WN FDF+TV+GSITD LV+E     F+SLGFLRLFRAARLI+LL+QGYTIRILLWTF+QSFKALPYVCLLI MLFFIY+I+GMQVFGNI L +  +INRHNNFQ+F N ++LLFRCATGE WQ+IM+A    K C +      NF+    CGSN +Y YF SF+FL SFLMLNLFVAVIMDNFDYLTRDSSILGPHHLDE+IRVWA+YDP A GRIH+SEMYEMLR M PPVGFGKKCPYRLAY+ LIRMNMPV E+GTV+FTTTLFALIRESL+IKM   E MD  D ELR T+ K+WP++AKK + +L+VPP+ EL F K+TVGKIYAG LI+EN+RA K+  E
Sbjct:  970 KPMVPYSSMFFLSPTNPFRVLIHSIVCTKYFEMMVMTVICLSSVSLAAEDPVDEENPRNKVLQYMDYCFTGVFACEMLLKLIDQGILLHPGSYCRDFWNILDGIVVTCALFAFGFA--------GTEGSAGKNLNTIKSLRVLRVLRPLKTIKRIPKLKAVFDCVVNSLKNVFNILIVYFLFQFIFAVIAVQLFNGKFFFCTDKNRKFANTCHGQFFVYDNQNDPPRVEQREWRLRPFNYDNTINAMLTLFVVTTGEGWPGIRQNSMDTTFEDQGPSPFFRVEVALFYVMFFIVFPFFFVNIFVALIIITFQEQGEAELSEGDLDKNQKQCIDFALNARPRSLFMPEDKNSTKYRIWRLVTSPPFEYFIMTMICCNTLILMMKYYNNP----------------LFYEEILRLFNTALTAVFTVESILKILAFGVRNYFRDGWNRFDFVTVVGSITDALVTEF-GGHFVSLGFLRLFRAARLIRLLQQGYTIRILLWTFVQSFKALPYVCLLIGMLFFIYAIVGMQVFGNIWLNAATEINRHNNFQSFFNAVILLFRCATGEGWQDIMMAAVQGKDCARAGSAEINFEKGQTCGSNVSYAYFTSFVFLSSFLMLNLFVAVIMDNFDYLTRDSSILGPHHLDEFIRVWADYDPAATGRIHYSEMYEMLRIMAPPVGFGKKCPYRLAYKHLIRMNMPVAEDGTVHFTTTLFALIRESLSIKMRPVEEMDEADEELRLTLKKIWPLKAKKNMVDLVVPPNHELCFQKLTVGKIYAGLLILENYRARKSGTE 1732          

HSP 2 Score: 706.827 bits (1823), Expect = 0.000e+0
Identity = 427/704 (60.65%), Postives = 517/704 (73.44%), Query Frame = 2
Query:  623 KTTSMRSLAKRTINLSFPGMQTSTSKSLFIFSEENVIRKYAKIIIEWGPFEYMVLLTILANCIVLSMERHLPKKDKTLLAGQLELTEKYFLGIFCVEALLKIVALGFCCHKEAYLRNVWNIMDFVVVVTGFLMMF----LNIDNHSDSSTVDLRTLRAVRVLRPLKLVAGFPSLQVVLKSIIRAMAPLLQIGLLVLFAITIFAIIGLEFYSGAFHYTCFKANSDKLPLPIPTEKSLVPCSNSKNGSGLGAYTCP-EDYQCKAYWEGPNYGITSFDNIGYAMLTVFQCITMEGWTDIMYHTNDAIGNRFNWLYFVPLIILGSFFMLNLVLGVLSGXXXXXXXXXXXXXXXLKLRRQQQTEKEFNGYMEWIQKAEEVLLNEATTTSEDKMRIIAARRRAEKQKYKLLGKNQSI--PDFEYEDTELYSETKSMKGNIFIRSYAGIRRRRKERCTSFWRTEKHFRFSVRRLVKSQPFYWAVIILVFFNTVCVAIEHYEQGKWLTLFLNYAEYVFLCLFMMEMMIKMYGLSIRVYFQSSFNIFDCVVIAGSLFEIIYGIFVQDSSFGLSVLRALRLLRIFKVTRYWAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMQLFGGEFNFEEGKPPQNFDTFVKALLTVFQILTGEDWNTVMYNGIQSKGGVKERGTVFSIYFVLLVVFGNYTLLNVFLAIAVDNLAN 2713
            K  S   + K T++ + P  +   S SLFIF+E+N+IR+ AK IIEWGPFEY +LLTI+ NC+VLSME+HLPK DK  L+  LE TE YF+GIFC+E +LK++A GF  HK +YLR+ WNIMDF+VVV+G + M          +    +VDLRTLRAVRVLRPLKLV+G PSLQVVLKSI+ AMAPLLQIGLLVLFAI IFAIIGLEFYSGAFH  C+    +   +   +E+ + PC+N    S +G Y C  +   C   W GPNYGITSFDNIG+AM+TVFQCITMEGWT +MY+TND++G+ +NW YF+PLI+LGSFFMLNLVLGVLSGEFAKERERVE RR FLKLRRQQQ E+E NGY+EWI  AEEV+L E  TT E+K  I+ ARRRA  +K K   K QS    +   ED +   E    +G      +A   R+++  C S  +  K  R  +R +VK+Q FYW+VI LVF NT CVA EHY Q +W T FL YAE+VFL +F++EM++K++ +  R YF S FN FDCVVI GS  E+I+   V   SFG+SV+RALRLLRIFK+T YW SLRNLV SL+NSMRSIISLLFLLFLFILIFALLGMQLFGG FNF    P  +FDTF  AL+TVFQILTGEDWN VMY  I+S+GG+   G  +SIYF++LV+FGNYTLLNVFLAIAVDNLAN
Sbjct:  206 KAESGTFVRKTTLSSNAPVKEKGPS-SLFIFAEDNIIRRNAKAIIEWGPFEYFILLTIIGNCVVLSMEQHLPKNDKKALSEWLERTEPYFMGIFCLECVLKVIAFGFALHKGSYLRSGWNIMDFIVVVSGVVTMLPFSPATQTANQPVDSVDLRTLRAVRVLRPLKLVSGIPSLQVVLKSILCAMAPLLQIGLLVLFAIIIFAIIGLEFYSGAFHSACYNERGE---IENVSERPM-PCTNKT--SPMGVYNCDVKGTTCLQKWIGPNYGITSFDNIGFAMITVFQCITMEGWTTVMYYTNDSLGSTYNWAYFIPLIVLGSFFMLNLVLGVLSGEFAKERERVENRREFLKLRRQQQIERELNGYLEWILTAEEVILKEDRTTEEEKAAIMEARRRAANKKLKQASKQQSTETEEDFEEDEDEMEEEYVDEGGTVEDEFA--ERKKRGCCHSVGKFIKQLRIQIRIMVKTQIFYWSVITLVFLNTCCVASEHYGQPQWFTDFLKYAEFVFLGIFVVEMLLKLFAMGSRTYFASKFNRFDCVVIVGSAAEVIWAE-VYGGSFGISVMRALRLLRIFKLTSYWVSLRNLVRSLMNSMRSIISLLFLLFLFILIFALLGMQLFGGRFNFPTMHPYTHFDTFPVALITVFQILTGEDWNEVMYLAIESQGGIYSGGWPYSIYFIVLVLFGNYTLLNVFLAIAVDNLAN 899          

HSP 3 Score: 116.316 bits (290), Expect = 2.442e-25
Identity = 82/278 (29.50%), Postives = 137/278 (49.28%), Query Frame = 2
Query: 3089 SAMFIFSPLNSLRRFCHFVVNLRYFDLFIMIVICASSIALAAED--PVKEKSLKNNILEFFDYAFTGVFTVEMILKIIDLGIILHPGSYCRDLWNILDATVVICALVAFIMGQKPSPTGNKLRGSSAKNLNTIKSLRVLRVLRPLKTINRVPKLKAVFDCVVSSLKNVFNILIVYILFQFIFAVIAVQLFQGKFFYCNDASKSSRETCRGYFFDYAGRSTPETKK-----------------RLWQHHDF---HFDNILYAMLTLFTVTTGEGWPTVL 3856
            S++FIF+  N +RR    ++    F+ FI++ I  + + L+ E   P  +K   +  LE  +  F G+F +E +LK+I  G  LH GSY R  WNI+D  VV+  +V  +     + T N+   S       +++LR +RVLRPLK ++ +P L+ V   ++ ++  +  I ++ +    IFA+I ++ + G F        S+    RG   + + R  P T K                 + W   ++    FDNI +AM+T+F   T EGW TV+
Sbjct:  230 SSLFIFAEDNIIRRNAKAIIEWGPFEYFILLTIIGNCVVLSMEQHLPKNDKKALSEWLERTEPYFMGIFCLECVLKVIAFGFALHKGSYLRSGWNIMDFIVVVSGVVTMLPFSPATQTANQPVDSV-----DLRTLRAVRVLRPLKLVSGIPSLQVVLKSILCAMAPLLQIGLLVLFAIIIFAIIGLEFYSGAF-------HSACYNERGEIENVSERPMPCTNKTSPMGVYNCDVKGTTCLQKWIGPNYGITSFDNIGFAMITVFQCITMEGWTTVM 495          

HSP 4 Score: 93.2041 bits (230), Expect = 2.343e-18
Identity = 73/274 (26.64%), Postives = 120/274 (43.80%), Query Frame = 2
Query:  701 SLFIFSEENVIRKYAKIIIEWGPFEYMVLLTILANCIVLSMERHLPKKDKTLLAGQLELTEKYFLGIFCVEALLKIVALGFCCHKEAYLRNVWNIMDFVVVVTG-FLMMFLNIDNHSDSSTVDLRTLRAVRVLRPLKLVAGFPSLQVVLKSIIRAMAPLLQIGLLVLFAITIFAIIGLEFYSGAFHYTCFKANSDKLPLPIPTEKSLVPCSNSKNGSGLGAYTCPEDYQCKAYWEGPNYGITSF--DNIGYAMLTVFQCITMEGWTDIMYHTND 1513
            S+F  S  N  R     I+    FE MV+  I  + + L+ E   P  ++      L+  +  F G+F  E LLK++  G   H  +Y R+ WNI+D +VV    F   F   +  +  +   +++LR +RVLRPLK +   P L+ V   ++ ++  +  I ++      IFA+I ++ ++G F + C   N           K    C         G +   ++       E   + +  F  DN   AMLT+F   T EGW  I  ++ D
Sbjct:  977 SMFFLSPTNPFRVLIHSIVCTKYFEMMVMTVICLSSVSLAAED--PVDEENPRNKVLQYMDYCFTGVFACEMLLKLIDQGILLHPGSYCRDFWNILDGIVVTCALFAFGFAGTEGSAGKNLNTIKSLRVLRVLRPLKTIKRIPKLKAVFDCVVNSLKNVFNILIVYFLFQFIFAVIAVQLFNGKFFF-CTDKN----------RKFANTCH--------GQFFVYDNQNDPPRVEQREWRLRPFNYDNTINAMLTLFVVTTGEGWPGIRQNSMD 1229          

HSP 5 Score: 77.0258 bits (188), Expect = 1.888e-13
Identity = 71/320 (22.19%), Postives = 126/320 (39.38%), Query Frame = 2
Query:  698 KSLFIFSEENVIRKYAKIIIEWGPFEYMVLLTILANCIVLSMERHLPKKDKTLLAGQLELTEKYFLGIFCVEALLKIVALGFCCHKEAYLRNVWNIMDFVVVVTGFLMMFLNIDNHSDSSTVDLRTLRAVRVLRPLKLVAGFPSLQVVLKSIIRAMAPLLQIGLLVLFAITIFAIIGLEFYSGAFHYTCFKANSDKLPLPIPTEKSLVPCSNSKNGSGLGAYTCPEDYQCKAYWEGPNYGITSFDNIGYAMLTVFQCITMEGWTDIM------------------YHTNDAIGNRFNWLYFVPLIILGSFFMLNLVLGVL 1603
            +SLF+  ++N  +     ++   PFEY ++  I  N ++L M+ +    +       L L       +F VE++LKI+A G       Y R+ WN  DFV VV       +        S   LR  RA R++R L+   G+ +++++L + +++   L  + LL+     I+AI+G++ +   +     + N                                                 +F +   A++ +F+C T EGW DIM                  +      G+  ++ YF   + L SF MLNL + V+
Sbjct: 1302 RSLFMPEDKNSTKYRIWRLVTSPPFEYFIMTMICCNTLILMMKYY---NNPLFYEEILRLFNTALTAVFTVESILKILAFGV----RNYFRDGWNRFDFVTVVGSITDALVTEFGGHFVSLGFLRLFRAARLIRLLQ--QGY-TIRILLWTFVQSFKALPYVCLLIGMLFFIYAIVGMQVFGNIWLNAATEINRHN----------------------------------------------NFQSFFNAVILLFRCATGEGWQDIMMAAVQGKDCARAGSAEINFEKGQTCGSNVSYAYFTSFVFLSSFLMLNLFVAVI 1565          

HSP 6 Score: 75.0998 bits (183), Expect = 6.944e-13
Identity = 66/261 (25.29%), Postives = 128/261 (49.04%), Query Frame = 2
Query: 1982 RFSVRRLVKSQPFYWAVIILVFFNTVCVAIEHYEQGKWLTLFLNYAEYVFLCLFMMEMMIKMYGLSIRVYFQSSFNIFDCVVIAGSLFEIIY----GIFVQDSSFGLSVLRALRLLRIFKVTRYWAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMQLFGGEF--NFEEGKPPQNFDTFVKALLTVFQILTGEDWNTVMYNGIQSKGGVK--------ERG-----TVFSIYFVLLVVFGNYTLLNVFLAIAVDNL 2707
            ++ + RLV S PF + ++ ++  NT+ + +++Y    +    L         +F +E ++K+    +R YF+  +N FD V + GS+ + +     G FV      L  LR  R  R+ ++ +   ++R L+ + + S +++  +  L+ +   I+A++GMQ+FG  +     E     NF +F  A++ +F+  TGE W  +M   +Q K   +        E+G      V   YF   V   ++ +LN+F+A+ +DN 
Sbjct: 1314 KYRIWRLVTSPPFEYFIMTMICCNTLILMMKYYNNPLFYEEILRLFNTALTAVFTVESILKILAFGVRNYFRDGWNRFDFVTVVGSITDALVTEFGGHFV-----SLGFLRLFRAARLIRLLQQGYTIRILLWTFVQSFKALPYVCLLIGMLFFIYAIVGMQVFGNIWLNAATEINRHNNFQSFFNAVILLFRCATGEGWQDIMMAAVQGKDCARAGSAEINFEKGQTCGSNVSYAYFTSFVFLSSFLMLNLFVAVIMDNF 1569          

HSP 7 Score: 67.781 bits (164), Expect = 1.315e-10
Identity = 65/283 (22.97%), Postives = 130/283 (45.94%), Query Frame = 2
Query: 4091 CRYMPKDKTTIKYRVWRLVVSTPFEYFIMVMIALNTLILMMKYYREEKKASSAATHDREQQAYLNYCNTLIFLNSAFTVMFSIECVLKIMAFGPKNYFRDPWNIFDFITVIGSITDVLVSELQDXXXXXXXXXXXXXXXXXXXXXXQGYTIRILLWTFIQSFKALPYVCLLIAMLFFIYSIIGMQVFG---NIKLISEYQINRHNNFQTFTNGLLLLFRCATGESWQEIMLACDNNKPCEKDIENTNNFDCGSNFTYIYFVSFIFLCSFLMLNLFVAVIMDNF 4930
            C  + K    ++ ++  +V +  F + ++ ++ LNT  +  ++Y + +  +           +L Y    +FL      +F +E +LK+ A G + YF   +N FD + ++GS  +V+ +E+   SF       L              ++R L+ + + S +++  +  L+ +   I++++GMQ+FG   N   +  Y      +F TF   L+ +F+  TGE W E+M            IE+      G     IYF+  +   ++ +LN+F+A+ +DN 
Sbjct:  646 CHSVGKFIKQLRIQIRIMVKTQIFYWSVITLVFLNTCCVASEHYGQPQWFTD----------FLKYAE-FVFLG-----IFVVEMLLKLFAMGSRTYFASKFNRFDCVVIVGSAAEVIWAEVYGGSFGISVMRALRLLRIFKLTSYW-VSLRNLVRSLMNSMRSIISLLFLLFLFILIFALLGMQLFGGRFNFPTMHPY-----THFDTFPVALITVFQILTGEDWNEVMYLA---------IESQGGIYSGGWPYSIYFIVLVLFGNYTLLNVFLAIAVDNL 897          

HSP 8 Score: 55.4546 bits (132), Expect = 6.479e-7
Identity = 35/102 (34.31%), Postives = 51/102 (50.00%), Query Frame = 2
Query: 4157 PFEYFIMVMIALNTLILMMKYY--REEKKASSAATHDREQQAYLNYCNTLIFLNSAFTVMFSIECVLKIMAFG----PKNYFRDPWNIFDFITVIGSITDVL 4444
            PFEYFI++ I  N ++L M+ +  + +KKA S      E                 F  +F +ECVLK++AFG      +Y R  WNI DFI V+  +  +L
Sbjct:  253 PFEYFILLTIIGNCVVLSMEQHLPKNDKKALSEWLERTE---------------PYFMGIFCLECVLKVIAFGFALHKGSYLRSGWNIMDFIVVVSGVVTML 339          
BLAST of Voltage dependent L type calcium channel subunit vs. Ensembl Celegans
Match: unc-2 (High voltage activated calcium channel alpha-1 subunit [Source:UniProtKB/TrEMBL;Acc:Q86G45])

HSP 1 Score: 969.533 bits (2505), Expect = 0.000e+0
Identity = 552/996 (55.42%), Postives = 673/996 (67.57%), Query Frame = 2
Query: 3071 KPVLPYSAMFIFSPLNSLRRFCHFVVNLRYFDLFIMIVICASSIALAAEDPVKEKSLKNNILEFFDYAFTGVFTVEMILKIIDLGIILHPGSYCRDLWNILDATVVICALVAFIMGQKPSPTGNKLRGSSAKNLNTIKSLRVLRVLRPLKTINRVPKLKAVFDCVVSSLKNVFNILIVYILFQFIFAVIAVQLFQGKFFYCNDASKSSRETCRGYFFDYAGRS-TPETKKRLWQHHDFHFDNILYAMLTLFTVTTGEGWPTVLKNSMESTNIDNGPIADYRQEMAXXXXXXXXXXXXXXXXXXXALIIITFQEQGENELIDLDLDKNQKQCIDFAINEKPLCRYMPKDKTTIKYRVWRLVVSTPFEYFIMVMIALNTLILMMKYYREEKKASSAATHDREQQAYLNYCNTLIFLNSAFTVMFSIECVLKIMAFGPKNYFRDPWNIFDFITVIGSITDVLVSELQDXXXXXXXXXXXXXXXXXXXXXXQGYTIRILLWTFIQSFKALPYVCLLIAMLFFIYSIIGMQVFGNIKLISEYQINRHNNFQTFTNGLLLLFRCATGESWQEIMLACDNNKPCEKDIENTNNFD----CGSNFTYIYFVSFIFLCSFLMLNLFVAVIMDNFDYLTRDSSILGPHHLDEYIRVWAEYDPGAIGRIHHSEMYEMLRNMEPPVGFGKKCPYRLAYRKLIRMNMPVDENGTVNFTTTLFALIRESLNIKMSTAEYMDIKDMELRQTICKMWPVQAKKKL-NLIVPPDSELVFHKMTVGKIYAGYLIVENWRAYKNSQE---------------------QGPRSSPAVSIKSVTKPVVKE----------------------------EKSANLLAKFFVAFKSNTNKSNI------SLDSHHE-------RDEERFS-IDHTYGEDYDANRRYSYLRRGSKPRGSKEIYSDLTPTQDYSYGLRPEHATI----PGMPAPRKFGNRPR----SPMYSLSELETKDR 5827
            KP++PYS+MF  SP N  R   H +V  +YF++ +M VIC SS++LAAEDPV E++ +N +L++ DY FTGVF  EM+LK+ID GI+LHPGSYCRD WNILD  VV CAL AF              GS+ KNLNTIKSLRVLRVLRPLKTI R+PKLKAVFDCVV+SLKNVFNILIVY LFQFIFAVIAVQLF GKFF+C D ++    TC G FF Y  ++  P  ++R W+   F++DN + AMLTLF VTTGEGWP + +NSM++T  D GP   +R E+A+FY++FFIVFPFFFVNIFVALIIITFQEQGE EL + DLDKNQKQCIDFA+N +P   +MP+DK + KYR+WRLV S PFEYFIM MI  NTLILMMKYY                   L Y   L   N+A T +F++E +LKI+AFG +NYFRD WN FDF+TV+GSITD LV+E     F+SLGFLRLFRAARLI+LL+QGYTIRILLWTF+QSFKALPYVCLLI MLFFIY+I+GMQVFGNI L +  +INRHNNFQ+F N ++LLFRCATGE WQ+IM+A    K C +      NF+    CGSN +Y YF SF+FL SFLMLNLFVAVIMDNFDYLTRDSSILGPHHLDE+IRVWA+YDP A GRIH+SEMYEMLR M PPVGFGKKCPYRLAY+ LIRMNMPV E+GTV+FTTTLFALIRESL+IKM   E MD  D ELR T+ K+WP++AKK + +L+VPP+ EL F K+TVGKIYAG LI+EN+RA K+  E                     +   SS        T P++ +                            ++  +L   F    KS     ++      S+D  HE       R  + FS I      D++ ++ YS+    S+ RGS+   ++    QD      P + ++    P  PA R +G+ PR    SP  S SE +   R
Sbjct:  848 KPMVPYSSMFFLSPTNPFRVLIHSIVCTKYFEMMVMTVICLSSVSLAAEDPVDEENPRNKVLQYMDYCFTGVFACEMLLKLIDQGILLHPGSYCRDFWNILDGIVVTCALFAFGFA--------GTEGSAGKNLNTIKSLRVLRVLRPLKTIKRIPKLKAVFDCVVNSLKNVFNILIVYFLFQFIFAVIAVQLFNGKFFFCTDKNRKFANTCHGQFFVYDNQNDPPRVEQREWRLRPFNYDNTINAMLTLFVVTTGEGWPGIRQNSMDTTFEDQGPSPFFRVEVALFYVMFFIVFPFFFVNIFVALIIITFQEQGEAELSEGDLDKNQKQCIDFALNARPRSLFMPEDKNSTKYRIWRLVTSPPFEYFIMTMICCNTLILMMKYYNNP----------------LFYEEILRLFNTALTAVFTVESILKILAFGVRNYFRDGWNRFDFVTVVGSITDALVTEF-GGHFVSLGFLRLFRAARLIRLLQQGYTIRILLWTFVQSFKALPYVCLLIGMLFFIYAIVGMQVFGNIWLNAATEINRHNNFQSFFNAVILLFRCATGEGWQDIMMAAVQGKDCARAGSAEINFEKGQTCGSNVSYAYFTSFVFLSSFLMLNLFVAVIMDNFDYLTRDSSILGPHHLDEFIRVWADYDPAATGRIHYSEMYEMLRIMAPPVGFGKKCPYRLAYKHLIRMNMPVAEDGTVHFTTTLFALIRESLSIKMRPVEEMDEADEELRLTLKKIWPLKAKKNMVDLVVPPNHELCFQKLTVGKIYAGLLILENYRARKSGTEVGGQGLFGGGLRSLVAAAKAAESQHSSHTPQPPEETTPIIPQHAQQFSAAPTMSAQGSLQQMQGTSSGGGQRPYSLFNSFVDTIKSGKQDGDVTDVQYQSVDQQHEKMNSTGRRLSDMFSKIRRGTSADHNPHQNYSHRFGYSRNRGSRYDETEHLLAQDNRSPSSPRYRSMARASPPSPAER-YGHPPRYRTESPPSSRSEYQMSIR 1817          

HSP 2 Score: 706.442 bits (1822), Expect = 0.000e+0
Identity = 424/702 (60.40%), Postives = 514/702 (73.22%), Query Frame = 2
Query:  623 KTTSMRSLAKRTINLSFPGMQTSTSKSLFIFSEENVIRKYAKIIIEWGPFEYMVLLTILANCIVLSMERHLPKKDKTLLAGQLELTEKYFLGIFCVEALLKIVALGFCCHKEAYLRNVWNIMDFVVVVTGFLMMF----LNIDNHSDSSTVDLRTLRAVRVLRPLKLVAGFPSLQVVLKSIIRAMAPLLQIGLLVLFAITIFAIIGLEFYSGAFHYTCFKANSDKLPLPIPTEKSLVPCSNSKNGSGLGAYTCP-EDYQCKAYWEGPNYGITSFDNIGYAMLTVFQCITMEGWTDIMYHTNDAIGNRFNWLYFVPLIILGSFFMLNLVLGVLSGXXXXXXXXXXXXXXXLKLRRQQQTEKEFNGYMEWIQKAEEVLLNEATTTSEDKMRIIAARRRAEKQKYKLLGKNQSIPDFEYEDTELYSETKSMKGNIFIRSYAGIRRRRKERCTSFWRTEKHFRFSVRRLVKSQPFYWAVIILVFFNTVCVAIEHYEQGKWLTLFLNYAEYVFLCLFMMEMMIKMYGLSIRVYFQSSFNIFDCVVIAGSLFEIIYGIFVQDSSFGLSVLRALRLLRIFKVTRYWAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMQLFGGEFNFEEGKPPQNFDTFVKALLTVFQILTGEDWNTVMYNGIQSKGGVKERGTVFSIYFVLLVVFGNYTLLNVFLAIAVDNLAN 2713
            K  S   + K T++ + P  +   S SLFIF+E+N+IR+ AK IIEWGPFEY +LLTI+ NC+VLSME+HLPK DK  L+  LE TE YF+GIFC+E +LK++A GF  HK +YLR+ WNIMDF+VVV+G + M          +    +VDLRTLRAVRVLRPLKLV+G PSLQVVLKSI+ AMAPLLQIGLLVLFAI IFAIIGLEFYSGAFH  C+    +   +   +E+ + PC+N    S +G Y C  +   C   W GPNYGITSFDNIG+AM+TVFQCITMEGWT +MY+TND++G+ +NW YF+PLI+LGSFFMLNLVLGVLSGEFAKERERVE RR FLKLRRQQQ E+E NGY+EWI  AEEV+L E  TT E+K  I+ ARRRA  +K K   K QS        TE   + +  +  +         R+++  C S  +  K  R  +R +VK+Q FYW+VI LVF NT CVA EHY Q +W T FL YAE+VFL +F++EM++K++ +  R YF S FN FDCVVI GS  E+I+   V   SFG+SV+RALRLLRIFK+T YW SLRNLV SL+NSMRSIISLLFLLFLFILIFALLGMQLFGG FNF    P  +FDTF  AL+TVFQILTGEDWN VMY  I+S+GG+   G  +SIYF++LV+FGNYTLLNVFLAIAVDNLAN
Sbjct:   92 KAESGTFVRKTTLSSNAPVKEKGPS-SLFIFAEDNIIRRNAKAIIEWGPFEYFILLTIIGNCVVLSMEQHLPKNDKKALSEWLERTEPYFMGIFCLECVLKVIAFGFALHKGSYLRSGWNIMDFIVVVSGVVTMLPFSPATQTANQPVDSVDLRTLRAVRVLRPLKLVSGIPSLQVVLKSILCAMAPLLQIGLLVLFAIIIFAIIGLEFYSGAFHSACYNERGE---IENVSERPM-PCTNKT--SPMGVYNCDVKGTTCLQKWIGPNYGITSFDNIGFAMITVFQCITMEGWTTVMYYTNDSLGSTYNWAYFIPLIVLGSFFMLNLVLGVLSGEFAKERERVENRREFLKLRRQQQIERELNGYLEWILTAEEVILKEDRTTEEEKAAIMEARRRAANKKLKQASKQQS--------TETEEDFEEDEDEMEEEYVDEAERKKRGCCHSVGKFIKQLRIQIRIMVKTQIFYWSVITLVFLNTCCVASEHYGQPQWFTDFLKYAEFVFLGIFVVEMLLKLFAMGSRTYFASKFNRFDCVVIVGSAAEVIWAE-VYGGSFGISVMRALRLLRIFKLTSYWVSLRNLVRSLMNSMRSIISLLFLLFLFILIFALLGMQLFGGRFNFPTMHPYTHFDTFPVALITVFQILTGEDWNEVMYLAIESQGGIYSGGWPYSIYFIVLVLFGNYTLLNVFLAIAVDNLAN 777          

HSP 3 Score: 116.316 bits (290), Expect = 2.247e-25
Identity = 82/278 (29.50%), Postives = 137/278 (49.28%), Query Frame = 2
Query: 3089 SAMFIFSPLNSLRRFCHFVVNLRYFDLFIMIVICASSIALAAED--PVKEKSLKNNILEFFDYAFTGVFTVEMILKIIDLGIILHPGSYCRDLWNILDATVVICALVAFIMGQKPSPTGNKLRGSSAKNLNTIKSLRVLRVLRPLKTINRVPKLKAVFDCVVSSLKNVFNILIVYILFQFIFAVIAVQLFQGKFFYCNDASKSSRETCRGYFFDYAGRSTPETKK-----------------RLWQHHDF---HFDNILYAMLTLFTVTTGEGWPTVL 3856
            S++FIF+  N +RR    ++    F+ FI++ I  + + L+ E   P  +K   +  LE  +  F G+F +E +LK+I  G  LH GSY R  WNI+D  VV+  +V  +     + T N+   S       +++LR +RVLRPLK ++ +P L+ V   ++ ++  +  I ++ +    IFA+I ++ + G F        S+    RG   + + R  P T K                 + W   ++    FDNI +AM+T+F   T EGW TV+
Sbjct:  116 SSLFIFAEDNIIRRNAKAIIEWGPFEYFILLTIIGNCVVLSMEQHLPKNDKKALSEWLERTEPYFMGIFCLECVLKVIAFGFALHKGSYLRSGWNIMDFIVVVSGVVTMLPFSPATQTANQPVDSV-----DLRTLRAVRVLRPLKLVSGIPSLQVVLKSILCAMAPLLQIGLLVLFAIIIFAIIGLEFYSGAF-------HSACYNERGEIENVSERPMPCTNKTSPMGVYNCDVKGTTCLQKWIGPNYGITSFDNIGFAMITVFQCITMEGWTTVM 381          

HSP 4 Score: 93.2041 bits (230), Expect = 2.628e-18
Identity = 73/274 (26.64%), Postives = 120/274 (43.80%), Query Frame = 2
Query:  701 SLFIFSEENVIRKYAKIIIEWGPFEYMVLLTILANCIVLSMERHLPKKDKTLLAGQLELTEKYFLGIFCVEALLKIVALGFCCHKEAYLRNVWNIMDFVVVVTG-FLMMFLNIDNHSDSSTVDLRTLRAVRVLRPLKLVAGFPSLQVVLKSIIRAMAPLLQIGLLVLFAITIFAIIGLEFYSGAFHYTCFKANSDKLPLPIPTEKSLVPCSNSKNGSGLGAYTCPEDYQCKAYWEGPNYGITSF--DNIGYAMLTVFQCITMEGWTDIMYHTND 1513
            S+F  S  N  R     I+    FE MV+  I  + + L+ E   P  ++      L+  +  F G+F  E LLK++  G   H  +Y R+ WNI+D +VV    F   F   +  +  +   +++LR +RVLRPLK +   P L+ V   ++ ++  +  I ++      IFA+I ++ ++G F + C   N           K    C         G +   ++       E   + +  F  DN   AMLT+F   T EGW  I  ++ D
Sbjct:  855 SMFFLSPTNPFRVLIHSIVCTKYFEMMVMTVICLSSVSLAAED--PVDEENPRNKVLQYMDYCFTGVFACEMLLKLIDQGILLHPGSYCRDFWNILDGIVVTCALFAFGFAGTEGSAGKNLNTIKSLRVLRVLRPLKTIKRIPKLKAVFDCVVNSLKNVFNILIVYFLFQFIFAVIAVQLFNGKFFF-CTDKN----------RKFANTCH--------GQFFVYDNQNDPPRVEQREWRLRPFNYDNTINAMLTLFVVTTGEGWPGIRQNSMD 1107          

HSP 5 Score: 77.0258 bits (188), Expect = 2.122e-13
Identity = 71/320 (22.19%), Postives = 126/320 (39.38%), Query Frame = 2
Query:  698 KSLFIFSEENVIRKYAKIIIEWGPFEYMVLLTILANCIVLSMERHLPKKDKTLLAGQLELTEKYFLGIFCVEALLKIVALGFCCHKEAYLRNVWNIMDFVVVVTGFLMMFLNIDNHSDSSTVDLRTLRAVRVLRPLKLVAGFPSLQVVLKSIIRAMAPLLQIGLLVLFAITIFAIIGLEFYSGAFHYTCFKANSDKLPLPIPTEKSLVPCSNSKNGSGLGAYTCPEDYQCKAYWEGPNYGITSFDNIGYAMLTVFQCITMEGWTDIM------------------YHTNDAIGNRFNWLYFVPLIILGSFFMLNLVLGVL 1603
            +SLF+  ++N  +     ++   PFEY ++  I  N ++L M+ +    +       L L       +F VE++LKI+A G       Y R+ WN  DFV VV       +        S   LR  RA R++R L+   G+ +++++L + +++   L  + LL+     I+AI+G++ +   +     + N                                                 +F +   A++ +F+C T EGW DIM                  +      G+  ++ YF   + L SF MLNL + V+
Sbjct: 1180 RSLFMPEDKNSTKYRIWRLVTSPPFEYFIMTMICCNTLILMMKYY---NNPLFYEEILRLFNTALTAVFTVESILKILAFGV----RNYFRDGWNRFDFVTVVGSITDALVTEFGGHFVSLGFLRLFRAARLIRLLQ--QGY-TIRILLWTFVQSFKALPYVCLLIGMLFFIYAIVGMQVFGNIWLNAATEINRHN----------------------------------------------NFQSFFNAVILLFRCATGEGWQDIMMAAVQGKDCARAGSAEINFEKGQTCGSNVSYAYFTSFVFLSSFLMLNLFVAVI 1443          

HSP 6 Score: 75.0998 bits (183), Expect = 7.744e-13
Identity = 66/261 (25.29%), Postives = 128/261 (49.04%), Query Frame = 2
Query: 1982 RFSVRRLVKSQPFYWAVIILVFFNTVCVAIEHYEQGKWLTLFLNYAEYVFLCLFMMEMMIKMYGLSIRVYFQSSFNIFDCVVIAGSLFEIIY----GIFVQDSSFGLSVLRALRLLRIFKVTRYWAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMQLFGGEF--NFEEGKPPQNFDTFVKALLTVFQILTGEDWNTVMYNGIQSKGGVK--------ERG-----TVFSIYFVLLVVFGNYTLLNVFLAIAVDNL 2707
            ++ + RLV S PF + ++ ++  NT+ + +++Y    +    L         +F +E ++K+    +R YF+  +N FD V + GS+ + +     G FV      L  LR  R  R+ ++ +   ++R L+ + + S +++  +  L+ +   I+A++GMQ+FG  +     E     NF +F  A++ +F+  TGE W  +M   +Q K   +        E+G      V   YF   V   ++ +LN+F+A+ +DN 
Sbjct: 1192 KYRIWRLVTSPPFEYFIMTMICCNTLILMMKYYNNPLFYEEILRLFNTALTAVFTVESILKILAFGVRNYFRDGWNRFDFVTVVGSITDALVTEFGGHFV-----SLGFLRLFRAARLIRLLQQGYTIRILLWTFVQSFKALPYVCLLIGMLFFIYAIVGMQVFGNIWLNAATEINRHNNFQSFFNAVILLFRCATGEGWQDIMMAAVQGKDCARAGSAEINFEKGQTCGSNVSYAYFTSFVFLSSFLMLNLFVAVIMDNF 1447          

HSP 7 Score: 67.781 bits (164), Expect = 1.210e-10
Identity = 65/283 (22.97%), Postives = 130/283 (45.94%), Query Frame = 2
Query: 4091 CRYMPKDKTTIKYRVWRLVVSTPFEYFIMVMIALNTLILMMKYYREEKKASSAATHDREQQAYLNYCNTLIFLNSAFTVMFSIECVLKIMAFGPKNYFRDPWNIFDFITVIGSITDVLVSELQDXXXXXXXXXXXXXXXXXXXXXXQGYTIRILLWTFIQSFKALPYVCLLIAMLFFIYSIIGMQVFG---NIKLISEYQINRHNNFQTFTNGLLLLFRCATGESWQEIMLACDNNKPCEKDIENTNNFDCGSNFTYIYFVSFIFLCSFLMLNLFVAVIMDNF 4930
            C  + K    ++ ++  +V +  F + ++ ++ LNT  +  ++Y + +  +           +L Y    +FL      +F +E +LK+ A G + YF   +N FD + ++GS  +V+ +E+   SF       L              ++R L+ + + S +++  +  L+ +   I++++GMQ+FG   N   +  Y      +F TF   L+ +F+  TGE W E+M            IE+      G     IYF+  +   ++ +LN+F+A+ +DN 
Sbjct:  524 CHSVGKFIKQLRIQIRIMVKTQIFYWSVITLVFLNTCCVASEHYGQPQWFTD----------FLKYAE-FVFLG-----IFVVEMLLKLFAMGSRTYFASKFNRFDCVVIVGSAAEVIWAEVYGGSFGISVMRALRLLRIFKLTSYW-VSLRNLVRSLMNSMRSIISLLFLLFLFILIFALLGMQLFGGRFNFPTMHPY-----THFDTFPVALITVFQILTGEDWNEVMYLA---------IESQGGIYSGGWPYSIYFIVLVLFGNYTLLNVFLAIAVDNL 775          

HSP 8 Score: 55.8398 bits (133), Expect = 5.873e-7
Identity = 35/102 (34.31%), Postives = 51/102 (50.00%), Query Frame = 2
Query: 4157 PFEYFIMVMIALNTLILMMKYY--REEKKASSAATHDREQQAYLNYCNTLIFLNSAFTVMFSIECVLKIMAFG----PKNYFRDPWNIFDFITVIGSITDVL 4444
            PFEYFI++ I  N ++L M+ +  + +KKA S      E                 F  +F +ECVLK++AFG      +Y R  WNI DFI V+  +  +L
Sbjct:  139 PFEYFILLTIIGNCVVLSMEQHLPKNDKKALSEWLERTE---------------PYFMGIFCLECVLKVIAFGFALHKGSYLRSGWNIMDFIVVVSGVVTML 225          
BLAST of Voltage dependent L type calcium channel subunit vs. Ensembl Celegans
Match: unc-2 (High voltage activated calcium channel alpha-1 subunit [Source:UniProtKB/TrEMBL;Acc:Q86G45])

HSP 1 Score: 969.148 bits (2504), Expect = 0.000e+0
Identity = 552/996 (55.42%), Postives = 673/996 (67.57%), Query Frame = 2
Query: 3071 KPVLPYSAMFIFSPLNSLRRFCHFVVNLRYFDLFIMIVICASSIALAAEDPVKEKSLKNNILEFFDYAFTGVFTVEMILKIIDLGIILHPGSYCRDLWNILDATVVICALVAFIMGQKPSPTGNKLRGSSAKNLNTIKSLRVLRVLRPLKTINRVPKLKAVFDCVVSSLKNVFNILIVYILFQFIFAVIAVQLFQGKFFYCNDASKSSRETCRGYFFDYAGRS-TPETKKRLWQHHDFHFDNILYAMLTLFTVTTGEGWPTVLKNSMESTNIDNGPIADYRQEMAXXXXXXXXXXXXXXXXXXXALIIITFQEQGENELIDLDLDKNQKQCIDFAINEKPLCRYMPKDKTTIKYRVWRLVVSTPFEYFIMVMIALNTLILMMKYYREEKKASSAATHDREQQAYLNYCNTLIFLNSAFTVMFSIECVLKIMAFGPKNYFRDPWNIFDFITVIGSITDVLVSELQDXXXXXXXXXXXXXXXXXXXXXXQGYTIRILLWTFIQSFKALPYVCLLIAMLFFIYSIIGMQVFGNIKLISEYQINRHNNFQTFTNGLLLLFRCATGESWQEIMLACDNNKPCEKDIENTNNFD----CGSNFTYIYFVSFIFLCSFLMLNLFVAVIMDNFDYLTRDSSILGPHHLDEYIRVWAEYDPGAIGRIHHSEMYEMLRNMEPPVGFGKKCPYRLAYRKLIRMNMPVDENGTVNFTTTLFALIRESLNIKMSTAEYMDIKDMELRQTICKMWPVQAKKKL-NLIVPPDSELVFHKMTVGKIYAGYLIVENWRAYKNSQE---------------------QGPRSSPAVSIKSVTKPVVKE----------------------------EKSANLLAKFFVAFKSNTNKSNI------SLDSHHE-------RDEERFS-IDHTYGEDYDANRRYSYLRRGSKPRGSKEIYSDLTPTQDYSYGLRPEHATI----PGMPAPRKFGNRPR----SPMYSLSELETKDR 5827
            KP++PYS+MF  SP N  R   H +V  +YF++ +M VIC SS++LAAEDPV E++ +N +L++ DY FTGVF  EM+LK+ID GI+LHPGSYCRD WNILD  VV CAL AF              GS+ KNLNTIKSLRVLRVLRPLKTI R+PKLKAVFDCVV+SLKNVFNILIVY LFQFIFAVIAVQLF GKFF+C D ++    TC G FF Y  ++  P  ++R W+   F++DN + AMLTLF VTTGEGWP + +NSM++T  D GP   +R E+A+FY++FFIVFPFFFVNIFVALIIITFQEQGE EL + DLDKNQKQCIDFA+N +P   +MP+DK + KYR+WRLV S PFEYFIM MI  NTLILMMKYY                   L Y   L   N+A T +F++E +LKI+AFG +NYFRD WN FDF+TV+GSITD LV+E     F+SLGFLRLFRAARLI+LL+QGYTIRILLWTF+QSFKALPYVCLLI MLFFIY+I+GMQVFGNI L +  +INRHNNFQ+F N ++LLFRCATGE WQ+IM+A    K C +      NF+    CGSN +Y YF SF+FL SFLMLNLFVAVIMDNFDYLTRDSSILGPHHLDE+IRVWA+YDP A GRIH+SEMYEMLR M PPVGFGKKCPYRLAY+ LIRMNMPV E+GTV+FTTTLFALIRESL+IKM   E MD  D ELR T+ K+WP++AKK + +L+VPP+ EL F K+TVGKIYAG LI+EN+RA K+  E                     +   SS        T P++ +                            ++  +L   F    KS     ++      S+D  HE       R  + FS I      D++ ++ YS+    S+ RGS+   ++    QD      P + ++    P  PA R +G+ PR    SP  S SE +   R
Sbjct:  783 KPMVPYSSMFFLSPTNPFRVLIHSIVCTKYFEMMVMTVICLSSVSLAAEDPVDEENPRNKVLQYMDYCFTGVFACEMLLKLIDQGILLHPGSYCRDFWNILDGIVVTCALFAFGFA--------GTEGSAGKNLNTIKSLRVLRVLRPLKTIKRIPKLKAVFDCVVNSLKNVFNILIVYFLFQFIFAVIAVQLFNGKFFFCTDKNRKFANTCHGQFFVYDNQNDPPRVEQREWRLRPFNYDNTINAMLTLFVVTTGEGWPGIRQNSMDTTFEDQGPSPFFRVEVALFYVMFFIVFPFFFVNIFVALIIITFQEQGEAELSEGDLDKNQKQCIDFALNARPRSLFMPEDKNSTKYRIWRLVTSPPFEYFIMTMICCNTLILMMKYYNNP----------------LFYEEILRLFNTALTAVFTVESILKILAFGVRNYFRDGWNRFDFVTVVGSITDALVTEF-GGHFVSLGFLRLFRAARLIRLLQQGYTIRILLWTFVQSFKALPYVCLLIGMLFFIYAIVGMQVFGNIWLNAATEINRHNNFQSFFNAVILLFRCATGEGWQDIMMAAVQGKDCARAGSAEINFEKGQTCGSNVSYAYFTSFVFLSSFLMLNLFVAVIMDNFDYLTRDSSILGPHHLDEFIRVWADYDPAATGRIHYSEMYEMLRIMAPPVGFGKKCPYRLAYKHLIRMNMPVAEDGTVHFTTTLFALIRESLSIKMRPVEEMDEADEELRLTLKKIWPLKAKKNMVDLVVPPNHELCFQKLTVGKIYAGLLILENYRARKSGTEVGGQGLFGGGLRSLVAAAKAAESQHSSHTPQPPEETTPIIPQHAQQFSAAPTMSAQGSLQQMQGTSSGGGQRPYSLFNSFVDTIKSGKQDGDVTDVQYQSVDQQHEKMNSTGRRLSDMFSKIRRGTSADHNPHQNYSHRFGYSRNRGSRYDETEHLLAQDNRSPSSPRYRSMARASPPSPAER-YGHPPRYRTESPPSSRSEYQMSIR 1752          

HSP 2 Score: 706.057 bits (1821), Expect = 0.000e+0
Identity = 424/702 (60.40%), Postives = 514/702 (73.22%), Query Frame = 2
Query:  623 KTTSMRSLAKRTINLSFPGMQTSTSKSLFIFSEENVIRKYAKIIIEWGPFEYMVLLTILANCIVLSMERHLPKKDKTLLAGQLELTEKYFLGIFCVEALLKIVALGFCCHKEAYLRNVWNIMDFVVVVTGFLMMF----LNIDNHSDSSTVDLRTLRAVRVLRPLKLVAGFPSLQVVLKSIIRAMAPLLQIGLLVLFAITIFAIIGLEFYSGAFHYTCFKANSDKLPLPIPTEKSLVPCSNSKNGSGLGAYTCP-EDYQCKAYWEGPNYGITSFDNIGYAMLTVFQCITMEGWTDIMYHTNDAIGNRFNWLYFVPLIILGSFFMLNLVLGVLSGXXXXXXXXXXXXXXXLKLRRQQQTEKEFNGYMEWIQKAEEVLLNEATTTSEDKMRIIAARRRAEKQKYKLLGKNQSIPDFEYEDTELYSETKSMKGNIFIRSYAGIRRRRKERCTSFWRTEKHFRFSVRRLVKSQPFYWAVIILVFFNTVCVAIEHYEQGKWLTLFLNYAEYVFLCLFMMEMMIKMYGLSIRVYFQSSFNIFDCVVIAGSLFEIIYGIFVQDSSFGLSVLRALRLLRIFKVTRYWAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMQLFGGEFNFEEGKPPQNFDTFVKALLTVFQILTGEDWNTVMYNGIQSKGGVKERGTVFSIYFVLLVVFGNYTLLNVFLAIAVDNLAN 2713
            K  S   + K T++ + P  +   S SLFIF+E+N+IR+ AK IIEWGPFEY +LLTI+ NC+VLSME+HLPK DK  L+  LE TE YF+GIFC+E +LK++A GF  HK +YLR+ WNIMDF+VVV+G + M          +    +VDLRTLRAVRVLRPLKLV+G PSLQVVLKSI+ AMAPLLQIGLLVLFAI IFAIIGLEFYSGAFH  C+    +   +   +E+ + PC+N    S +G Y C  +   C   W GPNYGITSFDNIG+AM+TVFQCITMEGWT +MY+TND++G+ +NW YF+PLI+LGSFFMLNLVLGVLSGEFAKERERVE RR FLKLRRQQQ E+E NGY+EWI  AEEV+L E  TT E+K  I+ ARRRA  +K K   K QS        TE   + +  +  +         R+++  C S  +  K  R  +R +VK+Q FYW+VI LVF NT CVA EHY Q +W T FL YAE+VFL +F++EM++K++ +  R YF S FN FDCVVI GS  E+I+   V   SFG+SV+RALRLLRIFK+T YW SLRNLV SL+NSMRSIISLLFLLFLFILIFALLGMQLFGG FNF    P  +FDTF  AL+TVFQILTGEDWN VMY  I+S+GG+   G  +SIYF++LV+FGNYTLLNVFLAIAVDNLAN
Sbjct:   27 KAESGTFVRKTTLSSNAPVKEKGPS-SLFIFAEDNIIRRNAKAIIEWGPFEYFILLTIIGNCVVLSMEQHLPKNDKKALSEWLERTEPYFMGIFCLECVLKVIAFGFALHKGSYLRSGWNIMDFIVVVSGVVTMLPFSPATQTANQPVDSVDLRTLRAVRVLRPLKLVSGIPSLQVVLKSILCAMAPLLQIGLLVLFAIIIFAIIGLEFYSGAFHSACYNERGE---IENVSERPM-PCTNKT--SPMGVYNCDVKGTTCLQKWIGPNYGITSFDNIGFAMITVFQCITMEGWTTVMYYTNDSLGSTYNWAYFIPLIVLGSFFMLNLVLGVLSGEFAKERERVENRREFLKLRRQQQIERELNGYLEWILTAEEVILKEDRTTEEEKAAIMEARRRAANKKLKQASKQQS--------TETEEDFEEDEDEMEEEYVDEAERKKRGCCHSVGKFIKQLRIQIRIMVKTQIFYWSVITLVFLNTCCVASEHYGQPQWFTDFLKYAEFVFLGIFVVEMLLKLFAMGSRTYFASKFNRFDCVVIVGSAAEVIWAE-VYGGSFGISVMRALRLLRIFKLTSYWVSLRNLVRSLMNSMRSIISLLFLLFLFILIFALLGMQLFGGRFNFPTMHPYTHFDTFPVALITVFQILTGEDWNEVMYLAIESQGGIYSGGWPYSIYFIVLVLFGNYTLLNVFLAIAVDNLAN 712          

HSP 3 Score: 116.316 bits (290), Expect = 2.542e-25
Identity = 82/278 (29.50%), Postives = 137/278 (49.28%), Query Frame = 2
Query: 3089 SAMFIFSPLNSLRRFCHFVVNLRYFDLFIMIVICASSIALAAED--PVKEKSLKNNILEFFDYAFTGVFTVEMILKIIDLGIILHPGSYCRDLWNILDATVVICALVAFIMGQKPSPTGNKLRGSSAKNLNTIKSLRVLRVLRPLKTINRVPKLKAVFDCVVSSLKNVFNILIVYILFQFIFAVIAVQLFQGKFFYCNDASKSSRETCRGYFFDYAGRSTPETKK-----------------RLWQHHDF---HFDNILYAMLTLFTVTTGEGWPTVL 3856
            S++FIF+  N +RR    ++    F+ FI++ I  + + L+ E   P  +K   +  LE  +  F G+F +E +LK+I  G  LH GSY R  WNI+D  VV+  +V  +     + T N+   S       +++LR +RVLRPLK ++ +P L+ V   ++ ++  +  I ++ +    IFA+I ++ + G F        S+    RG   + + R  P T K                 + W   ++    FDNI +AM+T+F   T EGW TV+
Sbjct:   51 SSLFIFAEDNIIRRNAKAIIEWGPFEYFILLTIIGNCVVLSMEQHLPKNDKKALSEWLERTEPYFMGIFCLECVLKVIAFGFALHKGSYLRSGWNIMDFIVVVSGVVTMLPFSPATQTANQPVDSV-----DLRTLRAVRVLRPLKLVSGIPSLQVVLKSILCAMAPLLQIGLLVLFAIIIFAIIGLEFYSGAF-------HSACYNERGEIENVSERPMPCTNKTSPMGVYNCDVKGTTCLQKWIGPNYGITSFDNIGFAMITVFQCITMEGWTTVM 316          

HSP 4 Score: 92.8189 bits (229), Expect = 2.883e-18
Identity = 73/274 (26.64%), Postives = 120/274 (43.80%), Query Frame = 2
Query:  701 SLFIFSEENVIRKYAKIIIEWGPFEYMVLLTILANCIVLSMERHLPKKDKTLLAGQLELTEKYFLGIFCVEALLKIVALGFCCHKEAYLRNVWNIMDFVVVVTG-FLMMFLNIDNHSDSSTVDLRTLRAVRVLRPLKLVAGFPSLQVVLKSIIRAMAPLLQIGLLVLFAITIFAIIGLEFYSGAFHYTCFKANSDKLPLPIPTEKSLVPCSNSKNGSGLGAYTCPEDYQCKAYWEGPNYGITSF--DNIGYAMLTVFQCITMEGWTDIMYHTND 1513
            S+F  S  N  R     I+    FE MV+  I  + + L+ E   P  ++      L+  +  F G+F  E LLK++  G   H  +Y R+ WNI+D +VV    F   F   +  +  +   +++LR +RVLRPLK +   P L+ V   ++ ++  +  I ++      IFA+I ++ ++G F + C   N           K    C         G +   ++       E   + +  F  DN   AMLT+F   T EGW  I  ++ D
Sbjct:  790 SMFFLSPTNPFRVLIHSIVCTKYFEMMVMTVICLSSVSLAAED--PVDEENPRNKVLQYMDYCFTGVFACEMLLKLIDQGILLHPGSYCRDFWNILDGIVVTCALFAFGFAGTEGSAGKNLNTIKSLRVLRVLRPLKTIKRIPKLKAVFDCVVNSLKNVFNILIVYFLFQFIFAVIAVQLFNGKFFF-CTDKN----------RKFANTCH--------GQFFVYDNQNDPPRVEQREWRLRPFNYDNTINAMLTLFVVTTGEGWPGIRQNSMD 1042          

HSP 5 Score: 76.6406 bits (187), Expect = 2.313e-13
Identity = 71/320 (22.19%), Postives = 126/320 (39.38%), Query Frame = 2
Query:  698 KSLFIFSEENVIRKYAKIIIEWGPFEYMVLLTILANCIVLSMERHLPKKDKTLLAGQLELTEKYFLGIFCVEALLKIVALGFCCHKEAYLRNVWNIMDFVVVVTGFLMMFLNIDNHSDSSTVDLRTLRAVRVLRPLKLVAGFPSLQVVLKSIIRAMAPLLQIGLLVLFAITIFAIIGLEFYSGAFHYTCFKANSDKLPLPIPTEKSLVPCSNSKNGSGLGAYTCPEDYQCKAYWEGPNYGITSFDNIGYAMLTVFQCITMEGWTDIM------------------YHTNDAIGNRFNWLYFVPLIILGSFFMLNLVLGVL 1603
            +SLF+  ++N  +     ++   PFEY ++  I  N ++L M+ +    +       L L       +F VE++LKI+A G       Y R+ WN  DFV VV       +        S   LR  RA R++R L+   G+ +++++L + +++   L  + LL+     I+AI+G++ +   +     + N                                                 +F +   A++ +F+C T EGW DIM                  +      G+  ++ YF   + L SF MLNL + V+
Sbjct: 1115 RSLFMPEDKNSTKYRIWRLVTSPPFEYFIMTMICCNTLILMMKYY---NNPLFYEEILRLFNTALTAVFTVESILKILAFGV----RNYFRDGWNRFDFVTVVGSITDALVTEFGGHFVSLGFLRLFRAARLIRLLQ--QGY-TIRILLWTFVQSFKALPYVCLLIGMLFFIYAIVGMQVFGNIWLNAATEINRHN----------------------------------------------NFQSFFNAVILLFRCATGEGWQDIMMAAVQGKDCARAGSAEINFEKGQTCGSNVSYAYFTSFVFLSSFLMLNLFVAVI 1378          

HSP 6 Score: 75.0998 bits (183), Expect = 8.658e-13
Identity = 66/261 (25.29%), Postives = 128/261 (49.04%), Query Frame = 2
Query: 1982 RFSVRRLVKSQPFYWAVIILVFFNTVCVAIEHYEQGKWLTLFLNYAEYVFLCLFMMEMMIKMYGLSIRVYFQSSFNIFDCVVIAGSLFEIIY----GIFVQDSSFGLSVLRALRLLRIFKVTRYWAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMQLFGGEF--NFEEGKPPQNFDTFVKALLTVFQILTGEDWNTVMYNGIQSKGGVK--------ERG-----TVFSIYFVLLVVFGNYTLLNVFLAIAVDNL 2707
            ++ + RLV S PF + ++ ++  NT+ + +++Y    +    L         +F +E ++K+    +R YF+  +N FD V + GS+ + +     G FV      L  LR  R  R+ ++ +   ++R L+ + + S +++  +  L+ +   I+A++GMQ+FG  +     E     NF +F  A++ +F+  TGE W  +M   +Q K   +        E+G      V   YF   V   ++ +LN+F+A+ +DN 
Sbjct: 1127 KYRIWRLVTSPPFEYFIMTMICCNTLILMMKYYNNPLFYEEILRLFNTALTAVFTVESILKILAFGVRNYFRDGWNRFDFVTVVGSITDALVTEFGGHFV-----SLGFLRLFRAARLIRLLQQGYTIRILLWTFVQSFKALPYVCLLIGMLFFIYAIVGMQVFGNIWLNAATEINRHNNFQSFFNAVILLFRCATGEGWQDIMMAAVQGKDCARAGSAEINFEKGQTCGSNVSYAYFTSFVFLSSFLMLNLFVAVIMDNF 1382          

HSP 7 Score: 67.3958 bits (163), Expect = 1.523e-10
Identity = 65/287 (22.65%), Postives = 132/287 (45.99%), Query Frame = 2
Query: 4079 EKPLCRYMPKDKTTIKYRVWRLVVSTPFEYFIMVMIALNTLILMMKYYREEKKASSAATHDREQQAYLNYCNTLIFLNSAFTVMFSIECVLKIMAFGPKNYFRDPWNIFDFITVIGSITDVLVSELQDXXXXXXXXXXXXXXXXXXXXXXQGYTIRILLWTFIQSFKALPYVCLLIAMLFFIYSIIGMQVFG---NIKLISEYQINRHNNFQTFTNGLLLLFRCATGESWQEIMLACDNNKPCEKDIENTNNFDCGSNFTYIYFVSFIFLCSFLMLNLFVAVIMDNF 4930
            ++  C  + K    ++ ++  +V +  F + ++ ++ LNT  +  ++Y + +  +           +L Y    +FL      +F +E +LK+ A G + YF   +N FD + ++GS  +V+ +E+   SF       L              ++R L+ + + S +++  +  L+ +   I++++GMQ+FG   N   +  Y      +F TF   L+ +F+  TGE W E+M            IE+      G     IYF+  +   ++ +LN+F+A+ +DN 
Sbjct:  455 KRGCCHSVGKFIKQLRIQIRIMVKTQIFYWSVITLVFLNTCCVASEHYGQPQWFTD----------FLKYAE-FVFLG-----IFVVEMLLKLFAMGSRTYFASKFNRFDCVVIVGSAAEVIWAEVYGGSFGISVMRALRLLRIFKLTSYW-VSLRNLVRSLMNSMRSIISLLFLLFLFILIFALLGMQLFGGRFNFPTMHPY-----THFDTFPVALITVFQILTGEDWNEVMYLA---------IESQGGIYSGGWPYSIYFIVLVLFGNYTLLNVFLAIAVDNL 710          

HSP 8 Score: 55.8398 bits (133), Expect = 6.050e-7
Identity = 35/102 (34.31%), Postives = 51/102 (50.00%), Query Frame = 2
Query: 4157 PFEYFIMVMIALNTLILMMKYY--REEKKASSAATHDREQQAYLNYCNTLIFLNSAFTVMFSIECVLKIMAFG----PKNYFRDPWNIFDFITVIGSITDVL 4444
            PFEYFI++ I  N ++L M+ +  + +KKA S      E                 F  +F +ECVLK++AFG      +Y R  WNI DFI V+  +  +L
Sbjct:   74 PFEYFILLTIIGNCVVLSMEQHLPKNDKKALSEWLERTE---------------PYFMGIFCLECVLKVIAFGFALHKGSYLRSGWNIMDFIVVVSGVVTML 160          
BLAST of Voltage dependent L type calcium channel subunit vs. Ensembl Celegans
Match: unc-2 (High voltage activated calcium channel alpha-1 subunit [Source:UniProtKB/TrEMBL;Acc:Q86G45])

HSP 1 Score: 969.148 bits (2504), Expect = 0.000e+0
Identity = 552/996 (55.42%), Postives = 673/996 (67.57%), Query Frame = 2
Query: 3071 KPVLPYSAMFIFSPLNSLRRFCHFVVNLRYFDLFIMIVICASSIALAAEDPVKEKSLKNNILEFFDYAFTGVFTVEMILKIIDLGIILHPGSYCRDLWNILDATVVICALVAFIMGQKPSPTGNKLRGSSAKNLNTIKSLRVLRVLRPLKTINRVPKLKAVFDCVVSSLKNVFNILIVYILFQFIFAVIAVQLFQGKFFYCNDASKSSRETCRGYFFDYAGRS-TPETKKRLWQHHDFHFDNILYAMLTLFTVTTGEGWPTVLKNSMESTNIDNGPIADYRQEMAXXXXXXXXXXXXXXXXXXXALIIITFQEQGENELIDLDLDKNQKQCIDFAINEKPLCRYMPKDKTTIKYRVWRLVVSTPFEYFIMVMIALNTLILMMKYYREEKKASSAATHDREQQAYLNYCNTLIFLNSAFTVMFSIECVLKIMAFGPKNYFRDPWNIFDFITVIGSITDVLVSELQDXXXXXXXXXXXXXXXXXXXXXXQGYTIRILLWTFIQSFKALPYVCLLIAMLFFIYSIIGMQVFGNIKLISEYQINRHNNFQTFTNGLLLLFRCATGESWQEIMLACDNNKPCEKDIENTNNFD----CGSNFTYIYFVSFIFLCSFLMLNLFVAVIMDNFDYLTRDSSILGPHHLDEYIRVWAEYDPGAIGRIHHSEMYEMLRNMEPPVGFGKKCPYRLAYRKLIRMNMPVDENGTVNFTTTLFALIRESLNIKMSTAEYMDIKDMELRQTICKMWPVQAKKKL-NLIVPPDSELVFHKMTVGKIYAGYLIVENWRAYKNSQE---------------------QGPRSSPAVSIKSVTKPVVKE----------------------------EKSANLLAKFFVAFKSNTNKSNI------SLDSHHE-------RDEERFS-IDHTYGEDYDANRRYSYLRRGSKPRGSKEIYSDLTPTQDYSYGLRPEHATI----PGMPAPRKFGNRPR----SPMYSLSELETKDR 5827
            KP++PYS+MF  SP N  R   H +V  +YF++ +M VIC SS++LAAEDPV E++ +N +L++ DY FTGVF  EM+LK+ID GI+LHPGSYCRD WNILD  VV CAL AF              GS+ KNLNTIKSLRVLRVLRPLKTI R+PKLKAVFDCVV+SLKNVFNILIVY LFQFIFAVIAVQLF GKFF+C D ++    TC G FF Y  ++  P  ++R W+   F++DN + AMLTLF VTTGEGWP + +NSM++T  D GP   +R E+A+FY++FFIVFPFFFVNIFVALIIITFQEQGE EL + DLDKNQKQCIDFA+N +P   +MP+DK + KYR+WRLV S PFEYFIM MI  NTLILMMKYY                   L Y   L   N+A T +F++E +LKI+AFG +NYFRD WN FDF+TV+GSITD LV+E     F+SLGFLRLFRAARLI+LL+QGYTIRILLWTF+QSFKALPYVCLLI MLFFIY+I+GMQVFGNI L +  +INRHNNFQ+F N ++LLFRCATGE WQ+IM+A    K C +      NF+    CGSN +Y YF SF+FL SFLMLNLFVAVIMDNFDYLTRDSSILGPHHLDE+IRVWA+YDP A GRIH+SEMYEMLR M PPVGFGKKCPYRLAY+ LIRMNMPV E+GTV+FTTTLFALIRESL+IKM   E MD  D ELR T+ K+WP++AKK + +L+VPP+ EL F K+TVGKIYAG LI+EN+RA K+  E                     +   SS        T P++ +                            ++  +L   F    KS     ++      S+D  HE       R  + FS I      D++ ++ YS+    S+ RGS+   ++    QD      P + ++    P  PA R +G+ PR    SP  S SE +   R
Sbjct:  848 KPMVPYSSMFFLSPTNPFRVLIHSIVCTKYFEMMVMTVICLSSVSLAAEDPVDEENPRNKVLQYMDYCFTGVFACEMLLKLIDQGILLHPGSYCRDFWNILDGIVVTCALFAFGFA--------GTEGSAGKNLNTIKSLRVLRVLRPLKTIKRIPKLKAVFDCVVNSLKNVFNILIVYFLFQFIFAVIAVQLFNGKFFFCTDKNRKFANTCHGQFFVYDNQNDPPRVEQREWRLRPFNYDNTINAMLTLFVVTTGEGWPGIRQNSMDTTFEDQGPSPFFRVEVALFYVMFFIVFPFFFVNIFVALIIITFQEQGEAELSEGDLDKNQKQCIDFALNARPRSLFMPEDKNSTKYRIWRLVTSPPFEYFIMTMICCNTLILMMKYYNNP----------------LFYEEILRLFNTALTAVFTVESILKILAFGVRNYFRDGWNRFDFVTVVGSITDALVTEF-GGHFVSLGFLRLFRAARLIRLLQQGYTIRILLWTFVQSFKALPYVCLLIGMLFFIYAIVGMQVFGNIWLNAATEINRHNNFQSFFNAVILLFRCATGEGWQDIMMAAVQGKDCARAGSAEINFEKGQTCGSNVSYAYFTSFVFLSSFLMLNLFVAVIMDNFDYLTRDSSILGPHHLDEFIRVWADYDPAATGRIHYSEMYEMLRIMAPPVGFGKKCPYRLAYKHLIRMNMPVAEDGTVHFTTTLFALIRESLSIKMRPVEEMDEADEELRLTLKKIWPLKAKKNMVDLVVPPNHELCFQKLTVGKIYAGLLILENYRARKSGTEVGGQGLFGGGLRSLVAAAKAAESQHSSHTPQPPEETTPIIPQHAQQFSAAPTMSAQGSLQQMQGTSSGGGQRPYSLFNSFVDTIKSGKQDGDVTDVQYQSVDQQHEKMNSTGRRLSDMFSKIRRGTSADHNPHQNYSHRFGYSRNRGSRYDETEHLLAQDNRSPSSPRYRSMARASPPSPAER-YGHPPRYRTESPPSSRSEYQMSIR 1817          

HSP 2 Score: 706.442 bits (1822), Expect = 0.000e+0
Identity = 424/702 (60.40%), Postives = 514/702 (73.22%), Query Frame = 2
Query:  623 KTTSMRSLAKRTINLSFPGMQTSTSKSLFIFSEENVIRKYAKIIIEWGPFEYMVLLTILANCIVLSMERHLPKKDKTLLAGQLELTEKYFLGIFCVEALLKIVALGFCCHKEAYLRNVWNIMDFVVVVTGFLMMF----LNIDNHSDSSTVDLRTLRAVRVLRPLKLVAGFPSLQVVLKSIIRAMAPLLQIGLLVLFAITIFAIIGLEFYSGAFHYTCFKANSDKLPLPIPTEKSLVPCSNSKNGSGLGAYTCP-EDYQCKAYWEGPNYGITSFDNIGYAMLTVFQCITMEGWTDIMYHTNDAIGNRFNWLYFVPLIILGSFFMLNLVLGVLSGXXXXXXXXXXXXXXXLKLRRQQQTEKEFNGYMEWIQKAEEVLLNEATTTSEDKMRIIAARRRAEKQKYKLLGKNQSIPDFEYEDTELYSETKSMKGNIFIRSYAGIRRRRKERCTSFWRTEKHFRFSVRRLVKSQPFYWAVIILVFFNTVCVAIEHYEQGKWLTLFLNYAEYVFLCLFMMEMMIKMYGLSIRVYFQSSFNIFDCVVIAGSLFEIIYGIFVQDSSFGLSVLRALRLLRIFKVTRYWAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMQLFGGEFNFEEGKPPQNFDTFVKALLTVFQILTGEDWNTVMYNGIQSKGGVKERGTVFSIYFVLLVVFGNYTLLNVFLAIAVDNLAN 2713
            K  S   + K T++ + P  +   S SLFIF+E+N+IR+ AK IIEWGPFEY +LLTI+ NC+VLSME+HLPK DK  L+  LE TE YF+GIFC+E +LK++A GF  HK +YLR+ WNIMDF+VVV+G + M          +    +VDLRTLRAVRVLRPLKLV+G PSLQVVLKSI+ AMAPLLQIGLLVLFAI IFAIIGLEFYSGAFH  C+    +   +   +E+ + PC+N    S +G Y C  +   C   W GPNYGITSFDNIG+AM+TVFQCITMEGWT +MY+TND++G+ +NW YF+PLI+LGSFFMLNLVLGVLSGEFAKERERVE RR FLKLRRQQQ E+E NGY+EWI  AEEV+L E  TT E+K  I+ ARRRA  +K K   K QS        TE   + +  +  +         R+++  C S  +  K  R  +R +VK+Q FYW+VI LVF NT CVA EHY Q +W T FL YAE+VFL +F++EM++K++ +  R YF S FN FDCVVI GS  E+I+   V   SFG+SV+RALRLLRIFK+T YW SLRNLV SL+NSMRSIISLLFLLFLFILIFALLGMQLFGG FNF    P  +FDTF  AL+TVFQILTGEDWN VMY  I+S+GG+   G  +SIYF++LV+FGNYTLLNVFLAIAVDNLAN
Sbjct:   92 KAESGTFVRKTTLSSNAPVKEKGPS-SLFIFAEDNIIRRNAKAIIEWGPFEYFILLTIIGNCVVLSMEQHLPKNDKKALSEWLERTEPYFMGIFCLECVLKVIAFGFALHKGSYLRSGWNIMDFIVVVSGVVTMLPFSPATQTANQPVDSVDLRTLRAVRVLRPLKLVSGIPSLQVVLKSILCAMAPLLQIGLLVLFAIIIFAIIGLEFYSGAFHSACYNERGE---IENVSERPM-PCTNKT--SPMGVYNCDVKGTTCLQKWIGPNYGITSFDNIGFAMITVFQCITMEGWTTVMYYTNDSLGSTYNWAYFIPLIVLGSFFMLNLVLGVLSGEFAKERERVENRREFLKLRRQQQIERELNGYLEWILTAEEVILKEDRTTEEEKAAIMEARRRAANKKLKQASKQQS--------TETEEDFEEDEDEMEEEYVDEAERKKRGCCHSVGKFIKQLRIQIRIMVKTQIFYWSVITLVFLNTCCVASEHYGQPQWFTDFLKYAEFVFLGIFVVEMLLKLFAMGSRTYFASKFNRFDCVVIVGSAAEVIWAE-VYGGSFGISVMRALRLLRIFKLTSYWVSLRNLVRSLMNSMRSIISLLFLLFLFILIFALLGMQLFGGRFNFPTMHPYTHFDTFPVALITVFQILTGEDWNEVMYLAIESQGGIYSGGWPYSIYFIVLVLFGNYTLLNVFLAIAVDNLAN 777          

HSP 3 Score: 116.316 bits (290), Expect = 2.227e-25
Identity = 82/278 (29.50%), Postives = 137/278 (49.28%), Query Frame = 2
Query: 3089 SAMFIFSPLNSLRRFCHFVVNLRYFDLFIMIVICASSIALAAED--PVKEKSLKNNILEFFDYAFTGVFTVEMILKIIDLGIILHPGSYCRDLWNILDATVVICALVAFIMGQKPSPTGNKLRGSSAKNLNTIKSLRVLRVLRPLKTINRVPKLKAVFDCVVSSLKNVFNILIVYILFQFIFAVIAVQLFQGKFFYCNDASKSSRETCRGYFFDYAGRSTPETKK-----------------RLWQHHDF---HFDNILYAMLTLFTVTTGEGWPTVL 3856
            S++FIF+  N +RR    ++    F+ FI++ I  + + L+ E   P  +K   +  LE  +  F G+F +E +LK+I  G  LH GSY R  WNI+D  VV+  +V  +     + T N+   S       +++LR +RVLRPLK ++ +P L+ V   ++ ++  +  I ++ +    IFA+I ++ + G F        S+    RG   + + R  P T K                 + W   ++    FDNI +AM+T+F   T EGW TV+
Sbjct:  116 SSLFIFAEDNIIRRNAKAIIEWGPFEYFILLTIIGNCVVLSMEQHLPKNDKKALSEWLERTEPYFMGIFCLECVLKVIAFGFALHKGSYLRSGWNIMDFIVVVSGVVTMLPFSPATQTANQPVDSV-----DLRTLRAVRVLRPLKLVSGIPSLQVVLKSILCAMAPLLQIGLLVLFAIIIFAIIGLEFYSGAF-------HSACYNERGEIENVSERPMPCTNKTSPMGVYNCDVKGTTCLQKWIGPNYGITSFDNIGFAMITVFQCITMEGWTTVM 381          

HSP 4 Score: 93.2041 bits (230), Expect = 2.694e-18
Identity = 73/274 (26.64%), Postives = 120/274 (43.80%), Query Frame = 2
Query:  701 SLFIFSEENVIRKYAKIIIEWGPFEYMVLLTILANCIVLSMERHLPKKDKTLLAGQLELTEKYFLGIFCVEALLKIVALGFCCHKEAYLRNVWNIMDFVVVVTG-FLMMFLNIDNHSDSSTVDLRTLRAVRVLRPLKLVAGFPSLQVVLKSIIRAMAPLLQIGLLVLFAITIFAIIGLEFYSGAFHYTCFKANSDKLPLPIPTEKSLVPCSNSKNGSGLGAYTCPEDYQCKAYWEGPNYGITSF--DNIGYAMLTVFQCITMEGWTDIMYHTND 1513
            S+F  S  N  R     I+    FE MV+  I  + + L+ E   P  ++      L+  +  F G+F  E LLK++  G   H  +Y R+ WNI+D +VV    F   F   +  +  +   +++LR +RVLRPLK +   P L+ V   ++ ++  +  I ++      IFA+I ++ ++G F + C   N           K    C         G +   ++       E   + +  F  DN   AMLT+F   T EGW  I  ++ D
Sbjct:  855 SMFFLSPTNPFRVLIHSIVCTKYFEMMVMTVICLSSVSLAAED--PVDEENPRNKVLQYMDYCFTGVFACEMLLKLIDQGILLHPGSYCRDFWNILDGIVVTCALFAFGFAGTEGSAGKNLNTIKSLRVLRVLRPLKTIKRIPKLKAVFDCVVNSLKNVFNILIVYFLFQFIFAVIAVQLFNGKFFF-CTDKN----------RKFANTCH--------GQFFVYDNQNDPPRVEQREWRLRPFNYDNTINAMLTLFVVTTGEGWPGIRQNSMD 1107          

HSP 5 Score: 77.0258 bits (188), Expect = 2.289e-13
Identity = 71/320 (22.19%), Postives = 126/320 (39.38%), Query Frame = 2
Query:  698 KSLFIFSEENVIRKYAKIIIEWGPFEYMVLLTILANCIVLSMERHLPKKDKTLLAGQLELTEKYFLGIFCVEALLKIVALGFCCHKEAYLRNVWNIMDFVVVVTGFLMMFLNIDNHSDSSTVDLRTLRAVRVLRPLKLVAGFPSLQVVLKSIIRAMAPLLQIGLLVLFAITIFAIIGLEFYSGAFHYTCFKANSDKLPLPIPTEKSLVPCSNSKNGSGLGAYTCPEDYQCKAYWEGPNYGITSFDNIGYAMLTVFQCITMEGWTDIM------------------YHTNDAIGNRFNWLYFVPLIILGSFFMLNLVLGVL 1603
            +SLF+  ++N  +     ++   PFEY ++  I  N ++L M+ +    +       L L       +F VE++LKI+A G       Y R+ WN  DFV VV       +        S   LR  RA R++R L+   G+ +++++L + +++   L  + LL+     I+AI+G++ +   +     + N                                                 +F +   A++ +F+C T EGW DIM                  +      G+  ++ YF   + L SF MLNL + V+
Sbjct: 1180 RSLFMPEDKNSTKYRIWRLVTSPPFEYFIMTMICCNTLILMMKYY---NNPLFYEEILRLFNTALTAVFTVESILKILAFGV----RNYFRDGWNRFDFVTVVGSITDALVTEFGGHFVSLGFLRLFRAARLIRLLQ--QGY-TIRILLWTFVQSFKALPYVCLLIGMLFFIYAIVGMQVFGNIWLNAATEINRHN----------------------------------------------NFQSFFNAVILLFRCATGEGWQDIMMAAVQGKDCARAGSAEINFEKGQTCGSNVSYAYFTSFVFLSSFLMLNLFVAVI 1443          

HSP 6 Score: 75.0998 bits (183), Expect = 7.940e-13
Identity = 66/261 (25.29%), Postives = 128/261 (49.04%), Query Frame = 2
Query: 1982 RFSVRRLVKSQPFYWAVIILVFFNTVCVAIEHYEQGKWLTLFLNYAEYVFLCLFMMEMMIKMYGLSIRVYFQSSFNIFDCVVIAGSLFEIIY----GIFVQDSSFGLSVLRALRLLRIFKVTRYWAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMQLFGGEF--NFEEGKPPQNFDTFVKALLTVFQILTGEDWNTVMYNGIQSKGGVK--------ERG-----TVFSIYFVLLVVFGNYTLLNVFLAIAVDNL 2707
            ++ + RLV S PF + ++ ++  NT+ + +++Y    +    L         +F +E ++K+    +R YF+  +N FD V + GS+ + +     G FV      L  LR  R  R+ ++ +   ++R L+ + + S +++  +  L+ +   I+A++GMQ+FG  +     E     NF +F  A++ +F+  TGE W  +M   +Q K   +        E+G      V   YF   V   ++ +LN+F+A+ +DN 
Sbjct: 1192 KYRIWRLVTSPPFEYFIMTMICCNTLILMMKYYNNPLFYEEILRLFNTALTAVFTVESILKILAFGVRNYFRDGWNRFDFVTVVGSITDALVTEFGGHFV-----SLGFLRLFRAARLIRLLQQGYTIRILLWTFVQSFKALPYVCLLIGMLFFIYAIVGMQVFGNIWLNAATEINRHNNFQSFFNAVILLFRCATGEGWQDIMMAAVQGKDCARAGSAEINFEKGQTCGSNVSYAYFTSFVFLSSFLMLNLFVAVIMDNF 1447          

HSP 7 Score: 67.781 bits (164), Expect = 1.272e-10
Identity = 65/283 (22.97%), Postives = 130/283 (45.94%), Query Frame = 2
Query: 4091 CRYMPKDKTTIKYRVWRLVVSTPFEYFIMVMIALNTLILMMKYYREEKKASSAATHDREQQAYLNYCNTLIFLNSAFTVMFSIECVLKIMAFGPKNYFRDPWNIFDFITVIGSITDVLVSELQDXXXXXXXXXXXXXXXXXXXXXXQGYTIRILLWTFIQSFKALPYVCLLIAMLFFIYSIIGMQVFG---NIKLISEYQINRHNNFQTFTNGLLLLFRCATGESWQEIMLACDNNKPCEKDIENTNNFDCGSNFTYIYFVSFIFLCSFLMLNLFVAVIMDNF 4930
            C  + K    ++ ++  +V +  F + ++ ++ LNT  +  ++Y + +  +           +L Y    +FL      +F +E +LK+ A G + YF   +N FD + ++GS  +V+ +E+   SF       L              ++R L+ + + S +++  +  L+ +   I++++GMQ+FG   N   +  Y      +F TF   L+ +F+  TGE W E+M            IE+      G     IYF+  +   ++ +LN+F+A+ +DN 
Sbjct:  524 CHSVGKFIKQLRIQIRIMVKTQIFYWSVITLVFLNTCCVASEHYGQPQWFTD----------FLKYAE-FVFLG-----IFVVEMLLKLFAMGSRTYFASKFNRFDCVVIVGSAAEVIWAEVYGGSFGISVMRALRLLRIFKLTSYW-VSLRNLVRSLMNSMRSIISLLFLLFLFILIFALLGMQLFGGRFNFPTMHPY-----THFDTFPVALITVFQILTGEDWNEVMYLA---------IESQGGIYSGGWPYSIYFIVLVLFGNYTLLNVFLAIAVDNL 775          

HSP 8 Score: 55.8398 bits (133), Expect = 6.073e-7
Identity = 35/102 (34.31%), Postives = 51/102 (50.00%), Query Frame = 2
Query: 4157 PFEYFIMVMIALNTLILMMKYY--REEKKASSAATHDREQQAYLNYCNTLIFLNSAFTVMFSIECVLKIMAFG----PKNYFRDPWNIFDFITVIGSITDVL 4444
            PFEYFI++ I  N ++L M+ +  + +KKA S      E                 F  +F +ECVLK++AFG      +Y R  WNI DFI V+  +  +L
Sbjct:  139 PFEYFILLTIIGNCVVLSMEQHLPKNDKKALSEWLERTE---------------PYFMGIFCLECVLKVIAFGFALHKGSYLRSGWNIMDFIVVVSGVVTML 225          
BLAST of Voltage dependent L type calcium channel subunit vs. Ensembl Celegans
Match: unc-2 (High voltage activated calcium channel alpha-1 subunit [Source:UniProtKB/TrEMBL;Acc:Q86G45])

HSP 1 Score: 968.763 bits (2503), Expect = 0.000e+0
Identity = 513/788 (65.10%), Postives = 608/788 (77.16%), Query Frame = 2
Query: 3071 KPVLPYSAMFIFSPLNSLRRFCHFVVNLRYFDLFIMIVICASSIALAAEDPVKEKSLKNNILEFFDYAFTGVFTVEMILKIIDLGIILHPGSYCRDLWNILDATVVICALVAFIMGQKPSPTGNKLRGSSAKNLNTIKSLRVLRVLRPLKTINRVPKLKAVFDCVVSSLKNVFNILIVYILFQFIFAVIAVQLFQGKFFYCNDASKSSRETCRGYFFDYAGRS-TPETKKRLWQHHDFHFDNILYAMLTLFTVTTGEGWPTVLKNSMESTNIDNGPIADYRQEMAXXXXXXXXXXXXXXXXXXXALIIITFQEQGENELIDLDLDKNQKQCIDFAINEKPLCRYMPKDKTTIKYRVWRLVVSTPFEYFIMVMIALNTLILMMKYYREEKKASSAATHDREQQAYLNYCNTLIFLNSAFTVMFSIECVLKIMAFGPKNYFRDPWNIFDFITVIGSITDVLVSELQDXXXXXXXXXXXXXXXXXXXXXXQGYTIRILLWTFIQSFKALPYVCLLIAMLFFIYSIIGMQVFGNIKLISEYQINRHNNFQTFTNGLLLLFRCATGESWQEIMLACDNNKPCEKDIENTNNFD----CGSNFTYIYFVSFIFLCSFLMLNLFVAVIMDNFDYLTRDSSILGPHHLDEYIRVWAEYDPGAIGRIHHSEMYEMLRNMEPPVGFGKKCPYRLAYRKLIRMNMPVDENGTVNFTTTLFALIRESLNIKMSTAEYMDIKDMELRQTICKMWPVQAKKKL-NLIVPPDSELVFHKMTVGKIYAGYLIVENWRAYKNSQE 5416
            KP++PYS+MF  SP N  R   H +V  +YF++ +M VIC SS++LAAEDPV E++ +N +L++ DY FTGVF  EM+LK+ID GI+LHPGSYCRD WNILD  VV CAL AF              GS+ KNLNTIKSLRVLRVLRPLKTI R+PKLKAVFDCVV+SLKNVFNILIVY LFQFIFAVIAVQLF GKFF+C D ++    TC G FF Y  ++  P  ++R W+   F++DN + AMLTLF VTTGEGWP + +NSM++T  D GP   +R E+A+FY++FFIVFPFFFVNIFVALIIITFQEQGE EL + DLDKNQKQCIDFA+N +P   +MP+DK + KYR+WRLV S PFEYFIM MI  NTLILMMKYY                   L Y   L   N+A T +F++E +LKI+AFG +NYFRD WN FDF+TV+GSITD LV+E     F+SLGFLRLFRAARLI+LL+QGYTIRILLWTF+QSFKALPYVCLLI MLFFIY+I+GMQVFGNI L +  +INRHNNFQ+F N ++LLFRCATGE WQ+IM+A    K C +      NF+    CGSN +Y YF SF+FL SFLMLNLFVAVIMDNFDYLTRDSSILGPHHLDE+IRVWA+YDP A GRIH+SEMYEMLR M PPVGFGKKCPYRLAY+ LIRMNMPV E+GTV+FTTTLFALIRESL+IKM   E MD  D ELR T+ K+WP++AKK + +L+VPP+ EL F K+TVGKIYAG LI+EN+RA K+  E
Sbjct:  918 KPMVPYSSMFFLSPTNPFRVLIHSIVCTKYFEMMVMTVICLSSVSLAAEDPVDEENPRNKVLQYMDYCFTGVFACEMLLKLIDQGILLHPGSYCRDFWNILDGIVVTCALFAFGFA--------GTEGSAGKNLNTIKSLRVLRVLRPLKTIKRIPKLKAVFDCVVNSLKNVFNILIVYFLFQFIFAVIAVQLFNGKFFFCTDKNRKFANTCHGQFFVYDNQNDPPRVEQREWRLRPFNYDNTINAMLTLFVVTTGEGWPGIRQNSMDTTFEDQGPSPFFRVEVALFYVMFFIVFPFFFVNIFVALIIITFQEQGEAELSEGDLDKNQKQCIDFALNARPRSLFMPEDKNSTKYRIWRLVTSPPFEYFIMTMICCNTLILMMKYYNNP----------------LFYEEILRLFNTALTAVFTVESILKILAFGVRNYFRDGWNRFDFVTVVGSITDALVTEF-GGHFVSLGFLRLFRAARLIRLLQQGYTIRILLWTFVQSFKALPYVCLLIGMLFFIYAIVGMQVFGNIWLNAATEINRHNNFQSFFNAVILLFRCATGEGWQDIMMAAVQGKDCARAGSAEINFEKGQTCGSNVSYAYFTSFVFLSSFLMLNLFVAVIMDNFDYLTRDSSILGPHHLDEFIRVWADYDPAATGRIHYSEMYEMLRIMAPPVGFGKKCPYRLAYKHLIRMNMPVAEDGTVHFTTTLFALIRESLSIKMRPVEEMDEADEELRLTLKKIWPLKAKKNMVDLVVPPNHELCFQKLTVGKIYAGLLILENYRARKSGTE 1680          

HSP 2 Score: 706.057 bits (1821), Expect = 0.000e+0
Identity = 427/704 (60.65%), Postives = 517/704 (73.44%), Query Frame = 2
Query:  623 KTTSMRSLAKRTINLSFPGMQTSTSKSLFIFSEENVIRKYAKIIIEWGPFEYMVLLTILANCIVLSMERHLPKKDKTLLAGQLELTEKYFLGIFCVEALLKIVALGFCCHKEAYLRNVWNIMDFVVVVTGFLMMF----LNIDNHSDSSTVDLRTLRAVRVLRPLKLVAGFPSLQVVLKSIIRAMAPLLQIGLLVLFAITIFAIIGLEFYSGAFHYTCFKANSDKLPLPIPTEKSLVPCSNSKNGSGLGAYTCP-EDYQCKAYWEGPNYGITSFDNIGYAMLTVFQCITMEGWTDIMYHTNDAIGNRFNWLYFVPLIILGSFFMLNLVLGVLSGXXXXXXXXXXXXXXXLKLRRQQQTEKEFNGYMEWIQKAEEVLLNEATTTSEDKMRIIAARRRAEKQKYKLLGKNQSI--PDFEYEDTELYSETKSMKGNIFIRSYAGIRRRRKERCTSFWRTEKHFRFSVRRLVKSQPFYWAVIILVFFNTVCVAIEHYEQGKWLTLFLNYAEYVFLCLFMMEMMIKMYGLSIRVYFQSSFNIFDCVVIAGSLFEIIYGIFVQDSSFGLSVLRALRLLRIFKVTRYWAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMQLFGGEFNFEEGKPPQNFDTFVKALLTVFQILTGEDWNTVMYNGIQSKGGVKERGTVFSIYFVLLVVFGNYTLLNVFLAIAVDNLAN 2713
            K  S   + K T++ + P  +   S SLFIF+E+N+IR+ AK IIEWGPFEY +LLTI+ NC+VLSME+HLPK DK  L+  LE TE YF+GIFC+E +LK++A GF  HK +YLR+ WNIMDF+VVV+G + M          +    +VDLRTLRAVRVLRPLKLV+G PSLQVVLKSI+ AMAPLLQIGLLVLFAI IFAIIGLEFYSGAFH  C+    +   +   +E+ + PC+N    S +G Y C  +   C   W GPNYGITSFDNIG+AM+TVFQCITMEGWT +MY+TND++G+ +NW YF+PLI+LGSFFMLNLVLGVLSGEFAKERERVE RR FLKLRRQQQ E+E NGY+EWI  AEEV+L E  TT E+K  I+ ARRRA  +K K   K QS    +   ED +   E    +G      +A   R+++  C S  +  K  R  +R +VK+Q FYW+VI LVF NT CVA EHY Q +W T FL YAE+VFL +F++EM++K++ +  R YF S FN FDCVVI GS  E+I+   V   SFG+SV+RALRLLRIFK+T YW SLRNLV SL+NSMRSIISLLFLLFLFILIFALLGMQLFGG FNF    P  +FDTF  AL+TVFQILTGEDWN VMY  I+S+GG+   G  +SIYF++LV+FGNYTLLNVFLAIAVDNLAN
Sbjct:  154 KAESGTFVRKTTLSSNAPVKEKGPS-SLFIFAEDNIIRRNAKAIIEWGPFEYFILLTIIGNCVVLSMEQHLPKNDKKALSEWLERTEPYFMGIFCLECVLKVIAFGFALHKGSYLRSGWNIMDFIVVVSGVVTMLPFSPATQTANQPVDSVDLRTLRAVRVLRPLKLVSGIPSLQVVLKSILCAMAPLLQIGLLVLFAIIIFAIIGLEFYSGAFHSACYNERGE---IENVSERPM-PCTNKT--SPMGVYNCDVKGTTCLQKWIGPNYGITSFDNIGFAMITVFQCITMEGWTTVMYYTNDSLGSTYNWAYFIPLIVLGSFFMLNLVLGVLSGEFAKERERVENRREFLKLRRQQQIERELNGYLEWILTAEEVILKEDRTTEEEKAAIMEARRRAANKKLKQASKQQSTETEEDFEEDEDEMEEEYVDEGGTVEDEFA--ERKKRGCCHSVGKFIKQLRIQIRIMVKTQIFYWSVITLVFLNTCCVASEHYGQPQWFTDFLKYAEFVFLGIFVVEMLLKLFAMGSRTYFASKFNRFDCVVIVGSAAEVIWAE-VYGGSFGISVMRALRLLRIFKLTSYWVSLRNLVRSLMNSMRSIISLLFLLFLFILIFALLGMQLFGGRFNFPTMHPYTHFDTFPVALITVFQILTGEDWNEVMYLAIESQGGIYSGGWPYSIYFIVLVLFGNYTLLNVFLAIAVDNLAN 847          

HSP 3 Score: 116.316 bits (290), Expect = 2.658e-25
Identity = 82/278 (29.50%), Postives = 137/278 (49.28%), Query Frame = 2
Query: 3089 SAMFIFSPLNSLRRFCHFVVNLRYFDLFIMIVICASSIALAAED--PVKEKSLKNNILEFFDYAFTGVFTVEMILKIIDLGIILHPGSYCRDLWNILDATVVICALVAFIMGQKPSPTGNKLRGSSAKNLNTIKSLRVLRVLRPLKTINRVPKLKAVFDCVVSSLKNVFNILIVYILFQFIFAVIAVQLFQGKFFYCNDASKSSRETCRGYFFDYAGRSTPETKK-----------------RLWQHHDF---HFDNILYAMLTLFTVTTGEGWPTVL 3856
            S++FIF+  N +RR    ++    F+ FI++ I  + + L+ E   P  +K   +  LE  +  F G+F +E +LK+I  G  LH GSY R  WNI+D  VV+  +V  +     + T N+   S       +++LR +RVLRPLK ++ +P L+ V   ++ ++  +  I ++ +    IFA+I ++ + G F        S+    RG   + + R  P T K                 + W   ++    FDNI +AM+T+F   T EGW TV+
Sbjct:  178 SSLFIFAEDNIIRRNAKAIIEWGPFEYFILLTIIGNCVVLSMEQHLPKNDKKALSEWLERTEPYFMGIFCLECVLKVIAFGFALHKGSYLRSGWNIMDFIVVVSGVVTMLPFSPATQTANQPVDSV-----DLRTLRAVRVLRPLKLVSGIPSLQVVLKSILCAMAPLLQIGLLVLFAIIIFAIIGLEFYSGAF-------HSACYNERGEIENVSERPMPCTNKTSPMGVYNCDVKGTTCLQKWIGPNYGITSFDNIGFAMITVFQCITMEGWTTVM 443          

HSP 4 Score: 93.2041 bits (230), Expect = 2.711e-18
Identity = 73/274 (26.64%), Postives = 120/274 (43.80%), Query Frame = 2
Query:  701 SLFIFSEENVIRKYAKIIIEWGPFEYMVLLTILANCIVLSMERHLPKKDKTLLAGQLELTEKYFLGIFCVEALLKIVALGFCCHKEAYLRNVWNIMDFVVVVTG-FLMMFLNIDNHSDSSTVDLRTLRAVRVLRPLKLVAGFPSLQVVLKSIIRAMAPLLQIGLLVLFAITIFAIIGLEFYSGAFHYTCFKANSDKLPLPIPTEKSLVPCSNSKNGSGLGAYTCPEDYQCKAYWEGPNYGITSF--DNIGYAMLTVFQCITMEGWTDIMYHTND 1513
            S+F  S  N  R     I+    FE MV+  I  + + L+ E   P  ++      L+  +  F G+F  E LLK++  G   H  +Y R+ WNI+D +VV    F   F   +  +  +   +++LR +RVLRPLK +   P L+ V   ++ ++  +  I ++      IFA+I ++ ++G F + C   N           K    C         G +   ++       E   + +  F  DN   AMLT+F   T EGW  I  ++ D
Sbjct:  925 SMFFLSPTNPFRVLIHSIVCTKYFEMMVMTVICLSSVSLAAED--PVDEENPRNKVLQYMDYCFTGVFACEMLLKLIDQGILLHPGSYCRDFWNILDGIVVTCALFAFGFAGTEGSAGKNLNTIKSLRVLRVLRPLKTIKRIPKLKAVFDCVVNSLKNVFNILIVYFLFQFIFAVIAVQLFNGKFFF-CTDKN----------RKFANTCH--------GQFFVYDNQNDPPRVEQREWRLRPFNYDNTINAMLTLFVVTTGEGWPGIRQNSMD 1177          

HSP 5 Score: 77.0258 bits (188), Expect = 2.150e-13
Identity = 71/320 (22.19%), Postives = 126/320 (39.38%), Query Frame = 2
Query:  698 KSLFIFSEENVIRKYAKIIIEWGPFEYMVLLTILANCIVLSMERHLPKKDKTLLAGQLELTEKYFLGIFCVEALLKIVALGFCCHKEAYLRNVWNIMDFVVVVTGFLMMFLNIDNHSDSSTVDLRTLRAVRVLRPLKLVAGFPSLQVVLKSIIRAMAPLLQIGLLVLFAITIFAIIGLEFYSGAFHYTCFKANSDKLPLPIPTEKSLVPCSNSKNGSGLGAYTCPEDYQCKAYWEGPNYGITSFDNIGYAMLTVFQCITMEGWTDIM------------------YHTNDAIGNRFNWLYFVPLIILGSFFMLNLVLGVL 1603
            +SLF+  ++N  +     ++   PFEY ++  I  N ++L M+ +    +       L L       +F VE++LKI+A G       Y R+ WN  DFV VV       +        S   LR  RA R++R L+   G+ +++++L + +++   L  + LL+     I+AI+G++ +   +     + N                                                 +F +   A++ +F+C T EGW DIM                  +      G+  ++ YF   + L SF MLNL + V+
Sbjct: 1250 RSLFMPEDKNSTKYRIWRLVTSPPFEYFIMTMICCNTLILMMKYY---NNPLFYEEILRLFNTALTAVFTVESILKILAFGV----RNYFRDGWNRFDFVTVVGSITDALVTEFGGHFVSLGFLRLFRAARLIRLLQ--QGY-TIRILLWTFVQSFKALPYVCLLIGMLFFIYAIVGMQVFGNIWLNAATEINRHN----------------------------------------------NFQSFFNAVILLFRCATGEGWQDIMMAAVQGKDCARAGSAEINFEKGQTCGSNVSYAYFTSFVFLSSFLMLNLFVAVI 1513          

HSP 6 Score: 75.0998 bits (183), Expect = 7.713e-13
Identity = 66/261 (25.29%), Postives = 128/261 (49.04%), Query Frame = 2
Query: 1982 RFSVRRLVKSQPFYWAVIILVFFNTVCVAIEHYEQGKWLTLFLNYAEYVFLCLFMMEMMIKMYGLSIRVYFQSSFNIFDCVVIAGSLFEIIY----GIFVQDSSFGLSVLRALRLLRIFKVTRYWAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMQLFGGEF--NFEEGKPPQNFDTFVKALLTVFQILTGEDWNTVMYNGIQSKGGVK--------ERG-----TVFSIYFVLLVVFGNYTLLNVFLAIAVDNL 2707
            ++ + RLV S PF + ++ ++  NT+ + +++Y    +    L         +F +E ++K+    +R YF+  +N FD V + GS+ + +     G FV      L  LR  R  R+ ++ +   ++R L+ + + S +++  +  L+ +   I+A++GMQ+FG  +     E     NF +F  A++ +F+  TGE W  +M   +Q K   +        E+G      V   YF   V   ++ +LN+F+A+ +DN 
Sbjct: 1262 KYRIWRLVTSPPFEYFIMTMICCNTLILMMKYYNNPLFYEEILRLFNTALTAVFTVESILKILAFGVRNYFRDGWNRFDFVTVVGSITDALVTEFGGHFV-----SLGFLRLFRAARLIRLLQQGYTIRILLWTFVQSFKALPYVCLLIGMLFFIYAIVGMQVFGNIWLNAATEINRHNNFQSFFNAVILLFRCATGEGWQDIMMAAVQGKDCARAGSAEINFEKGQTCGSNVSYAYFTSFVFLSSFLMLNLFVAVIMDNF 1517          

HSP 7 Score: 67.781 bits (164), Expect = 1.355e-10
Identity = 65/283 (22.97%), Postives = 130/283 (45.94%), Query Frame = 2
Query: 4091 CRYMPKDKTTIKYRVWRLVVSTPFEYFIMVMIALNTLILMMKYYREEKKASSAATHDREQQAYLNYCNTLIFLNSAFTVMFSIECVLKIMAFGPKNYFRDPWNIFDFITVIGSITDVLVSELQDXXXXXXXXXXXXXXXXXXXXXXQGYTIRILLWTFIQSFKALPYVCLLIAMLFFIYSIIGMQVFG---NIKLISEYQINRHNNFQTFTNGLLLLFRCATGESWQEIMLACDNNKPCEKDIENTNNFDCGSNFTYIYFVSFIFLCSFLMLNLFVAVIMDNF 4930
            C  + K    ++ ++  +V +  F + ++ ++ LNT  +  ++Y + +  +           +L Y    +FL      +F +E +LK+ A G + YF   +N FD + ++GS  +V+ +E+   SF       L              ++R L+ + + S +++  +  L+ +   I++++GMQ+FG   N   +  Y      +F TF   L+ +F+  TGE W E+M            IE+      G     IYF+  +   ++ +LN+F+A+ +DN 
Sbjct:  594 CHSVGKFIKQLRIQIRIMVKTQIFYWSVITLVFLNTCCVASEHYGQPQWFTD----------FLKYAE-FVFLG-----IFVVEMLLKLFAMGSRTYFASKFNRFDCVVIVGSAAEVIWAEVYGGSFGISVMRALRLLRIFKLTSYW-VSLRNLVRSLMNSMRSIISLLFLLFLFILIFALLGMQLFGGRFNFPTMHPY-----THFDTFPVALITVFQILTGEDWNEVMYLA---------IESQGGIYSGGWPYSIYFIVLVLFGNYTLLNVFLAIAVDNL 845          

HSP 8 Score: 55.8398 bits (133), Expect = 6.092e-7
Identity = 35/102 (34.31%), Postives = 51/102 (50.00%), Query Frame = 2
Query: 4157 PFEYFIMVMIALNTLILMMKYY--REEKKASSAATHDREQQAYLNYCNTLIFLNSAFTVMFSIECVLKIMAFG----PKNYFRDPWNIFDFITVIGSITDVL 4444
            PFEYFI++ I  N ++L M+ +  + +KKA S      E                 F  +F +ECVLK++AFG      +Y R  WNI DFI V+  +  +L
Sbjct:  201 PFEYFILLTIIGNCVVLSMEQHLPKNDKKALSEWLERTE---------------PYFMGIFCLECVLKVIAFGFALHKGSYLRSGWNIMDFIVVVSGVVTML 287          
BLAST of Voltage dependent L type calcium channel subunit vs. Ensembl Fly
Match: cac (gene:FBgn0263111 transcript:FBtr0332391)

HSP 1 Score: 999.579 bits (2583), Expect = 0.000e+0
Identity = 564/978 (57.67%), Postives = 685/978 (70.04%), Query Frame = 2
Query: 3071 KPVLPYSAMFIFSPLNSLRRFCHFVVNLRYFDLFIMIVICASSIALAAEDPVKEKSLKNNILEFFDYAFTGVFTVEMILKIIDLGIILHPGSYCRDLWNILDATVVICALVAFIMGQKPSPTGNKLRGSSA-KNLNTIKSLRVLRVLRPLKTINRVPKLKAVFDCVVSSLKNVFNILIVYILFQFIFAVIAVQLFQGKFFYCNDASKSSRETCRGYFFDYA-GRSTPETKKRLWQHHDFHFDNILYAMLTLFTVTTGEGWPTVLKNSMESTNIDNGPIADYRQEMAXXXXXXXXXXXXXXXXXXXALIIITFQEQGENELIDLDLDKNQKQCIDFAINEKPLCRYMPKDKTTIKYRVWRLVVSTPFEYFIMVMIALNTLILMMKYYREEKKASSAATHDREQQAYLNYCNTLIFLNSAFTVMFSIECVLKIMAFGPKNYFRDPWNIFDFITVIGSITDVLVSEL-QDXXXXXXXXXXXXXXXXXXXXXXQGYTIRILLWTFIQSFKALPYVCLLIAMLFFIYSIIGMQVFGNIKLISEYQINRHNNFQTFTNGLLLLFRCATGESWQEIMLACDNNKPCEKDIENTNNFDCGSNFTYIYFVSFIFLCSFLMLNLFVAVIMDNFDYLTRDSSILGPHHLDEYIRVWAEYDPGAIGRIHHSEMYEMLRNMEPPVGFGKKCPYRLAYRKLIRMNMPVDENGTVNFTTTLFALIRESLNIKMSTAEYMDIKDMELRQTICKMWPVQAKKKLNLIVPPDSELVFHKMTVGKIYAGYLIVENWRAYKNSQ-EQG-PRSSPAVSIKSVTKPVVKEEKSANLLAKFFVAFKSNTNKSNISLDSHHERDEERFSIDHTYGEDYDANRRYSYLRRGSKP---------RGSKEIYSDLTPTQDYSYGLRPEHATIPGMPAPRKFGNRPRSPMYSLSELETKDRANTPQSLNSTIS---------PTSGDRESDKFHRRSPAVSPSNPQ 5935
            KP+LPYS+MFI SP N +RR  H+VVNL YFD FIM+VI  SSIALAAEDPV+E S +N IL +FDYAFTGVFT+EM+LKI+DLG+ILHPGSY R+ WNI+DA VVICA V+F         G  + GSSA +NL+TIKSLRVLRVLRPLKTI RVPKLKAVFDCVV+SLKNV NILIVYILFQFIF+VI VQLF GKFFYC D SK +   C+G +F Y      P+ + R+W+   FH+DN+  AMLTLF V TGEGWP VL++SM +T  D GPI ++R EM+IFYIV+FIVFPFFFVNIFVALIIITFQEQGE EL D ++DKNQK CIDF I  +PL RYMPK++ T KY+VWR+VVSTPFEYFIM++I  NTL+LMMKY+ +                   Y  +L ++N  FT MFS+E VLKI+ FG KN+F+DPWNIFD ITV+GSI D L  E   DS+ +++GFLRLFRAARLIKLLRQGYTIRILLWTF+QSFKALPYVCLLIAMLFFIY+IIGMQVFGNI+   + Q+NRHNNFQ+F+ G++LLFRCATGE+W  IMLAC   K C+ D E      CGS   Y YFVSFIF CSFLMLNLFVAVIMDNFDYLTRDSSILG HHLDE++R+WAEYDP A G+IH++EMY+ML+NM+PP+GFG KCP RLAY+KLIRMNMP+D+   V FTTTLFALIRE+L+IKM   E MD  DMELR+TI  +WP+QAKK LNL+VPP  +L   K++VGKIYAG+LI+E+WR+ +  Q + G PR       +    P   EE    L      A +  + +S    D+ H          H+Y    + +RR   LR    P         RG + I+ D+  +   S  +     T      PR   + PR P  S S   +  R+ +P      +S         PT G   +    +RS + SP+  Q
Sbjct:  741 KPMLPYSSMFILSPTNPIRRGAHWVVNLPYFDFFIMVVISMSSIALAAEDPVRENSRRNKILNYFDYAFTGVFTIEMLLKIVDLGVILHPGSYLREFWNIMDAVVVICAAVSF---------GFDMSGSSAGQNLSTIKSLRVLRVLRPLKTIKRVPKLKAVFDCVVNSLKNVVNILIVYILFQFIFSVIGVQLFNGKFFYCTDESKHTSAECQGSYFKYEEDELLPKQELRVWKPRAFHYDNVAAAMLTLFAVQTGEGWPQVLQHSMAATYEDRGPIQNFRIEMSIFYIVYFIVFPFFFVNIFVALIIITFQEQGEAELQDGEIDKNQKSCIDFTIGARPLERYMPKNRNTFKYKVWRIVVSTPFEYFIMMLIVFNTLLLMMKYHNQGDM----------------YEKSLKYINMGFTGMFSVETVLKIIGFGVKNFFKDPWNIFDLITVLGSIVDALWMEFGHDSNSINVGFLRLFRAARLIKLLRQGYTIRILLWTFVQSFKALPYVCLLIAMLFFIYAIIGMQVFGNIRYDPDTQLNRHNNFQSFSGGIMLLFRCATGEAWPNIMLACLKGKACDDDAEKAPGEYCGSTLAYAYFVSFIFFCSFLMLNLFVAVIMDNFDYLTRDSSILGAHHLDEFVRIWAEYDPNATGKIHYTEMYDMLKNMDPPLGFGNKCPNRLAYKKLIRMNMPLDDELRVQFTTTLFALIRENLSIKMRAPEEMDQADMELRETITNIWPLQAKKMLNLLVPPSDQLNKGKLSVGKIYAGFLILESWRSTRFGQLDSGMPRKKLEHDDEHKYSPTAVEEPMLELQD----ASRHPSQESLTGADAGH------LHPGHSY---MNGHRRSPSLRHNGSPLARSPSPRRRGHQYIHHDIGFSDTVSNVVEMVKET----RHPRHGNSHPRYPRGSWSASTSPARSPSPSRYGGHLSRSKRTQLPYPTYG---TTSLCQRSRSPSPARLQ 1673          

HSP 2 Score: 731.095 bits (1886), Expect = 0.000e+0
Identity = 431/675 (63.85%), Postives = 512/675 (75.85%), Query Frame = 2
Query:  701 SLFIFSEENVIRKYAKIIIEWGPFEYMVLLTILANCIVLSMERHLPKKDKTLLAGQLELTEKYFLGIFCVEALLKIVALGFCCHKEAYLRNVWNIMDFVVVVTGFLMMFLNIDNHSDSSTVDLRTLRAVRVLRPLKLVAGFPSLQVVLKSIIRAMAPLLQIGLLVLFAITIFAIIGLEFYSGAFHYTCFK-ANSDKLPLPIPTEKSLVPCSNSKN--GSGLGAYTCPEDYQ-CKAYWEGPNYGITSFDNIGYAMLTVFQCITMEGWTDIMYHTNDAIGNRFNWLYFVPLIILGSFFMLNLVLGVLSGXXXXXXXXXXXXXXXLKLRRQQQTEKEFNGYMEWIQKAEEVLLNEATTTSEDKMRIIAARRRAEKQKYKLLGKNQSIPDFEYEDTELYSETKSMKGNIFIRSYAGIRRRRKERCTSFWRTEKHFRFSVRRLVKSQPFYWAVIILVFFNTVCVAIEHYEQGKWLTLFLNYAEYVFLCLFMMEMMIKMYGLSIRVYFQSSFNIFDCVVIAGSLFEIIYGIFVQDSSFGLSVLRALRLLRIFKVTRYWAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMQLFGGEFNFEEGKPPQNFDTFVKALLTVFQILTGEDWNTVMYNGIQSKGGVKERGTVFSIYFVLLVVFGNYTLLNVFLAIAVDNLAN 2713
            SLFI +E+N IRKY + IIEW PFEY VLLTI+ANC+VL++E HLP  DKT+LA +LE TE YFL IFCVEA LKI+ALG   HK +YLRN+WNIMDF VVVTGF+  +  I        VDLRTLRA+RVLRPLKLV+G PSLQVVLKSII+AMAPLLQIGLLVLFAI IFAIIGLEFYSGA H TC+   + +KL   +   +S  PC N+ N      G++ C      C   WEGPN GITSFDNIG+AMLTVFQCITMEGWT I+Y TNDA+G+ FNW+YFVPLI++GSFFMLNLVLGVLSGEF+ ER RVE+R  F K R +   +     Y++WI +AEEV+L E  TT E+KM I+ ARRR   ++ KL    +S    +  DTE     +    + ++++    R + +  CT FWR EK FRF +R  VK+Q FYW VI+LVF NTVCVA+EHY Q  +LT FL YAE++FL LFM EM IKMY L  R+YF+SSFN FDCVVI+GS+FE+I+   V+  SFGLSVLRALRLLRIFKVT+YW+SLRNLV+SLLNSMRSIISLLFLLFLFILIFALLGMQLFGG+FN   G P  NF+TF  ALLTVFQILTGEDWN VMY GI S+GG  ++G ++SIYF++LV+FGNYTLLNVFLAIAVDNLAN
Sbjct:   17 SLFILTEDNPIRKYTRFIIEWPPFEYAVLLTIIANCVVLALEEHLPGGDKTVLAQKLEKTEAYFLCIFCVEASLKILALGLVLHKHSYLRNIWNIMDFFVVVTGFMTQYPQI-----GPEVDLRTLRAIRVLRPLKLVSGIPSLQVVLKSIIKAMAPLLQIGLLVLFAIVIFAIIGLEFYSGALHKTCYSLEDPNKL---VKEGESETPC-NTDNILEKATGSFVCNNTTSMCLEKWEGPNSGITSFDNIGFAMLTVFQCITMEGWTAILYWTNDALGSAFNWIYFVPLIVIGSFFMLNLVLGVLSGEFSNERNRVERRMEFQKCRFRAMFQTAMVSYLDWITQAEEVILAEERTTEEEKMHIMEARRRNAAKRKKLKSLGKS----KSTDTEEEEAEEDYGDDGYLKT----RSKPQGSCTGFWRAEKRFRFWIRHTVKTQWFYWFVIVLVFLNTVCVAVEHYGQPSFLTEFLYYAEFIFLGLFMSEMFIKMYALGPRIYFESSFNRFDCVVISGSIFEVIWSE-VKGGSFGLSVLRALRLLRIFKVTKYWSSLRNLVISLLNSMRSIISLLFLLFLFILIFALLGMQLFGGQFNLPGGTPETNFNTFPIALLTVFQILTGEDWNEVMYQGIISQGGA-QKGMIYSIYFIVLVLFGNYTLLNVFLAIAVDNLAN 672          

HSP 3 Score: 117.472 bits (293), Expect = 1.246e-25
Identity = 79/275 (28.73%), Postives = 136/275 (49.45%), Query Frame = 2
Query:  701 SLFIFSEENVIRKYAKIIIEWGPFEYMVLLTILANCIVLSMERHLPKKDKTLLAGQLELTEKYFLGIFCVEALLKIVALGFCCHKEAYLRNVWNIMDFVVVVTGFLMMFLNIDNHSDSSTVD-LRTLRAVRVLRPLKLVAGFPSLQVVLKSIIRAMAPLLQIGLLVLFAITIFAIIGLEFYSGAFHYTCFKANSDKLPLPIPTEKSLVPCSNSKNGSGLGAYTCPEDYQCKAYWEGPNYGITSF--DNIGYAMLTVFQCITMEGWTDIMYHTNDA 1516
            S+FI S  N IR+ A  ++    F++ +++ I  + I L+ E   P ++ +     L   +  F G+F +E LLKIV LG   H  +YLR  WNIMD VVV+   +    ++   S    +  +++LR +RVLRPLK +   P L+ V   ++ ++  ++ I ++ +    IF++IG++ ++G F Y      +D+              S   +    G+Y   E+ +     E   +   +F  DN+  AMLT+F   T EGW  ++ H+  A
Sbjct:  748 SMFILSPTNPIRRGAHWVVNLPYFDFFIMVVISMSSIALAAED--PVRENSRRNKILNYFDYAFTGVFTIEMLLKIVDLGVILHPGSYLREFWNIMDAVVVICAAVSFGFDMSGSSAGQNLSTIKSLRVLRVLRPLKTIKRVPKLKAVFDCVVNSLKNVVNILIVYILFQFIFSVIGVQLFNGKFFYC-----TDE--------------SKHTSAECQGSYFKYEEDELLPKQELRVWKPRAFHYDNVAAAMLTLFAVQTGEGWPQVLQHSMAA 1001          

HSP 4 Score: 113.235 bits (282), Expect = 2.294e-24
Identity = 78/288 (27.08%), Postives = 140/288 (48.61%), Query Frame = 2
Query: 3053 PETIQRKPVLPYSAMFIFSPLNSLRRFCHFVVNLRYFDLFIMIVICASSIALAAED--PVKEKSLKNNILEFFDYAFTGVFTVEMILKIIDLGIILHPGSYCRDLWNILDATVVICALVAFIMGQKPSPTGNKLRGSSAKNLNTIKSLRVLRVLRPLKTINRVPKLKAVFDCVVSSLKNVFNILIVYILFQFIFAVIAVQLFQGKF----FYCNDASKSSRE-----------TCRGYFFDYAGRSTPETKKRLWQHHD---FHFDNILYAMLTLFTVTTGEGWPTVL 3856
            P+  +  P    +++FI +  N +R++  F++    F+  +++ I A+ + LA E+  P  +K++    LE  +  F  +F VE  LKI+ LG++LH  SY R++WNI+D  VV+       M Q P   G ++          +++LR +RVLRPLK ++ +P L+ V   ++ ++  +  I ++ +    IFA+I ++ + G      +   D +K  +E                   +   +T       W+  +     FDNI +AMLT+F   T EGW  +L
Sbjct:    4 PKKEENPPGGGPTSLFILTEDNPIRKYTRFIIEWPPFEYAVLLTIIANCVVLALEEHLPGGDKTVLAQKLEKTEAYFLCIFCVEASLKILALGLVLHKHSYLRNIWNIMDFFVVVTGF----MTQYPQ-IGPEV---------DLRTLRAIRVLRPLKLVSGIPSLQVVLKSIIKAMAPLLQIGLLVLFAIVIFAIIGLEFYSGALHKTCYSLEDPNKLVKEGESETPCNTDNILEKATGSFVCNNTTSMCLEKWEGPNSGITSFDNIGFAMLTVFQCITMEGWTAIL 277          

HSP 5 Score: 97.4413 bits (241), Expect = 1.695e-19
Identity = 72/258 (27.91%), Postives = 137/258 (53.10%), Query Frame = 2
Query: 1979 FRFSVRRLVKSQPFYWAVIILVFFNTVCVAIEHYEQGKWLTLFLNYAEYVFLCLFMMEMMIKMYGLSIRVYFQSSFNIFDCVVIAGSLFEIIYGIFVQDS-SFGLSVLRALRLLRIFKVTRYWAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMQLFGGEFNFEEGKPPQ-----NFDTFVKALLTVFQILTGEDWNTVMYNGIQSKG---------GVKERGTVFSIYFVLLVVFGNYTLLNVFLAIAVDNL 2707
            F++ V R+V S PF + +++L+ FNT+ + ++++ QG      L Y    F  +F +E ++K+ G  ++ +F+  +NIFD + + GS+ + ++  F  DS S  +  LR  R  R+ K+ R   ++R L+ + + S +++  +  L+ +   I+A++GMQ+FG   N       Q     NF +F   ++ +F+  TGE W  +M   ++ K          G     T+   YFV  + F ++ +LN+F+A+ +DN 
Sbjct: 1084 FKYKVWRIVVSTPFEYFIMMLIVFNTLLLMMKYHNQGDMYEKSLKYINMGFTGMFSVETVLKIIGFGVKNFFKDPWNIFDLITVLGSIVDALWMEFGHDSNSINVGFLRLFRAARLIKLLRQGYTIRILLWTFVQSFKALPYVCLLIAMLFFIYAIIGMQVFG---NIRYDPDTQLNRHNNFQSFSGGIMLLFRCATGEAWPNIMLACLKGKACDDDAEKAPGEYCGSTLAYAYFVSFIFFCSFLMLNLFVAVIMDNF 1338          

HSP 6 Score: 78.5666 bits (192), Expect = 9.302e-14
Identity = 69/293 (23.55%), Postives = 126/293 (43.00%), Query Frame = 2
Query:  767 PFEYMVLLTILANCIVLSMERHLPKKDKTLLAGQLELTEKYFLGIFCVEALLKIVALGFCCHKEAYLRNVWNIMDFVVVVTGFLMMFLNIDNHSDSSTVDLRTLRAVRVLRPLKLVAGFPSLQVVLKSIIRAMAPLLQIGLLVLFAITIFAIIGLEFYSGAFHYTCFKANSDKLPLPIPTEKSLVPCSNSKNGSGLGAYTCPEDYQCKAYWEGPNYGITSFDNIGYAMLTVFQCITMEGWTDIMYHT-------NDA-------IGNRFNWLYFVPLIILGSFFMLNLVLGVL 1603
            PFEY +++ I+ N ++L M+ H       +    L+     F G+F VE +LKI+  G     + + ++ WNI D + V+ G ++  L ++   DS+++++  LR  R  R +KL+    +++++L + +++   L  + LL+     I+AIIG++ + G   Y                                       D Q   +         +F +    ++ +F+C T E W +IM          +DA        G+   + YFV  I   SF MLNL + V+
Sbjct: 1096 PFEYFIMMLIVFNTLLLMMKYH---NQGDMYEKSLKYINMGFTGMFSVETVLKIIGFGV----KNFFKDPWNIFDLITVL-GSIVDALWMEFGHDSNSINVGFLRLFRAARLIKLLRQGYTIRILLWTFVQSFKALPYVCLLIAMLFFIYAIIGMQVF-GNIRYD-------------------------------------PDTQLNRH--------NNFQSFSGGIMLLFRCATGEAWPNIMLACLKGKACDDDAEKAPGEYCGSTLAYAYFVSFIFFCSFLMLNLFVAVI 1334          

HSP 7 Score: 72.7886 bits (177), Expect = 4.379e-12
Identity = 80/306 (26.14%), Postives = 137/306 (44.77%), Query Frame = 2
Query: 4043 KNQKQCIDFAINEKPLCRYMPKDKTTIKYRVW-RLVVSTP-FEYFIMVMIALNTLILMMKYYREEKKASSAATHDREQQAYLN---YCNTLIFLNSAFTVMFSIECVLKIMAFGPKNYFRDPWNIFDFITVIGSITDVLVSELQDXXXXXXXXXXXXXXXXXXXXXXQGYTIRILLWTFIQSFKALPYVCLLIAMLFFIYSIIGMQVFGNIKLISEYQIN-----RHNNFQTFTNGLLLLFRCATGESWQEIMLACDNNKPCEKDIENTNNFDCGSNFTYIYFVSFIFLCSFLMLNLFVAVIMDNF 4930
            K Q  C  F   EK             ++R W R  V T  F +F++V++ LNT+ + +++Y               Q ++L    Y    IFL      +F  E  +K+ A GP+ YF   +N FD + + GSI +V+ SE++  SF       L              ++R L+ + + S +++  +  L+ +   I++++GMQ+FG        Q N        NF TF   LL +F+  TGE W E+M          + I +      G  ++ IYF+  +   ++ +LN+F+A+ +DN 
Sbjct:  415 KPQGSCTGFWRAEK-------------RFRFWIRHTVKTQWFYWFVIVLVFLNTVCVAVEHY--------------GQPSFLTEFLYYAEFIFLG-----LFMSEMFIKMYALGPRIYFESSFNRFDCVVISGSIFEVIWSEVKGGSFGLSVLRALRLLRIFKVTKYWS-SLRNLVISLLNSMRSIISLLFLLFLFILIFALLGMQLFGG-------QFNLPGGTPETNFNTFPIALLTVFQILTGEDWNEVMY---------QGIISQGGAQKGMIYS-IYFIVLVLFGNYTLLNVFLAIAVDNL 670          
BLAST of Voltage dependent L type calcium channel subunit vs. Ensembl Fly
Match: cac (gene:FBgn0263111 transcript:FBtr0307313)

HSP 1 Score: 993.801 bits (2568), Expect = 0.000e+0
Identity = 558/976 (57.17%), Postives = 677/976 (69.36%), Query Frame = 2
Query: 3071 KPVLPYSAMFIFSPLNSLRRFCHFVVNLRYFDLFIMIVICASSIALAAEDPVKEKSLKNNILEFFDYAFTGVFTVEMILKIIDLGIILHPGSYCRDLWNILDATVVICALVAFIMGQKPSPTGNKLRGSSA-KNLNTIKSLRVLRVLRPLKTINRVPKLKAVFDCVVSSLKNVFNILIVYILFQFIFAVIAVQLFQGKFFYCNDASKSSRETCRGYFFDYAGRST-PETKKRLWQHHDFHFDNILYAMLTLFTVTTGEGWPTVLKNSMESTNIDNGPIADYRQEMAXXXXXXXXXXXXXXXXXXXALIIITFQEQGENELIDLDLDKNQKQCIDFAINEKPLCRYMPKDKTTIKYRVWRLVVSTPFEYFIMVMIALNTLILMMKYYREEKKASSAATHDREQQAYLNYCNTLIFLNSAFTVMFSIECVLKIMAFGPKNYFRDPWNIFDFITVIGSITDVLVSELQDXXXXXXXXXXXXXXXXXXXXXXQGYTIRILLWTFIQSFKALPYVCLLIAMLFFIYSIIGMQVFGNIKLIS-EYQINRHNNFQTFTNGLLLLFRCATGESWQEIMLACDNNKPCEKDIENTNNFDCGSNFTYIYFVSFIFLCSFLMLNLFVAVIMDNFDYLTRDSSILGPHHLDEYIRVWAEYDPGAIGRIHHSEMYEMLRNMEPPVGFGKKCPYRLAYRKLIRMNMPVDENGTVNFTTTLFALIRESLNIKMSTAEYMDIKDMELRQTICKMWPVQAKKKLNLIVPPDSELVFHKMTVGKIYAGYLIVENWRAYKNSQEQGPRSSPAVSIKSVTKPVVKEEKSANLLAKFFVAFKSNTNKSNISLDSHHERDEERFSIDHTYGEDYDANRRYSYLRRGSKP---------RGSKEIYSDLTPTQDYSYGLRPEHATIPGMPAPRKFGNRPRSPMYSLSELETKDRANTPQSLNSTIS---------PTSGDRESDKFHRRSPAVSPSNPQ 5935
            KP+LPYS+MFI SP N +RR  H+VVNL YFD FIM+VI  SSIALAAEDPV+E S +N IL +FDYAFTGVFT+EM+LKI+DLG+ILHPGSY R+ WNI+DA VVICA V+F         G  + GSSA +NL+TIKSLRVLRVLRPLKTI RVPKLKAVFDCVV+SLKNV NILIVYILFQFIF+VI VQLF GKFFYC D SK +   C+G +F Y      P+ + R+W+   FH+DN+  AMLTLF V TGEGWP VL++SM +T  D GPI ++R EM+IFYIV+FIVFPFFFVNIFVALIIITFQEQGE EL D ++DKNQK CIDF I  +PL RYMPK++ T KY+VWR+VVSTPFEYFIM++I  NTL+LMMKY+ +                   Y  +L ++N  FT MFS+E VLKI+ FG KN+F+DPWNIFD ITV+GSI D L  E  DS+ +++GFLRLFRAARLIKLLRQGYTIRILLWTF+QSFKALPYVCLLIAMLFFIY+IIGMQVFGNIKL + E  I RHNNFQ+F  G++LLFRCATGE+W  IMLAC   K C+ D E      CGS   Y YFVSFIF CSFLMLNLFVAVIMDNFDYLTRDSSILG HHLDE++R+WAEYDP A G+IH++EMY+ML+NM+PP+GFG KCP RLAY+KLIRMNMP+D+   V FTTTLFALIRE+L+IKM   E MD  DMELR+TI  +WP+QAKK LNL+VPP  +L   K++VGKIYAG+LI+E+WR+ +  Q       P + ++  ++   +E  +                            D       H+Y    + +RR   LR    P         RG + I+ D+  +   S  +     T      PR   + PR P  S S   +  R+ +P      +S         PT G   +    +RS + SP+  Q
Sbjct:  741 KPMLPYSSMFILSPTNPIRRGAHWVVNLPYFDFFIMVVISMSSIALAAEDPVRENSRRNKILNYFDYAFTGVFTIEMLLKIVDLGVILHPGSYLREFWNIMDAVVVICAAVSF---------GFDMSGSSAGQNLSTIKSLRVLRVLRPLKTIKRVPKLKAVFDCVVNSLKNVVNILIVYILFQFIFSVIGVQLFNGKFFYCTDESKHTSAECQGSYFKYEEDELLPKQELRVWKPRAFHYDNVAAAMLTLFAVQTGEGWPQVLQHSMAATYEDRGPIQNFRIEMSIFYIVYFIVFPFFFVNIFVALIIITFQEQGEAELQDGEIDKNQKSCIDFTIGARPLERYMPKNRNTFKYKVWRIVVSTPFEYFIMMLIVFNTLLLMMKYHNQGDM----------------YEKSLKYINMGFTGMFSVETVLKIIGFGVKNFFKDPWNIFDLITVLGSIVDALWMEFGDSNSINVGFLRLFRAARLIKLLRQGYTIRILLWTFVQSFKALPYVCLLIAMLFFIYAIIGMQVFGNIKLGTVENSITRHNNFQSFIQGVMLLFRCATGEAWPNIMLACLKGKACDDDAEKAPGEYCGSTLAYAYFVSFIFFCSFLMLNLFVAVIMDNFDYLTRDSSILGAHHLDEFVRIWAEYDPNATGKIHYTEMYDMLKNMDPPLGFGNKCPNRLAYKKLIRMNMPLDDELRVQFTTTLFALIRENLSIKMRAPEEMDQADMELRETITNIWPLQAKKMLNLLVPPSDQLNKGKLSVGKIYAGFLILESWRSTRFGQLDS--GMPMLELQDASRHPSQESLTG--------------------------ADAGHLHPGHSY---MNGHRRSPSLRHNGSPLARSPSPRRRGHQYIHHDIGFSDTVSNVVEMVKET----RHPRHGNSHPRYPRGSWSASTSPARSPSPSRYGGHLSRSKRTQLPYPTYG---TTSLCQRSRSPSPARLQ 1653          

HSP 2 Score: 747.273 bits (1928), Expect = 0.000e+0
Identity = 444/677 (65.58%), Postives = 522/677 (77.10%), Query Frame = 2
Query:  701 SLFIFSEENVIRKYAKIIIEWGPFEYMVLLTILANCIVLSMERHLPKKDKTLLAGQLELTEKYFLGIFCVEALLKIVALGFCCHKEAYLRNVWNIMDFVVVVTGFLMMFL--NIDNHSDSSTVDLRTLRAVRVLRPLKLVAGFPSLQVVLKSIIRAMAPLLQIGLLVLFAITIFAIIGLEFYSGAFHYTCFK-ANSDKLPLPIPTEKSLVPCSNSKN--GSGLGAYTCPEDYQ-CKAYWEGPNYGITSFDNIGYAMLTVFQCITMEGWTDIMYHTNDAIGNRFNWLYFVPLIILGSFFMLNLVLGVLSGXXXXXXXXXXXXXXXLKLRRQQQTEKEFNGYMEWIQKAEEVLLNEATTTSEDKMRIIAARRRAEKQKYKLLGKNQSIPDFEYEDTELYSETKSMKGNIFIRSYAGIRRRRKERCTSFWRTEKHFRFSVRRLVKSQPFYWAVIILVFFNTVCVAIEHYEQGKWLTLFLNYAEYVFLCLFMMEMMIKMYGLSIRVYFQSSFNIFDCVVIAGSLFEIIYGIFVQDSSFGLSVLRALRLLRIFKVTRYWAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMQLFGGEFNFEEGKPPQNFDTFVKALLTVFQILTGEDWNTVMYNGIQSKGGVKERGTVFSIYFVLLVVFGNYTLLNVFLAIAVDNLAN 2713
            SLFI +E+N IRKY + IIEW PFEY VLLTI+ANC+VL++E HLP  DKT+LA +LE TE YFL IFCVEA LKI+ALG   HK +YLRN+WNIMDF VVVTG + +F   NID       VDLR LR+ RVLRPLKLV+  PSLQVVLKSII+AMAPLLQIGLLVLFAI IFAIIGLEFYSGA H TC+   + +KL   +   +S  PC N+ N      G++ C      C   WEGPN GITSFDNIG+AMLTVFQCITMEGWT I+Y TNDA+G+ FNW+YFVPLI++GSFFMLNLVLGVLSGEFAKERE+VE R+ FLKLRRQQQ E+E NGY+EWI KAEEV+L E  TT E+KM I+ ARRR   ++ KL    +S    +  DTE     +    + ++++    R + +  CT FWR EK FRF +R  VK+Q FYW VI+LVF NTVCVA+EHY Q  +LT FL YAE++FL LFM EM IKMY L  R+YF+SSFN FDCVVI+GS+FE+I+   V+  SFGLSVLRALRLLRIFKVT+YW+SLRNLV+SLLNSMRSIISLLFLLFLFILIFALLGMQLFGG+FN   G P  NF+TF  ALLTVFQILTGEDWN VMY GI S+GG  ++G ++SIYF++LV+FGNYTLLNVFLAIAVDNLAN
Sbjct:   17 SLFILTEDNPIRKYTRFIIEWPPFEYAVLLTIIANCVVLALEEHLPGGDKTVLAQKLEKTEAYFLCIFCVEASLKILALGLVLHKHSYLRNIWNIMDFFVVVTGAMTIFAEANID-------VDLRMLRSFRVLRPLKLVSRIPSLQVVLKSIIKAMAPLLQIGLLVLFAIVIFAIIGLEFYSGALHKTCYSLEDPNKL---VKEGESETPC-NTDNILEKATGSFVCNNTTSMCLEKWEGPNSGITSFDNIGFAMLTVFQCITMEGWTAILYWTNDALGSAFNWIYFVPLIVIGSFFMLNLVLGVLSGEFAKEREKVENRQEFLKLRRQQQLERELNGYVEWICKAEEVILAEERTTEEEKMHIMEARRRNAAKRKKLKSLGKS----KSTDTEEEEAEEDYGDDGYLKT----RSKPQGSCTGFWRAEKRFRFWIRHTVKTQWFYWFVIVLVFLNTVCVAVEHYGQPSFLTEFLYYAEFIFLGLFMSEMFIKMYALGPRIYFESSFNRFDCVVISGSIFEVIWSE-VKGGSFGLSVLRALRLLRIFKVTKYWSSLRNLVISLLNSMRSIISLLFLLFLFILIFALLGMQLFGGQFNLPGGTPETNFNTFPIALLTVFQILTGEDWNEVMYQGIISQGGA-QKGMIYSIYFIVLVLFGNYTLLNVFLAIAVDNLAN 672          

HSP 3 Score: 117.472 bits (293), Expect = 1.432e-25
Identity = 79/275 (28.73%), Postives = 136/275 (49.45%), Query Frame = 2
Query:  701 SLFIFSEENVIRKYAKIIIEWGPFEYMVLLTILANCIVLSMERHLPKKDKTLLAGQLELTEKYFLGIFCVEALLKIVALGFCCHKEAYLRNVWNIMDFVVVVTGFLMMFLNIDNHSDSSTVD-LRTLRAVRVLRPLKLVAGFPSLQVVLKSIIRAMAPLLQIGLLVLFAITIFAIIGLEFYSGAFHYTCFKANSDKLPLPIPTEKSLVPCSNSKNGSGLGAYTCPEDYQCKAYWEGPNYGITSF--DNIGYAMLTVFQCITMEGWTDIMYHTNDA 1516
            S+FI S  N IR+ A  ++    F++ +++ I  + I L+ E   P ++ +     L   +  F G+F +E LLKIV LG   H  +YLR  WNIMD VVV+   +    ++   S    +  +++LR +RVLRPLK +   P L+ V   ++ ++  ++ I ++ +    IF++IG++ ++G F Y      +D+              S   +    G+Y   E+ +     E   +   +F  DN+  AMLT+F   T EGW  ++ H+  A
Sbjct:  748 SMFILSPTNPIRRGAHWVVNLPYFDFFIMVVISMSSIALAAED--PVRENSRRNKILNYFDYAFTGVFTIEMLLKIVDLGVILHPGSYLREFWNIMDAVVVICAAVSFGFDMSGSSAGQNLSTIKSLRVLRVLRPLKTIKRVPKLKAVFDCVVNSLKNVVNILIVYILFQFIFSVIGVQLFNGKFFYC-----TDE--------------SKHTSAECQGSYFKYEEDELLPKQELRVWKPRAFHYDNVAAAMLTLFAVQTGEGWPQVLQHSMAA 1001          

HSP 4 Score: 112.079 bits (279), Expect = 5.347e-24
Identity = 78/288 (27.08%), Postives = 137/288 (47.57%), Query Frame = 2
Query: 3053 PETIQRKPVLPYSAMFIFSPLNSLRRFCHFVVNLRYFDLFIMIVICASSIALAAED--PVKEKSLKNNILEFFDYAFTGVFTVEMILKIIDLGIILHPGSYCRDLWNILDATVVICALVAFIMGQKPSPTGNKLRGSSAKNLNTIKSLRVLRVLRPLKTINRVPKLKAVFDCVVSSLKNVFNILIVYILFQFIFAVIAVQLFQGKF----FYCNDASKSSRE-----------TCRGYFFDYAGRSTPETKKRLWQHHD---FHFDNILYAMLTLFTVTTGEGWPTVL 3856
            P+  +  P    +++FI +  N +R++  F++    F+  +++ I A+ + LA E+  P  +K++    LE  +  F  +F VE  LKI+ LG++LH  SY R++WNI+D  VV+              TG     + A     ++ LR  RVLRPLK ++R+P L+ V   ++ ++  +  I ++ +    IFA+I ++ + G      +   D +K  +E                   +   +T       W+  +     FDNI +AMLT+F   T EGW  +L
Sbjct:    4 PKKEENPPGGGPTSLFILTEDNPIRKYTRFIIEWPPFEYAVLLTIIANCVVLALEEHLPGGDKTVLAQKLEKTEAYFLCIFCVEASLKILALGLVLHKHSYLRNIWNIMDFFVVV--------------TGAMTIFAEANIDVDLRMLRSFRVLRPLKLVSRIPSLQVVLKSIIKAMAPLLQIGLLVLFAIVIFAIIGLEFYSGALHKTCYSLEDPNKLVKEGESETPCNTDNILEKATGSFVCNNTTSMCLEKWEGPNSGITSFDNIGFAMLTVFQCITMEGWTAIL 277          

HSP 5 Score: 98.9821 bits (245), Expect = 4.862e-20
Identity = 70/258 (27.13%), Postives = 139/258 (53.88%), Query Frame = 2
Query: 1979 FRFSVRRLVKSQPFYWAVIILVFFNTVCVAIEHYEQGKWLTLFLNYAEYVFLCLFMMEMMIKMYGLSIRVYFQSSFNIFDCVVIAGSLFEIIYGIFVQDSSFGLSVLRALRLLRIFKVTRYWAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMQLFGGEFNFEEGKPP------QNFDTFVKALLTVFQILTGEDWNTVMYNGIQSKG---------GVKERGTVFSIYFVLLVVFGNYTLLNVFLAIAVDNL 2707
            F++ V R+V S PF + +++L+ FNT+ + ++++ QG      L Y    F  +F +E ++K+ G  ++ +F+  +NIFD + + GS+ + ++  F   +S  +  LR  R  R+ K+ R   ++R L+ + + S +++  +  L+ +   I+A++GMQ+FG   N + G          NF +F++ ++ +F+  TGE W  +M   ++ K          G     T+   YFV  + F ++ +LN+F+A+ +DN 
Sbjct: 1084 FKYKVWRIVVSTPFEYFIMMLIVFNTLLLMMKYHNQGDMYEKSLKYINMGFTGMFSVETVLKIIGFGVKNFFKDPWNIFDLITVLGSIVDALWMEFGDSNSINVGFLRLFRAARLIKLLRQGYTIRILLWTFVQSFKALPYVCLLIAMLFFIYAIIGMQVFG---NIKLGTVENSITRHNNFQSFIQGVMLLFRCATGEAWPNIMLACLKGKACDDDAEKAPGEYCGSTLAYAYFVSFIFFCSFLMLNLFVAVIMDNF 1338          

HSP 6 Score: 75.0998 bits (183), Expect = 9.221e-13
Identity = 71/297 (23.91%), Postives = 127/297 (42.76%), Query Frame = 2
Query:  767 PFEYMVLLTILANCIVLSMERHLPKKDKTLLAGQLELTEKYFLGIFCVEALLKIVALGFCCHKEAYLRNVWNIMDFVVV----VTGFLMMFLNIDNHSDSSTVDLRTLRAVRVLRPLKLVAGFPSLQVVLKSIIRAMAPLLQIGLLVLFAITIFAIIGLEFYSGAFHYTCFKANSDKLPLPIPTEKSLVPCSNSKNGSGLGAYTCPEDYQCKAYWEGPNYGITSFDNIGYAMLTVFQCITMEGWTDIMYHT-------NDA-------IGNRFNWLYFVPLIILGSFFMLNLVLGVL 1603
            PFEY +++ I+ N ++L M+ H       +    L+     F G+F VE +LKI+  G     + + ++ WNI D + V    V    M F       DS+++++  LR  R  R +KL+    +++++L + +++   L  + LL+     I+AIIG++ +                              N K G+   + T   ++Q  ++ +G              ++ +F+C T E W +IM          +DA        G+   + YFV  I   SF MLNL + V+
Sbjct: 1096 PFEYFIMMLIVFNTLLLMMKYH---NQGDMYEKSLKYINMGFTGMFSVETVLKIIGFGV----KNFFKDPWNIFDLITVLGSIVDALWMEF------GDSNSINVGFLRLFRAARLIKLLRQGYTIRILLWTFVQSFKALPYVCLLIAMLFFIYAIIGMQVF-----------------------------GNIKLGTVENSITRHNNFQ--SFIQG--------------VMLLFRCATGEAWPNIMLACLKGKACDDDAEKAPGEYCGSTLAYAYFVSFIFFCSFLMLNLFVAVI 1334          

HSP 7 Score: 72.4034 bits (176), Expect = 6.274e-12
Identity = 80/307 (26.06%), Postives = 137/307 (44.63%), Query Frame = 2
Query: 4040 DKNQKQCIDFAINEKPLCRYMPKDKTTIKYRVW-RLVVSTP-FEYFIMVMIALNTLILMMKYYREEKKASSAATHDREQQAYLN---YCNTLIFLNSAFTVMFSIECVLKIMAFGPKNYFRDPWNIFDFITVIGSITDVLVSELQDXXXXXXXXXXXXXXXXXXXXXXQGYTIRILLWTFIQSFKALPYVCLLIAMLFFIYSIIGMQVFGNIKLISEYQIN-----RHNNFQTFTNGLLLLFRCATGESWQEIMLACDNNKPCEKDIENTNNFDCGSNFTYIYFVSFIFLCSFLMLNLFVAVIMDNF 4930
             K Q  C  F   EK             ++R W R  V T  F +F++V++ LNT+ + +++Y               Q ++L    Y    IFL      +F  E  +K+ A GP+ YF   +N FD + + GSI +V+ SE++  SF       L              ++R L+ + + S +++  +  L+ +   I++++GMQ+FG        Q N        NF TF   LL +F+  TGE W E+M          + I +      G  ++ IYF+  +   ++ +LN+F+A+ +DN 
Sbjct:  414 SKPQGSCTGFWRAEK-------------RFRFWIRHTVKTQWFYWFVIVLVFLNTVCVAVEHY--------------GQPSFLTEFLYYAEFIFLG-----LFMSEMFIKMYALGPRIYFESSFNRFDCVVISGSIFEVIWSEVKGGSFGLSVLRALRLLRIFKVTKYWS-SLRNLVISLLNSMRSIISLLFLLFLFILIFALLGMQLFGG-------QFNLPGGTPETNFNTFPIALLTVFQILTGEDWNEVMY---------QGIISQGGAQKGMIYS-IYFIVLVLFGNYTLLNVFLAIAVDNL 670          
BLAST of Voltage dependent L type calcium channel subunit vs. Ensembl Fly
Match: cac (gene:FBgn0263111 transcript:FBtr0307314)

HSP 1 Score: 993.416 bits (2567), Expect = 0.000e+0
Identity = 558/976 (57.17%), Postives = 677/976 (69.36%), Query Frame = 2
Query: 3071 KPVLPYSAMFIFSPLNSLRRFCHFVVNLRYFDLFIMIVICASSIALAAEDPVKEKSLKNNILEFFDYAFTGVFTVEMILKIIDLGIILHPGSYCRDLWNILDATVVICALVAFIMGQKPSPTGNKLRGSSA-KNLNTIKSLRVLRVLRPLKTINRVPKLKAVFDCVVSSLKNVFNILIVYILFQFIFAVIAVQLFQGKFFYCNDASKSSRETCRGYFFDYAGRST-PETKKRLWQHHDFHFDNILYAMLTLFTVTTGEGWPTVLKNSMESTNIDNGPIADYRQEMAXXXXXXXXXXXXXXXXXXXALIIITFQEQGENELIDLDLDKNQKQCIDFAINEKPLCRYMPKDKTTIKYRVWRLVVSTPFEYFIMVMIALNTLILMMKYYREEKKASSAATHDREQQAYLNYCNTLIFLNSAFTVMFSIECVLKIMAFGPKNYFRDPWNIFDFITVIGSITDVLVSELQDXXXXXXXXXXXXXXXXXXXXXXQGYTIRILLWTFIQSFKALPYVCLLIAMLFFIYSIIGMQVFGNIKLIS-EYQINRHNNFQTFTNGLLLLFRCATGESWQEIMLACDNNKPCEKDIENTNNFDCGSNFTYIYFVSFIFLCSFLMLNLFVAVIMDNFDYLTRDSSILGPHHLDEYIRVWAEYDPGAIGRIHHSEMYEMLRNMEPPVGFGKKCPYRLAYRKLIRMNMPVDENGTVNFTTTLFALIRESLNIKMSTAEYMDIKDMELRQTICKMWPVQAKKKLNLIVPPDSELVFHKMTVGKIYAGYLIVENWRAYKNSQEQGPRSSPAVSIKSVTKPVVKEEKSANLLAKFFVAFKSNTNKSNISLDSHHERDEERFSIDHTYGEDYDANRRYSYLRRGSKP---------RGSKEIYSDLTPTQDYSYGLRPEHATIPGMPAPRKFGNRPRSPMYSLSELETKDRANTPQSLNSTIS---------PTSGDRESDKFHRRSPAVSPSNPQ 5935
            KP+LPYS+MFI SP N +RR  H+VVNL YFD FIM+VI  SSIALAAEDPV+E S +N IL +FDYAFTGVFT+EM+LKI+DLG+ILHPGSY R+ WNI+DA VVICA V+F         G  + GSSA +NL+TIKSLRVLRVLRPLKTI RVPKLKAVFDCVV+SLKNV NILIVYILFQFIF+VI VQLF GKFFYC D SK +   C+G +F Y      P+ + R+W+   FH+DN+  AMLTLF V TGEGWP VL++SM +T  D GPI ++R EM+IFYIV+FIVFPFFFVNIFVALIIITFQEQGE EL D ++DKNQK CIDF I  +PL RYMPK++ T KY+VWR+VVSTPFEYFIM++I  NTL+LMMKY+ +                   Y  +L ++N  FT MFS+E VLKI+ FG KN+F+DPWNIFD ITV+GSI D L  E  DS+ +++GFLRLFRAARLIKLLRQGYTIRILLWTF+QSFKALPYVCLLIAMLFFIY+IIGMQVFGNIKL + E  I RHNNFQ+F  G++LLFRCATGE+W  IMLAC   K C+ D E      CGS   Y YFVSFIF CSFLMLNLFVAVIMDNFDYLTRDSSILG HHLDE++R+WAEYDP A G+IH++EMY+ML+NM+PP+GFG KCP RLAY+KLIRMNMP+D+   V FTTTLFALIRE+L+IKM   E MD  DMELR+TI  +WP+QAKK LNL+VPP  +L   K++VGKIYAG+LI+E+WR+ +  Q       P + ++  ++   +E  +                            D       H+Y    + +RR   LR    P         RG + I+ D+  +   S  +     T      PR   + PR P  S S   +  R+ +P      +S         PT G   +    +RS + SP+  Q
Sbjct:  741 KPMLPYSSMFILSPTNPIRRGAHWVVNLPYFDFFIMVVISMSSIALAAEDPVRENSRRNKILNYFDYAFTGVFTIEMLLKIVDLGVILHPGSYLREFWNIMDAVVVICAAVSF---------GFDMSGSSAGQNLSTIKSLRVLRVLRPLKTIKRVPKLKAVFDCVVNSLKNVVNILIVYILFQFIFSVIGVQLFNGKFFYCTDESKHTSAECQGSYFKYEEDELLPKQELRVWKPRAFHYDNVAAAMLTLFAVQTGEGWPQVLQHSMAATYEDRGPIQNFRIEMSIFYIVYFIVFPFFFVNIFVALIIITFQEQGEAELQDGEIDKNQKSCIDFTIGARPLERYMPKNRNTFKYKVWRIVVSTPFEYFIMMLIVFNTLLLMMKYHNQGDM----------------YEKSLKYINMGFTGMFSVETVLKIIGFGVKNFFKDPWNIFDLITVLGSIVDALWMEFGDSNSINVGFLRLFRAARLIKLLRQGYTIRILLWTFVQSFKALPYVCLLIAMLFFIYAIIGMQVFGNIKLGTVENSITRHNNFQSFIQGVMLLFRCATGEAWPNIMLACLKGKACDDDAEKAPGEYCGSTLAYAYFVSFIFFCSFLMLNLFVAVIMDNFDYLTRDSSILGAHHLDEFVRIWAEYDPNATGKIHYTEMYDMLKNMDPPLGFGNKCPNRLAYKKLIRMNMPLDDELRVQFTTTLFALIRENLSIKMRAPEEMDQADMELRETITNIWPLQAKKMLNLLVPPSDQLNKGKLSVGKIYAGFLILESWRSTRFGQLDS--GMPMLELQDASRHPSQESLTG--------------------------ADAGHLHPGHSY---MNGHRRSPSLRHNGSPLARSPSPRRRGHQYIHHDIGFSDTVSNVVEMVKET----RHPRHGNSHPRYPRGSWSASTSPARSPSPSRYGGHLSRSKRTQLPYPTYG---TTSLCQRSRSPSPARLQ 1653          

HSP 2 Score: 729.554 bits (1882), Expect = 0.000e+0
Identity = 431/675 (63.85%), Postives = 512/675 (75.85%), Query Frame = 2
Query:  701 SLFIFSEENVIRKYAKIIIEWGPFEYMVLLTILANCIVLSMERHLPKKDKTLLAGQLELTEKYFLGIFCVEALLKIVALGFCCHKEAYLRNVWNIMDFVVVVTGFLMMFLNIDNHSDSSTVDLRTLRAVRVLRPLKLVAGFPSLQVVLKSIIRAMAPLLQIGLLVLFAITIFAIIGLEFYSGAFHYTCFK-ANSDKLPLPIPTEKSLVPCSNSKN--GSGLGAYTCPEDYQ-CKAYWEGPNYGITSFDNIGYAMLTVFQCITMEGWTDIMYHTNDAIGNRFNWLYFVPLIILGSFFMLNLVLGVLSGXXXXXXXXXXXXXXXLKLRRQQQTEKEFNGYMEWIQKAEEVLLNEATTTSEDKMRIIAARRRAEKQKYKLLGKNQSIPDFEYEDTELYSETKSMKGNIFIRSYAGIRRRRKERCTSFWRTEKHFRFSVRRLVKSQPFYWAVIILVFFNTVCVAIEHYEQGKWLTLFLNYAEYVFLCLFMMEMMIKMYGLSIRVYFQSSFNIFDCVVIAGSLFEIIYGIFVQDSSFGLSVLRALRLLRIFKVTRYWAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMQLFGGEFNFEEGKPPQNFDTFVKALLTVFQILTGEDWNTVMYNGIQSKGGVKERGTVFSIYFVLLVVFGNYTLLNVFLAIAVDNLAN 2713
            SLFI +E+N IRKY + IIEW PFEY VLLTI+ANC+VL++E HLP  DKT+LA +LE TE YFL IFCVEA LKI+ALG   HK +YLRN+WNIMDF VVVTGF+  +  I        VDLRTLRA+RVLRPLKLV+G PSLQVVLKSII+AMAPLLQIGLLVLFAI IFAIIGLEFYSGA H TC+   + +KL   +   +S  PC N+ N      G++ C      C   WEGPN GITSFDNIG+AMLTVFQCITMEGWT I+Y TNDA+G+ FNW+YFVPLI++GSFFMLNLVLGVLSGEF+ ER RVE+R  F K R +   +     Y++WI +AEEV+L E  TT E+KM I+ ARRR   ++ KL    +S    +  DTE     +    + ++++    R + +  CT FWR EK FRF +R  VK+Q FYW VI+LVF NTVCVA+EHY Q  +LT FL YAE++FL LFM EM IKMY L  R+YF+SSFN FDCVVI+GS+FE+I+   V+  SFGLSVLRALRLLRIFKVT+YW+SLRNLV+SLLNSMRSIISLLFLLFLFILIFALLGMQLFGG+FN   G P  NF+TF  ALLTVFQILTGEDWN VMY GI S+GG  ++G ++SIYF++LV+FGNYTLLNVFLAIAVDNLAN
Sbjct:   17 SLFILTEDNPIRKYTRFIIEWPPFEYAVLLTIIANCVVLALEEHLPGGDKTVLAQKLEKTEAYFLCIFCVEASLKILALGLVLHKHSYLRNIWNIMDFFVVVTGFMTQYPQI-----GPEVDLRTLRAIRVLRPLKLVSGIPSLQVVLKSIIKAMAPLLQIGLLVLFAIVIFAIIGLEFYSGALHKTCYSLEDPNKL---VKEGESETPC-NTDNILEKATGSFVCNNTTSMCLEKWEGPNSGITSFDNIGFAMLTVFQCITMEGWTAILYWTNDALGSAFNWIYFVPLIVIGSFFMLNLVLGVLSGEFSNERNRVERRMEFQKCRFRAMFQTAMVSYLDWITQAEEVILAEERTTEEEKMHIMEARRRNAAKRKKLKSLGKS----KSTDTEEEEAEEDYGDDGYLKT----RSKPQGSCTGFWRAEKRFRFWIRHTVKTQWFYWFVIVLVFLNTVCVAVEHYGQPSFLTEFLYYAEFIFLGLFMSEMFIKMYALGPRIYFESSFNRFDCVVISGSIFEVIWSE-VKGGSFGLSVLRALRLLRIFKVTKYWSSLRNLVISLLNSMRSIISLLFLLFLFILIFALLGMQLFGGQFNLPGGTPETNFNTFPIALLTVFQILTGEDWNEVMYQGIISQGGA-QKGMIYSIYFIVLVLFGNYTLLNVFLAIAVDNLAN 672          

HSP 3 Score: 117.087 bits (292), Expect = 1.519e-25
Identity = 79/275 (28.73%), Postives = 136/275 (49.45%), Query Frame = 2
Query:  701 SLFIFSEENVIRKYAKIIIEWGPFEYMVLLTILANCIVLSMERHLPKKDKTLLAGQLELTEKYFLGIFCVEALLKIVALGFCCHKEAYLRNVWNIMDFVVVVTGFLMMFLNIDNHSDSSTVD-LRTLRAVRVLRPLKLVAGFPSLQVVLKSIIRAMAPLLQIGLLVLFAITIFAIIGLEFYSGAFHYTCFKANSDKLPLPIPTEKSLVPCSNSKNGSGLGAYTCPEDYQCKAYWEGPNYGITSF--DNIGYAMLTVFQCITMEGWTDIMYHTNDA 1516
            S+FI S  N IR+ A  ++    F++ +++ I  + I L+ E   P ++ +     L   +  F G+F +E LLKIV LG   H  +YLR  WNIMD VVV+   +    ++   S    +  +++LR +RVLRPLK +   P L+ V   ++ ++  ++ I ++ +    IF++IG++ ++G F Y      +D+              S   +    G+Y   E+ +     E   +   +F  DN+  AMLT+F   T EGW  ++ H+  A
Sbjct:  748 SMFILSPTNPIRRGAHWVVNLPYFDFFIMVVISMSSIALAAED--PVRENSRRNKILNYFDYAFTGVFTIEMLLKIVDLGVILHPGSYLREFWNIMDAVVVICAAVSFGFDMSGSSAGQNLSTIKSLRVLRVLRPLKTIKRVPKLKAVFDCVVNSLKNVVNILIVYILFQFIFSVIGVQLFNGKFFYC-----TDE--------------SKHTSAECQGSYFKYEEDELLPKQELRVWKPRAFHYDNVAAAMLTLFAVQTGEGWPQVLQHSMAA 1001          

HSP 4 Score: 112.849 bits (281), Expect = 3.394e-24
Identity = 78/288 (27.08%), Postives = 140/288 (48.61%), Query Frame = 2
Query: 3053 PETIQRKPVLPYSAMFIFSPLNSLRRFCHFVVNLRYFDLFIMIVICASSIALAAED--PVKEKSLKNNILEFFDYAFTGVFTVEMILKIIDLGIILHPGSYCRDLWNILDATVVICALVAFIMGQKPSPTGNKLRGSSAKNLNTIKSLRVLRVLRPLKTINRVPKLKAVFDCVVSSLKNVFNILIVYILFQFIFAVIAVQLFQGKF----FYCNDASKSSRE-----------TCRGYFFDYAGRSTPETKKRLWQHHD---FHFDNILYAMLTLFTVTTGEGWPTVL 3856
            P+  +  P    +++FI +  N +R++  F++    F+  +++ I A+ + LA E+  P  +K++    LE  +  F  +F VE  LKI+ LG++LH  SY R++WNI+D  VV+       M Q P   G ++          +++LR +RVLRPLK ++ +P L+ V   ++ ++  +  I ++ +    IFA+I ++ + G      +   D +K  +E                   +   +T       W+  +     FDNI +AMLT+F   T EGW  +L
Sbjct:    4 PKKEENPPGGGPTSLFILTEDNPIRKYTRFIIEWPPFEYAVLLTIIANCVVLALEEHLPGGDKTVLAQKLEKTEAYFLCIFCVEASLKILALGLVLHKHSYLRNIWNIMDFFVVVTGF----MTQYPQ-IGPEV---------DLRTLRAIRVLRPLKLVSGIPSLQVVLKSIIKAMAPLLQIGLLVLFAIVIFAIIGLEFYSGALHKTCYSLEDPNKLVKEGESETPCNTDNILEKATGSFVCNNTTSMCLEKWEGPNSGITSFDNIGFAMLTVFQCITMEGWTAIL 277          

HSP 5 Score: 98.9821 bits (245), Expect = 5.244e-20
Identity = 70/258 (27.13%), Postives = 139/258 (53.88%), Query Frame = 2
Query: 1979 FRFSVRRLVKSQPFYWAVIILVFFNTVCVAIEHYEQGKWLTLFLNYAEYVFLCLFMMEMMIKMYGLSIRVYFQSSFNIFDCVVIAGSLFEIIYGIFVQDSSFGLSVLRALRLLRIFKVTRYWAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMQLFGGEFNFEEGKPP------QNFDTFVKALLTVFQILTGEDWNTVMYNGIQSKG---------GVKERGTVFSIYFVLLVVFGNYTLLNVFLAIAVDNL 2707
            F++ V R+V S PF + +++L+ FNT+ + ++++ QG      L Y    F  +F +E ++K+ G  ++ +F+  +NIFD + + GS+ + ++  F   +S  +  LR  R  R+ K+ R   ++R L+ + + S +++  +  L+ +   I+A++GMQ+FG   N + G          NF +F++ ++ +F+  TGE W  +M   ++ K          G     T+   YFV  + F ++ +LN+F+A+ +DN 
Sbjct: 1084 FKYKVWRIVVSTPFEYFIMMLIVFNTLLLMMKYHNQGDMYEKSLKYINMGFTGMFSVETVLKIIGFGVKNFFKDPWNIFDLITVLGSIVDALWMEFGDSNSINVGFLRLFRAARLIKLLRQGYTIRILLWTFVQSFKALPYVCLLIAMLFFIYAIIGMQVFG---NIKLGTVENSITRHNNFQSFIQGVMLLFRCATGEAWPNIMLACLKGKACDDDAEKAPGEYCGSTLAYAYFVSFIFFCSFLMLNLFVAVIMDNF 1338          

HSP 6 Score: 75.0998 bits (183), Expect = 9.946e-13
Identity = 71/297 (23.91%), Postives = 127/297 (42.76%), Query Frame = 2
Query:  767 PFEYMVLLTILANCIVLSMERHLPKKDKTLLAGQLELTEKYFLGIFCVEALLKIVALGFCCHKEAYLRNVWNIMDFVVV----VTGFLMMFLNIDNHSDSSTVDLRTLRAVRVLRPLKLVAGFPSLQVVLKSIIRAMAPLLQIGLLVLFAITIFAIIGLEFYSGAFHYTCFKANSDKLPLPIPTEKSLVPCSNSKNGSGLGAYTCPEDYQCKAYWEGPNYGITSFDNIGYAMLTVFQCITMEGWTDIMYHT-------NDA-------IGNRFNWLYFVPLIILGSFFMLNLVLGVL 1603
            PFEY +++ I+ N ++L M+ H       +    L+     F G+F VE +LKI+  G     + + ++ WNI D + V    V    M F       DS+++++  LR  R  R +KL+    +++++L + +++   L  + LL+     I+AIIG++ +                              N K G+   + T   ++Q  ++ +G              ++ +F+C T E W +IM          +DA        G+   + YFV  I   SF MLNL + V+
Sbjct: 1096 PFEYFIMMLIVFNTLLLMMKYH---NQGDMYEKSLKYINMGFTGMFSVETVLKIIGFGV----KNFFKDPWNIFDLITVLGSIVDALWMEF------GDSNSINVGFLRLFRAARLIKLLRQGYTIRILLWTFVQSFKALPYVCLLIAMLFFIYAIIGMQVF-----------------------------GNIKLGTVENSITRHNNFQ--SFIQG--------------VMLLFRCATGEAWPNIMLACLKGKACDDDAEKAPGEYCGSTLAYAYFVSFIFFCSFLMLNLFVAVI 1334          

HSP 7 Score: 72.4034 bits (176), Expect = 6.327e-12
Identity = 80/307 (26.06%), Postives = 137/307 (44.63%), Query Frame = 2
Query: 4040 DKNQKQCIDFAINEKPLCRYMPKDKTTIKYRVW-RLVVSTP-FEYFIMVMIALNTLILMMKYYREEKKASSAATHDREQQAYLN---YCNTLIFLNSAFTVMFSIECVLKIMAFGPKNYFRDPWNIFDFITVIGSITDVLVSELQDXXXXXXXXXXXXXXXXXXXXXXQGYTIRILLWTFIQSFKALPYVCLLIAMLFFIYSIIGMQVFGNIKLISEYQIN-----RHNNFQTFTNGLLLLFRCATGESWQEIMLACDNNKPCEKDIENTNNFDCGSNFTYIYFVSFIFLCSFLMLNLFVAVIMDNF 4930
             K Q  C  F   EK             ++R W R  V T  F +F++V++ LNT+ + +++Y               Q ++L    Y    IFL      +F  E  +K+ A GP+ YF   +N FD + + GSI +V+ SE++  SF       L              ++R L+ + + S +++  +  L+ +   I++++GMQ+FG        Q N        NF TF   LL +F+  TGE W E+M          + I +      G  ++ IYF+  +   ++ +LN+F+A+ +DN 
Sbjct:  414 SKPQGSCTGFWRAEK-------------RFRFWIRHTVKTQWFYWFVIVLVFLNTVCVAVEHY--------------GQPSFLTEFLYYAEFIFLG-----LFMSEMFIKMYALGPRIYFESSFNRFDCVVISGSIFEVIWSEVKGGSFGLSVLRALRLLRIFKVTKYWS-SLRNLVISLLNSMRSIISLLFLLFLFILIFALLGMQLFGG-------QFNLPGGTPETNFNTFPIALLTVFQILTGEDWNEVMY---------QGIISQGGAQKGMIYS-IYFIVLVLFGNYTLLNVFLAIAVDNL 670          
BLAST of Voltage dependent L type calcium channel subunit vs. Ensembl Fly
Match: cac (gene:FBgn0263111 transcript:FBtr0307316)

HSP 1 Score: 989.949 bits (2558), Expect = 0.000e+0
Identity = 558/977 (57.11%), Postives = 677/977 (69.29%), Query Frame = 2
Query: 3071 KPVLPYSAMFIFSPLNSLRRFCHFVVNLRYFDLFIMIVICASSIALAAEDPVKEKSLKNNILEFFDYAFTGVFTVEMILKIIDLGIILHPGSYCRDLWNILDATVVICALVAFIMGQKPSPTGNKLRGSSA-KNLNTIKSLRVLRVLRPLKTINRVPKLKAVFDCVVSSLKNVFNILIVYILFQFIFAVIAVQLFQGKFFYCNDASKSSRETCRGYFFDYAGRST-PETKKRLWQHHDFHFDNILYAMLTLFTVTTGEGWPTVLKNSMESTNIDNGPIADYRQEMAXXXXXXXXXXXXXXXXXXXALIIITFQEQGENELIDLDLDKNQKQCIDFAINEKPLCRYMPKDKTTIKYRVWRLVVSTPFEYFIMVMIALNTLILMMKYYREEKKASSAATHDREQQAYLNYCNTLIFLNSAFTVMFSIECVLKIMAFGPKNYFRDPWNIFDFITVIGSITDVLVSEL-QDXXXXXXXXXXXXXXXXXXXXXXQGYTIRILLWTFIQSFKALPYVCLLIAMLFFIYSIIGMQVFGNIKLIS-EYQINRHNNFQTFTNGLLLLFRCATGESWQEIMLACDNNKPCEKDIENTNNFDCGSNFTYIYFVSFIFLCSFLMLNLFVAVIMDNFDYLTRDSSILGPHHLDEYIRVWAEYDPGAIGRIHHSEMYEMLRNMEPPVGFGKKCPYRLAYRKLIRMNMPVDENGTVNFTTTLFALIRESLNIKMSTAEYMDIKDMELRQTICKMWPVQAKKKLNLIVPPDSELVFHKMTVGKIYAGYLIVENWRAYKNSQEQGPRSSPAVSIKSVTKPVVKEEKSANLLAKFFVAFKSNTNKSNISLDSHHERDEERFSIDHTYGEDYDANRRYSYLRRGSKP---------RGSKEIYSDLTPTQDYSYGLRPEHATIPGMPAPRKFGNRPRSPMYSLSELETKDRANTPQSLNSTIS---------PTSGDRESDKFHRRSPAVSPSNPQ 5935
            KP+LPYS+MFI SP N +RR  H+VVNL YFD FIM+VI  SSIALAAEDPV+E S +N IL +FDYAFTGVFT+EM+LKI+DLG+ILHPGSY R+ WNI+DA VVICA V+F         G  + GSSA +NL+TIKSLRVLRVLRPLKTI RVPKLKAVFDCVV+SLKNV NILIVYILFQFIF+VI VQLF GKFFYC D SK +   C+G +F Y      P+ + R+W+   FH+DN+  AMLTLF V TGEGWP VL++SM +T  D GPI ++R EM+IFYIV+FIVFPFFFVNIFVALIIITFQEQGE EL D ++DKNQK CIDF I  +PL RYMPK++ T KY+VWR+VVSTPFEYFIM++I  NTL+LMMKY+ +                   Y  +L ++N  FT MFS+E VLKI+ FG KN+F+DPWNIFD ITV+GSI D L  E   DS+ +++GFLRLFRAARLIKLLRQGYTIRILLWTF+QSFKALPYVCLLIAMLFFIY+IIGMQVFGNIKL + E  I RHNNFQ+F  G++LLFRCATGE+W  IMLAC   K C+ D E      CGS   Y YFVSFIF CSFLMLNLFVAVIMDNFDYLTRDSSILG HHLDE++R+WAEYDP A G+IH++EMY+ML+NM+PP+GFG KCP RLAY+KLIRMNMP+D+   V FTTTLFALIRE+L+IKM   E MD  DMELR+TI  +WP+QAKK LNL+VPP  +L   K++VGKIYAG+LI+E+WR+ +  Q       P + ++  ++   +E  +                            D       H+Y    + +RR   LR    P         RG + I+ D+  +   S  +     T      PR   + PR P  S S   +  R+ +P      +S         PT G   +    +RS + SP+  Q
Sbjct:  741 KPMLPYSSMFILSPTNPIRRGAHWVVNLPYFDFFIMVVISMSSIALAAEDPVRENSRRNKILNYFDYAFTGVFTIEMLLKIVDLGVILHPGSYLREFWNIMDAVVVICAAVSF---------GFDMSGSSAGQNLSTIKSLRVLRVLRPLKTIKRVPKLKAVFDCVVNSLKNVVNILIVYILFQFIFSVIGVQLFNGKFFYCTDESKHTSAECQGSYFKYEEDELLPKQELRVWKPRAFHYDNVAAAMLTLFAVQTGEGWPQVLQHSMAATYEDRGPIQNFRIEMSIFYIVYFIVFPFFFVNIFVALIIITFQEQGEAELQDGEIDKNQKSCIDFTIGARPLERYMPKNRNTFKYKVWRIVVSTPFEYFIMMLIVFNTLLLMMKYHNQGDM----------------YEKSLKYINMGFTGMFSVETVLKIIGFGVKNFFKDPWNIFDLITVLGSIVDALWMEFGHDSNSINVGFLRLFRAARLIKLLRQGYTIRILLWTFVQSFKALPYVCLLIAMLFFIYAIIGMQVFGNIKLGTVENSITRHNNFQSFIQGVMLLFRCATGEAWPNIMLACLKGKACDDDAEKAPGEYCGSTLAYAYFVSFIFFCSFLMLNLFVAVIMDNFDYLTRDSSILGAHHLDEFVRIWAEYDPNATGKIHYTEMYDMLKNMDPPLGFGNKCPNRLAYKKLIRMNMPLDDELRVQFTTTLFALIRENLSIKMRAPEEMDQADMELRETITNIWPLQAKKMLNLLVPPSDQLNKGKLSVGKIYAGFLILESWRSTRFGQLDS--GMPMLELQDASRHPSQESLTG--------------------------ADAGHLHPGHSY---MNGHRRSPSLRHNGSPLARSPSPRRRGHQYIHHDIGFSDTVSNVVEMVKET----RHPRHGNSHPRYPRGSWSASTSPARSPSPSRYGGHLSRSKRTQLPYPTYG---TTSLCQRSRSPSPARLQ 1654          

HSP 2 Score: 747.273 bits (1928), Expect = 0.000e+0
Identity = 444/677 (65.58%), Postives = 522/677 (77.10%), Query Frame = 2
Query:  701 SLFIFSEENVIRKYAKIIIEWGPFEYMVLLTILANCIVLSMERHLPKKDKTLLAGQLELTEKYFLGIFCVEALLKIVALGFCCHKEAYLRNVWNIMDFVVVVTGFLMMFL--NIDNHSDSSTVDLRTLRAVRVLRPLKLVAGFPSLQVVLKSIIRAMAPLLQIGLLVLFAITIFAIIGLEFYSGAFHYTCFK-ANSDKLPLPIPTEKSLVPCSNSKN--GSGLGAYTCPEDYQ-CKAYWEGPNYGITSFDNIGYAMLTVFQCITMEGWTDIMYHTNDAIGNRFNWLYFVPLIILGSFFMLNLVLGVLSGXXXXXXXXXXXXXXXLKLRRQQQTEKEFNGYMEWIQKAEEVLLNEATTTSEDKMRIIAARRRAEKQKYKLLGKNQSIPDFEYEDTELYSETKSMKGNIFIRSYAGIRRRRKERCTSFWRTEKHFRFSVRRLVKSQPFYWAVIILVFFNTVCVAIEHYEQGKWLTLFLNYAEYVFLCLFMMEMMIKMYGLSIRVYFQSSFNIFDCVVIAGSLFEIIYGIFVQDSSFGLSVLRALRLLRIFKVTRYWAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMQLFGGEFNFEEGKPPQNFDTFVKALLTVFQILTGEDWNTVMYNGIQSKGGVKERGTVFSIYFVLLVVFGNYTLLNVFLAIAVDNLAN 2713
            SLFI +E+N IRKY + IIEW PFEY VLLTI+ANC+VL++E HLP  DKT+LA +LE TE YFL IFCVEA LKI+ALG   HK +YLRN+WNIMDF VVVTG + +F   NID       VDLR LR+ RVLRPLKLV+  PSLQVVLKSII+AMAPLLQIGLLVLFAI IFAIIGLEFYSGA H TC+   + +KL   +   +S  PC N+ N      G++ C      C   WEGPN GITSFDNIG+AMLTVFQCITMEGWT I+Y TNDA+G+ FNW+YFVPLI++GSFFMLNLVLGVLSGEFAKERE+VE R+ FLKLRRQQQ E+E NGY+EWI KAEEV+L E  TT E+KM I+ ARRR   ++ KL    +S    +  DTE     +    + ++++    R + +  CT FWR EK FRF +R  VK+Q FYW VI+LVF NTVCVA+EHY Q  +LT FL YAE++FL LFM EM IKMY L  R+YF+SSFN FDCVVI+GS+FE+I+   V+  SFGLSVLRALRLLRIFKVT+YW+SLRNLV+SLLNSMRSIISLLFLLFLFILIFALLGMQLFGG+FN   G P  NF+TF  ALLTVFQILTGEDWN VMY GI S+GG  ++G ++SIYF++LV+FGNYTLLNVFLAIAVDNLAN
Sbjct:   17 SLFILTEDNPIRKYTRFIIEWPPFEYAVLLTIIANCVVLALEEHLPGGDKTVLAQKLEKTEAYFLCIFCVEASLKILALGLVLHKHSYLRNIWNIMDFFVVVTGAMTIFAEANID-------VDLRMLRSFRVLRPLKLVSRIPSLQVVLKSIIKAMAPLLQIGLLVLFAIVIFAIIGLEFYSGALHKTCYSLEDPNKL---VKEGESETPC-NTDNILEKATGSFVCNNTTSMCLEKWEGPNSGITSFDNIGFAMLTVFQCITMEGWTAILYWTNDALGSAFNWIYFVPLIVIGSFFMLNLVLGVLSGEFAKEREKVENRQEFLKLRRQQQLERELNGYVEWICKAEEVILAEERTTEEEKMHIMEARRRNAAKRKKLKSLGKS----KSTDTEEEEAEEDYGDDGYLKT----RSKPQGSCTGFWRAEKRFRFWIRHTVKTQWFYWFVIVLVFLNTVCVAVEHYGQPSFLTEFLYYAEFIFLGLFMSEMFIKMYALGPRIYFESSFNRFDCVVISGSIFEVIWSE-VKGGSFGLSVLRALRLLRIFKVTKYWSSLRNLVISLLNSMRSIISLLFLLFLFILIFALLGMQLFGGQFNLPGGTPETNFNTFPIALLTVFQILTGEDWNEVMYQGIISQGGA-QKGMIYSIYFIVLVLFGNYTLLNVFLAIAVDNLAN 672          

HSP 3 Score: 117.472 bits (293), Expect = 1.420e-25
Identity = 79/275 (28.73%), Postives = 136/275 (49.45%), Query Frame = 2
Query:  701 SLFIFSEENVIRKYAKIIIEWGPFEYMVLLTILANCIVLSMERHLPKKDKTLLAGQLELTEKYFLGIFCVEALLKIVALGFCCHKEAYLRNVWNIMDFVVVVTGFLMMFLNIDNHSDSSTVD-LRTLRAVRVLRPLKLVAGFPSLQVVLKSIIRAMAPLLQIGLLVLFAITIFAIIGLEFYSGAFHYTCFKANSDKLPLPIPTEKSLVPCSNSKNGSGLGAYTCPEDYQCKAYWEGPNYGITSF--DNIGYAMLTVFQCITMEGWTDIMYHTNDA 1516
            S+FI S  N IR+ A  ++    F++ +++ I  + I L+ E   P ++ +     L   +  F G+F +E LLKIV LG   H  +YLR  WNIMD VVV+   +    ++   S    +  +++LR +RVLRPLK +   P L+ V   ++ ++  ++ I ++ +    IF++IG++ ++G F Y      +D+              S   +    G+Y   E+ +     E   +   +F  DN+  AMLT+F   T EGW  ++ H+  A
Sbjct:  748 SMFILSPTNPIRRGAHWVVNLPYFDFFIMVVISMSSIALAAED--PVRENSRRNKILNYFDYAFTGVFTIEMLLKIVDLGVILHPGSYLREFWNIMDAVVVICAAVSFGFDMSGSSAGQNLSTIKSLRVLRVLRPLKTIKRVPKLKAVFDCVVNSLKNVVNILIVYILFQFIFSVIGVQLFNGKFFYC-----TDE--------------SKHTSAECQGSYFKYEEDELLPKQELRVWKPRAFHYDNVAAAMLTLFAVQTGEGWPQVLQHSMAA 1001          

HSP 4 Score: 112.079 bits (279), Expect = 5.531e-24
Identity = 78/288 (27.08%), Postives = 137/288 (47.57%), Query Frame = 2
Query: 3053 PETIQRKPVLPYSAMFIFSPLNSLRRFCHFVVNLRYFDLFIMIVICASSIALAAED--PVKEKSLKNNILEFFDYAFTGVFTVEMILKIIDLGIILHPGSYCRDLWNILDATVVICALVAFIMGQKPSPTGNKLRGSSAKNLNTIKSLRVLRVLRPLKTINRVPKLKAVFDCVVSSLKNVFNILIVYILFQFIFAVIAVQLFQGKF----FYCNDASKSSRE-----------TCRGYFFDYAGRSTPETKKRLWQHHD---FHFDNILYAMLTLFTVTTGEGWPTVL 3856
            P+  +  P    +++FI +  N +R++  F++    F+  +++ I A+ + LA E+  P  +K++    LE  +  F  +F VE  LKI+ LG++LH  SY R++WNI+D  VV+              TG     + A     ++ LR  RVLRPLK ++R+P L+ V   ++ ++  +  I ++ +    IFA+I ++ + G      +   D +K  +E                   +   +T       W+  +     FDNI +AMLT+F   T EGW  +L
Sbjct:    4 PKKEENPPGGGPTSLFILTEDNPIRKYTRFIIEWPPFEYAVLLTIIANCVVLALEEHLPGGDKTVLAQKLEKTEAYFLCIFCVEASLKILALGLVLHKHSYLRNIWNIMDFFVVV--------------TGAMTIFAEANIDVDLRMLRSFRVLRPLKLVSRIPSLQVVLKSIIKAMAPLLQIGLLVLFAIVIFAIIGLEFYSGALHKTCYSLEDPNKLVKEGESETPCNTDNILEKATGSFVCNNTTSMCLEKWEGPNSGITSFDNIGFAMLTVFQCITMEGWTAIL 277          

HSP 5 Score: 98.9821 bits (245), Expect = 5.803e-20
Identity = 72/259 (27.80%), Postives = 140/259 (54.05%), Query Frame = 2
Query: 1979 FRFSVRRLVKSQPFYWAVIILVFFNTVCVAIEHYEQGKWLTLFLNYAEYVFLCLFMMEMMIKMYGLSIRVYFQSSFNIFDCVVIAGSLFEIIYGIFVQDS-SFGLSVLRALRLLRIFKVTRYWAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMQLFGGEFNFEEGKPP------QNFDTFVKALLTVFQILTGEDWNTVMYNGIQSKG---------GVKERGTVFSIYFVLLVVFGNYTLLNVFLAIAVDNL 2707
            F++ V R+V S PF + +++L+ FNT+ + ++++ QG      L Y    F  +F +E ++K+ G  ++ +F+  +NIFD + + GS+ + ++  F  DS S  +  LR  R  R+ K+ R   ++R L+ + + S +++  +  L+ +   I+A++GMQ+FG   N + G          NF +F++ ++ +F+  TGE W  +M   ++ K          G     T+   YFV  + F ++ +LN+F+A+ +DN 
Sbjct: 1084 FKYKVWRIVVSTPFEYFIMMLIVFNTLLLMMKYHNQGDMYEKSLKYINMGFTGMFSVETVLKIIGFGVKNFFKDPWNIFDLITVLGSIVDALWMEFGHDSNSINVGFLRLFRAARLIKLLRQGYTIRILLWTFVQSFKALPYVCLLIAMLFFIYAIIGMQVFG---NIKLGTVENSITRHNNFQSFIQGVMLLFRCATGEAWPNIMLACLKGKACDDDAEKAPGEYCGSTLAYAYFVSFIFFCSFLMLNLFVAVIMDNF 1339          

HSP 6 Score: 78.1814 bits (191), Expect = 1.195e-13
Identity = 70/293 (23.89%), Postives = 131/293 (44.71%), Query Frame = 2
Query:  767 PFEYMVLLTILANCIVLSMERHLPKKDKTLLAGQLELTEKYFLGIFCVEALLKIVALGFCCHKEAYLRNVWNIMDFVVVVTGFLMMFLNIDNHSDSSTVDLRTLRAVRVLRPLKLVAGFPSLQVVLKSIIRAMAPLLQIGLLVLFAITIFAIIGLEFYSGAFHYTCFKANSDKLPLPIPTEKSLVPCSNSKNGSGLGAYTCPEDYQCKAYWEGPNYGITSFDNIGYAMLTVFQCITMEGWTDIMYHT-------NDA-------IGNRFNWLYFVPLIILGSFFMLNLVLGVL 1603
            PFEY +++ I+ N ++L M+ H       +    L+     F G+F VE +LKI+  G     + + ++ WNI D + V+ G ++  L ++   DS+++++  LR  R  R +KL+    +++++L + +++   L  + LL+     I+AIIG++ +                              N K G+   + T   ++Q  ++ +G              ++ +F+C T E W +IM          +DA        G+   + YFV  I   SF MLNL + V+
Sbjct: 1096 PFEYFIMMLIVFNTLLLMMKYH---NQGDMYEKSLKYINMGFTGMFSVETVLKIIGFGV----KNFFKDPWNIFDLITVL-GSIVDALWMEFGHDSNSINVGFLRLFRAARLIKLLRQGYTIRILLWTFVQSFKALPYVCLLIAMLFFIYAIIGMQVF-----------------------------GNIKLGTVENSITRHNNFQ--SFIQG--------------VMLLFRCATGEAWPNIMLACLKGKACDDDAEKAPGEYCGSTLAYAYFVSFIFFCSFLMLNLFVAVI 1335          

HSP 7 Score: 72.4034 bits (176), Expect = 6.435e-12
Identity = 80/307 (26.06%), Postives = 137/307 (44.63%), Query Frame = 2
Query: 4040 DKNQKQCIDFAINEKPLCRYMPKDKTTIKYRVW-RLVVSTP-FEYFIMVMIALNTLILMMKYYREEKKASSAATHDREQQAYLN---YCNTLIFLNSAFTVMFSIECVLKIMAFGPKNYFRDPWNIFDFITVIGSITDVLVSELQDXXXXXXXXXXXXXXXXXXXXXXQGYTIRILLWTFIQSFKALPYVCLLIAMLFFIYSIIGMQVFGNIKLISEYQIN-----RHNNFQTFTNGLLLLFRCATGESWQEIMLACDNNKPCEKDIENTNNFDCGSNFTYIYFVSFIFLCSFLMLNLFVAVIMDNF 4930
             K Q  C  F   EK             ++R W R  V T  F +F++V++ LNT+ + +++Y               Q ++L    Y    IFL      +F  E  +K+ A GP+ YF   +N FD + + GSI +V+ SE++  SF       L              ++R L+ + + S +++  +  L+ +   I++++GMQ+FG        Q N        NF TF   LL +F+  TGE W E+M          + I +      G  ++ IYF+  +   ++ +LN+F+A+ +DN 
Sbjct:  414 SKPQGSCTGFWRAEK-------------RFRFWIRHTVKTQWFYWFVIVLVFLNTVCVAVEHY--------------GQPSFLTEFLYYAEFIFLG-----LFMSEMFIKMYALGPRIYFESSFNRFDCVVISGSIFEVIWSEVKGGSFGLSVLRALRLLRIFKVTKYWS-SLRNLVISLLNSMRSIISLLFLLFLFILIFALLGMQLFGG-------QFNLPGGTPETNFNTFPIALLTVFQILTGEDWNEVMY---------QGIISQGGAQKGMIYS-IYFIVLVLFGNYTLLNVFLAIAVDNL 670          
BLAST of Voltage dependent L type calcium channel subunit vs. Ensembl Fly
Match: cac (gene:FBgn0263111 transcript:FBtr0307315)

HSP 1 Score: 989.564 bits (2557), Expect = 0.000e+0
Identity = 558/977 (57.11%), Postives = 677/977 (69.29%), Query Frame = 2
Query: 3071 KPVLPYSAMFIFSPLNSLRRFCHFVVNLRYFDLFIMIVICASSIALAAEDPVKEKSLKNNILEFFDYAFTGVFTVEMILKIIDLGIILHPGSYCRDLWNILDATVVICALVAFIMGQKPSPTGNKLRGSSA-KNLNTIKSLRVLRVLRPLKTINRVPKLKAVFDCVVSSLKNVFNILIVYILFQFIFAVIAVQLFQGKFFYCNDASKSSRETCRGYFFDYAGRST-PETKKRLWQHHDFHFDNILYAMLTLFTVTTGEGWPTVLKNSMESTNIDNGPIADYRQEMAXXXXXXXXXXXXXXXXXXXALIIITFQEQGENELIDLDLDKNQKQCIDFAINEKPLCRYMPKDKTTIKYRVWRLVVSTPFEYFIMVMIALNTLILMMKYYREEKKASSAATHDREQQAYLNYCNTLIFLNSAFTVMFSIECVLKIMAFGPKNYFRDPWNIFDFITVIGSITDVLVSEL-QDXXXXXXXXXXXXXXXXXXXXXXQGYTIRILLWTFIQSFKALPYVCLLIAMLFFIYSIIGMQVFGNIKLIS-EYQINRHNNFQTFTNGLLLLFRCATGESWQEIMLACDNNKPCEKDIENTNNFDCGSNFTYIYFVSFIFLCSFLMLNLFVAVIMDNFDYLTRDSSILGPHHLDEYIRVWAEYDPGAIGRIHHSEMYEMLRNMEPPVGFGKKCPYRLAYRKLIRMNMPVDENGTVNFTTTLFALIRESLNIKMSTAEYMDIKDMELRQTICKMWPVQAKKKLNLIVPPDSELVFHKMTVGKIYAGYLIVENWRAYKNSQEQGPRSSPAVSIKSVTKPVVKEEKSANLLAKFFVAFKSNTNKSNISLDSHHERDEERFSIDHTYGEDYDANRRYSYLRRGSKP---------RGSKEIYSDLTPTQDYSYGLRPEHATIPGMPAPRKFGNRPRSPMYSLSELETKDRANTPQSLNSTIS---------PTSGDRESDKFHRRSPAVSPSNPQ 5935
            KP+LPYS+MFI SP N +RR  H+VVNL YFD FIM+VI  SSIALAAEDPV+E S +N IL +FDYAFTGVFT+EM+LKI+DLG+ILHPGSY R+ WNI+DA VVICA V+F         G  + GSSA +NL+TIKSLRVLRVLRPLKTI RVPKLKAVFDCVV+SLKNV NILIVYILFQFIF+VI VQLF GKFFYC D SK +   C+G +F Y      P+ + R+W+   FH+DN+  AMLTLF V TGEGWP VL++SM +T  D GPI ++R EM+IFYIV+FIVFPFFFVNIFVALIIITFQEQGE EL D ++DKNQK CIDF I  +PL RYMPK++ T KY+VWR+VVSTPFEYFIM++I  NTL+LMMKY+ +                   Y  +L ++N  FT MFS+E VLKI+ FG KN+F+DPWNIFD ITV+GSI D L  E   DS+ +++GFLRLFRAARLIKLLRQGYTIRILLWTF+QSFKALPYVCLLIAMLFFIY+IIGMQVFGNIKL + E  I RHNNFQ+F  G++LLFRCATGE+W  IMLAC   K C+ D E      CGS   Y YFVSFIF CSFLMLNLFVAVIMDNFDYLTRDSSILG HHLDE++R+WAEYDP A G+IH++EMY+ML+NM+PP+GFG KCP RLAY+KLIRMNMP+D+   V FTTTLFALIRE+L+IKM   E MD  DMELR+TI  +WP+QAKK LNL+VPP  +L   K++VGKIYAG+LI+E+WR+ +  Q       P + ++  ++   +E  +                            D       H+Y    + +RR   LR    P         RG + I+ D+  +   S  +     T      PR   + PR P  S S   +  R+ +P      +S         PT G   +    +RS + SP+  Q
Sbjct:  741 KPMLPYSSMFILSPTNPIRRGAHWVVNLPYFDFFIMVVISMSSIALAAEDPVRENSRRNKILNYFDYAFTGVFTIEMLLKIVDLGVILHPGSYLREFWNIMDAVVVICAAVSF---------GFDMSGSSAGQNLSTIKSLRVLRVLRPLKTIKRVPKLKAVFDCVVNSLKNVVNILIVYILFQFIFSVIGVQLFNGKFFYCTDESKHTSAECQGSYFKYEEDELLPKQELRVWKPRAFHYDNVAAAMLTLFAVQTGEGWPQVLQHSMAATYEDRGPIQNFRIEMSIFYIVYFIVFPFFFVNIFVALIIITFQEQGEAELQDGEIDKNQKSCIDFTIGARPLERYMPKNRNTFKYKVWRIVVSTPFEYFIMMLIVFNTLLLMMKYHNQGDM----------------YEKSLKYINMGFTGMFSVETVLKIIGFGVKNFFKDPWNIFDLITVLGSIVDALWMEFGHDSNSINVGFLRLFRAARLIKLLRQGYTIRILLWTFVQSFKALPYVCLLIAMLFFIYAIIGMQVFGNIKLGTVENSITRHNNFQSFIQGVMLLFRCATGEAWPNIMLACLKGKACDDDAEKAPGEYCGSTLAYAYFVSFIFFCSFLMLNLFVAVIMDNFDYLTRDSSILGAHHLDEFVRIWAEYDPNATGKIHYTEMYDMLKNMDPPLGFGNKCPNRLAYKKLIRMNMPLDDELRVQFTTTLFALIRENLSIKMRAPEEMDQADMELRETITNIWPLQAKKMLNLLVPPSDQLNKGKLSVGKIYAGFLILESWRSTRFGQLDS--GMPMLELQDASRHPSQESLTG--------------------------ADAGHLHPGHSY---MNGHRRSPSLRHNGSPLARSPSPRRRGHQYIHHDIGFSDTVSNVVEMVKET----RHPRHGNSHPRYPRGSWSASTSPARSPSPSRYGGHLSRSKRTQLPYPTYG---TTSLCQRSRSPSPARLQ 1654          

HSP 2 Score: 729.554 bits (1882), Expect = 0.000e+0
Identity = 431/675 (63.85%), Postives = 512/675 (75.85%), Query Frame = 2
Query:  701 SLFIFSEENVIRKYAKIIIEWGPFEYMVLLTILANCIVLSMERHLPKKDKTLLAGQLELTEKYFLGIFCVEALLKIVALGFCCHKEAYLRNVWNIMDFVVVVTGFLMMFLNIDNHSDSSTVDLRTLRAVRVLRPLKLVAGFPSLQVVLKSIIRAMAPLLQIGLLVLFAITIFAIIGLEFYSGAFHYTCFK-ANSDKLPLPIPTEKSLVPCSNSKN--GSGLGAYTCPEDYQ-CKAYWEGPNYGITSFDNIGYAMLTVFQCITMEGWTDIMYHTNDAIGNRFNWLYFVPLIILGSFFMLNLVLGVLSGXXXXXXXXXXXXXXXLKLRRQQQTEKEFNGYMEWIQKAEEVLLNEATTTSEDKMRIIAARRRAEKQKYKLLGKNQSIPDFEYEDTELYSETKSMKGNIFIRSYAGIRRRRKERCTSFWRTEKHFRFSVRRLVKSQPFYWAVIILVFFNTVCVAIEHYEQGKWLTLFLNYAEYVFLCLFMMEMMIKMYGLSIRVYFQSSFNIFDCVVIAGSLFEIIYGIFVQDSSFGLSVLRALRLLRIFKVTRYWAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMQLFGGEFNFEEGKPPQNFDTFVKALLTVFQILTGEDWNTVMYNGIQSKGGVKERGTVFSIYFVLLVVFGNYTLLNVFLAIAVDNLAN 2713
            SLFI +E+N IRKY + IIEW PFEY VLLTI+ANC+VL++E HLP  DKT+LA +LE TE YFL IFCVEA LKI+ALG   HK +YLRN+WNIMDF VVVTGF+  +  I        VDLRTLRA+RVLRPLKLV+G PSLQVVLKSII+AMAPLLQIGLLVLFAI IFAIIGLEFYSGA H TC+   + +KL   +   +S  PC N+ N      G++ C      C   WEGPN GITSFDNIG+AMLTVFQCITMEGWT I+Y TNDA+G+ FNW+YFVPLI++GSFFMLNLVLGVLSGEF+ ER RVE+R  F K R +   +     Y++WI +AEEV+L E  TT E+KM I+ ARRR   ++ KL    +S    +  DTE     +    + ++++    R + +  CT FWR EK FRF +R  VK+Q FYW VI+LVF NTVCVA+EHY Q  +LT FL YAE++FL LFM EM IKMY L  R+YF+SSFN FDCVVI+GS+FE+I+   V+  SFGLSVLRALRLLRIFKVT+YW+SLRNLV+SLLNSMRSIISLLFLLFLFILIFALLGMQLFGG+FN   G P  NF+TF  ALLTVFQILTGEDWN VMY GI S+GG  ++G ++SIYF++LV+FGNYTLLNVFLAIAVDNLAN
Sbjct:   17 SLFILTEDNPIRKYTRFIIEWPPFEYAVLLTIIANCVVLALEEHLPGGDKTVLAQKLEKTEAYFLCIFCVEASLKILALGLVLHKHSYLRNIWNIMDFFVVVTGFMTQYPQI-----GPEVDLRTLRAIRVLRPLKLVSGIPSLQVVLKSIIKAMAPLLQIGLLVLFAIVIFAIIGLEFYSGALHKTCYSLEDPNKL---VKEGESETPC-NTDNILEKATGSFVCNNTTSMCLEKWEGPNSGITSFDNIGFAMLTVFQCITMEGWTAILYWTNDALGSAFNWIYFVPLIVIGSFFMLNLVLGVLSGEFSNERNRVERRMEFQKCRFRAMFQTAMVSYLDWITQAEEVILAEERTTEEEKMHIMEARRRNAAKRKKLKSLGKS----KSTDTEEEEAEEDYGDDGYLKT----RSKPQGSCTGFWRAEKRFRFWIRHTVKTQWFYWFVIVLVFLNTVCVAVEHYGQPSFLTEFLYYAEFIFLGLFMSEMFIKMYALGPRIYFESSFNRFDCVVISGSIFEVIWSE-VKGGSFGLSVLRALRLLRIFKVTKYWSSLRNLVISLLNSMRSIISLLFLLFLFILIFALLGMQLFGGQFNLPGGTPETNFNTFPIALLTVFQILTGEDWNEVMYQGIISQGGA-QKGMIYSIYFIVLVLFGNYTLLNVFLAIAVDNLAN 672          

HSP 3 Score: 117.087 bits (292), Expect = 1.558e-25
Identity = 79/275 (28.73%), Postives = 136/275 (49.45%), Query Frame = 2
Query:  701 SLFIFSEENVIRKYAKIIIEWGPFEYMVLLTILANCIVLSMERHLPKKDKTLLAGQLELTEKYFLGIFCVEALLKIVALGFCCHKEAYLRNVWNIMDFVVVVTGFLMMFLNIDNHSDSSTVD-LRTLRAVRVLRPLKLVAGFPSLQVVLKSIIRAMAPLLQIGLLVLFAITIFAIIGLEFYSGAFHYTCFKANSDKLPLPIPTEKSLVPCSNSKNGSGLGAYTCPEDYQCKAYWEGPNYGITSF--DNIGYAMLTVFQCITMEGWTDIMYHTNDA 1516
            S+FI S  N IR+ A  ++    F++ +++ I  + I L+ E   P ++ +     L   +  F G+F +E LLKIV LG   H  +YLR  WNIMD VVV+   +    ++   S    +  +++LR +RVLRPLK +   P L+ V   ++ ++  ++ I ++ +    IF++IG++ ++G F Y      +D+              S   +    G+Y   E+ +     E   +   +F  DN+  AMLT+F   T EGW  ++ H+  A
Sbjct:  748 SMFILSPTNPIRRGAHWVVNLPYFDFFIMVVISMSSIALAAED--PVRENSRRNKILNYFDYAFTGVFTIEMLLKIVDLGVILHPGSYLREFWNIMDAVVVICAAVSFGFDMSGSSAGQNLSTIKSLRVLRVLRPLKTIKRVPKLKAVFDCVVNSLKNVVNILIVYILFQFIFSVIGVQLFNGKFFYC-----TDE--------------SKHTSAECQGSYFKYEEDELLPKQELRVWKPRAFHYDNVAAAMLTLFAVQTGEGWPQVLQHSMAA 1001          

HSP 4 Score: 112.849 bits (281), Expect = 3.541e-24
Identity = 78/288 (27.08%), Postives = 140/288 (48.61%), Query Frame = 2
Query: 3053 PETIQRKPVLPYSAMFIFSPLNSLRRFCHFVVNLRYFDLFIMIVICASSIALAAED--PVKEKSLKNNILEFFDYAFTGVFTVEMILKIIDLGIILHPGSYCRDLWNILDATVVICALVAFIMGQKPSPTGNKLRGSSAKNLNTIKSLRVLRVLRPLKTINRVPKLKAVFDCVVSSLKNVFNILIVYILFQFIFAVIAVQLFQGKF----FYCNDASKSSRE-----------TCRGYFFDYAGRSTPETKKRLWQHHD---FHFDNILYAMLTLFTVTTGEGWPTVL 3856
            P+  +  P    +++FI +  N +R++  F++    F+  +++ I A+ + LA E+  P  +K++    LE  +  F  +F VE  LKI+ LG++LH  SY R++WNI+D  VV+       M Q P   G ++          +++LR +RVLRPLK ++ +P L+ V   ++ ++  +  I ++ +    IFA+I ++ + G      +   D +K  +E                   +   +T       W+  +     FDNI +AMLT+F   T EGW  +L
Sbjct:    4 PKKEENPPGGGPTSLFILTEDNPIRKYTRFIIEWPPFEYAVLLTIIANCVVLALEEHLPGGDKTVLAQKLEKTEAYFLCIFCVEASLKILALGLVLHKHSYLRNIWNIMDFFVVVTGF----MTQYPQ-IGPEV---------DLRTLRAIRVLRPLKLVSGIPSLQVVLKSIIKAMAPLLQIGLLVLFAIVIFAIIGLEFYSGALHKTCYSLEDPNKLVKEGESETPCNTDNILEKATGSFVCNNTTSMCLEKWEGPNSGITSFDNIGFAMLTVFQCITMEGWTAIL 277          

HSP 5 Score: 98.5969 bits (244), Expect = 6.419e-20
Identity = 72/259 (27.80%), Postives = 140/259 (54.05%), Query Frame = 2
Query: 1979 FRFSVRRLVKSQPFYWAVIILVFFNTVCVAIEHYEQGKWLTLFLNYAEYVFLCLFMMEMMIKMYGLSIRVYFQSSFNIFDCVVIAGSLFEIIYGIFVQDS-SFGLSVLRALRLLRIFKVTRYWAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMQLFGGEFNFEEGKPP------QNFDTFVKALLTVFQILTGEDWNTVMYNGIQSKG---------GVKERGTVFSIYFVLLVVFGNYTLLNVFLAIAVDNL 2707
            F++ V R+V S PF + +++L+ FNT+ + ++++ QG      L Y    F  +F +E ++K+ G  ++ +F+  +NIFD + + GS+ + ++  F  DS S  +  LR  R  R+ K+ R   ++R L+ + + S +++  +  L+ +   I+A++GMQ+FG   N + G          NF +F++ ++ +F+  TGE W  +M   ++ K          G     T+   YFV  + F ++ +LN+F+A+ +DN 
Sbjct: 1084 FKYKVWRIVVSTPFEYFIMMLIVFNTLLLMMKYHNQGDMYEKSLKYINMGFTGMFSVETVLKIIGFGVKNFFKDPWNIFDLITVLGSIVDALWMEFGHDSNSINVGFLRLFRAARLIKLLRQGYTIRILLWTFVQSFKALPYVCLLIAMLFFIYAIIGMQVFG---NIKLGTVENSITRHNNFQSFIQGVMLLFRCATGEAWPNIMLACLKGKACDDDAEKAPGEYCGSTLAYAYFVSFIFFCSFLMLNLFVAVIMDNF 1339          

HSP 6 Score: 78.1814 bits (191), Expect = 1.256e-13
Identity = 70/293 (23.89%), Postives = 131/293 (44.71%), Query Frame = 2
Query:  767 PFEYMVLLTILANCIVLSMERHLPKKDKTLLAGQLELTEKYFLGIFCVEALLKIVALGFCCHKEAYLRNVWNIMDFVVVVTGFLMMFLNIDNHSDSSTVDLRTLRAVRVLRPLKLVAGFPSLQVVLKSIIRAMAPLLQIGLLVLFAITIFAIIGLEFYSGAFHYTCFKANSDKLPLPIPTEKSLVPCSNSKNGSGLGAYTCPEDYQCKAYWEGPNYGITSFDNIGYAMLTVFQCITMEGWTDIMYHT-------NDA-------IGNRFNWLYFVPLIILGSFFMLNLVLGVL 1603
            PFEY +++ I+ N ++L M+ H       +    L+     F G+F VE +LKI+  G     + + ++ WNI D + V+ G ++  L ++   DS+++++  LR  R  R +KL+    +++++L + +++   L  + LL+     I+AIIG++ +                              N K G+   + T   ++Q  ++ +G              ++ +F+C T E W +IM          +DA        G+   + YFV  I   SF MLNL + V+
Sbjct: 1096 PFEYFIMMLIVFNTLLLMMKYH---NQGDMYEKSLKYINMGFTGMFSVETVLKIIGFGV----KNFFKDPWNIFDLITVL-GSIVDALWMEFGHDSNSINVGFLRLFRAARLIKLLRQGYTIRILLWTFVQSFKALPYVCLLIAMLFFIYAIIGMQVF-----------------------------GNIKLGTVENSITRHNNFQ--SFIQG--------------VMLLFRCATGEAWPNIMLACLKGKACDDDAEKAPGEYCGSTLAYAYFVSFIFFCSFLMLNLFVAVI 1335          

HSP 7 Score: 72.4034 bits (176), Expect = 6.274e-12
Identity = 80/307 (26.06%), Postives = 137/307 (44.63%), Query Frame = 2
Query: 4040 DKNQKQCIDFAINEKPLCRYMPKDKTTIKYRVW-RLVVSTP-FEYFIMVMIALNTLILMMKYYREEKKASSAATHDREQQAYLN---YCNTLIFLNSAFTVMFSIECVLKIMAFGPKNYFRDPWNIFDFITVIGSITDVLVSELQDXXXXXXXXXXXXXXXXXXXXXXQGYTIRILLWTFIQSFKALPYVCLLIAMLFFIYSIIGMQVFGNIKLISEYQIN-----RHNNFQTFTNGLLLLFRCATGESWQEIMLACDNNKPCEKDIENTNNFDCGSNFTYIYFVSFIFLCSFLMLNLFVAVIMDNF 4930
             K Q  C  F   EK             ++R W R  V T  F +F++V++ LNT+ + +++Y               Q ++L    Y    IFL      +F  E  +K+ A GP+ YF   +N FD + + GSI +V+ SE++  SF       L              ++R L+ + + S +++  +  L+ +   I++++GMQ+FG        Q N        NF TF   LL +F+  TGE W E+M          + I +      G  ++ IYF+  +   ++ +LN+F+A+ +DN 
Sbjct:  414 SKPQGSCTGFWRAEK-------------RFRFWIRHTVKTQWFYWFVIVLVFLNTVCVAVEHY--------------GQPSFLTEFLYYAEFIFLG-----LFMSEMFIKMYALGPRIYFESSFNRFDCVVISGSIFEVIWSEVKGGSFGLSVLRALRLLRIFKVTKYWS-SLRNLVISLLNSMRSIISLLFLLFLFILIFALLGMQLFGG-------QFNLPGGTPETNFNTFPIALLTVFQILTGEDWNEVMY---------QGIISQGGAQKGMIYS-IYFIVLVLFGNYTLLNVFLAIAVDNL 670          
BLAST of Voltage dependent L type calcium channel subunit vs. Ensembl Zebrafish
Match: cacna1sa (calcium channel, voltage-dependent, L type, alpha 1S subunit, a [Source:ZFIN;Acc:ZDB-GENE-090514-1])

HSP 1 Score: 1132.09 bits (2927), Expect = 0.000e+0
Identity = 714/1657 (43.09%), Postives = 985/1657 (59.44%), Query Frame = 2
Query:  623 KTTSMRSLAKRTINLSFPGMQTSTSKSLFIFSEENVIRKYAKIIIEWGPFEYMVLLTILANCIVLSMERHLPKKDKTLLAGQLELTEKYFLGIFCVEALLKIVALGFCCHKEAYLRNVWNIMDFVVVVTGFLMMFLNIDNH--------SDSSTVDLRTLRAVRVLRPLKLVAGFPSLQVVLKSIIRAMAPLLQIGLLVLFAITIFAIIGLEFYSGAFHYTCFKANSDKLPLPIPTEKSLVPCSNSKNGSGLGAYTCP-EDYQCKAYWEGPNYGITSFDNIGYAMLTVFQCITMEGWTDIMYHTNDAIGNRFNWLYFVPLIILGSFFMLNLVLGVLSGXXXXXXXXXXXXXXXLKLRRQQQTEKEFNGYMEWIQKAEEVLLNEATTTSEDKMRIIAARRRAEKQKYKLLGKNQSIPDFEYEDTELYSETKSMKGNIFIRSYAGIRRRRKERCTSFWRTEKHFRFSVRRLVKSQPFYWAVIILVFFNTVCVAIEHYEQGKWLTLFLNYAEYVFLCLFMMEMMIKMYGLSIRVYFQSSFNIFDCVVIAGSLFEIIYGIFVQDSSFGLSVLRALRLLRIFKVTRYWAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMQLFGGEFNFEEGKPPQ-NFDTFVKALLTVFQILTGEDWNTVMYNGIQSKGGVKERGTVFSIYFVLLVVFGNYTLLNVFLAIAVDNLANXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSSDNFIGRLPLSIDPPMVQVCPPSPQTANSLISKNFSFDHNQVEVNDKGCLLNTNKPNGKLGMLGHDNTNFNSLESDPVPNKIEPETIQRK--PVLPYSAMFIFSPLNSLRRFCHFVVNLRYFDLFIMIVICASSIALAAEDPVKEKSLKNNILEFFDYAFTGVFTVEMILKIIDLGIILHPGSYCRDLWNILDATVVICALVAFIMGQKPSPTGNKLRGSSAKNLNTIKSLRVLRVLRPLKTINRVPKLKAVFDCVVSSLKNVFNILIVYILFQFIFAVIAVQLFQGKFFYCNDASKSSRETCRGYFFDYAGRSTPE--TKKRLWQHHDFHFDNILYAMLTLFTVTTGEGWPTVLKNSMESTNIDNGPIADYRQEMAXXXXXXXXXXXXXXXXXXXALIIITFQEQGENELIDLDLDKNQKQCIDFAINEKPLCRYMPKDKTTIKYRVWRLVVSTPFEYFIMVMIALNTLILMMKYYREEKKASSAATHDREQQAYLNYCNTLIFLNSAFTVMFSIECVLKIMAFGPKNYFRDPWNIFDFITVIGSITDVLVSEL---------------------------QDXXXXXXXXXXXXXXXXXXXXXXQGYTIRILLWTFIQSFKALPYVCLLIAMLFFIYSIIGMQVFGNIKLISEYQINRHNNFQTFTNGLLLLFRCATGESWQEIMLACDNNKPCEKDIE--NTNNFDCGSNFTYIYFVSFIFLCSFLMLNLFVAVIMDNFDYLTRDSSILGPHHLDEYIRVWAEYDPGAIGRIHHSEMYEMLRNMEPPVGFGKKCPYRLAYRKLIRMNMPVDENGTVNFTTTLFALIRESLNIKMSTAEYMDIKDMELRQTICKMWPVQAKKKLNLIVPPDSELVFHKMTVGKIYAGYLIVENWRAYKNSQEQGPRSSPAVSIKSVTK 5464
            + T  R   ++   L   G     ++SL   + +N  RK    I+EW PFE ++LLTI ANC+ L++   +P++D       LE  E  FL IF +E  LKIVA GF  H +AYLRN WNI+DFV+V  G   + ++  N               D++ LRA RVLRPL+LV+G PSLQVV+ SI+++M PL  I LLV F +TI+AIIGLE +    H TC+   +D +      +    PC+ + NG       C     +C+  W GPN GIT FDN+G++MLTV+QCIT +GWTD++Y  NDAIG  + WLYFV LI+LGSFF+LNLVLGVL GEF KERE+  +   +  LR +QQ +++  GYMEWI +AE V+ N+                  E Q          +P  +  +TE   E   +   +F      +R  R        R  + FR   R  VKS+ FYW VI+LVFFNT+ +A EH++Q   LT F +      L LF +EM +KMY + +  YF S FN FDC V++  + E+I       S  G+SVLR +RLLRI K+TR+W +L NLV SLLNS+RSI SLL LLFLFI+IFALLGMQ+FGG+FNF + +  + NFD F +AL+TVFQILTGE WN VMY+GI + GG    G + SIYF++L + GNY LLNVFLAIAVDNLA A+ LT+A++EKA E +R         ++   +  +    L+     +   P + +       K   F+ N  E+ D         P       G D      +   P P  +    ++    P+   SA F+F P N  R+ CH ++N   F   I++ I  SSI+LAAEDP+   S +N +L + DY FT VFT E++LK+   G  LH GS+CR+ +NILD  VV  +L++  MG + S             ++ +K LRVLRVLRPL+ INR   LK V  CV  ++K + NI++V +L  F+FA I VQLF+GKF YC D  K + E C+G F  +   +  +    +RLW + D +FDN+L  ML LFTV+T EGWP +L  +++S   + GP+ +   E++IF+IV+ I+  FF +NIFV  +I+TFQEQGE E  + +LDKNQ+QC+ +A+  +PL  Y+PK+    +Y+VW +V S  FEY + ++I LNT+ L M++ ++    +  A                  LN  FTV+F++E +LK+ AF  K YF DPWN+FDF+ V+GSI DV++SE+                            ++  +S+   RLFR  RL+KLL +   IR LLWTFI+SF+ALPYV LLI MLFFIY++IGMQVFG I L+    INR+NNFQTF   +LLLFRCATGE W EIML C   + C+   E      + CGS F  +YF+SF  LC+FL++NLFVAVIMDNFDYLTRD SILGP HLDE+ ++WAEYDP A GRI H ++  +LR ++PP+GFGK CP+R+A ++LI MNMP++ +GTV F  TLFAL+R  L IK  T    +  + ELR  I K+W   + K L+ ++P   +    ++TVGK YA +LI +++R +   QE+     P+   K+ T+
Sbjct:   16 EETLKRKQREKLKKLQATGGNPRPARSLLFLTLKNPFRKACINIVEWKPFEIIILLTIFANCVALAVFMPMPEEDTNNTNSNLESLEYIFLIIFTMECFLKIVAYGFLFHADAYLRNCWNILDFVIVTMGLFTVVVDFINSISGVEAPVEQKGGFDMKALRAFRVLRPLRLVSGVPSLQVVMSSILKSMLPLFHISLLVFFMVTIYAIIGLELFKCKMHKTCYHTGTDIIA--TGDDAQAAPCAQAGNGR-----RCTLNGTECRGDWPGPNNGITHFDNLGFSMLTVYQCITTQGWTDVLYWVNDAIGMEWPWLYFVTLILLGSFFILNLVLGVLCGEFTKEREKSSRSGEYQILRERQQFDEDLKGYMEWITQAE-VMDNDQ-----------------EGQGL--------LPLQDGSETETLYELDILNKLMFY-----VRHAR--------RWNRFFRRKCRVWVKSKLFYWLVILLVFFNTLAIATEHHQQPDSLTNFQDNTNKALLSLFAVEMFLKMYAMGLPSYFMSLFNRFDCFVVSVGILELILVRMDVMSVMGISVLRCIRLLRIIKITRHWTTLSNLVASLLNSVRSIASLLLLLFLFIVIFALLGMQVFGGKFNFPDDRVRRSNFDNFPQALITVFQILTGEGWNYVMYDGIMAHGGPAIPGILVSIYFIILFICGNYILLNVFLAIAVDNLAEAESLTSAQKEKAEEKKRKRLLRENLPDKGEEEKALLAKKLAEQRAKIDGIPTTAKL------KVDEFESNVNEIKD---------PFPPADFPGDDEEEEPEIPLSPRPRPMADLQLKETEVPMPEASAFFLFGPQNKFRKLCHRIINATTFTNIILLFILLSSISLAAEDPIDPMSFRNQVLAYADYVFTSVFTAEIVLKMTTYGAFLHKGSFCRNSFNILDLIVVGVSLLS--MGMESSA------------ISVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIKTIGNIVLVTMLLDFMFACIGVQLFKGKFLYCTDPLKMTAEECQGTFIQHQENALHDMVVSQRLWMNSDLNFDNVLNGMLALFTVSTFEGWPDLLYKAIDSNLENMGPVYNNHIEISIFFIVYLILIAFFMMNIFVGFVIVTFQEQGEQEYKNCELDKNQRQCVQYALKARPLRCYIPKNP--YQYQVWYIVTSCYFEYLMFLLIMLNTMCLGMQHCKQSDHITDLADT----------------LNVIFTVLFTVEMILKLGAFKAKGYFGDPWNVFDFVIVVGSIVDVILSEIDAALAAQGGLYCLTGCSEVNPMQAIADSENMSVSITLFRLFRVMRLVKLLNRFEGIRNLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQVFGKIALLDGTIINRNNNFQTFPQAVLLLFRCATGEGWHEIMLGCLYGQRCDPKSEYLPGEEYTCGSGFAILYFMSFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPQHLDEFKKIWAEYDPEATGRIKHLDVVTLLRRIQPPLGFGKFCPHRVACKRLISMNMPLNSDGTVTFNATLFALVRTGLKIK--TEGNFEQANEELRAIIKKIWKRTSMKLLDQVIPALGD---DEVTVGKFYATFLIQDHFRKFMKRQEEYYGYRPSKKNKNTTE 1574          
BLAST of Voltage dependent L type calcium channel subunit vs. Ensembl Zebrafish
Match: cacna1sb (calcium channel, voltage-dependent, L type, alpha 1S subunit, b [Source:ZFIN;Acc:ZDB-GENE-051227-1])

HSP 1 Score: 1106.66 bits (2861), Expect = 0.000e+0
Identity = 710/1655 (42.90%), Postives = 987/1655 (59.64%), Query Frame = 2
Query:  677 GMQTSTSKSLFIFSEENVIRKYAKIIIEWGPFEYMVLLTILANCIVLSMERHLPKKDKTLLAGQLELTEKYFLGIFCVEALLKIVALGFCCHKEAYLRNVWNIMDFVVVVTGFLMMFLN-ID-----NHSDSSTVDLRTLRAVRVLRPLKLVAGFPSLQVVLKSIIRAMAPLLQIGLLVLFAITIFAIIGLEFYSGAFHYTCFKANSDKLPLPIPTEKSLVPCSNSKNGSGLGAYTCP-EDYQCKAYWEGPNYGITSFDNIGYAMLTVFQCITMEGWTDIMYHTNDAIGNRFNWLYFVPLIILGSFFMLNLVLGVLSGXXXXXXXXXXXXXXXLKLRRQQQTEKEFNGYMEWIQKAEEVLLNEATTTSEDKMRIIAARRRAEKQK-YKLLGKNQSIPDFEYEDTELYSETKSMKGNIFIRSYAGIRRRRKERCTSFWRTEKHFRFSVRRLVKSQPFYWAVIILVFFNTVCVAIEHYEQGKWLTLFLNYAEYVFLCLFMMEMMIKMYGLSIRVYFQSSFNIFDCVVIAGSLFEIIY---GIFVQDSSFGLSVLRALRLLRIFKVTRYWAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMQLFGGEFNFEEGKPPQ--NFDTFVKALLTVFQILTGEDWNTVMYNGIQSKGGVKERGTVFSIYFVLLVVFGNYTLLNVFLAIAVDNLANXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSSDNFIGRLPLSIDPPMVQVCPPSPQTANSLISKNFSFDHNQVEVNDKGCLLNTNKPNGKLGMLGHDNTNFNSLESDPVPNKIEPETIQRK--PVLPYSAMFIFSPLNSLRRFCHFVVNLRYFDLFIMIVICASSIALAAEDPVKEKSLKNNILEFFDYAFTGVFTVEMILKIIDLGIILHPGSYCRDLWNILDATVVICALVAFIMGQKPSPTGNKLRGSSAKNLNTIKSLRVLRVLRPLKTINRVPKLKAVFDCVVSSLKNVFNILIVYILFQFIFAVIAVQLFQGKFFYCNDASKSSRETCRGYFFDYAGRSTPETK--KRLWQHHDFHFDNILYAMLTLFTVTTGEGWPTVLKNSMESTNIDNGPIADYRQEMAXXXXXXXXXXXXXXXXXXXALIIITFQEQGENELIDLDLDKNQKQCIDFAINEKPLCRYMPKDKTTIKYRVWRLVVSTPFEYFIMVMIALNTLILMMKYYREEKKASSAATHDREQQAYLNYCNTLIFLNSAFTVMFSIECVLKIMAFGPKNYFRDPWNIFDFITVIGSITDVLVSELQ---------------------------DXXXXXXXXXXXXXXXXXXXXXXQGYTIRILLWTFIQSFKALPYVCLLIAMLFFIYSIIGMQVFGNIKLISEYQINRHNNFQTFTNGLLLLFRCATGESWQEIMLACDNNKPCE--KDIENTNNFDCGSNFTYIYFVSFIFLCSFLMLNLFVAVIMDNFDYLTRDSSILGPHHLDEYIRVWAEYDPGAIGRIHHSEMYEMLRNMEPPVGFGKKCPYRLAYRKLIRMNMPVDENGTVNFTTTLFALIRESLNIKMSTAEYMDIKDMELRQTICKMWPVQAKKKLNLIVPPDSELVFHKMTVGKIYAGYLIVENWRAYKNSQEQ----GPRSSPAVSIKSVTKPVVKEEKSA 5491
            G      ++LF F   N  RK    I+EW PFE ++LLTI ANC+ L++   +P++D       LE  E  FL IF +E  LKI+A G   H+ AYLRN WNI+DFV+V  G   + ++ ID             D++ LRA RVLRPL+LV+G PSLQVV+ S++++M PL  I LLV F +TI+AI+GLE +    H TC+   ++ + L    + S  PC+ + NG       C     +C+  W GPN+GIT FDN G+AMLTVFQCIT E WTD++Y  NDA+GN + W+YF+ LI+LGSFF+LNLVLGVLSGEF KERE+   R  +  LR +QQ +++  GYMEWI  A      E      D M ++     +E    YK+ G N+ +          Y    + + NI IR           +C  +              VKS+ F W V+I+V  NT+ +A EH+ Q + LT F + A  + L  F +EM++KMY    R YF S FN FDC V+   + EII    GI    +  G+SV+R +RLLR+FK+T+YW SL NLV+SLLNS++SI SLL LLFLFI+IFALLGMQ+FGG+FNF + +P Q  NFD F +AL++VFQ+LTGE+W+T+MYNGI + GG K  G + SIYF++L V GN+ LLNVFLAIAVDNLA A+ L AA++E+A E  R      L  + +     + +  +       Q     P TA   I +   F+ N  EV D         P       G D      +   P P  +    ++    P+   S+ FIF P N  R+ CH ++N   F   I++ I  SSI+LAAEDP+   S +N +L + D  FT VFT+E++LK+   G  LHPGS+CR+ +NILD  VV  +L++               G  +  ++ +K LRVLRVLRPL+ INR   LK V  C+  ++K + NI++V +L  F+F+ I VQLF+G  FYC D  + + E C+G F  +   S  +T+  +R W + DF+FDN+L  ML LFT++T EGWP +L  +++S ++D GP+ + R  ++IF+I++ I+  FF +NIFV  +I+TFQ QGE E  + +LDKNQ+QC+ +A+  +PL  Y+P++    +YRVW LV S  FEY +  +I LNTL L M+Y  +    +  + +                LN  FTV+F+ E ++K++AF  K YF DPWN+FDF+ VIGSI DV++SE+                            ++  LS+ F RLFR  RLIKLL +   IR LLWTFI+SF+ALP+V LLI MLFFIY++IGMQ+FG I L+   +INR+NNFQTF   +LLLFR ATGE W +IMLA    K C+   D      + CGS+    YF+SF  LC+FL++NLFVA+IMDNFDYLT D SILGPHHLDE+ ++W EYDP A GRI H ++  +LR ++PP+GFGK CP+  A ++LI MNMP++ +GTV F  TLFAL+R +L IK  T    +  + ELR  I  +W   + K L+ ++PP  E    ++TVGK YA +LI E++R +   QE+     P    A  IK+  + +  EE++A
Sbjct:   45 GGNPRPPRTLFFFKLRNPFRKACTNIVEWKPFEIIILLTIFANCVALAVFLPMPEEDTNNTNLTLESLEYIFLVIFTLECFLKIIAYGLLFHEGAYLRNCWNILDFVIVFMGLFTLVVDTIDTITGVQKEKGGGFDMKALRAFRVLRPLRLVSGVPSLQVVMSSVLKSMLPLFHILLLVFFMVTIYAIMGLELFKCKMHKTCYYQGTNIIALRENEKPS--PCAQAGNGR-----RCTINGTECRDGWPGPNFGITHFDNFGFAMLTVFQCITTESWTDVLYWINDAMGNDWPWIYFLSLIMLGSFFILNLVLGVLSGEFTKEREKSRSRGEWQVLRERQQMDEDLKGYMEWITHA------EVMDGDSDAMLLLRKDTGSETDSLYKMEGINKVV----------YFYRLARRWNIVIR----------RKCHGW--------------VKSKSFNWWVLIVVLLNTLVIATEHHNQTEGLTNFQDTANVILLACFTIEMIMKMYAFGPRSYFMSIFNRFDCFVVTIGILEIILVGSGIM---TPLGISVMRCIRLLRLFKLTKYWTSLNNLVVSLLNSVKSIASLLLLLFLFIVIFALLGMQVFGGKFNFPD-RPIQRSNFDNFPQALISVFQVLTGEEWDTIMYNGIMAHGGPKSPGILVSIYFIILYVCGNFVLLNVFLAIAVDNLAEAESLAAAQKERAEERARKKLMKPLPEKTEEEKALMAKRLMESR----QKTEGMPTTAKLKIDE---FESNVNEVKD---------PFPPADFPGDDEEEEPEIPISPRPRPMADLQLKETVVPMPEASSFFIFGPQNKFRKLCHRIINHTTFTNIILLFILLSSISLAAEDPIDPHSFRNKVLAYADIVFTTVFTIEIVLKMTVYGAFLHPGSFCRNSFNILDLIVVAVSLLSM--------------GMESSTISVVKILRVLRVLRPLRAINRAKGLKHVVQCMFVAIKTIGNIVLVTMLLDFMFSCIGVQLFKGTLFYCTDPLQKTAEQCQGTFLKHVQNSLHDTEIHQRRWVNSDFNFDNVLNGMLALFTISTFEGWPEILYKAIDSYDVDTGPLYNNRVGISIFFIIYIIIIAFFMMNIFVGFVIVTFQRQGEQEYKNCELDKNQRQCVQYALKARPLKCYIPENPH--QYRVWYLVTSCYFEYLMFFLIMLNTLSLGMQYCNQPFYITKLSDN----------------LNVIFTVLFTGEMIVKLIAFKAKGYFGDPWNVFDFVIVIGSIVDVVLSEVDRTLEASGGLWCLHGCSEVDPMQAIAEAENVKLSITFFRLFRVLRLIKLLNRSEGIRNLLWTFIKSFQALPHVGLLIVMLFFIYAVIGMQMFGKIALVDGTEINRNNNFQTFPQAVLLLFRVATGEQWPKIMLASMYGKLCDPKSDYGPGEEYTCGSSIAVCYFLSFYMLCAFLVINLFVAIIMDNFDYLTHDWSILGPHHLDEFKKIWGEYDPEATGRIKHLDVVTLLRRIQPPLGFGKFCPHHAACKRLISMNMPLNSDGTVTFNATLFALVRTALKIK--TEGNFEQANEELRAIIKSIWKRTSMKLLDQVIPPIGE---DEVTVGKFYATFLIQEHFRKFMQRQEELYGYRPTKKNADEIKAGLRSI--EEEAA 1593          
BLAST of Voltage dependent L type calcium channel subunit vs. Ensembl Zebrafish
Match: cacna1bb (calcium channel, voltage-dependent, N type, alpha 1B subunit, b [Source:ZFIN;Acc:ZDB-GENE-090514-4])

HSP 1 Score: 920.998 bits (2379), Expect = 0.000e+0
Identity = 486/801 (60.67%), Postives = 619/801 (77.28%), Query Frame = 2
Query: 3071 KPVLPYSAMFIFSPLNSLRRFCHFVVNLRYFDLFIMIVICASSIALAAEDPVKEKSLKNNILEFFDYAFTGVFTVEMILKIIDLGIILHPGSYCRDLWNILDATVVICALVAFIMGQKPSPTGNKLRGSSAKNLNTIKSLRVLRVLRPLKTINRVPKLKAVFDCVVSSLKNVFNILIVYILFQFIFAVIAVQLFQGKFFYCNDASKSSRETCRGYFFDYAGRSTPETKKRLWQHHDFHFDNILYAMLTLFTVTTGEGWPTVLKNSMESTNIDNGPIADYRQEMAXXXXXXXXXXXXXXXXXXXALIIITFQEQGENELIDLDLDKNQKQCIDFAINEKPLCRYMPKDKTTIKYRVWRLVVSTPFEYFIMVMIALNTLILMMKYYREEKKASSAATHDREQQAYLNYCNTLIFLNSAFTVMFSIECVLKIMAFGPKNYFRDPWNIFDFITVIGSITDVLVSELQDXXXXXXXXXXXXXXXXXXXXXXQGYTIRILLWTFIQSFKALPYVCLLIAMLFFIYSIIGMQVFGNIKLISE-YQINRHNNFQTFTNGLLLLFRCATGESWQEIMLACDNNKPCEKDIENT-NNFDCGSNFTYIYFVSFIFLCSFLMLNLFVAVIMDNFDYLTRDSSILGPHHLDEYIRVWAEYDPGAIGRIHHSEMYEMLRNMEPPVGFGKKCPYRLAYRKLIRMNMPVDENGTVNFTTTLFALIRESLNIKMSTAEYMD-IKDMELRQTICKMWPVQAKKKLNLIVPPD----SELVFHKMTVGKIYAGYLIVENWRAYKNSQEQGPRSSPAVSIK 5452
            K +LPYS+MF+F P N +RR CH+VVNLRYF++ I+ VI  SSIALAAEDPV+  + +N++L++ DY FTGVFT EM++K+IDLG++LHPGSY RDLWNILD  VV  ALVAF              G+  K++NTIKSLRVLRVLRPLKTI R+PKLKAVFDCVV+SLKNV NILIVYILF FIFAVIAVQLF+GKFF+C D SK+  + CRG F +Y       T+ R W+ +DFH+DN+L+A LTLFTV+TGEGWP VLK+S+++T  D GP   YR E +IFY+V+FIVFPFFFVNIFVALIIITFQEQG+  + +  L+KN++ CIDFAIN KPL RYMP+DK + +Y++W+ VVSTPFEY I+ MIA+NT++LMMK++   K                 Y + L +LN  FT +F++ECVLK++AFGP NY ++ WNIFDF+TV+GSITD+LV+E++D   ++L FLRLFRAARLIKLLRQGYTIRILLWTF+QSFKALPYVCLLIAMLFFIY+IIGMQVFGNI L +E   IN HNNF+TF   L+LLFR ATGE+W EIMLAC + + C  DIE+  +  +CGS+F Y YFVSFIFLCSFLMLNLFVAVIMDNF+YLTRD+SILGPHHLDE+IRVWAEYDP A GR+ + +MYEMLR+M PP+G GKKCP R+AY++L+RMNMP+ E+ TV+FT+TL ALIR +L IK+++      I D ELR+ I K+WP  + K ++L+V P     ++L ++++TVGK+YA  +I + ++  +  + Q  +++P    K
Sbjct: 1064 KHILPYSSMFVFGPTNPVRRLCHYVVNLRYFEMCILTVITMSSIALAAEDPVQAHAPRNDVLKYLDYVFTGVFTFEMVIKMIDLGLLLHPGSYFRDLWNILDFIVVSGALVAFACS-----------GTKGKDINTIKSLRVLRVLRPLKTIKRLPKLKAVFDCVVNSLKNVLNILIVYILFMFIFAVIAVQLFKGKFFHCTDESKALEKDCRGQFLEYGSDGVAMTQPREWKKYDFHYDNVLWAFLTLFTVSTGEGWPLVLKHSVDATYEDQGPSPGYRMETSIFYVVYFIVFPFFFVNIFVALIIITFQEQGDKAMSECSLEKNERACIDFAINAKPLTRYMPQDKNSYQYKMWKFVVSTPFEYSILTMIAINTVVLMMKFHGAPKP----------------YEDMLKWLNIIFTALFTLECVLKVIAFGPLNYLKEAWNIFDFVTVLGSITDILVTEIKD-KRINLSFLRLFRAARLIKLLRQGYTIRILLWTFVQSFKALPYVCLLIAMLFFIYAIIGMQVFGNIALNNEDSAINIHNNFRTFFQALMLLFRSATGEAWHEIMLACLSERYC--DIESGYSGKECGSDFAYFYFVSFIFLCSFLMLNLFVAVIMDNFEYLTRDASILGPHHLDEFIRVWAEYDPAACGRMSYLDMYEMLRHMSPPLGLGKKCPPRIAYKRLVRMNMPIAEDNTVHFTSTLMALIRTALEIKLASGVLAQRICDAELRKEINKIWPSLSSKTVDLLVTPHKRKFNKLSYNELTVGKVYAALMIFDYYKQNRAKRLQQQQAAPGTQSK 1834          

HSP 2 Score: 706.442 bits (1822), Expect = 0.000e+0
Identity = 422/715 (59.02%), Postives = 524/715 (73.29%), Query Frame = 2
Query:  617 GSKTTSMRSLAKRTINLS-FPGMQT-----STSKSLFIFSEENVIRKYAKIIIEWGPFEYMVLLTILANCIVLSMERHLPKKDKTLLAGQLELTEKYFLGIFCVEALLKIVALGFCCHKEAYLRNVWNIMDFVVVVTGFLMMFLNIDNHSDSSTVDLRTLRAVRVLRPLKLVAGFPSLQVVLKSIIRAMAPLLQIGLLVLFAITIFAIIGLEFYSGAFHYTCFKANSDKLPLPIPTEKSL-VPCSNSKNGSGLGAYTCPEDYQCKAYWEGPNYGITSFDNIGYAMLTVFQCITMEGWTDIMYHTNDAIGNRFNWLYFVPLIILGSFFMLNLVLGVLSGXXXXXXXXXXXXXXXLKLRRQQQTEKEFNGYMEWIQKAEEVLLNEATTTSEDKMRIIAA--RRRAE----KQKYKLLGKNQSIPDFEYEDTELYSETKSMK--GNIFIRSYAGIRRRRKERCTSFWRTEKHFRFSVRRLVKSQPFYWAVIILVFFNTVCVAIEHYEQGKWLTLFLNYAEYVFLCLFMMEMMIKMYGLSIRVYFQSSFNIFDCVVIAGSLFEIIYGIFVQDSSFGLSVLRALRLLRIFKVTRYWAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMQLFGGEFNFEEGKPPQNFDTFVKALLTVFQILTGEDWNTVMYNGIQSKGGVKERGTVF-SIYFVLLVVFGNYTLLNVFLAIAVDNLAN 2713
            G +    +S+A+R   ++ +   QT     + ++SLFIFSE+NVIRKY           Y++L TI+ANCIVL++E+HLP  DKT ++ +L+ TE YF+GIFC EA +KI+ALGF  HK++YLRN WNIMDFVVVVTG L            S  DLRTLRAVRVLRPLKLV+G PSLQVVLKSI++AM PLLQIGLL+ FAI +FAIIG+EFY G FH+TCFK ++         EK++  PC     G+   + +CP    C  YW+GPN+GIT+FDNI +A+LTVFQCITMEGWTD++YHTNDA GN +NWLYF+PLII+GSFFMLNLVLGVLSGEFAKERERVEKR+ FLKLRRQQQ E+E  GY+EWI KAEEVLL E    +E+K  +  A  RR+      K+     G+N  I     E  E +++  S+   G+ F R  A ++  + +  + F R EK  RF +RR+VK+Q FYW V+ LV  NT+CVAI HY+Q +WLT  L  AE+VFL LF+ EM +KMYGL  R YF SSFN FD  VI GS+FE+I+      +SFG+SVLRALRLLRIFKVT+YW SLRNLV+SLLNSM+SIISLLFLLFLFI++FALLGMQLFGG+FNFE+  P  NFD+F  A++TVFQILTGEDWN VMY+GI+S+GGV  RG +F S+YF++L +FGNYTLLNVFLAIAVDNLAN
Sbjct:   33 GGQRMYKQSMAQRARTMALYNPKQTKQNCFTVNRSLFIFSEDNVIRKY-----------YLILTTIIANCIVLALEQHLPALDKTPMSERLDDTEPYFIGIFCFEAGIKIIALGFVFHKDSYLRNGWNIMDFVVVVTGILTTV--------GSQFDLRTLRAVRVLRPLKLVSGIPSLQVVLKSIMKAMVPLLQIGLLLFFAIVMFAIIGVEFYMGKFHFTCFKVDTG--------EKAVDYPC-----GAEPPSRSCPVGTNCTEYWKGPNFGITNFDNILFAILTVFQCITMEGWTDVLYHTNDAAGNTWNWLYFIPLIIIGSFFMLNLVLGVLSGEFAKERERVEKRQEFLKLRRQQQIERELTGYLEWICKAEEVLLAEEDQNAEEKSPLDGAWYRRKQNNPVLKRTKSRKGRNDLIS--AEEGDEHFTDISSVAPPGSPFAR--ASLKSSKNDSSSYFRRKEKRIRFFIRRMVKAQSFYWIVLCLVGLNTMCVAIVHYDQPEWLTKALYLAEFVFLGLFLTEMTLKMYGLGPRNYFHSSFNCFDFGVIVGSIFEVIWAAIQPGASFGISVLRALRLLRIFKVTKYWNSLRNLVVSLLNSMKSIISLLFLLFLFIVVFALLGMQLFGGQFNFEDETPTTNFDSFPAAIMTVFQILTGEDWNAVMYHGIESQGGV--RGGMFSSVYFIVLTLFGNYTLLNVFLAIAVDNLAN 709          

HSP 3 Score: 119.783 bits (299), Expect = 3.983e-26
Identity = 84/316 (26.58%), Postives = 153/316 (48.42%), Query Frame = 2
Query:  701 SLFIFSEENVIRKYAKIIIEWGPFEYMVLLTILANCIVLSME----RHLPKKDKTLLAGQLELTEKYFLGIFCVEALLKIVALGFCCHKEAYLRNVWNIMDFVVVVTGFLMMFLNIDNHSDSSTVDLRTLRAVRVLRPLKLVAGFPSLQVVLKSIIRAMAPLLQIGLLVLFAITIFAIIGLEFYSGAFHYTCFKANSDKLPLPIPTEKSLVPCSNS--KNGSGLGAYTCPEDYQCKAYWEGPNYGITSFDNIGYAMLTVFQCITMEGWTDIMYHTNDAI--------GNRFNW-LYFVPLIILGSFFMLNLVLGVL 1603
            S+F+F   N +R+    ++    FE  +L  I  + I L+ E     H P+ D       L+  +  F G+F  E ++K++ LG   H  +Y R++WNI+DF+VV    +    +     D +T+  ++LR +RVLRPLK +   P L+ V   ++ ++  +L I ++ +  + IFA+I ++ + G F +   ++ +         EK    C     + GS   A T P +      W+  ++    +DN+ +A LT+F   T EGW  ++ H+ DA         G R    +++V   I+  FF +N+ + ++
Sbjct: 1071 SMFVFGPTNPVRRLCHYVVNLRYFEMCILTVITMSSIALAAEDPVQAHAPRNDV------LKYLDYVFTGVFTFEMVIKMIDLGLLLHPGSYFRDLWNILDFIVVSGALVAFACSGTKGKDINTI--KSLRVLRVLRPLKTIKRLPKLKAVFDCVVNSLKNVLNILIVYILFMFIFAVIAVQLFKGKFFHCTDESKA--------LEKD---CRGQFLEYGSDGVAMTQPRE------WKKYDF---HYDNVLWAFLTLFTVSTGEGWPLVLKHSVDATYEDQGPSPGYRMETSIFYVVYFIVFPFFFVNIFVALI 1358          

HSP 4 Score: 113.235 bits (282), Expect = 3.346e-24
Identity = 78/277 (28.16%), Postives = 132/277 (47.65%), Query Frame = 2
Query: 3092 AMFIFSPLNSLRRFCHFVVNLRYFDLFIMIVICASSIALAAED--PVKEKSLKNNILEFFDYAFTGVFTVEMILKIIDLGIILHPGSYCRDLWNILDATVVICALVAFIMGQKPSPTGNKLRGSSAKNLNTIKSLRVLRVLRPLKTINRVPKLKAVFDCVVSSLKNVFNILIVYILFQFIFAVIAVQLFQGKF-FYCNDASKSSRETCRGYFFDYAGRSTPETKK--------RLWQHHDF---HFDNILYAMLTLFTVTTGEGWPTVLKNSMESTN 3880
            ++FIFS  N +R++             I+  I A+ I LA E   P  +K+  +  L+  +  F G+F  E  +KII LG + H  SY R+ WNI+D  VV+  ++  +  Q                   +++LR +RVLRPLK ++ +P L+ V   ++ ++  +  I ++      +FA+I V+ + GKF F C       +        DY   + P ++           W+  +F   +FDNIL+A+LT+F   T EGW  VL ++ ++  
Sbjct:   67 SLFIFSEDNVIRKY-----------YLILTTIIANCIVLALEQHLPALDKTPMSERLDDTEPYFIGIFCFEAGIKIIALGFVFHKDSYLRNGWNIMDFVVVVTGILTTVGSQ-----------------FDLRTLRAVRVLRPLKLVSGIPSLQVVLKSIMKAMVPLLQIGLLLFFAIVMFAIIGVEFYMGKFHFTCFKVDTGEKAV------DYPCGAEPPSRSCPVGTNCTEYWKGPNFGITNFDNILFAILTVFQCITMEGWTDVLYHTNDAAG 309          

HSP 5 Score: 91.6633 bits (226), Expect = 1.310e-17
Identity = 73/253 (28.85%), Postives = 138/253 (54.55%), Query Frame = 2
Query: 1979 FRFSVRRLVKSQPFYWAVIILVFFNTVCVAIEHYEQGKWLTLFLNYAEYVFLCLFMMEMMIKMYGLSIRVYFQSSFNIFDCVVIAGSLFEIIYGIFVQDSSFGLSVLRALRLLRIFKVTRYWAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMQLFGG-EFNFEEG--KPPQNFDTFVKALLTVFQILTGEDWNTVM-------YNGIQSKGGVKERGTVFS-IYFVLLVVFGNYTLLNVFLAIAVDN 2704
            +++ + + V S PF ++++ ++  NTV + ++ +   K     L +   +F  LF +E ++K+       Y + ++NIFD V + GS+ +I+    ++D    LS LR  R  R+ K+ R   ++R L+ + + S +++  +  L+ +   I+A++GMQ+FG    N E+       NF TF +AL+ +F+  TGE W+ +M       Y  I+S    KE G+ F+  YFV  +   ++ +LN+F+A+ +DN
Sbjct: 1403 YQYKMWKFVVSTPFEYSILTMIAINTVVLMMKFHGAPKPYEDMLKWLNIIFTALFTLECVLKVIAFGPLNYLKEAWNIFDFVTVLGSITDILV-TEIKDKRINLSFLRLFRAARLIKLLRQGYTIRILLWTFVQSFKALPYVCLLIAMLFFIYAIIGMQVFGNIALNNEDSAINIHNNFRTFFQALMLLFRSATGEAWHEIMLACLSERYCDIESGYSGKECGSDFAYFYFVSFIFLCSFLMLNLFVAVIMDN 1654          

HSP 6 Score: 90.1225 bits (222), Expect = 4.248e-17
Identity = 72/292 (24.66%), Postives = 142/292 (48.63%), Query Frame = 2
Query: 4097 YMPKDKTTIKYRVWRLVVSTPFEYFIMVMIALNTLILMMKYYREEKKASSAATHDREQQAYLNYCNTLIFLNSAFTVMFSIECVLKIMAFGPKNYFRDPWNIFDFITVIGSITDVLVSELQDXXXXXXXXXXXXXXXXXXXXXXQGYTIRILLWTFIQSFKALPYVCLLIAMLFFIYSIIGMQVFGNIKLISEYQINRHN-----NFQTFTNGLLLLFRCATGESWQEIMLACDNNKPCEKDIENTNNFDCGSNFTYIYFVSFIFLCSFLMLNLFVAVIMDNF---DYLTRD 4948
            Y  + +  I++ + R+V +  F + ++ ++ LNT+ + + +Y + +  + A            Y    +FL      +F  E  LK+   GP+NYF   +N FDF  ++GSI +V+ + +Q  +   +  LR  R  R+ K+ +   ++R L+ + + S K++  +  L+ +   +++++GMQ+FG        Q N  +     NF +F   ++ +F+  TGE W  +M            IE+      G  F+ +YF+      ++ +LN+F+A+ +DN      LT+D
Sbjct:  458 YFRRKEKRIRFFIRRMVKAQSFYWIVLCLVGLNTMCVAIVHYDQPEWLTKAL-----------YLAEFVFLG-----LFLTEMTLKMYGLGPRNYFHSSFNCFDFGVIVGSIFEVIWAAIQPGASFGISVLRALRLLRIFKVTKYWNSLRNLVVSLLNSMKSIISLLFLLFLFIVVFALLGMQLFGG-------QFNFEDETPTTNFDSFPAAIMTVFQILTGEDWNAVMY---------HGIESQGGVR-GGMFSSVYFIVLTLFGNYTLLNVFLAIAVDNLANAQELTKD 716          

HSP 7 Score: 77.0258 bits (188), Expect = 3.216e-13
Identity = 71/293 (24.23%), Postives = 120/293 (40.96%), Query Frame = 2
Query:  767 PFEYMVLLTILANCIVLSMERH-LPKKDKTLLAGQLELTEKYFLGIFCVEALLKIVALGFCCHKEAYLRNVWNIMDFVVVVTGFLMMFLNIDNHSDSSTVDLRTLRAVRVLRPLKLVAGFPSLQVVLKSIIRAMAPLLQIGLLVLFAITIFAIIGLEFYSGAFHYTCFKANSDKLPLPIPTEKSLVPCSNSKNGSGLGAYTCPEDYQCKAYWEGPNYGITSFDNIGYAMLTVFQCITMEGWTDIMY-------------HTNDAIGNRFNWLYFVPLIILGSFFMLNLVLGVL 1603
            PFEY +L  I  N +VL M+ H  PK  + +L    +     F  +F +E +LK++A G       YL+  WNI DFV V+     + +          ++L  LR  R  R +KL+    +++++L + +++   L  + LL+     I+AIIG++ +                 + +  E S +   N                              +F     A++ +F+  T E W +IM              ++    G+ F + YFV  I L SF MLNL + V+
Sbjct: 1415 PFEYSILTMIAINTVVLMMKFHGAPKPYEDML----KWLNIIFTALFTLECVLKVIAFG----PLNYLKEAWNIFDFVTVLGSITDILV---TEIKDKRINLSFLRLFRAARLIKLLRQGYTIRILLWTFVQSFKALPYVCLLIAMLFFIYAIIGMQVFGN---------------IALNNEDSAINIHN------------------------------NFRTFFQALMLLFRSATGEAWHEIMLACLSERYCDIESGYSGKECGSDFAYFYFVSFIFLCSFLMLNLFVAVI 1651          

HSP 8 Score: 53.1434 bits (126), Expect = 6.746e-6
Identity = 50/207 (24.15%), Postives = 100/207 (48.31%), Query Frame = 2
Query: 3254 LEFFDYAFTGVFTVEMILKIIDLGIILHPGSYCRDLWNILDATVVICALVAFIMGQKPSPTGNKLRGSSAKNLNTIKSLRVLRVLRPLKTINRVPKLKAVFDCVVSSLKNVFNILIVYILFQFIFAVIAVQLFQGKFFYCNDASKSSRETCRGYFFDYAGRSTPETKKRLWQHHDFHFDNILYAMLTLFTVTTGEGWPTVLKNSMES 3874
            L   ++ F G+F  EM LK+  LG    P +Y    +N  D  V++ ++   I           ++  ++  ++ +++LR+LR+ +  K  N    L+ +   +++S+K++ ++L +  LF  +FA++ +QLF G+F + ++                    TP T          +FD+   A++T+F + TGE W  V+ + +ES
Sbjct:  509 LYLAEFVFLGLFLTEMTLKMYGLG----PRNYFHSSFNCFDFGVIVGSIFEVIWA--------AIQPGASFGISVLRALRLLRIFKVTKYWN---SLRNLVVSLLNSMKSIISLLFLLFLFIVVFALLGMQLFGGQFNFEDE--------------------TPTT----------NFDSFPAAIMTVFQILTGEDWNAVMYHGIES 670          
BLAST of Voltage dependent L type calcium channel subunit vs. Ensembl Zebrafish
Match: cacna1bb (calcium channel, voltage-dependent, N type, alpha 1B subunit, b [Source:ZFIN;Acc:ZDB-GENE-090514-4])

HSP 1 Score: 920.998 bits (2379), Expect = 0.000e+0
Identity = 486/801 (60.67%), Postives = 619/801 (77.28%), Query Frame = 2
Query: 3071 KPVLPYSAMFIFSPLNSLRRFCHFVVNLRYFDLFIMIVICASSIALAAEDPVKEKSLKNNILEFFDYAFTGVFTVEMILKIIDLGIILHPGSYCRDLWNILDATVVICALVAFIMGQKPSPTGNKLRGSSAKNLNTIKSLRVLRVLRPLKTINRVPKLKAVFDCVVSSLKNVFNILIVYILFQFIFAVIAVQLFQGKFFYCNDASKSSRETCRGYFFDYAGRSTPETKKRLWQHHDFHFDNILYAMLTLFTVTTGEGWPTVLKNSMESTNIDNGPIADYRQEMAXXXXXXXXXXXXXXXXXXXALIIITFQEQGENELIDLDLDKNQKQCIDFAINEKPLCRYMPKDKTTIKYRVWRLVVSTPFEYFIMVMIALNTLILMMKYYREEKKASSAATHDREQQAYLNYCNTLIFLNSAFTVMFSIECVLKIMAFGPKNYFRDPWNIFDFITVIGSITDVLVSELQDXXXXXXXXXXXXXXXXXXXXXXQGYTIRILLWTFIQSFKALPYVCLLIAMLFFIYSIIGMQVFGNIKLISE-YQINRHNNFQTFTNGLLLLFRCATGESWQEIMLACDNNKPCEKDIENT-NNFDCGSNFTYIYFVSFIFLCSFLMLNLFVAVIMDNFDYLTRDSSILGPHHLDEYIRVWAEYDPGAIGRIHHSEMYEMLRNMEPPVGFGKKCPYRLAYRKLIRMNMPVDENGTVNFTTTLFALIRESLNIKMSTAEYMD-IKDMELRQTICKMWPVQAKKKLNLIVPPD----SELVFHKMTVGKIYAGYLIVENWRAYKNSQEQGPRSSPAVSIK 5452
            K +LPYS+MF+F P N +RR CH+VVNLRYF++ I+ VI  SSIALAAEDPV+  + +N++L++ DY FTGVFT EM++K+IDLG++LHPGSY RDLWNILD  VV  ALVAF              G+  K++NTIKSLRVLRVLRPLKTI R+PKLKAVFDCVV+SLKNV NILIVYILF FIFAVIAVQLF+GKFF+C D SK+  + CRG F +Y       T+ R W+ +DFH+DN+L+A LTLFTV+TGEGWP VLK+S+++T  D GP   YR E +IFY+V+FIVFPFFFVNIFVALIIITFQEQG+  + +  L+KN++ CIDFAIN KPL RYMP+DK + +Y++W+ VVSTPFEY I+ MIA+NT++LMMK++   K                 Y + L +LN  FT +F++ECVLK++AFGP NY ++ WNIFDF+TV+GSITD+LV+E++D   ++L FLRLFRAARLIKLLRQGYTIRILLWTF+QSFKALPYVCLLIAMLFFIY+IIGMQVFGNI L +E   IN HNNF+TF   L+LLFR ATGE+W EIMLAC + + C  DIE+  +  +CGS+F Y YFVSFIFLCSFLMLNLFVAVIMDNF+YLTRD+SILGPHHLDE+IRVWAEYDP A GR+ + +MYEMLR+M PP+G GKKCP R+AY++L+RMNMP+ E+ TV+FT+TL ALIR +L IK+++      I D ELR+ I K+WP  + K ++L+V P     ++L ++++TVGK+YA  +I + ++  +  + Q  +++P    K
Sbjct: 1064 KHILPYSSMFVFGPTNPVRRLCHYVVNLRYFEMCILTVITMSSIALAAEDPVQAHAPRNDVLKYLDYVFTGVFTFEMVIKMIDLGLLLHPGSYFRDLWNILDFIVVSGALVAFACS-----------GTKGKDINTIKSLRVLRVLRPLKTIKRLPKLKAVFDCVVNSLKNVLNILIVYILFMFIFAVIAVQLFKGKFFHCTDESKALEKDCRGQFLEYGSDGVAMTQPREWKKYDFHYDNVLWAFLTLFTVSTGEGWPLVLKHSVDATYEDQGPSPGYRMETSIFYVVYFIVFPFFFVNIFVALIIITFQEQGDKAMSECSLEKNERACIDFAINAKPLTRYMPQDKNSYQYKMWKFVVSTPFEYSILTMIAINTVVLMMKFHGAPKP----------------YEDMLKWLNIIFTALFTLECVLKVIAFGPLNYLKEAWNIFDFVTVLGSITDILVTEIKD-KRINLSFLRLFRAARLIKLLRQGYTIRILLWTFVQSFKALPYVCLLIAMLFFIYAIIGMQVFGNIALNNEDSAINIHNNFRTFFQALMLLFRSATGEAWHEIMLACLSERYC--DIESGYSGKECGSDFAYFYFVSFIFLCSFLMLNLFVAVIMDNFEYLTRDASILGPHHLDEFIRVWAEYDPAACGRMSYLDMYEMLRHMSPPLGLGKKCPPRIAYKRLVRMNMPIAEDNTVHFTSTLMALIRTALEIKLASGVLAQRICDAELRKEINKIWPSLSSKTVDLLVTPHKRKFNKLSYNELTVGKVYAALMIFDYYKQNRAKRLQQQQAAPGTQSK 1834          

HSP 2 Score: 706.442 bits (1822), Expect = 0.000e+0
Identity = 422/715 (59.02%), Postives = 524/715 (73.29%), Query Frame = 2
Query:  617 GSKTTSMRSLAKRTINLS-FPGMQT-----STSKSLFIFSEENVIRKYAKIIIEWGPFEYMVLLTILANCIVLSMERHLPKKDKTLLAGQLELTEKYFLGIFCVEALLKIVALGFCCHKEAYLRNVWNIMDFVVVVTGFLMMFLNIDNHSDSSTVDLRTLRAVRVLRPLKLVAGFPSLQVVLKSIIRAMAPLLQIGLLVLFAITIFAIIGLEFYSGAFHYTCFKANSDKLPLPIPTEKSL-VPCSNSKNGSGLGAYTCPEDYQCKAYWEGPNYGITSFDNIGYAMLTVFQCITMEGWTDIMYHTNDAIGNRFNWLYFVPLIILGSFFMLNLVLGVLSGXXXXXXXXXXXXXXXLKLRRQQQTEKEFNGYMEWIQKAEEVLLNEATTTSEDKMRIIAA--RRRAE----KQKYKLLGKNQSIPDFEYEDTELYSETKSMK--GNIFIRSYAGIRRRRKERCTSFWRTEKHFRFSVRRLVKSQPFYWAVIILVFFNTVCVAIEHYEQGKWLTLFLNYAEYVFLCLFMMEMMIKMYGLSIRVYFQSSFNIFDCVVIAGSLFEIIYGIFVQDSSFGLSVLRALRLLRIFKVTRYWAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMQLFGGEFNFEEGKPPQNFDTFVKALLTVFQILTGEDWNTVMYNGIQSKGGVKERGTVF-SIYFVLLVVFGNYTLLNVFLAIAVDNLAN 2713
            G +    +S+A+R   ++ +   QT     + ++SLFIFSE+NVIRKY           Y++L TI+ANCIVL++E+HLP  DKT ++ +L+ TE YF+GIFC EA +KI+ALGF  HK++YLRN WNIMDFVVVVTG L            S  DLRTLRAVRVLRPLKLV+G PSLQVVLKSI++AM PLLQIGLL+ FAI +FAIIG+EFY G FH+TCFK ++         EK++  PC     G+   + +CP    C  YW+GPN+GIT+FDNI +A+LTVFQCITMEGWTD++YHTNDA GN +NWLYF+PLII+GSFFMLNLVLGVLSGEFAKERERVEKR+ FLKLRRQQQ E+E  GY+EWI KAEEVLL E    +E+K  +  A  RR+      K+     G+N  I     E  E +++  S+   G+ F R  A ++  + +  + F R EK  RF +RR+VK+Q FYW V+ LV  NT+CVAI HY+Q +WLT  L  AE+VFL LF+ EM +KMYGL  R YF SSFN FD  VI GS+FE+I+      +SFG+SVLRALRLLRIFKVT+YW SLRNLV+SLLNSM+SIISLLFLLFLFI++FALLGMQLFGG+FNFE+  P  NFD+F  A++TVFQILTGEDWN VMY+GI+S+GGV  RG +F S+YF++L +FGNYTLLNVFLAIAVDNLAN
Sbjct:   33 GGQRMYKQSMAQRARTMALYNPKQTKQNCFTVNRSLFIFSEDNVIRKY-----------YLILTTIIANCIVLALEQHLPALDKTPMSERLDDTEPYFIGIFCFEAGIKIIALGFVFHKDSYLRNGWNIMDFVVVVTGILTTV--------GSQFDLRTLRAVRVLRPLKLVSGIPSLQVVLKSIMKAMVPLLQIGLLLFFAIVMFAIIGVEFYMGKFHFTCFKVDTG--------EKAVDYPC-----GAEPPSRSCPVGTNCTEYWKGPNFGITNFDNILFAILTVFQCITMEGWTDVLYHTNDAAGNTWNWLYFIPLIIIGSFFMLNLVLGVLSGEFAKERERVEKRQEFLKLRRQQQIERELTGYLEWICKAEEVLLAEEDQNAEEKSPLDGAWYRRKQNNPVLKRTKSRKGRNDLIS--AEEGDEHFTDISSVAPPGSPFAR--ASLKSSKNDSSSYFRRKEKRIRFFIRRMVKAQSFYWIVLCLVGLNTMCVAIVHYDQPEWLTKALYLAEFVFLGLFLTEMTLKMYGLGPRNYFHSSFNCFDFGVIVGSIFEVIWAAIQPGASFGISVLRALRLLRIFKVTKYWNSLRNLVVSLLNSMKSIISLLFLLFLFIVVFALLGMQLFGGQFNFEDETPTTNFDSFPAAIMTVFQILTGEDWNAVMYHGIESQGGV--RGGMFSSVYFIVLTLFGNYTLLNVFLAIAVDNLAN 709          

HSP 3 Score: 119.783 bits (299), Expect = 3.983e-26
Identity = 84/316 (26.58%), Postives = 153/316 (48.42%), Query Frame = 2
Query:  701 SLFIFSEENVIRKYAKIIIEWGPFEYMVLLTILANCIVLSME----RHLPKKDKTLLAGQLELTEKYFLGIFCVEALLKIVALGFCCHKEAYLRNVWNIMDFVVVVTGFLMMFLNIDNHSDSSTVDLRTLRAVRVLRPLKLVAGFPSLQVVLKSIIRAMAPLLQIGLLVLFAITIFAIIGLEFYSGAFHYTCFKANSDKLPLPIPTEKSLVPCSNS--KNGSGLGAYTCPEDYQCKAYWEGPNYGITSFDNIGYAMLTVFQCITMEGWTDIMYHTNDAI--------GNRFNW-LYFVPLIILGSFFMLNLVLGVL 1603
            S+F+F   N +R+    ++    FE  +L  I  + I L+ E     H P+ D       L+  +  F G+F  E ++K++ LG   H  +Y R++WNI+DF+VV    +    +     D +T+  ++LR +RVLRPLK +   P L+ V   ++ ++  +L I ++ +  + IFA+I ++ + G F +   ++ +         EK    C     + GS   A T P +      W+  ++    +DN+ +A LT+F   T EGW  ++ H+ DA         G R    +++V   I+  FF +N+ + ++
Sbjct: 1071 SMFVFGPTNPVRRLCHYVVNLRYFEMCILTVITMSSIALAAEDPVQAHAPRNDV------LKYLDYVFTGVFTFEMVIKMIDLGLLLHPGSYFRDLWNILDFIVVSGALVAFACSGTKGKDINTI--KSLRVLRVLRPLKTIKRLPKLKAVFDCVVNSLKNVLNILIVYILFMFIFAVIAVQLFKGKFFHCTDESKA--------LEKD---CRGQFLEYGSDGVAMTQPRE------WKKYDF---HYDNVLWAFLTLFTVSTGEGWPLVLKHSVDATYEDQGPSPGYRMETSIFYVVYFIVFPFFFVNIFVALI 1358          

HSP 4 Score: 113.235 bits (282), Expect = 3.346e-24
Identity = 78/277 (28.16%), Postives = 132/277 (47.65%), Query Frame = 2
Query: 3092 AMFIFSPLNSLRRFCHFVVNLRYFDLFIMIVICASSIALAAED--PVKEKSLKNNILEFFDYAFTGVFTVEMILKIIDLGIILHPGSYCRDLWNILDATVVICALVAFIMGQKPSPTGNKLRGSSAKNLNTIKSLRVLRVLRPLKTINRVPKLKAVFDCVVSSLKNVFNILIVYILFQFIFAVIAVQLFQGKF-FYCNDASKSSRETCRGYFFDYAGRSTPETKK--------RLWQHHDF---HFDNILYAMLTLFTVTTGEGWPTVLKNSMESTN 3880
            ++FIFS  N +R++             I+  I A+ I LA E   P  +K+  +  L+  +  F G+F  E  +KII LG + H  SY R+ WNI+D  VV+  ++  +  Q                   +++LR +RVLRPLK ++ +P L+ V   ++ ++  +  I ++      +FA+I V+ + GKF F C       +        DY   + P ++           W+  +F   +FDNIL+A+LT+F   T EGW  VL ++ ++  
Sbjct:   67 SLFIFSEDNVIRKY-----------YLILTTIIANCIVLALEQHLPALDKTPMSERLDDTEPYFIGIFCFEAGIKIIALGFVFHKDSYLRNGWNIMDFVVVVTGILTTVGSQ-----------------FDLRTLRAVRVLRPLKLVSGIPSLQVVLKSIMKAMVPLLQIGLLLFFAIVMFAIIGVEFYMGKFHFTCFKVDTGEKAV------DYPCGAEPPSRSCPVGTNCTEYWKGPNFGITNFDNILFAILTVFQCITMEGWTDVLYHTNDAAG 309          

HSP 5 Score: 91.6633 bits (226), Expect = 1.310e-17
Identity = 73/253 (28.85%), Postives = 138/253 (54.55%), Query Frame = 2
Query: 1979 FRFSVRRLVKSQPFYWAVIILVFFNTVCVAIEHYEQGKWLTLFLNYAEYVFLCLFMMEMMIKMYGLSIRVYFQSSFNIFDCVVIAGSLFEIIYGIFVQDSSFGLSVLRALRLLRIFKVTRYWAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMQLFGG-EFNFEEG--KPPQNFDTFVKALLTVFQILTGEDWNTVM-------YNGIQSKGGVKERGTVFS-IYFVLLVVFGNYTLLNVFLAIAVDN 2704
            +++ + + V S PF ++++ ++  NTV + ++ +   K     L +   +F  LF +E ++K+       Y + ++NIFD V + GS+ +I+    ++D    LS LR  R  R+ K+ R   ++R L+ + + S +++  +  L+ +   I+A++GMQ+FG    N E+       NF TF +AL+ +F+  TGE W+ +M       Y  I+S    KE G+ F+  YFV  +   ++ +LN+F+A+ +DN
Sbjct: 1403 YQYKMWKFVVSTPFEYSILTMIAINTVVLMMKFHGAPKPYEDMLKWLNIIFTALFTLECVLKVIAFGPLNYLKEAWNIFDFVTVLGSITDILV-TEIKDKRINLSFLRLFRAARLIKLLRQGYTIRILLWTFVQSFKALPYVCLLIAMLFFIYAIIGMQVFGNIALNNEDSAINIHNNFRTFFQALMLLFRSATGEAWHEIMLACLSERYCDIESGYSGKECGSDFAYFYFVSFIFLCSFLMLNLFVAVIMDN 1654          

HSP 6 Score: 90.1225 bits (222), Expect = 4.248e-17
Identity = 72/292 (24.66%), Postives = 142/292 (48.63%), Query Frame = 2
Query: 4097 YMPKDKTTIKYRVWRLVVSTPFEYFIMVMIALNTLILMMKYYREEKKASSAATHDREQQAYLNYCNTLIFLNSAFTVMFSIECVLKIMAFGPKNYFRDPWNIFDFITVIGSITDVLVSELQDXXXXXXXXXXXXXXXXXXXXXXQGYTIRILLWTFIQSFKALPYVCLLIAMLFFIYSIIGMQVFGNIKLISEYQINRHN-----NFQTFTNGLLLLFRCATGESWQEIMLACDNNKPCEKDIENTNNFDCGSNFTYIYFVSFIFLCSFLMLNLFVAVIMDNF---DYLTRD 4948
            Y  + +  I++ + R+V +  F + ++ ++ LNT+ + + +Y + +  + A            Y    +FL      +F  E  LK+   GP+NYF   +N FDF  ++GSI +V+ + +Q  +   +  LR  R  R+ K+ +   ++R L+ + + S K++  +  L+ +   +++++GMQ+FG        Q N  +     NF +F   ++ +F+  TGE W  +M            IE+      G  F+ +YF+      ++ +LN+F+A+ +DN      LT+D
Sbjct:  458 YFRRKEKRIRFFIRRMVKAQSFYWIVLCLVGLNTMCVAIVHYDQPEWLTKAL-----------YLAEFVFLG-----LFLTEMTLKMYGLGPRNYFHSSFNCFDFGVIVGSIFEVIWAAIQPGASFGISVLRALRLLRIFKVTKYWNSLRNLVVSLLNSMKSIISLLFLLFLFIVVFALLGMQLFGG-------QFNFEDETPTTNFDSFPAAIMTVFQILTGEDWNAVMY---------HGIESQGGVR-GGMFSSVYFIVLTLFGNYTLLNVFLAIAVDNLANAQELTKD 716          

HSP 7 Score: 77.0258 bits (188), Expect = 3.216e-13
Identity = 71/293 (24.23%), Postives = 120/293 (40.96%), Query Frame = 2
Query:  767 PFEYMVLLTILANCIVLSMERH-LPKKDKTLLAGQLELTEKYFLGIFCVEALLKIVALGFCCHKEAYLRNVWNIMDFVVVVTGFLMMFLNIDNHSDSSTVDLRTLRAVRVLRPLKLVAGFPSLQVVLKSIIRAMAPLLQIGLLVLFAITIFAIIGLEFYSGAFHYTCFKANSDKLPLPIPTEKSLVPCSNSKNGSGLGAYTCPEDYQCKAYWEGPNYGITSFDNIGYAMLTVFQCITMEGWTDIMY-------------HTNDAIGNRFNWLYFVPLIILGSFFMLNLVLGVL 1603
            PFEY +L  I  N +VL M+ H  PK  + +L    +     F  +F +E +LK++A G       YL+  WNI DFV V+     + +          ++L  LR  R  R +KL+    +++++L + +++   L  + LL+     I+AIIG++ +                 + +  E S +   N                              +F     A++ +F+  T E W +IM              ++    G+ F + YFV  I L SF MLNL + V+
Sbjct: 1415 PFEYSILTMIAINTVVLMMKFHGAPKPYEDML----KWLNIIFTALFTLECVLKVIAFG----PLNYLKEAWNIFDFVTVLGSITDILV---TEIKDKRINLSFLRLFRAARLIKLLRQGYTIRILLWTFVQSFKALPYVCLLIAMLFFIYAIIGMQVFGN---------------IALNNEDSAINIHN------------------------------NFRTFFQALMLLFRSATGEAWHEIMLACLSERYCDIESGYSGKECGSDFAYFYFVSFIFLCSFLMLNLFVAVI 1651          

HSP 8 Score: 53.1434 bits (126), Expect = 6.746e-6
Identity = 50/207 (24.15%), Postives = 100/207 (48.31%), Query Frame = 2
Query: 3254 LEFFDYAFTGVFTVEMILKIIDLGIILHPGSYCRDLWNILDATVVICALVAFIMGQKPSPTGNKLRGSSAKNLNTIKSLRVLRVLRPLKTINRVPKLKAVFDCVVSSLKNVFNILIVYILFQFIFAVIAVQLFQGKFFYCNDASKSSRETCRGYFFDYAGRSTPETKKRLWQHHDFHFDNILYAMLTLFTVTTGEGWPTVLKNSMES 3874
            L   ++ F G+F  EM LK+  LG    P +Y    +N  D  V++ ++   I           ++  ++  ++ +++LR+LR+ +  K  N    L+ +   +++S+K++ ++L +  LF  +FA++ +QLF G+F + ++                    TP T          +FD+   A++T+F + TGE W  V+ + +ES
Sbjct:  509 LYLAEFVFLGLFLTEMTLKMYGLG----PRNYFHSSFNCFDFGVIVGSIFEVIWA--------AIQPGASFGISVLRALRLLRIFKVTKYWN---SLRNLVVSLLNSMKSIISLLFLLFLFIVVFALLGMQLFGGQFNFEDE--------------------TPTT----------NFDSFPAAIMTVFQILTGEDWNAVMYHGIES 670          
BLAST of Voltage dependent L type calcium channel subunit vs. Ensembl Zebrafish
Match: cacna1ba (calcium channel, voltage-dependent, N type, alpha 1B subunit, a [Source:ZFIN;Acc:ZDB-GENE-060531-44])

HSP 1 Score: 909.442 bits (2349), Expect = 0.000e+0
Identity = 478/827 (57.80%), Postives = 616/827 (74.49%), Query Frame = 2
Query: 3014 NSLESDPVP----NKIEPETIQRKPVLPYSAMFIFSPLNSLRRFCHFVVNLRYFDLFIMIVICASSIALAAEDPVKEKSLKNNILEFFDYAFTGVFTVEMILKIIDLGIILHPGSYCRDLWNILDATVVICALVAFIMGQKPSPTGNKLRGSSAKNLNTIKSLRVLRVLRPLKTINRVPKLKAVFDCVVSSLKNVFNILIVYILFQFIFAVIAVQLFQGKFFYCNDASKSSRETCRGYFFDYAGRSTPETKKRLWQHHDFHFDNILYAMLTLFTVTTGEGWPTVLKNSMESTNIDNGPIADYRQEMAXXXXXXXXXXXXXXXXXXXALIIITFQEQGENELIDLDLDKNQKQCIDFAINEKPLCRYMPKDKTTIKYRVWRLVVSTPFEYFIMVMIALNTLILMMKYYREEKKASSAATHDREQQAYLNYCNTLIFLNSAFTVMFSIECVLKIMAFGPKNYFRDPWNIFDFITVIGSITDVLVSELQDXXXXXXXXXXXX-XXXXXXXXXXQGYTIRILLWTFIQSFKALPYVCLLIAMLFFIYSIIGMQVFGNIKLISEYQINRHNNFQTFTNGLLLLFRCATGESWQEIMLACDNNKPCEKDIENTNNFDCGSNFTYIYFVSFIFLCSFLMLNLFVAVIMDNFDYLTRDSSILGPHHLDEYIRVWAEYDPGAIGRIHHSEMYEMLRNMEPPVGFGKKCPYRLAYRKLIRMNMPVDENGTVNFTTTLFALIRESLNIKMSTAEYMD-IKDMELRQTICKMWPVQAKKKLNLIVPPDSELVFHKMTVGKIYAGYLIVENWRAYKN----------SQEQGPRSSPAVS 5446
            NS++S+ VP    N  +      +P+LP+S+MFIF+P N +RR CH++V+LRYF++ I++VI  SSIALAAEDPV+  + +NN+L++ DY FTGVFT EM++K++DLG+ILHPGSY RDLWNILD  VV  ALVAF              G+  K+++TIKSLRVLRVLRPLKTI R+PKLKAVFDCVV+SLKNV NILIVYILF FIFAVIAVQLF+GKFFYC D SK   + CRG F DY  +     + R W+ ++FH+DN+L+A LTLFTV+TGEGWPTVLK+S+++T  D GP   YR EM+IFY+V+F+VFPFFFVNIFVALIIITFQEQG+  L +  L+KN++ CIDFAIN KPL RYMP+++ + +YR+W+ VVS PFEY IM+MIALNT++LMMK++                 A   Y   L +LN  FTV+FS+EC+LKI+AFGP NY +D WN+FDF+TV+GSITD+LV+E+  +            RAARLIKLLRQGYTIRILLWTF+QSFKALPYVCLLIAMLFFIY+IIGMQVFGNI L  +  INRHNNF+TF   L+LLFR ATGE+W +IML+C + + C+     T   +CGS+F Y YFVSFIFLCSFLMLNLFVAVIMDNF+YLTRDSSILGPHHLDE+IRVWAEYDP A GRI + +MYEML +M PP+G GKKCP R+AY++L++MNMP+ ++ +V+FT+TL ALIR +L IK+++      + D EL++ +  +WP  ++K ++L+V P      +++TVGK+YA  +I + ++  +            ++ GP S   VS
Sbjct: 1124 NSIDSETVPMTEKNLEDLNQSSIRPILPFSSMFIFNPTNPVRRLCHYIVSLRYFEMCILVVIAMSSIALAAEDPVQANAPRNNVLKYLDYVFTGVFTFEMVIKMVDLGLILHPGSYFRDLWNILDFIVVSGALVAF-----------AFSGTKGKDISTIKSLRVLRVLRPLKTIKRLPKLKAVFDCVVNSLKNVLNILIVYILFMFIFAVIAVQLFKGKFFYCTDESKGLEKDCRGLFLDY-DKDDVTAQPREWKKYEFHYDNVLWAFLTLFTVSTGEGWPTVLKHSVDATFEDQGPSPGYRIEMSIFYVVYFVVFPFFFVNIFVALIIITFQEQGDKVLSECSLEKNERACIDFAINAKPLTRYMPQNQQSFQYRLWKFVVSPPFEYSIMIMIALNTVVLMMKFH----------------GAPDFYEAMLKYLNIVFTVLFSLECILKIIAFGPLNYLKDAWNVFDFVTVLGSITDILVTEINTTERQLNFSFLRLFRAARLIKLLRQGYTIRILLWTFVQSFKALPYVCLLIAMLFFIYAIIGMQVFGNIDLNDDTAINRHNNFRTFLQALMLLFRSATGEAWHDIMLSCLSERTCDPS-SGTLGKECGSDFAYFYFVSFIFLCSFLMLNLFVAVIMDNFEYLTRDSSILGPHHLDEFIRVWAEYDPAACGRIKYLDMYEMLLHMSPPLGLGKKCPPRIAYKRLVKMNMPIADDNSVHFTSTLMALIRTALEIKLASGMVAQRLSDAELKKELSTVWPNLSQKTMDLLVTPHKP---NELTVGKVYAALMIFDYYKQNRAKRLQMQQQQLKEQAGPGSQNKVS 1918          

HSP 2 Score: 719.153 bits (1855), Expect = 0.000e+0
Identity = 416/691 (60.20%), Postives = 508/691 (73.52%), Query Frame = 2
Query:  689 STSKSLFIFSEENVIRKYAKIIIEWGPFEYMVLLTILANCIVLSMERHLPKKDKTLLAGQLELTEKYFLGIFCVEALLKIVALGFCCHKEAYLRNVWNIMDFVVVVTGFLMMFLNIDNHSDSSTVDLRTLRAVRVLRPLKLVAGFPSLQVVLKSIIRAMAPLLQIGLLVLFAITIFAIIGLEFYSGAFHYTCFKANSDKLPLPIPTEKSLVPCSNSKNGSGLGAYTCPEDYQCKAYWEGPNYGITSFDNIGYAMLTVFQCITMEGWTDIMYHTNDAIGNRFNWLYFVPLIILGSFFMLNLVLGVLSGXXXXXXXXXXXXXXXLKLRRQQQTEKEFNGYMEWIQKAEEVLLNEATTTSEDKMRIIAARRRAEKQ----------------KYKLLGKNQSIPDFEYEDTELYSETKSMKGNIFIRSYAGIRRRRKERCTSFWRTEKHFRFSVRRLVKSQPFYWAVIILVFFNTVCVAIEHYEQGKWLTLFLNYAEYVFLCLFMMEMMIKMYGLSIRVYFQSSFNIFDCVVIAGSLFEIIYGIFVQDSSFGLSVLRALRLLRIFKVTRYWAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMQLFGGEFNFEEGKPPQNFDTFVKALLTVFQILTGEDWNTVMYNGIQSKGGVKERGTVFSIYFVLLVVFGNYTLLNVFLAIAVDNLAN 2713
            + ++SLFIFSE+N+IRKYAK I EW PFEYM+L TI+ANCIVL +E+HLP  DKT ++ +L+ TE YF+GIFC EA +KI+ALGF  HK +YLRN WN+MDFVVV+TG L +             DLRTLRAVRVLRPLKLV+G PSLQVVLKSI++AM PLLQIGLL+ FAI +FAIIGL+FY G FH TCF+ ++ +       +    PC     G    A+TC    +C+ YW GPN+GIT+FDNI +A+LTVFQCITMEGW DI+Y+ NDA GN +NWLYF+PLII+GSFFMLNLVLGVLSGEFAKERERVEKR+ FLKLRRQQQ E+E  GY+EWI KAEEV+L E    +EDK  +   +R+                    K     KN  I   E ED      + + +G+ F R+   ++  + E  + F R EK FRF +RR+VK+Q FYW V+ +V  NT+CVAI HY+Q +WLT  L  AE+VFL LF++EM +KMYGL  R YF SSFN FD  VI GS+FE+I+      +SFG+SVLRALRLLRIFKVT+YW SLRNLV+SLLNSM+SIISLLFLLFLFI++FALLGMQLFGG+FNFE+  P  NFDTF  A+LTVFQILTGEDWN VMY+GI+S+GGV  RG   S+YF++L +FGNYTLLNVFLAIAVDNLAN
Sbjct:   65 TVNRSLFIFSEDNIIRKYAKKITEWPPFEYMILATIIANCIVLGLEQHLPALDKTPMSKRLDDTEPYFIGIFCFEAGIKIIALGFAFHKGSYLRNGWNVMDFVVVLTGILTIV--------GPDFDLRTLRAVRVLRPLKLVSGIPSLQVVLKSIMKAMVPLLQIGLLLFFAILMFAIIGLDFYMGKFHRTCFRTDTGE-------QVDEFPC-----GLESPAWTCENGTECREYWIGPNFGITNFDNILFAVLTVFQCITMEGWVDILYNANDASGNTWNWLYFIPLIIIGSFFMLNLVLGVLSGEFAKERERVEKRQEFLKLRRQQQIERELTGYLEWICKAEEVMLAEEDKNAEDKDDVAWYKRKCNNPGGFTRSLGADFGLPVLKRAKKSKNDLINAEEGEDHFTDISSVAPQGSPFTRT--SVKSSKIESLSYFRRKEKRFRFFIRRMVKAQSFYWTVLCIVGLNTLCVAIVHYDQPEWLTYALYLAEFVFLGLFLIEMSLKMYGLGPRTYFHSSFNCFDFGVIVGSIFEVIWAAVKPGASFGISVLRALRLLRIFKVTKYWNSLRNLVVSLLNSMKSIISLLFLLFLFIVVFALLGMQLFGGQFNFEDETPTTNFDTFPAAILTVFQILTGEDWNAVMYHGIESQGGV-HRGMFCSVYFIVLTLFGNYTLLNVFLAIAVDNLAN 732          

HSP 3 Score: 118.242 bits (295), Expect = 1.159e-25
Identity = 93/343 (27.11%), Postives = 157/343 (45.77%), Query Frame = 2
Query:  539 CFASPYIPSNNKN--QRG-----ILTTVMSIDDGSKTTSMRSLAKRTINLSFPGM----QTSTS-----KSLFIFSEENVIRKYAKIIIEWGPFEYMVLLTILANCIVLSMERHLPKKDKTLLAGQLELTEKYFLGIFCVEALLKIVALGFCCHKEAYLRNVWNIMDFVVVVTGFLMMFLNIDNHSDSSTVDLRTLRAVRVLRPLKLVAGFPSLQVVLKSIIRAMAPLLQIGLLVLFAITIFAIIGLEFYSGAFHYTCFKANSDKLPLPIPTEKSLVPCSNSKNGSGLGAYTCPEDYQCKAY-WEGPNYGITSFDNIGYAMLTVFQCITMEGWTDIMYHTNDA 1516
            C   P    N +N  Q G     I  TV S    +    M S+   T+ ++   +    Q+S        S+FIF+  N +R+    I+    FE  +L+ I  + I L+ E   P +        L+  +  F G+F  E ++K+V LG   H  +Y R++WNI+DF+VV    +    +     D ST+  ++LR +RVLRPLK +   P L+ V   ++ ++  +L I ++ +  + IFA+I ++ + G F Y   ++            K L      K+  GL      +D   +   W+   +    +DN+ +A LT+F   T EGW  ++ H+ DA
Sbjct: 1084 CLEKPEDSDNKRNIGQTGGMSTHIPVTVTSPPGETTLIPMNSIDSETVPMTEKNLEDLNQSSIRPILPFSSMFIFNPTNPVRRLCHYIVSLRYFEMCILVVIAMSSIALAAED--PVQANAPRNNVLKYLDYVFTGVFTFEMVIKMVDLGLILHPGSYFRDLWNILDFIVVSGALVAFAFSGTKGKDISTI--KSLRVLRVLRPLKTIKRLPKLKAVFDCVVNSLKNVLNILIVYILFMFIFAVIAVQLFKGKFFYCTDES------------KGL-----EKDCRGLFLDYDKDDVTAQPREWKKYEF---HYDNVLWAFLTLFTVSTGEGWPTVLKHSVDA 1402          

HSP 4 Score: 115.931 bits (289), Expect = 6.027e-25
Identity = 80/293 (27.30%), Postives = 142/293 (48.46%), Query Frame = 2
Query: 3029 DPVPNKIEPETIQRKPVLPYSAMFIFSPLNSLRRFCHFVVNLRYFDLFIMIVICASSIALAAED--PVKEKSLKNNILEFFDYAFTGVFTVEMILKIIDLGIILHPGSYCRDLWNILDATVVICALVAFIMGQKPSPTGNKLRGSSAKNLNTIKSLRVLRVLRPLKTINRVPKLKAVFDCVVSSLKNVFNILIVYILFQFIFAVIAVQLFQGKF----FYCNDASKSSRETCRGYFFDYAGRSTPETKKRLWQHHDF---HFDNILYAMLTLFTVTTGEGWPTVLKNSMESTN 3880
            +P+P K    T+ R       ++FIFS  N +R++   +     F+  I+  I A+ I L  E   P  +K+  +  L+  +  F G+F  E  +KII LG   H GSY R+ WN++D  VV+  ++  +      P  +            +++LR +RVLRPLK ++ +P L+ V   ++ ++  +  I ++      +FA+I +  + GKF    F  +   +     C      +   +  E ++  W   +F   +FDNIL+A+LT+F   T EGW  +L N+ +++ 
Sbjct:   55 NPIPVKQNCLTVNR-------SLFIFSEDNIIRKYAKKITEWPPFEYMILATIIANCIVLGLEQHLPALDKTPMSKRLDDTEPYFIGIFCFEAGIKIIALGFAFHKGSYLRNGWNVMDFVVVLTGILTIV-----GPDFD------------LRTLRAVRVLRPLKLVSGIPSLQVVLKSIMKAMVPLLQIGLLLFFAILMFAIIGLDFYMGKFHRTCFRTDTGEQVDEFPCGLESPAWTCENGTECRE-YWIGPNFGITNFDNILFAVLTVFQCITMEGWVDILYNANDASG 322          

HSP 5 Score: 90.5077 bits (223), Expect = 3.210e-17
Identity = 72/258 (27.91%), Postives = 142/258 (55.04%), Query Frame = 2
Query: 1964 RTEKHFRFSVRRLVKSQPFYWAVIILVFFNTVCVAIEHYEQGKWLTLFLNYAEYVFLCLFMMEMMIKMYGLSIRVYFQSSFNIFDCVVIAGSLFEI-IYGIFVQDSSFGLSVLRALRLLRIFKVTRYWAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMQLFGG-EFNFEEG-KPPQNFDTFVKALLTVFQILTGEDWNTVMYNGIQ------SKGGV-KERGTVFS-IYFVLLVVFGNYTLLNVFLAIAVDN 2704
            + ++ F++ + + V S PF ++++I++  NTV + ++ +    +    L Y   VF  LF +E ++K+       Y + ++N+FD V + GS+ +I +  I   +     S LR  R  R+ K+ R   ++R L+ + + S +++  +  L+ +   I+A++GMQ+FG  + N +       NF TF++AL+ +F+  TGE W+ +M + +       S G + KE G+ F+  YFV  +   ++ +LN+F+A+ +DN
Sbjct: 1480 QNQQSFQYRLWKFVVSPPFEYSIMIMIALNTVVLMMKFHGAPDFYEAMLKYLNIVFTVLFSLECILKIIAFGPLNYLKDAWNVFDFVTVLGSITDILVTEINTTERQLNFSFLRLFRAARLIKLLRQGYTIRILLWTFVQSFKALPYVCLLIAMLFFIYAIIGMQVFGNIDLNDDTAINRHNNFRTFLQALMLLFRSATGEAWHDIMLSCLSERTCDPSSGTLGKECGSDFAYFYFVSFIFLCSFLMLNLFVAVIMDN 1737          

HSP 6 Score: 85.8853 bits (211), Expect = 7.077e-16
Identity = 74/292 (25.34%), Postives = 139/292 (47.60%), Query Frame = 2
Query: 4097 YMPKDKTTIKYRVWRLVVSTPFEYFIMVMIALNTLILMMKYYREEKKASSAATHDREQQAYLNYCNTLIFLNSAFTVMFSIECVLKIMAFGPKNYFRDPWNIFDFITVIGSITDVLVSELQDXXXXXXXXXXXXXXXXXXXXXXQGYTIRILLWTFIQSFKALPYVCLLIAMLFFIYSIIGMQVFGNIKLISEYQINRHN-----NFQTFTNGLLLLFRCATGESWQEIMLACDNNKPCEKDIENTNNFDCGSNFTYIYFVSFIFLCSFLMLNLFVAVIMDNF---DYLTRD 4948
            Y  + +   ++ + R+V +  F + ++ ++ LNTL + + +Y              +Q  +L Y   L      F  +F IE  LK+   GP+ YF   +N FDF  ++GSI +V+ + ++  +   +  LR  R  R+ K+ +   ++R L+ + + S K++  +  L+ +   +++++GMQ+FG        Q N  +     NF TF   +L +F+  TGE W  +M            IE+      G  F  +YF+      ++ +LN+F+A+ +DN      LT+D
Sbjct:  481 YFRRKEKRFRFFIRRMVKAQSFYWTVLCIVGLNTLCVAIVHY--------------DQPEWLTYA--LYLAEFVFLGLFLIEMSLKMYGLGPRTYFHSSFNCFDFGVIVGSIFEVIWAAVKPGASFGISVLRALRLLRIFKVTKYWNSLRNLVVSLLNSMKSIISLLFLLFLFIVVFALLGMQLFGG-------QFNFEDETPTTNFDTFPAAILTVFQILTGEDWNAVMY---------HGIESQGGVHRGM-FCSVYFIVLTLFGNYTLLNVFLAIAVDNLANAQELTKD 739          

HSP 7 Score: 74.7146 bits (182), Expect = 1.830e-12
Identity = 71/292 (24.32%), Postives = 117/292 (40.07%), Query Frame = 2
Query:  767 PFEYMVLLTILANCIVLSMERHLPKKDKTLLAGQLELTEKYFLGIFCVEALLKIVALGFCCHKEAYLRNVWNIMDFVVVVTGFLMMFLNIDNHSDSSTVDLRTLRAVRVLRPLKLVAGFPSLQVVLKSIIRAMAPLLQIGLLVLFAITIFAIIGLEFYSGAFHYTCFKANSDKLPLPIPTEKSLVPCSNSKNGSGLGAYTCPEDYQCKAYWEGPNYGITSFDNIGYAMLTVFQCITMEGWTDIMYHT-------------NDAIGNRFNWLYFVPLIILGSFFMLNLVLGVL 1603
            PFEY +++ I  N +VL M+ H            L+     F  +F +E +LKI+A G       YL++ WN+ DFV V+ G +   L  + ++    ++   LR  R  R +KL+    +++++L + +++   L  + LL+     I+AIIG++ +           N D                N  N                           +F     A++ +F+  T E W DIM                    G+ F + YFV  I L SF MLNL + V+
Sbjct: 1497 PFEYSIMIMIALNTVVLMMKFH---GAPDFYEAMLKYLNIVFTVLFSLECILKIIAFG----PLNYLKDAWNVFDFVTVL-GSITDILVTEINTTERQLNFSFLRLFRAARLIKLLRQGYTIRILLWTFVQSFKALPYVCLLIAMLFFIYAIIGMQVFGN------IDLNDDT-------------AINRHN---------------------------NFRTFLQALMLLFRSATGEAWHDIMLSCLSERTCDPSSGTLGKECGSDFAYFYFVSFIFLCSFLMLNLFVAVI 1734          

HSP 8 Score: 53.9138 bits (128), Expect = 3.758e-6
Identity = 50/203 (24.63%), Postives = 99/203 (48.77%), Query Frame = 2
Query: 3266 DYAFTGVFTVEMILKIIDLGIILHPGSYCRDLWNILDATVVICALVAFIMGQKPSPTGNKLRGSSAKNLNTIKSLRVLRVLRPLKTINRVPKLKAVFDCVVSSLKNVFNILIVYILFQFIFAVIAVQLFQGKFFYCNDASKSSRETCRGYFFDYAGRSTPETKKRLWQHHDFHFDNILYAMLTLFTVTTGEGWPTVLKNSMES 3874
            ++ F G+F +EM LK+  LG    P +Y    +N  D  V++ ++   I           ++  ++  ++ +++LR+LR+ +  K  N    L+ +   +++S+K++ ++L +  LF  +FA++ +QLF G+F + ++                    TP T          +FD    A+LT+F + TGE W  V+ + +ES
Sbjct:  536 EFVFLGLFLIEMSLKMYGLG----PRTYFHSSFNCFDFGVIVGSIFEVIWA--------AVKPGASFGISVLRALRLLRIFKVTKYWN---SLRNLVVSLLNSMKSIISLLFLLFLFIVVFALLGMQLFGGQFNFEDE--------------------TPTT----------NFDTFPAAILTVFQILTGEDWNAVMYHGIES 693          
BLAST of Voltage dependent L type calcium channel subunit vs. Ensembl Xenopus
Match: CACNA1C (calcium channel, voltage-dependent, L type, alpha 1C subunit [Source:NCBI gene;Acc:100488055])

HSP 1 Score: 1217.6 bits (3149), Expect = 0.000e+0
Identity = 758/1658 (45.72%), Postives = 1029/1658 (62.06%), Query Frame = 2
Query:  677 GMQTST--SKSLFIFSEENVIRKYAKIIIEWGPFEYMVLLTILANCIVLSMERHLPKKDKTLLAGQLELTEKYFLGIFCVEALLKIVALGFCCHKEAYLRNVWNIMDFVVVVTGFLMMFLNIDNHSDSSTV--------DLRTLRAVRVLRPLKLVAGFPSLQVVLKSIIRAMAPLLQIGLLVLFAITIFAIIGLEFYSGAFHYTCFKANSDKLPLPIPTEKSLVPCS-NSKNGSGLGAYTCPEDYQCKAYWEGPNYGITSFDNIGYAMLTVFQCITMEGWTDIMYHTNDAIGNRFNWLYFVPLIILGSFFMLNLVLGVLSGXXXXXXXXXXXXXXXLKLRRQQQTEKEFNGYMEWIQKAEEVLLNEATTTSEDKMRIIAARRRAEKQKYKLLGKNQSIPDFEYEDTELYSETKSMKGNIFIRSYAGIR---RRRKERCTSFWRTEKHF-RFSVRRLVKSQPFYWAVIILVFFNTVCVAIEHYEQGKWLTLFLNYAEYVFLCLFMMEMMIKMYGLSIRVYFQSSFNIFDCVVIAGSLFEIIYGIFVQDSSFGLSVLRALRLLRIFKVTRYWAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMQLFGGEFNFEEGKPPQN-FDTFVKALLTVFQILTGEDWNTVMYNGIQSKGGVKERGTVFSIYFVLLVVFGNYTLLNVFLAIAVDNLANXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSSDNFIGRLPL--------SIDPPMVQVCPPSPQTANSLIS-KNFSFDHNQVEVNDKGCLLNTNKPNGKLGMLGHDNTNFNSLESDPVPNKIEPETIQRK--PVLPYSAMFIFSPLNSLRRFCHFVVNLRYFDLFIMIVICASSIALAAEDPVKEKSLKNNILEFFDYAFTGVFTVEMILKIIDLGIILHPGSYCRDLWNILDATVVICALVAFIMGQKPSPTGNKLRGSSAKNLNTIKSLRVLRVLRPLKTINRVPKLKAVFDCVVSSLKNVFNILIVYILFQFIFAVIAVQLFQGKFFYCNDASKSSRETCRGYFFDY--AGRSTPETKKRLWQHHDFHFDNILYAMLTLFTVTTGEGWPTVLKNSMESTNIDNGPIADYRQEMAXXXXXXXXXXXXXXXXXXXALIIITFQEQGENELIDLDLDKNQKQCIDFAINEKPLCRYMPKDKTTIKYRVWRLVVSTPFEYFIMVMIALNTLILMMKYYREEKKASSAATHDREQQAYLNYCNTLIFLNSAFTVMFSIECVLKIMAFGPKNYFRDPWNIFDFITVIGSITDVLVSE---------LQDXXXXXXXXXXXXXXXXXXXXXXQGYTIRILLWTFIQSFKALPYVCLLIAMLFFIYSIIGMQVFGNIKLISEYQINRHNNFQTFTNGLLLLFRCATGESWQEIMLACDNNKPCEKDIENTNNFDCGSNFTYIYFVSFIFLCSFLMLNLFVAVIMDNFDYLTRDSSILGPHHLDEYIRVWAEYDPGAIGRIHHSEMYEMLRNMEPPVGFGKKCPYRLAYRKLIRMNMPVDENGTVNFTTTLFALIRESLNIKMSTAEYMDIKDMELRQTICKMWPVQAKKKLNLIVPPDSELVFHKMTVGKIYAGYLIVENWRAYKNSQEQG----PRSSPAVSIKSVTK------PVVKEEKSANLLAK 5506
            G  T+T   ++L   + +N IR+    I+EW PFE ++LLTI ANC+ L++    P+ D       LE  E  FL IF VEA LK++A G   H  AYLRN WN++DF++VV G     L     +D  +         D++ LRA RVLRPL+LV+G PSLQVVL SII+AM PLL I LLVLF I I+AIIGLE + G  H TC+   ++  P  + TE+   PC+  S NG       CP    C++ W GP +GIT+FDN  +AMLTVFQCITMEGWTD++Y   DA+G     +YFV L+I GSFF+LNLVLGVLSGEF+KERE+ + R  F KLR +QQ E++  GY++WI +AE++         +++                   +N S+P  E E       T ++          G+R   R  K + + +WR    F R   R  VKS  FYW VI LVF NT+ +A EHY Q  WLT   + A  V L LF  EM++KMY L ++ YF S FN FDC ++ G + E I       S  G+SVLR +RLLRIFK+TRYW SL NLV SLLNS+RSI SLL LLFLFI+IF+LLGMQLFGG+FNF+E    ++ FD F +ALLTVFQILTGEDWN+VMY+GI + GG    G +  IYF++L + GNY LLNVFLAIAVDNLA+A+ LT+A++E+  E +R   A     E+K  +  +G+ P+         I+   +     SP   N+ IS + FS + N+ +         T  P+        +            P  +    I+ K  P+   SA F+F   N  R  CH +VN   F   I+  I  SSI+LAAEDPV+  S +N +L +FD  FT +FTVE++LK+   G  LH GS+CR+ +NILD  VV  +L++F              G  +  +N +K LRVLRVLRPL+ INR   LK V  CV  +++ + NI+IV  L QF+FA I VQLF+GK + C D+SK +   C+G +  Y     S P    R W++  F FDN+L AM+ LFTV+T EGWP +L  +++S   D GPI ++R E++IF+I++ I+  FF +NIFV  +I+TFQEQGE E  + +LDKNQ+QC+++A+  +PL RY+PK++   +Y+VW +V ST FEY + V+I LNT+ L M++Y +                  ++   +  LN  FT +F++E +LK++AF PK YF DPWN+FDF+ VIGS+ DV++SE         ++++S +S+ F RLFR  RL+KLL +G  IR LLWTFI+SF+ALPYV LLI MLFFIY++IGMQVFG I L    +INR+NNFQTF   +LLLFRCATGE+WQEIMLAC  +KPC  + E T+   CGS+F   YF+SF  LC+FL++NLFVAVIMDNFDYLTRD SILGPHHLDE+ R+WAEYDP A GRI H ++  +LR ++PP+GFGK CP+R+A ++L+ MNMP++ +GTV F  TLFAL+R SL IK  T   ++  + ELR  I K+W   + K L+ +VPP  +    ++TVGK YA +LI E +R +K  +EQG    P    A+S+++  +      P ++   S +L A+
Sbjct:  100 GTTTATRPPRALLCLTLKNPIRRACISIVEWKPFEIIILLTIFANCVALAVYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIAYGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKADGGSAIGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFMGKMHKTCYYL-TNGYP-DVLTEEEPSPCALESNNGR-----HCPNGTLCRSGWVGPKHGITNFDNFAFAMLTVFQCITMEGWTDVLYWMQDAMGYELPCVYFVSLVIFGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPENEDEDIDEEK-----------------PRNMSMPTSETESVN----TDNVGSGDVEEESCGVRLAHRISKSKFSRYWRRWNRFCRRKCRAAVKSNVFYWLVIFLVFLNTLTIASEHYNQPDWLTEVQDTANKVLLALFTAEMLLKMYSLGLQAYFVSLFNRFDCFIVCGGILETILVETRIMSPLGISVLRCVRLLRIFKITRYWNSLSNLVASLLNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDEMLTRRSTFDNFPQALLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYILLNVFLAIAVDNLADAESLTSAQKEEEEEKERKKLARTASPEKKQENESLGKSPVPAVEENKEKIELKAITADGESP--PNTKISVEEFSTNENEEK---------TPYPSSNETPGEEEEEEPEMPVGPR-PRPLSELHIKEKAAPMPEASAFFVFRSDNRFRVHCHRIVNNNIFTNLILFFILLSSISLAAEDPVRHNSFRNQVLFYFDIVFTAIFTVEIVLKMTAYGAFLHKGSFCRNYFNILDLLVVSVSLISF--------------GIQSSAINVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTTLLQFMFACIGVQLFKGKLYSCTDSSKITEAECKGKYITYKDGDVSQPMIVDRSWENSKFDFDNVLSAMMALFTVSTFEGWPELLYRAIDSHTEDVGPIYNHRVEISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEQEYKNCELDKNQRQCVEYALKARPLRRYIPKNQ--YQYKVWYVVNSTYFEYLMFVLILLNTICLAMQHYGQS----------------CSFKEAMNILNMLFTGLFTVEMILKLIAFKPKGYFSDPWNVFDFLIVIGSVVDVILSETNVSISGQNVEENSRISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQVFGKIALNDTTEINRNNNFQTFPQAVLLLFRCATGEAWQEIMLACLPSKPCAPESE-TSEEKCGSSFAVFYFISFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVAMNMPLNSDGTVMFNATLFALVRTSLCIK--TDGNLEQANEELRAIIKKIWKRTSMKLLDQVVPPAGD---DEVTVGKFYATFLIQEYFRKFKKRKEQGLVGKPSQRNALSLQAGLRTLHDIGPEIRRAISGDLTAE 1679          
BLAST of Voltage dependent L type calcium channel subunit vs. Ensembl Xenopus
Match: CACNA1C (calcium channel, voltage-dependent, L type, alpha 1C subunit [Source:NCBI gene;Acc:100488055])

HSP 1 Score: 1209.13 bits (3127), Expect = 0.000e+0
Identity = 754/1659 (45.45%), Postives = 1028/1659 (61.97%), Query Frame = 2
Query:  677 GMQTSTS--KSLFIFSEENVIRKYAKIIIEWGPFEYMVLLTILANCIVLSMERHLPKKDKTLLAGQLELTEKYFLGIFCVEALLKIVALGFCCHKEAYLRNVWNIMDFVVVVTGFLMMFLNIDNHSDSSTV--------DLRTLRAVRVLRPLKLVAGFPSLQVVLKSIIRAMAPLLQIGLLVLFAITIFAIIGLEFYSGAFHYTCFKANSDKLPLPIPTEKSLVPCS-NSKNGSGLGAYTCPEDYQCKAYWEGPNYGITSFDNIGYAMLTVFQCITMEGWTDIMYHTNDAIGNRFNWLYFVPLIILGSFFMLNLVLGVLSGXXXXXXXXXXXXXXXLKLRRQQQTEKEFNGYMEWIQKAEEVLLNEATTTSEDKMRIIAARRRAEKQKYKLLGKNQSIPDFEYEDTELYSETKSMKGNIFIRSYAGIR---RRRKERCTSFWRTEKHF-RFSVRRLVKSQPFYWAVIILVFFNTVCVAIEHYEQGKWLTLFLNYAEYVFLCLFMMEMMIKMYGLSIRVYFQSSFNIFDCVVIAGSLFEIIYGIFVQDSSFGLSVLRALRLLRIFKVTRYWAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMQLFGGEFNFEEGKPPQN-FDTFVKALLTVFQILTGEDWNTVMYNGIQSKGGVKERGTVFSIYFVLLVVFGNYTLLNVFLAIAVDNLANXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSSDNFIGRLPL--------SIDPPMVQVCPPSPQTANSLIS-KNFSFDHNQVEVNDKGCLLNTNKPNGKLGMLGHDNTNFNSLESDPVPNKIEPETIQRK--PVLPYSAMFIFSPLNSLRRFCHFVVNLRYFDLFIMIVICASSIALAAEDPVKEKSLKNNILEFFDYAFTGVFTVEMILKIIDLGIILHPGSYCRDLWNILDATVVICALVAFIMGQKPSPTGNKLRGSSAKNLNTIKSLRVLRVLRPLKTINRVPKLKAVFDCVVSSLKNVFNILIVYILFQFIFAVIAVQLFQGKFFYCNDASKSSRETCRGYFFDY--AGRSTPETKKRLWQHHDFHFDNILYAMLTLFTVTTGEGWPTVLKNSMESTNIDNGPIADYRQEMAXXXXXXXXXXXXXXXXXXXALIIITFQEQGENELIDLDLDKNQKQCIDFAINEKPLCRYMPKDKTTIKYRVWRLVVSTPFEYFIMVMIALNTLILMMKYYREEKKASSAATHDREQQAYLNYCNTLIFLNSAFTVMFSIECVLKIMAFGPKNYFRDPWNIFDFITVIGSITDVLVSEL----------QDXXXXXXXXXXXXXXXXXXXXXXQGYTIRILLWTFIQSFKALPYVCLLIAMLFFIYSIIGMQVFGNIKLISEYQINRHNNFQTFTNGLLLLFRCATGESWQEIMLACDNNKPCEKDIENTNNFDCGSNFTYIYFVSFIFLCSFLMLNLFVAVIMDNFDYLTRDSSILGPHHLDEYIRVWAEYDPGAIGRIHHSEMYEMLRNMEPPVGFGKKCPYRLAYRKLIRMNMPVDENGTVNFTTTLFALIRESLNIKMSTAEYMDIKDMELRQTICKMWPVQAKKKLNLIVPPDSELVFHKMTVGKIYAGYLIVENWRAYKNSQEQG----PRSSPAVSIKSVTK------PVVKEEKSANLLAK 5506
            G  T+T   ++L   + +N IR+    I+EW PFE ++LLTI ANC+ L++    P+ D       LE  E  FL IF VEA LK++A G   H  AYLRN WN++DF++VV G     L     +D  +         D++ LRA RVLRPL+LV+G PSLQVVL SII+AM PLL I LLVLF I I+AIIGLE + G  H TC+   ++  P  + TE+   PC+  S NG       CP    C++ W GP +GIT+FDN  +AMLTVFQCITMEGWTD++Y   DA+G     +YFV L+I GSFF+LNLVLGVLSGEF+KERE+ + R  F KLR +QQ E++  GY++WI +AE++                   R +    + ++  + +       +TE  +      G++   S  G+R   R  K + + +WR    F R   R  VKS  FYW VI LVF NT+ +A EHY Q  WLT   + A  V L LF  EM++KMY L ++ YF S FN FDC ++ G + E I       S  G+SVLR +RLLRIFK+TRYW SL NLV SLLNS+RSI SLL LLFLFI+IF+LLGMQLFGG+FNF+E    ++ FD F +ALLTVFQILTGEDWN+VMY+GI + GG    G +  IYF++L + GNY LLNVFLAIAVDNLA+A+ LT+A++E+  E +R   A     E+K  +  +G+ P+         I+   +     SP   N+ IS + FS + N+ +         T  P+        +            P  +    I+ K  P+   SA F+F   N  R  CH +VN   F   I+  I  SSI+LAAEDPV+  S +N +L +FD  FT +FTVE++LK+   G  LH GS+CR+ +NILD  VV  +L++F              G  +  +N +K LRVLRVLRPL+ INR   LK V  CV  +++ + NI+IV  L QF+FA I VQLF+GK + C D+SK +   C+G +  Y     S P    R W++  F FDN+L AM+ LFTV+T EGWP +L  +++S   D GPI ++R E++IF+I++ I+  FF +NIFV  +I+TFQEQGE E  + +LDKNQ+QC+++A+  +PL RY+PK++   +Y+VW +V ST FEY + V+I LNT+ L M++Y +                  ++   +  LN  FT +F++E +LK++AF PK+YF D WN FD + V+GSI D+ ++EL          +++S +S+ F RLFR  RL+KLL +G  IR LLWTFI+SF+ALPYV LLI MLFFIY++IGMQVFG I L    +INR+NNFQTF   +LLLFRCATGE+WQEIMLAC  +KPC  + E T+   CGS+F   YF+SF  LC+FL++NLFVAVIMDNFDYLTRD SILGPHHLDE+ R+WAEYDP A GRI H ++  +LR ++PP+GFGK CP+R+A ++L+ MNMP++ +GTV F  TLFAL+R SL IK  T   ++  + ELR  I K+W   + K L+ +VPP  +    ++TVGK YA +LI E +R +K  +EQG    P    A+S+++  +      P ++   S +L A+
Sbjct:   99 GTTTATRPPRALLCLTLKNPIRRACISIVEWKPFEIIILLTIFANCVALAVYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIAYGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKADGGSAIGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFMGKMHKTCYYL-TNGYP-DVLTEEEPSPCALESNNGR-----HCPNGTLCRSGWVGPKHGITNFDNFAFAMLTVFQCITMEGWTDVLYWMQDAMGYELPCVYFVSLVIFGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPENEDEDI-----DEEKPRNSMSCAHMIIHASSASMSMPTSETESVNTDNVGSGDVEEES-CGVRLAHRISKSKFSRYWRRWNRFCRRKCRAAVKSNVFYWLVIFLVFLNTLTIASEHYNQPDWLTEVQDTANKVLLALFTAEMLLKMYSLGLQAYFVSLFNRFDCFIVCGGILETILVETRIMSPLGISVLRCVRLLRIFKITRYWNSLSNLVASLLNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDEMLTRRSTFDNFPQALLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYILLNVFLAIAVDNLADAESLTSAQKEEEEEKERKKLARTASPEKKQENESLGKSPVPAVEENKEKIELKAITADGESP--PNTKISVEEFSTNENEEK---------TPYPSSNETPGEEEEEEPEMPVGPR-PRPLSELHIKEKAAPMPEASAFFVFRSDNRFRVHCHRIVNNNIFTNLILFFILLSSISLAAEDPVRHNSFRNQVLFYFDIVFTAIFTVEIVLKMTAYGAFLHKGSFCRNYFNILDLLVVSVSLISF--------------GIQSSAINVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTTLLQFMFACIGVQLFKGKLYSCTDSSKITEAECKGKYITYKDGDVSQPMIVDRSWENSKFDFDNVLSAMMALFTVSTFEGWPELLYRAIDSHTEDVGPIYNHRVEISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEQEYKNCELDKNQRQCVEYALKARPLRRYIPKNQ--YQYKVWYVVNSTYFEYLMFVLILLNTICLAMQHYGQS----------------CSFKEAMNILNMLFTGLFTVEMILKLIAFKPKHYFCDAWNTFDALIVVGSIVDIAITELNVSNPRLSNVEENSRISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQVFGKIALNDTTEINRNNNFQTFPQAVLLLFRCATGEAWQEIMLACLPSKPCAPESE-TSEEKCGSSFAVFYFISFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVAMNMPLNSDGTVMFNATLFALVRTSLCIK--TDGNLEQANEELRAIIKKIWKRTSMKLLDQVVPPAGD---DEVTVGKFYATFLIQEYFRKFKKRKEQGLVGKPSQRNALSLQAGLRTLHDIGPEIRRAISGDLTAE 1694          
BLAST of Voltage dependent L type calcium channel subunit vs. Ensembl Xenopus
Match: CACNA1C (calcium channel, voltage-dependent, L type, alpha 1C subunit [Source:NCBI gene;Acc:100488055])

HSP 1 Score: 1204.12 bits (3114), Expect = 0.000e+0
Identity = 757/1687 (44.87%), Postives = 1028/1687 (60.94%), Query Frame = 2
Query:  677 GMQTST--SKSLFIFSEENVIRKYAKIIIEWGPFEYMVLLTILANCIVLSMERHLPKKDKTLLAGQLELTEKYFLGIFCVEALLKIVALGFCCHKEAYLRNVWNIMDFVVVVTGFLMMFLNIDNHSDSSTV--------DLRTLRAVRVLRPLKLVAGFPSLQVVLKSIIRAMAPLLQIGLLVLFAITIFAIIGLEFYSGAFHYTCFKANSDKLPLPIPTEKSLVPCS-NSKNGSGLGAYTCPEDYQCKAYWEGPNYGITSFDNIGYAMLTVFQCITMEGWTDIMYHTNDAIGNRFNWLYFVPLIILGSFFMLNLVLGVLSGXXXXXXXXXXXXXXXLKLRRQQQTEKEFNGYMEWIQKAEEVLLNEATTTSEDKMRIIAARRRAEKQKYKLLGKNQSIPDFEYEDTELYSETKSMKGNIFIRSYAGIR---RRRKERCTSFWRTEKHF-RFSVRRLVKSQPFYWAVIILVFFNTVCVAIEHYEQGKWLTLFLNYAEYVFLCLFMMEMMIKMYGLSIRVYFQSSFNIFDCVVIAGSLFEIIYGIFVQDSSFGLSVLRALRLLRIFKVTRYWAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMQLFGGEFNFEEGKPPQN-FDTFVKALLTVFQILTGEDWNTVMYNGIQSKGGVKERGTVFSIYFVLLVVFGNYTLLNVFLAIAVDNLANXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSSDNFIGRLPL--------SIDPPMVQVCPPSPQTANSLIS-KNFSFDHNQVEVNDKGCLLNTNKPNGKLGMLGHDNTNFNSLESDPVPNKIEPETIQRK--PVLPYSAMFIFSPLNSLRRFCHFVVNLRYFDLFIMIVICASSIALAAEDPVKEKSLKNNILEFFDYAFTGVFTVEMILKIIDLGIILHPGSYCRDLWNILDATVVICALVAFIMGQKPSPTGNKLRGSSAKNLNTIKSLRVLRVLRPLKTINRVPKLKAVFDCVVSSLKNVFNILIVYILFQFIFAVIAVQLFQGKFFYCNDASKSSRETCRGYFFDY--AGRSTPETKKRLWQHHDFHFDNILYAMLTLFTVTTGEGWPTVLKNSMESTNIDNGPIADYRQEMAXXXXXXXXXXXXXXXXXXXALIIITFQEQGENELIDLDLDKNQKQCIDFAINEKPLCRYMPKDKTTIKYRVWRLVVSTPFEYFIMVMIALNTLILMMKYYREEKKASSAATHDREQQAYLNYCNTLIFLNSAFTVMFSIECVLKIMAFGPKNYFRDPWNIFDFITVIGSITDVLV--------------------------------------SELQDXXXXXXXXXXXXXXXXXXXXXXQGYTIRILLWTFIQSFKALPYVCLLIAMLFFIYSIIGMQVFGNIKLISEYQINRHNNFQTFTNGLLLLFRCATGESWQEIMLACDNNKPCEKDIENTNNFDCGSNFTYIYFVSFIFLCSFLMLNLFVAVIMDNFDYLTRDSSILGPHHLDEYIRVWAEYDPGAIGRIHHSEMYEMLRNMEPPVGFGKKCPYRLAYRKLIRMNMPVDENGTVNFTTTLFALIRESLNIKMSTAEYMDIKDMELRQTICKMWPVQAKKKLNLIVPPDSELVFHKMTVGKIYAGYLIVENWRAYKNSQEQG----PRSSPAVSIKSVTK------PVVKEEKSANLLAK 5506
            G  T+T   ++L   + +N IR+    I+EW PFE ++LLTI ANC+ L++    P+ D       LE  E  FL IF VEA LK++A G   H  AYLRN WN++DF++VV G     L     +D  +         D++ LRA RVLRPL+LV+G PSLQVVL SII+AM PLL I LLVLF I I+AIIGLE + G  H TC+   ++  P  + TE+   PC+  S NG       CP    C++ W GP +GIT+FDN  +AMLTVFQCITMEGWTD++Y   DA+G     +YFV L+I GSFF+LNLVLGVLSGEF+KERE+ + R  F KLR +QQ E++  GY++WI +AE++         +++                   +N S+P  E E       T ++          G+R   R  K + + +WR    F R   R  VKS  FYW VI LVF NT+ +A EHY Q  WLT   + A  V L LF  EM++KMY L ++ YF S FN FDC ++ G + E I       S  G+SVLR +RLLRIFK+TRYW SL NLV SLLNS+RSI SLL LLFLFI+IF+LLGMQLFGG+FNF+E    ++ FD F +ALLTVFQILTGEDWN+VMY+GI + GG    G +  IYF++L + GNY LLNVFLAIAVDNLA+A+ LT+A++E+  E +R   A     E+K  +  +G+ P+         I+   +     SP   N+ IS + FS + N+ +         T  P+        +            P  +    I+ K  P+   SA F+F   N  R  CH +VN   F   I+  I  SSI+LAAEDPV+  S +N +L +FD  FT +FTVE++LK+   G  LH GS+CR+ +NILD  VV  +L++F              G  +  +N +K LRVLRVLRPL+ INR   LK V  CV  +++ + NI+IV  L QF+FA I VQLF+GK + C D+SK +   C+G +  Y     S P    R W++  F FDN+L AM+ LFTV+T EGWP +L  +++S   D GPI ++R E++IF+I++ I+  FF +NIFV  +I+TFQEQGE E  + +LDKNQ+QC+++A+  +PL RY+PK++   +Y+VW +V ST FEY + V+I LNT+ L M++Y +                  ++   +  LN  FT +F++E +LK++AF PK YF DPWN+FDF+ VIGS+ DV++                                      S ++++S +S+ F RLFR  RL+KLL +G  IR LLWTFI+SF+ALPYV LLI MLFFIY++IGMQVFG I L    +INR+NNFQTF   +LLLFRCATGE+WQEIMLAC  +KPC  + E T+   CGS+F   YF+SF  LC+FL++NLFVAVIMDNFDYLTRD SILGPHHLDE+ R+WAEYDP A GRI H ++  +LR ++PP+GFGK CP+R+A ++L+ MNMP++ +GTV F  TLFAL+R SL IK  T   ++  + ELR  I K+W   + K L+ +VPP  +    ++TVGK YA +LI E +R +K  +EQG    P    A+S+++  +      P ++   S +L A+
Sbjct:   99 GTTTATRPPRALLCLTLKNPIRRACISIVEWKPFEIIILLTIFANCVALAVYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIAYGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKADGGSAIGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFMGKMHKTCYYL-TNGYP-DVLTEEEPSPCALESNNGR-----HCPNGTLCRSGWVGPKHGITNFDNFAFAMLTVFQCITMEGWTDVLYWMQDAMGYELPCVYFVSLVIFGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPENEDEDIDEEK-----------------PRNMSMPTSETESVN----TDNVGSGDVEEESCGVRLAHRISKSKFSRYWRRWNRFCRRKCRAAVKSNVFYWLVIFLVFLNTLTIASEHYNQPDWLTEVQDTANKVLLALFTAEMLLKMYSLGLQAYFVSLFNRFDCFIVCGGILETILVETRIMSPLGISVLRCVRLLRIFKITRYWNSLSNLVASLLNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDEMLTRRSTFDNFPQALLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYILLNVFLAIAVDNLADAESLTSAQKEEEEEKERKKLARTASPEKKQENESLGKSPVPAVEENKEKIELKAITADGESP--PNTKISVEEFSTNENEEK---------TPYPSSNETPGEEEEEEPEMPVGPR-PRPLSELHIKEKAAPMPEASAFFVFRSDNRFRVHCHRIVNNNIFTNLILFFILLSSISLAAEDPVRHNSFRNQVLFYFDIVFTAIFTVEIVLKMTAYGAFLHKGSFCRNYFNILDLLVVSVSLISF--------------GIQSSAINVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTTLLQFMFACIGVQLFKGKLYSCTDSSKITEAECKGKYITYKDGDVSQPMIVDRSWENSKFDFDNVLSAMMALFTVSTFEGWPELLYRAIDSHTEDVGPIYNHRVEISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEQEYKNCELDKNQRQCVEYALKARPLRRYIPKNQ--YQYKVWYVVNSTYFEYLMFVLILLNTICLAMQHYGQS----------------CSFKEAMNILNMLFTGLFTVEMILKLIAFKPKGYFSDPWNVFDFLIVIGSVVDVILSETNHYFCDAWNTFDALIVVGSIVDIAITELNVSNPRLSNVEENSRISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQVFGKIALNDTTEINRNNNFQTFPQAVLLLFRCATGEAWQEIMLACLPSKPCAPESE-TSEEKCGSSFAVFYFISFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVAMNMPLNSDGTVMFNATLFALVRTSLCIK--TDGNLEQANEELRAIIKKIWKRTSMKLLDQVVPPAGD---DEVTVGKFYATFLIQEYFRKFKKRKEQGLVGKPSQRNALSLQAGLRTLHDIGPEIRRAISGDLTAE 1707          
BLAST of Voltage dependent L type calcium channel subunit vs. Ensembl Xenopus
Match: CACNA1C (calcium channel, voltage-dependent, L type, alpha 1C subunit [Source:NCBI gene;Acc:100488055])

HSP 1 Score: 1203.73 bits (3113), Expect = 0.000e+0
Identity = 751/1671 (44.94%), Postives = 1023/1671 (61.22%), Query Frame = 2
Query:  677 GMQTST--SKSLFIFSEENVIRKYAKIIIEWGPFEYMVLLTILANCIVLSMERHLPKKDKTLLAGQLELTEKYFLGIFCVEALLKIVALGFCCHKEAYLRNVWNIMDFVVVVTGFLMMFLNIDNHSDSSTV--------DLRTLRAVRVLRPLKLVAGFPSLQVVLKSIIRAMAPLLQIGLLVLFAITIFAIIGLEFYSGAFHYTCFKANSDKLPLPIPTEKSLVPCS-NSKNGSGLGAYTCPEDYQCKAYWEGPNYGITSFDNIGYAMLTVFQCITMEGWTDIMYHTNDAIGNRFNWLYFVPLIILGSFFMLNLVLGVLSGXXXXXXXXXXXXXXXLKLRRQQQTEKEFNGYMEWIQKAEEVLLNEATTTSEDKMRIIAARRRAEKQKYKLLGKNQSIPDFEYEDTELYSETKSMKGNIFIRSYAGIR---RRRKERCTSFWRTEKHF-RFSVRRLVKSQPFYWAVIILVFFNTVCVAIEHYEQGKWLTLFLNYAEYVFLCLFMMEMMIKMYGLSIRVYFQSSFNIFDCVVIAGSLFEIIYGIFVQDSSFGLSVLRALRLLRIFKVTRYWAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMQLFGGEFNFEEGKPPQN-FDTFVKALLTVFQILTGEDWNTVMYNGIQSKGGVKERGTVFSIYFVLLVVFGNYTLLNVFLAIAVDNLANXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSSDNFIGRLPLSIDPPMVQVCPPSPQTANSLISKNFSFDHNQVEVNDKGCLLNTNKPNGKLGMLGHDNTNFNSLESDPVPNK-----------------IEPETI------QRKPVLPYSAMF-IFSPLNSLRRFCHFVVNLRYFDLFIMIVICASSIALAAEDPVKEKSLKNNILEFFDYAFTGVFTVEMILKIIDLGIILHPGSYCRDLWNILDATVVICALVAFIMGQKPSPTGNKLRGSSAKNLNTIKSLRVLRVLRPLKTINRVPKLKAVFDCVVSSLKNVFNILIVYILFQFIFAVIAVQLFQGKFFYCNDASKSSRETCRGYFFDY--AGRSTPETKKRLWQHHDFHFDNILYAMLTLFTVTTGEGWPTVLKNSMESTNIDNGPIADYRQEMAXXXXXXXXXXXXXXXXXXXALIIITFQEQGENELIDLDLDKNQKQCIDFAINEKPLCRYMPKDKTTIKYRVWRLVVSTPFEYFIMVMIALNTLILMMKYYREEKKASSAATHDREQQAYLNYCNTLIFLNSAFTVMFSIECVLKIMAFGPKNYFRDPWNIFDFITVIGSITDVLVSELQ---------DXXXXXXXXXXXXXXXXXXXXXXQGYTIRILLWTFIQSFKALPYVCLLIAMLFFIYSIIGMQVFGNIKLISEYQINRHNNFQTFTNGLLLLFRCATGESWQEIMLACDNNKPCEKDIENTNNFDCGSNFTYIYFVSFIFLCSFLMLNLFVAVIMDNFDYLTRDSSILGPHHLDEYIRVWAEYDPGAIGRIHHSEMYEMLRNMEPPVGFGKKCPYRLAYRKLIRMNMPVDENGTVNFTTTLFALIRESLNIKMSTAEYMDIKDMELRQTICKMWPVQAKKKLNLIVPPDSELVFHKMTVGKIYAGYLIVENWRAYKNSQEQG----PRSSPAVSIKSVTK------PVVKEEKSANLLAK 5506
            G  T+T   ++L   + +N IR+    I+EW PFE ++LLTI ANC+ L++    P+ D       LE  E  FL IF VEA LK++A G   H  AYLRN WN++DF++VV G     L     +D  +         D++ LRA RVLRPL+LV+G PSLQVVL SII+AM PLL I LLVLF I I+AIIGLE + G  H TC+   ++  P  + TE+   PC+  S NG       CP    C++ W GP +GIT+FDN  +AMLTVFQCITMEGWTD++Y   DA+G     +YFV L+I GSFF+LNLVLGVLSGEF+KERE+ + R  F KLR +QQ E++  GY++WI +AE++         +++                   +N S+P  E E       T ++          G+R   R  K + + +WR    F R   R  VKS  FYW VI LVF NT+ +A EHY Q  WLT   + A  V L LF  EM++KMY L ++ YF S FN FDC ++ G + E I       S  G+SVLR +RLLRIFK+TRYW SL NLV SLLNS+RSI SLL LLFLFI+IF+LLGMQLFGG+FNF+E    ++ FD F +ALLTVFQILTGEDWN+VMY+GI + GG    G +  IYF++L + GNY LLNVFLAIAVDNLA+A+ LT+A++E+  E +R   A     E+K  +  +G+ P+    P V                    + N+ ++  K    +   P      +   +TN N  E  P P+                    P  +      ++   +P ++ F +F   N  R  CH +VN   F   I+  I  SSI+LAAEDPV+  S +N +L +FD  FT +FTVE++LK+   G  LH GS+CR+ +NILD  VV  +L++F              G  +  +N +K LRVLRVLRPL+ INR   LK V  CV  +++ + NI+IV  L QF+FA I VQLF+GK + C D+SK +   C+G +  Y     S P    R W++  F FDN+L AM+ LFTV+T EGWP +L  +++S   D GPI ++R E++IF+I++ I+  FF +NIFV  +I+TFQEQGE E  + +LDKNQ+QC+++A+  +PL RY+PK++   +Y+VW +V ST FEY + V+I LNT+ L M++Y +                  ++   +  LN  FT +F++E +LK++AF PK+YF D WN FD + V+GSI D+ ++EL          ++S +S+ F RLFR  RL+KLL +G  IR LLWTFI+SF+ALPYV LLI MLFFIY++IGMQVFG I L    +INR+NNFQTF   +LLLFRCATGE+WQEIMLAC  +KPC  + E T+   CGS+F   YF+SF  LC+FL++NLFVAVIMDNFDYLTRD SILGPHHLDE+ R+WAEYDP A GRI H ++  +LR ++PP+GFGK CP+R+A ++L+ MNMP++ +GTV F  TLFAL+R SL IK  T   ++  + ELR  I K+W   + K L+ +VPP  +    ++TVGK YA +LI E +R +K  +EQG    P    A+S+++  +      P ++   S +L A+
Sbjct:  134 GTTTATRPPRALLCLTLKNPIRRACISIVEWKPFEIIILLTIFANCVALAVYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIAYGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKADGGSAIGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFMGKMHKTCYYL-TNGYP-DVLTEEEPSPCALESNNGR-----HCPNGTLCRSGWVGPKHGITNFDNFAFAMLTVFQCITMEGWTDVLYWMQDAMGYELPCVYFVSLVIFGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPENEDEDIDEEK-----------------PRNMSMPTSETESV----NTDNVGSGDVEEESCGVRLAHRISKSKFSRYWRRWNRFCRRKCRAAVKSNVFYWLVIFLVFLNTLTIASEHYNQPDWLTEVQDTANKVLLALFTAEMLLKMYSLGLQAYFVSLFNRFDCFIVCGGILETILVETRIMSPLGISVLRCVRLLRIFKITRYWNSLSNLVASLLNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDEMLTRRSTFDNFPQALLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYILLNVFLAIAVDNLADAESLTSAQKEEEEEKERKKLARTASPEKKQENESLGKSPV----PAV--------------------EENKEKIELKAITADGESPPNTKISVEEFSTNENE-EKTPYPSSNETPGEEEEEEPEMPVGPRPRPLSELHIKEKAAPMPEASAFFVFRSDNRFRVHCHRIVNNNIFTNLILFFILLSSISLAAEDPVRHNSFRNQVLFYFDIVFTAIFTVEIVLKMTAYGAFLHKGSFCRNYFNILDLLVVSVSLISF--------------GIQSSAINVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTTLLQFMFACIGVQLFKGKLYSCTDSSKITEAECKGKYITYKDGDVSQPMIVDRSWENSKFDFDNVLSAMMALFTVSTFEGWPELLYRAIDSHTEDVGPIYNHRVEISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEQEYKNCELDKNQRQCVEYALKARPLRRYIPKNQ--YQYKVWYVVNSTYFEYLMFVLILLNTICLAMQHYGQS----------------CSFKEAMNILNMLFTGLFTVEMILKLIAFKPKHYFCDAWNTFDALIVVGSIVDIAITELNVSNPRLSVTENSRISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQVFGKIALNDTTEINRNNNFQTFPQAVLLLFRCATGEAWQEIMLACLPSKPCAPESE-TSEEKCGSSFAVFYFISFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVAMNMPLNSDGTVMFNATLFALVRTSLCIK--TDGNLEQANEELRAIIKKIWKRTSMKLLDQVVPPAGD---DEVTVGKFYATFLIQEYFRKFKKRKEQGLVGKPSQRNALSLQAGLRTLHDIGPEIRRAISGDLTAE 1713          
BLAST of Voltage dependent L type calcium channel subunit vs. Ensembl Xenopus
Match: CACNA1C (calcium channel, voltage-dependent, L type, alpha 1C subunit [Source:NCBI gene;Acc:100488055])

HSP 1 Score: 1199.5 bits (3102), Expect = 0.000e+0
Identity = 755/1671 (45.18%), Postives = 1024/1671 (61.28%), Query Frame = 2
Query:  677 GMQTSTS--KSLFIFSEENVIRKYAKIIIEWGPFEYMVLLTILANCIVLSMERHLPKKDKTLLAGQLELTEKYFLGIFCVEALLKIVALGFCCHKEAYLRNVWNIMDFVVVVTGFLMMFLNIDNHSDSSTV--------DLRTLRAVRVLRPLKLVAGFPSLQVVLKSIIRAMAPLLQIGLLVLFAITIFAIIGLEFYSGAFHYTCFKANSDKLPLPIPTEKSLVPCS-NSKNGSGLGAYTCPEDYQCKAYWEGPNYGITSFDNIGYAMLTVFQCITMEGWTDIMYHTNDAIGNRFNWLYFVPLIILGSFFMLNLVLGVLSGXXXXXXXXXXXXXXXLKLRRQQQTEKEFNGYMEWIQKAEEVLLNEATTTSEDKMRIIAARRRAEKQKYKLLGKNQSIPDFEYEDTELYSETKSMKGNIFIRSYAGIR---RRRKERCTSFWRTEKHF-RFSVRRLVKSQPFYWAVIILVFFNTVCVAIEHYEQGKWLTLFLNYAEYVFLCLFMMEMMIKMYGLSIRVYFQSSFNIFDCVVIAGSLFEIIYGIFVQDSSFGLSVLRALRLLRIFKVTRYWAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMQLFGGEFNFEEGKPPQN-FDTFVKALLTVFQILTGEDWNTVMYNGIQSKGGVKERGTVFSIYFVLLVVFGNYTLLNVFLAIAVDNLANXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSSDNFIGRLPL--------SIDPPMVQVCPPSPQTANSLIS-KNFSFDHNQVEVNDKGCLLNTNKPNGKLGMLGHDNTNFNSLESDPVPNKIEPETIQRK--PVLPYSAMFIFSPLNSLRRFCHFVVNLRYFDLFIMIVICASSIALAAEDPVKEKSLKNNILEFFDYAFTGVFTVEMILKIIDLGIILHPGSYCRDLWNILDATVVICALVAFIMGQKPSPTGNKLRGSSAKNLNTIKSLRVLRVLRPLKTINRVPKLKAVFDCVVSSLKNVFNILIVYILFQFIFAVIAVQLFQGKFFYCNDASKSSRETCRGYFFDY--AGRSTPETKKRLWQHHDFHFDNILYAMLTLFTVTTGEGWPTVLKNSMESTNIDNGPIADYRQEMAXXXXXXXXXXXXXXXXXXXALIIITFQEQGENELIDLDLDKNQKQCIDFAINEKPLCRYMPKDKTTIKYRVWRLVVSTPFEYFIMVMIALNTLILMMKYYREEKKASSAATHDREQQAYLNYCNTLIFLNSAFTVMFSIECVLKIMAFGPKNYFRDPWNIFDFITVIGSITDVLVSEL----------QDXXXXXXXXXXXXXXXXXXXXXXQGYTIRILLWTFIQSFKALPYVCLLIAMLFFIYSIIGMQVFGNIKLISEYQINRHNNFQTFTNGLLLLFRCATGESWQEIMLACDNNKPCEKDIENTNNFDCGSNFTYIYFVSFIFLCSFLMLNLFVAVIMDNFDYLTRDSSILGPHHLDEYIRVWAEYDPGAIGRIHHSEMYEMLRNMEPPVGFGKKCPYRLAYRKLIRMNMPVDENGTVNFTTTLFALIRESLNIKMSTAEY------------MDIKDMELRQTICKMWPVQAKKKLNLIVPPDSELVFHKMTVGKIYAGYLIVENWRAYKNSQEQG----PRSSPAVSIKSVTK------PVVKEEKSANLLAK 5506
            G  T+T   ++L   + +N IR+    I+EW PFE ++LLTI ANC+ L++    P+ D       LE  E  FL IF VEA LK++A G   H  AYLRN WN++DF++VV G     L     +D  +         D++ LRA RVLRPL+LV+G PSLQVVL SII+AM PLL I LLVLF I I+AIIGLE + G  H TC+   ++  P  + TE+   PC+  S NG       CP    C++ W GP +GIT+FDN  +AMLTVFQCITMEGWTD++Y   DA+G     +YFV L+I GSFF+LNLVLGVLSGEF+KERE+ + R  F KLR +QQ E++  GY++WI +AE++         +++                   +N S+P  E E       T ++          G+R   R  K + + +WR    F R   R  VKS  FYW VI LVF NT+ +A EHY Q  WLT   + A  V L LF  EM++KMY L ++ YF S FN FDC ++ G + E I       S  G+SVLR +RLLRIFK+TRYW SL NLV SLLNS+RSI SLL LLFLFI+IF+LLGMQLFGG+FNF+E    ++ FD F +ALLTVFQILTGEDWN+VMY+GI + GG    G +  IYF++L + GNY LLNVFLAIAVDNLA+A+ LT+A++E+  E +R   A     E+K  +  +G+ P+         I+   +     SP   N+ IS + FS + N+ +         T  P+        +            P  +    I+ K  P+   SA F+F   N  R  CH +VN   F   I+  I  SSI+LAAEDPV+  S +N IL   DY FT +FT+E+ILK+   G  LH GS+CR+ +NILD  VV  +L++F              G  +  +N +K LRVLRVLRPL+ INR   LK V  CV  +++ + NI+IV  L QF+FA I VQLF+GK + C D+SK +   C+G +  Y     S P    R W++  F FDN+L AM+ LFTV+T EGWP +L  +++S   D GPI ++R E++IF+I++ I+  FF +NIFV  +I+TFQEQGE E  + +LDKNQ+QC+++A+  +PL RY+PK++   +Y+VW +V ST FEY + V+I LNT+ L M++Y +                  ++   +  LN  FT +F++E +LK++AF PK+YF D WN FD + V+GSI D+ ++EL          +++S +S+ F RLFR  RL+KLL +G  IR LLWTFI+SF+ALPYV LLI MLFFIY++IGMQVFG I L    +INR+NNFQTF   +LLLFRCATGE+WQEIMLAC  +KPC  + E T+   CGS+F   YF+SF  LC+FL++NLFVAVIMDNFDYLTRD SILGPHHLDE+ R+WAEYDP A GRI H ++  +LR ++PP+GFGK CP+R+A ++L+ MNMP++ +GTV F  TLFAL+R SL IK                  ++  + ELR  I K+W   + K L+ +VPP  +    ++TVGK YA +LI E +R +K  +EQG    P    A+S+++  +      P ++   S +L A+
Sbjct:   99 GTTTATRPPRALLCLTLKNPIRRACISIVEWKPFEIIILLTIFANCVALAVYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIAYGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKADGGSAIGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFMGKMHKTCYYL-TNGYP-DVLTEEEPSPCALESNNGR-----HCPNGTLCRSGWVGPKHGITNFDNFAFAMLTVFQCITMEGWTDVLYWMQDAMGYELPCVYFVSLVIFGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPENEDEDIDEEK-----------------PRNMSMPTSETESVN----TDNVGSGDVEEESCGVRLAHRISKSKFSRYWRRWNRFCRRKCRAAVKSNVFYWLVIFLVFLNTLTIASEHYNQPDWLTEVQDTANKVLLALFTAEMLLKMYSLGLQAYFVSLFNRFDCFIVCGGILETILVETRIMSPLGISVLRCVRLLRIFKITRYWNSLSNLVASLLNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDEMLTRRSTFDNFPQALLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYILLNVFLAIAVDNLADAESLTSAQKEEEEEKERKKLARTASPEKKQENESLGKSPVPAVEENKEKIELKAITADGESP--PNTKISVEEFSTNENEEK---------TPYPSSNETPGEEEEEEPEMPVGPR-PRPLSELHIKEKAAPMPEASAFFVFRSDNRFRVHCHRIVNNNIFTNLILFFILLSSISLAAEDPVRHNSFRNQILGNADYVFTSIFTLEIILKMTAYGAFLHKGSFCRNYFNILDLLVVSVSLISF--------------GIQSSAINVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTTLLQFMFACIGVQLFKGKLYSCTDSSKITEAECKGKYITYKDGDVSQPMIVDRSWENSKFDFDNVLSAMMALFTVSTFEGWPELLYRAIDSHTEDVGPIYNHRVEISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEQEYKNCELDKNQRQCVEYALKARPLRRYIPKNQ--YQYKVWYVVNSTYFEYLMFVLILLNTICLAMQHYGQS----------------CSFKEAMNILNMLFTGLFTVEMILKLIAFKPKHYFCDAWNTFDALIVVGSIVDIAITELNVSNPRLSNVEENSRISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQVFGKIALNDTTEINRNNNFQTFPQAVLLLFRCATGEAWQEIMLACLPSKPCAPESE-TSEEKCGSSFAVFYFISFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVAMNMPLNSDGTVMFNATLFALVRTSLCIKTDGNSLLLLFACQIFSWNLEQANEELRAIIKKIWKRTSMKLLDQVVPPAGD---DEVTVGKFYATFLIQEYFRKFKKRKEQGLVGKPSQRNALSLQAGLRTLHDIGPEIRRAISGDLTAE 1693          
BLAST of Voltage dependent L type calcium channel subunit vs. Ensembl Mouse
Match: Cacna1c (calcium channel, voltage-dependent, L type, alpha 1C subunit [Source:MGI Symbol;Acc:MGI:103013])

HSP 1 Score: 1245.72 bits (3222), Expect = 0.000e+0
Identity = 765/1650 (46.36%), Postives = 1037/1650 (62.85%), Query Frame = 2
Query:  686 TSTSKSLFIFSEENVIRKYAKIIIEWGPFEYMVLLTILANCIVLSMERHLPKKDKTLLAGQLELTEKYFLGIFCVEALLKIVALGFCCHKEAYLRNVWNIMDFVVVVTGFLMMFLNIDNHSDSSTV--------DLRTLRAVRVLRPLKLVAGFPSLQVVLKSIIRAMAPLLQIGLLVLFAITIFAIIGLEFYSGAFHYTCFKANSDKLPLPIPTEKSLVPCSNSKNGSGLGAYTCPEDYQCKAYWEGPNYGITSFDNIGYAMLTVFQCITMEGWTDIMYHTNDAIGNRFNWLYFVPLIILGSFFMLNLVLGVLSGXXXXXXXXXXXXXXXLKLRRQQQTEKEFNGYMEWIQKAEEV-LLNEATTTSEDKMRIIAARRRAEKQKYKLLG-------KNQSIPDFEYEDTELYSETKSMKGNIFIRSYAGIR---RRRKERCTSFWRTEKHF-RFSVRRLVKSQPFYWAVIILVFFNTVCVAIEHYEQGKWLTLFLNYAEYVFLCLFMMEMMIKMYGLSIRVYFQSSFNIFDCVVIAGSLFEIIYGIFVQDSSFGLSVLRALRLLRIFKVTRYWAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMQLFGGEFNFEEGKPPQN-FDTFVKALLTVFQILTGEDWNTVMYNGIQSKGGVKERGTVFSIYFVLLVVFGNYTLLNVFLAIAVDNLANXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSSDNFIGRLPLSIDPPMVQVCPPSPQTANSLISKNFSFDHNQVEVNDKGCLLNTNK-PNGKLGMLGHDNTNFNSLESDPVPNKIEPETIQRK--PVLPYSAMFIFSPLNSLRRFCHFVVNLRYFDLFIMIVICASSIALAAEDPVKEKSLKNNILEFFDYAFTGVFTVEMILKIIDLGIILHPGSYCRDLWNILDATVVICALVAFIMGQKPSPTGNKLRGSSAKNLNTIKSLRVLRVLRPLKTINRVPKLKAVFDCVVSSLKNVFNILIVYILFQFIFAVIAVQLFQGKFFYCNDASKSSRETCRGYFFDYAGRST--PETKKRLWQHHDFHFDNILYAMLTLFTVTTGEGWPTVLKNSMESTNIDNGPIADYRQEMAXXXXXXXXXXXXXXXXXXXALIIITFQEQGENELIDLDLDKNQKQCIDFAINEKPLCRYMPKDKTTIKYRVWRLVVSTPFEYFIMVMIALNTLILMMKYYREEKKASSAATHDREQQAYLNYCNTLIFLNSAFTVMFSIECVLKIMAFGPKNYFRDPWNIFDFITVIGSITDVLVSE---LQDXXXXXXXXXXXXXXXXXXXXXXQGYTIRILLWTFIQSFKALPYVCLLIAMLFFIYSIIGMQVFGNIKLISEYQINRHNNFQTFTNGLLLLFRCATGESWQEIMLACDNNKPCEKDIENTNNFD----CGSNFTYIYFVSFIFLCSFLMLNLFVAVIMDNFDYLTRDSSILGPHHLDEYIRVWAEYDPGAIGRIHHSEMYEMLRNMEPPVGFGKKCPYRLAYRKLIRMNMPVDENGTVNFTTTLFALIRESLNIKMSTAEYMDIKDMELRQTICKMWPVQAKKKLNLIVPPDSELVFHKMTVGKIYAGYLIVENWRAYKNSQEQG----PRSSPAVSIKSVTK------PVVKEEKSANLLAK 5506
            T   ++L   + +N IR+    I+EW PFE ++LLTI ANC+ L++    P+ D       LE  E  FL IF VEA LK++A G   H  AYLRN WN++DF++VV G     L     +D +          D++ LRA RVLRPL+LV+G PSLQVVL SII+AM PLL I LLVLF I I+AIIGLE + G  H TC+  N + + + +P E+   PC+  + G G     C     CK  W+GP +GIT+FDN  +AMLTVFQCITMEGWTD++Y  NDA+G  + W+YFV LII+GSFF+LNLVLGVLSGEF+KERE+ + R  F KLR +QQ E++  GY++WI +AE++   NE     EDK R   A      QK             + S+P  E E       T+++ G        G R   R  K + + +WR    F R   R  VKS  FYW VI LVF NT+ +A EHY Q  WLT   + A    L LF  EM++KMY L ++ YF S FN FDC ++ G + E I       S  G+SVLR +RLLRIFK+TRYW SL NLV SLLNS+RSI SLL LLFLFI+IF+LLGMQLFGG+FNF+E +  ++ FD F ++LLTVFQILTGEDWN+VMY+GI + GG    G +  IYF++L + GNY LLNVFLAIAVDNLA+A+ LT+A++E+  E +R   A     E+K            ++ P V+          S+ +   S    ++ ++D     N +K P+      G ++     +   P P  +    ++ K  P+   SA FIFSP N  R  CH +VN   F   I+  I  SSI+LAAEDPV+  S +N+IL +FD  FT +FT+E+ LK+   G  LH GS+CR+ +NILD  VV  +L++F              G  +  +N +K LRVLRVLRPL+ INR   LK V  CV  +++ + NI+IV  L QF+FA I VQLF+GK + C+D+SK +   C+G +  Y       P  + R W++  F FDN+L AM+ LFTV+T EGWP +L  S++S   D GPI +YR E++IF+I++ I+  FF +NIFV  +I+TFQEQGE E  + +LDKNQ+QC+++A+  +PL RY+PK++   +Y+VW +V ST FEY + V+I LNT+ L M++Y                Q+ L +   +  LN  FT +F++E +LK++AF PK YF DPWN+FDF+ VIGSI DV++SE    +++S +S+ F RLFR  RL+KLL +G  IR LLWTFI+SF+ALPYV LLI MLFFIY++IGMQVFG I L    +INR+NNFQTF   +LLLFRCATGE+WQ+IMLAC   K C  + E +N+ +    CGS+F   YF+SF  LC+FL++NLFVAVIMDNFDYLTRD SILGPHHLDE+ R+WAEYDP A GRI H ++  +LR ++PP+GFGK CP+R+A ++L+ MNMP++ +GTV F  TLFAL+R +L IK  T   ++  + ELR  I K+W   + K L+ +VPP  +    ++TVGK YA +LI E +R +K  +EQG    P    A+S+++  +      P ++   S +L A+
Sbjct:   98 TRPPRALLCLTLKNPIRRACISIVEWKPFEIIILLTIFANCVALAIYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIAYGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKADGANALGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFMGKMHKTCY--NQEGI-IDVPAEEDPSPCA-LETGHG---RQCQNGTVCKPGWDGPKHGITNFDNFAFAMLTVFQCITMEGWTDVLYWVNDAVGRDWPWIYFVTLIIIGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPENEDEGMDEDKPRNRGAPAGLHDQKKGKFAWFSHSTETHVSMPTSETESVN----TENVAGGDIEGENCGARLAHRISKSKFSRYWRRWNRFCRRKCRAAVKSNVFYWLVIFLVFLNTLTIASEHYNQPHWLTEVQDTANKALLALFTAEMLLKMYSLGLQAYFVSLFNRFDCFIVCGGILETILVETKIMSPLGISVLRCVRLLRIFKITRYWNSLSNLVASLLNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDEMQTRRSTFDNFPQSLLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYILLNVFLAIAVDNLADAESLTSAQKEEEEEKERKKLARTASPEKKQE---------VMEKPAVEESKEEKIELKSITADGESPPTTKINMDDLQPSENEDKSPHSNPDTAGEEDEEEPEMPVGPRPRPLSELHLKEKAVPMPEASAFFIFSPNNRFRLQCHRIVNDTIFTNLILFFILLSSISLAAEDPVQHTSFRNHILFYFDIVFTTIFTIEIALKMTAYGAFLHKGSFCRNYFNILDLLVVSVSLISF--------------GIQSSAINVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTTLLQFMFACIGVQLFKGKLYTCSDSSKQTEAECKGNYITYKDGEVDHPIIQPRSWENSKFDFDNVLAAMMALFTVSTFEGWPELLYRSIDSHTEDKGPIYNYRVEISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEQEYKNCELDKNQRQCVEYALKARPLRRYIPKNQH--QYKVWYVVNSTYFEYLMFVLILLNTICLAMQHY---------------GQSCL-FKIAMNILNMLFTGLFTVEMILKLIAFKPKGYFSDPWNVFDFLIVIGSIIDVILSETNSAEENSRISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQVFGKIALNDTTEINRNNNFQTFPQAVLLLFRCATGEAWQDIMLACMPGKKCAPESEPSNSTEGETPCGSSFAVFYFISFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVSMNMPLNSDGTVMFNATLFALVRTALRIK--TEGNLEQANEELRAIIKKIWKRTSMKLLDQVVPPAGD---DEVTVGKFYATFLIQEYFRKFKKRKEQGLVGKPSQRNALSLQAGLRTLHDIGPEIRRAISGDLTAE 1690          
BLAST of Voltage dependent L type calcium channel subunit vs. Ensembl Mouse
Match: Cacna1s (calcium channel, voltage-dependent, L type, alpha 1S subunit [Source:MGI Symbol;Acc:MGI:88294])

HSP 1 Score: 1242.64 bits (3214), Expect = 0.000e+0
Identity = 745/1614 (46.16%), Postives = 1017/1614 (63.01%), Query Frame = 2
Query:  641 SLAKRTINLSFPGMQTSTSKSLFIFSEENVIRKYAKIIIEWGPFEYMVLLTILANCIVLSMERHLPKKDKTLLAGQLELTEKYFLGIFCVEALLKIVALGFCCHKEAYLRNVWNIMDFVVVVTGFLMMFLNIDN---------HSDSSTVDLRTLRAVRVLRPLKLVAGFPSLQVVLKSIIRAMAPLLQIGLLVLFAITIFAIIGLEFYSGAFHYTCFKANSDKLPLPIPTEKSLVPCSNSKNGSGLGAYTCPEDYQCKAYWEGPNYGITSFDNIGYAMLTVFQCITMEGWTDIMYHTNDAIGNRFNWLYFVPLIILGSFFMLNLVLGVLSGXXXXXXXXXXXXXXXLKLRRQQQTEKEFNGYMEWIQKAEEVLLNEATTTSEDKMRIIAARRRAEKQKYKLLGKNQSIPDFEYEDTELYSETKSMKGNI-FIRSYAGIRRRRKERCTSFWRT-EKHFRFSVRRLVKSQPFYWAVIILVFFNTVCVAIEHYEQGKWLTLFLNYAEYVFLCLFMMEMMIKMYGLSIRVYFQSSFNIFDCVVIAGSLFEIIYGIFVQDSSFGLSVLRALRLLRIFKVTRYWAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMQLFGGEFNFEEGKPPQ-NFDTFVKALLTVFQILTGEDWNTVMYNGIQSKGGVKERGTVFSIYFVLLVVFGNYTLLNVFLAIAVDNLANXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSSDNFIGRLPLSIDPPMVQVCPPSPQTANSLISKNFSFDHNQVEVNDKGCLLNTNKPNGKLGMLGHDNTNFNSLESDPVPNKIEPETIQRK--PVLPYSAMFIFSPLNSLRRFCHFVVNLRYFDLFIMIVICASSIALAAEDPVKEKSLKNNILEFFDYAFTGVFTVEMILKIIDLGIILHPGSYCRDLWNILDATVVICALVAFIMGQKPSPTGNKLRGSSAKNLNTIKSLRVLRVLRPLKTINRVPKLKAVFDCVVSSLKNVFNILIVYILFQFIFAVIAVQLFQGKFFYCNDASKSSRETCRGYFFDYA-GRSTP-ETKKRLWQHHDFHFDNILYAMLTLFTVTTGEGWPTVLKNSMESTNIDNGPIADYRQEMAXXXXXXXXXXXXXXXXXXXALIIITFQEQGENELIDLDLDKNQKQCIDFAINEKPLCRYMPKDKTTIKYRVWRLVVSTPFEYFIMVMIALNTLILMMKYYREEKKASSAATHDREQQAYLNYCNTLIFLNSAFTVMFSIECVLKIMAFGPKNYFRDPWNIFDFITVIGSITDVLVSELQDXXXXXXXXXX---XXXXXXXXXXXXQGYTIRILLWTFIQSFKALPYVCLLIAMLFFIYSIIGMQVFGNIKLISEYQINRHNNFQTFTNGLLLLFRCATGESWQEIMLACDNNKPC--EKDIENTNNFDCGSNFTYIYFVSFIFLCSFLMLNLFVAVIMDNFDYLTRDSSILGPHHLDEYIRVWAEYDPGAIGRIHHSEMYEMLRNMEPPVGFGKKCPYRLAYRKLIRMNMPVDENGTVNFTTTLFALIRESLNIKMSTAEYMDIKDMELRQTICKMWPVQAKKKLNLIVPPDSELVFHKMTVGKIYAGYLIVENWRAYKNSQEQ 5419
             L K+      P +     ++LF  + +N +RK    I+EW PFE ++LLTI ANC+ L++   +P+ D   L   LE  E +FL +F +EA +KI+A GF  H++AYLR+ WN++DF++V  G   + L   N          S  + +D++ LRA RVLRPL+LV+G PSLQVVL SI +AM PL  I LLVLF + I+AIIGLE + G  H TC+   +D     + T ++  P   ++ GSG          +C+  W GPN+GIT FDN G++MLTV+QCI+MEGWTD++Y  NDAIGN + W+YFV LI+LGSFF+LNLVLGVLSGEF KERE+ + R  F KLR +QQ E++  GYM WI + E   + +     E K+ +                      D    DTE   E + +   I FIR                WR   + FR+    LVKS+ FYW VI++V  NT+ +A EH+ Q  WLT   + A  V L LF +EM++KMYGL +R YF S FN FDC V+   + EI+       S  G+SVLR +RLLR+FK+T+YW SL NLV SLLNS+RSI SLL LLFLFI+IFALLGMQLFGG ++FE+ +  + NFD F +AL++VFQ+LTGEDWN+VMYNGI + GG    G +  IYF++L V GNY LLNVFLAIAVDNLA A+ LT+A++ KA E +R   +  L ++ +       R  ++            P TA   I +   F+ N  EV D         P       G D  +   +   P P  +    ++ K  P+   S+ FIFSP N +R  CH +VN  +F  FI++ I  SS ALAAEDP++  S++N ILE+FDY FT VFTVE++LK+   G  LH GS+CR+ +NILD  VV  +L++               G  +  ++ +K LRVLRVLRPL+ INR   LK V  CV  +++ + NI++V  L QF+FA I VQLF+GKF+ CND SK + E CRGY++ Y  G  T  E + R W H+DFHFDN+L AM++LFTV+T EGWP +L  +++S   D GP+ + R EMAIF+I++ I+  FF +NIFV  +I+TFQEQGE E  + +LDKNQ+QC+ +A+  +PL  Y+PK+    +Y+VW +V S+ FEY +  +I LNT+ L M++Y + ++              +N+ + +  LN AFT++F++E VLK++AF P+ YF DPWN+FDF+ VIGSI DV++SE+ D    +        LFR  RL+KLL +   +R LLWTFI+SF+ALPYV LLI MLFFIY++IGMQ+FG I ++   QINR+NNFQTF   +LLLFRCATGE+WQEI+LAC   K C  E D        CG+NF Y YF+SF  LC+FL++NLFVAVIMDNFDYLTRD SILGPHHLDE+  +WAEYDP A GRI H ++  +LR ++PP+GFGK CP+R+A ++L+ MNMP++ +GTV F  TLFAL+R +L IK  T    +  + ELR  I K+W   + K L+ ++PP  +    ++TVGK YA +LI E++R +   QE+
Sbjct:   10 GLRKKQPKKPVPEILPRPPRALFCLTLQNPLRKACISIVEWKPFETIILLTIFANCVALAVYLPMPEDDNNTLNLGLEKLEYFFLIVFSIEAAMKIIAYGFLFHQDAYLRSGWNVLDFIIVFLGVFTVILEQVNIIQTNTAPMSSKGAGLDVKALRAFRVLRPLRLVSGVPSLQVVLNSIFKAMLPLFHIALLVLFMVIIYAIIGLELFKGKMHKTCYFIGTDI----VATVENEKPSPCARTGSGRPCTI--NGSECRGGWPGPNHGITHFDNFGFSMLTVYQCISMEGWTDVLYWVNDAIGNEWPWIYFVTLILLGSFFILNLVLGVLSGEFTKEREKAKSRGTFQKLREKQQLEEDLRGYMSWITQGE---VMDVDDLREGKLSL----------------------DEGGSDTESLYEIEGLNKIIQFIRH---------------WRQWNRVFRWKCHDLVKSKVFYWLVILIVALNTLSIASEHHNQPLWLTHLQDVANRVLLTLFTIEMLMKMYGLGLRQYFMSIFNRFDCFVVCSGILEILLVESGAMSPLGISVLRCIRLLRLFKITKYWTSLSNLVASLLNSIRSIASLLLLLFLFIIIFALLGMQLFGGRYDFEDTEVRRSNFDNFPQALISVFQVLTGEDWNSVMYNGIMAYGGPTYPGVLVCIYFIILFVCGNYILLNVFLAIAVDNLAEAESLTSAQKAKAEERKRRKMSKGLPDKSEEE-----RATVTKKLEQKSKGEGIPTTAKLKIDE---FESNVNEVKD---------PYPSADFPGDDEEDEPEIPVSPRPRPLAELQLKEKAVPIPEASSFFIFSPTNKIRVLCHRIVNATWFTNFILLFILLSSAALAAEDPIRADSMRNQILEYFDYVFTAVFTVEIVLKMTTYGAFLHKGSFCRNYFNILDLLVVAVSLISM--------------GLESSAISVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVLVTTLLQFMFACIGVQLFKGKFYSCNDLSKMTEEECRGYYYIYKDGDPTQIELRPRQWIHNDFHFDNVLSAMMSLFTVSTFEGWPQLLYKAIDSNEEDTGPVYNNRVEMAIFFIIYIILIAFFMMNIFVGFVIVTFQEQGETEYKNCELDKNQRQCVQYALKARPLRCYIPKNP--YQYQVWYVVTSSYFEYLMFALIMLNTICLGMQHYNQSEQ--------------MNHISDI--LNVAFTIIFTLEMVLKLIAFKPRGYFGDPWNVFDFLIVIGSIIDVILSEIDDPDESARISSAFFRLFRVMRLVKLLNRAEGVRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQMFGKIAMVDGTQINRNNNFQTFPQAVLLLFRCATGEAWQEILLACSYGKLCDPESDYAPGEEHTCGTNFAYYYFISFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKAIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKFCPHRVACKRLVGMNMPLNSDGTVTFNATLFALVRTALKIK--TEGNFEQANEELRAIIKKIWKRTSMKLLDQVIPPIGD---DEVTVGKFYATFLIQEHFRKFMKRQEE 1523          
BLAST of Voltage dependent L type calcium channel subunit vs. Ensembl Mouse
Match: Cacna1c (calcium channel, voltage-dependent, L type, alpha 1C subunit [Source:MGI Symbol;Acc:MGI:103013])

HSP 1 Score: 1242.25 bits (3213), Expect = 0.000e+0
Identity = 764/1654 (46.19%), Postives = 1034/1654 (62.52%), Query Frame = 2
Query:  686 TSTSKSLFIFSEENVIRKYAKIIIEWGPFEYMVLLTILANCIVLSMERHLPKKDKTLLAGQLELTEKYFLGIFCVEALLKIVALGFCCHKEAYLRNVWNIMDFVVVVTGFLMMFLNIDNHSDSSTV--------DLRTLRAVRVLRPLKLVAGFPSLQVVLKSIIRAMAPLLQIGLLVLFAITIFAIIGLEFYSGAFHYTCFKANSDKLPLPIPTEKSLVPCSNSKNGSGLGAYTCPEDYQCKAYWEGPNYGITSFDNIGYAMLTVFQCITMEGWTDIMYHTNDAIGNRFNWLYFVPLIILGSFFMLNLVLGVLSGXXXXXXXXXXXXXXXLKLRRQQQTEKEFNGYMEWIQKAEEV-LLNEATTTSEDKMRIIAARRRAEKQKYKLLGKNQSIPDFEYEDTELYSETKSMKGNIFIRSYAGIR---RRRKERCTSFWRTEKHF-RFSVRRLVKSQPFYWAVIILVFFNTVCVAIEHYEQGKWLTLFLNYAEYVFLCLFMMEMMIKMYGLSIRVYFQSSFNIFDCVVIAGSLFEIIYGIFVQDSSFGLSVLRALRLLRIFKVTRYWAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMQLFGGEFNFEEGKPPQN-FDTFVKALLTVFQILTGEDWNTVMYNGIQSKGGVKERGTVFSIYFVLLVVFGNYTLLNVFLAIAVDNLANXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSSDNFIGRLPLSIDPPMVQVCPPSPQTANSLISKNFSFDHNQVEVNDKGCLLNTNK-PNGKLGMLGHDNTNFNSLESDPVPNKIEPETIQRK--PVLPYSAMFIFSPLNSLRRFCHFVVNLRYFDLFIMIVICASSIALAAEDPVKEKSLKNNILEFFDYAFTGVFTVEMILKIIDLGIILHPGSYCRDLWNILDATVVICALVAFIMGQKPSPTGNKLRGSSAKNLNTIKSLRVLRVLRPLKTINRVPKLKAVFDCVVSSLKNVFNILIVYILFQFIFAVIAVQLFQGKFFYCNDASKSSRETCRGYFFDYAGRST--PETKKRLWQHHDFHFDNILYAMLTLFTVTTGEGWPTVLKNSMESTNIDNGPIADYRQEMAXXXXXXXXXXXXXXXXXXXALIIITFQEQGENELIDLDLDKNQKQCIDFAINEKPLCRYMPKDKTTIKYRVWRLVVSTPFEYFIMVMIALNTLILMMKYYREEKKASSAATHDREQQAYLNYCNTLIFLNSAFTVMFSIECVLKIMAFGPKNYFRDPWNIFDFITVIGSITDVLVSE--------------LQDXXXXXXXXXXXXXXXXXXXXXXQGYTIRILLWTFIQSFKALPYVCLLIAMLFFIYSIIGMQVFGNIKLISEYQINRHNNFQTFTNGLLLLFRCATGESWQEIMLACDNNKPCEKDIENTNNFD----CGSNFTYIYFVSFIFLCSFLMLNLFVAVIMDNFDYLTRDSSILGPHHLDEYIRVWAEYDPGAIGRIHHSEMYEMLRNMEPPVGFGKKCPYRLAYRKLIRMNMPVDENGTVNFTTTLFALIRESLNIKMSTAEYMDIKDMELRQTICKMWPVQAKKKLNLIVPPDSELVFHKMTVGKIYAGYLIVENWRAYKNSQEQG----PRSSPAVSIKSVTK------PVVKEEKSANLLAK 5506
            T   ++L   + +N IR+    I+EW PFE ++LLTI ANC+ L++    P+ D       LE  E  FL IF VEA LK++A G   H  AYLRN WN++DF++VV G     L     +D +          D++ LRA RVLRPL+LV+G PSLQVVL SII+AM PLL I LLVLF I I+AIIGLE + G  H TC+  N + + + +P E+   PC+  + G G     C     CK  W+GP +GIT+FDN  +AMLTVFQCITMEGWTD++Y  NDA+G  + W+YFV LII+GSFF+LNLVLGVLSGEF+KERE+ + R  F KLR +QQ E++  GY++WI +AE++   NE     EDK R                  N S+P  E E       T+++ G        G R   R  K + + +WR    F R   R  VKS  FYW VI LVF NT+ +A EHY Q  WLT   + A    L LF  EM++KMY L ++ YF S FN FDC ++ G + E I       S  G+SVLR +RLLRIFK+TRYW SL NLV SLLNS+RSI SLL LLFLFI+IF+LLGMQLFGG+FNF+E +  ++ FD F ++LLTVFQILTGEDWN+VMY+GI + GG    G +  IYF++L + GNY LLNVFLAIAVDNLA+A+ LT+A++E+  E +R   A     E+K            ++ P V+          S+ +   S    ++ ++D     N +K P+      G ++     +   P P  +    ++ K  P+   SA FIFSP N  R  CH +VN   F   I+  I  SSI+LAAEDPV+  S +N+IL   DY FT +FT+E+ILK+   G  LH GS+CR+ +NILD  VV  +L++F              G  +  +N +K LRVLRVLRPL+ INR   LK V  CV  +++ + NI+IV  L QF+FA I VQLF+GK + C+D+SK +   C+G +  Y       P  + R W++  F FDN+L AM+ LFTV+T EGWP +L  S++S   D GPI +YR E++IF+I++ I+  FF +NIFV  +I+TFQEQGE E  + +LDKNQ+QC+++A+  +PL RY+PK++   +Y+VW +V ST FEY + V+I LNT+ L M++Y                Q+ L +   +  LN  FT +F++E +LK++AF PK YF DPWN+FDF+ VIGSI DV++SE               +++S +S+ F RLFR  RL+KLL +G  IR LLWTFI+SF+ALPYV LLI MLFFIY++IGMQVFG I L    +INR+NNFQTF   +LLLFRCATGE+WQ+IMLAC   K C  + E +N+ +    CGS+F   YF+SF  LC+FL++NLFVAVIMDNFDYLTRD SILGPHHLDE+ R+WAEYDP A GRI H ++  +LR ++PP+GFGK CP+R+A ++L+ MNMP++ +GTV F  TLFAL+R +L IK  T   ++  + ELR  I K+W   + K L+ +VPP  +    ++TVGK YA +LI E +R +K  +EQG    P    A+S+++  +      P ++   S +L A+
Sbjct:   98 TRPPRALLCLTLKNPIRRACISIVEWKPFEIIILLTIFANCVALAIYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIAYGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKADGANALGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFMGKMHKTCY--NQEGI-IDVPAEEDPSPCA-LETGHG---RQCQNGTVCKPGWDGPKHGITNFDNFAFAMLTVFQCITMEGWTDVLYWVNDAVGRDWPWIYFVTLIIIGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPENEDEGMDEDKPR------------------NMSMPTSETESV----NTENVAGGDIEGENCGARLAHRISKSKFSRYWRRWNRFCRRKCRAAVKSNVFYWLVIFLVFLNTLTIASEHYNQPHWLTEVQDTANKALLALFTAEMLLKMYSLGLQAYFVSLFNRFDCFIVCGGILETILVETKIMSPLGISVLRCVRLLRIFKITRYWNSLSNLVASLLNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDEMQTRRSTFDNFPQSLLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYILLNVFLAIAVDNLADAESLTSAQKEEEEEKERKKLARTASPEKKQE---------VMEKPAVEESKEEKIELKSITADGESPPTTKINMDDLQPSENEDKSPHSNPDTAGEEDEEEPEMPVGPRPRPLSELHLKEKAVPMPEASAFFIFSPNNRFRLQCHRIVNDTIFTNLILFFILLSSISLAAEDPVQHTSFRNHILGNADYVFTSIFTLEIILKMTAYGAFLHKGSFCRNYFNILDLLVVSVSLISF--------------GIQSSAINVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTTLLQFMFACIGVQLFKGKLYTCSDSSKQTEAECKGNYITYKDGEVDHPIIQPRSWENSKFDFDNVLAAMMALFTVSTFEGWPELLYRSIDSHTEDKGPIYNYRVEISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEQEYKNCELDKNQRQCVEYALKARPLRRYIPKNQH--QYKVWYVVNSTYFEYLMFVLILLNTICLAMQHY---------------GQSCL-FKIAMNILNMLFTGLFTVEMILKLIAFKPKGYFSDPWNVFDFLIVIGSIIDVILSETNPAEHTQCSPSMSAEENSRISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQVFGKIALNDTTEINRNNNFQTFPQAVLLLFRCATGEAWQDIMLACMPGKKCAPESEPSNSTEGETPCGSSFAVFYFISFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVSMNMPLNSDGTVMFNATLFALVRTALRIK--TEGNLEQANEELRAIIKKIWKRTSMKLLDQVVPPAGD---DEVTVGKFYATFLIQEYFRKFKKRKEQGLVGKPSQRNALSLQAGLRTLHDIGPEIRRAISGDLTAE 1676          
BLAST of Voltage dependent L type calcium channel subunit vs. Ensembl Mouse
Match: Cacna1c (calcium channel, voltage-dependent, L type, alpha 1C subunit [Source:MGI Symbol;Acc:MGI:103013])

HSP 1 Score: 1237.63 bits (3201), Expect = 0.000e+0
Identity = 763/1661 (45.94%), Postives = 1034/1661 (62.25%), Query Frame = 2
Query:  686 TSTSKSLFIFSEENVIRKYAKIIIEWGPFEYMVLLTILANCIVLSMERHLPKKDKTLLAGQLELTEKYFLGIFCVEALLKIVALGFCCHKEAYLRNVWNIMDFVVVVTGFLMMFLNIDNHSDSSTV--------DLRTLRAVRVLRPLKLVAGFPSLQVVLKSIIRAMAPLLQIGLLVLFAITIFAIIGLEFYSGAFHYTCFKANSDKLPLPIPTEKSLVPCSNSKNGSGLGAYTCPEDYQCKAYWEGPNYGITSFDNIGYAMLTVFQCITMEGWTDIMYHTNDAIGNRFNWLYFVPLIILGSFFMLNLVLGVLSGXXXXXXXXXXXXXXXLKLRRQQQTEKEFNGYMEWIQKAEEV-LLNEATTTSEDKMRIIAARRRAEKQKYKLLG-------KNQSIPDFEYEDTELYSETKSMKGNIFIRSYAGIR---RRRKERCTSFWRTEKHF-RFSVRRLVKSQPFYWAVIILVFFNTVCVAIEHYEQGKWLTLFLNYAEYVFLCLFMMEMMIKMYGLSIRVYFQSSFNIFDCVVIAGSLFEIIYGIFVQDSSFGLSVLRALRLLRIFKVTRYWAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMQLFGGEFNFEEGKPPQN-FDTFVKALLTVFQILTGEDWNTVMYNGIQSKGGVKERGTVFSIYFVLLVVFGNYTLLNVFLAIAVDNLANXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSSDNFIGRLPLSIDPPMVQVCPPSPQTANSLISKNFSFDHNQVEVNDKGCLLNTNK-PNGKLGMLGHDNTNFNSLESDPVPNKIEPETIQRK--PVLPYSAMFIFSPLNSLRRFCHFVVNLRYFDLFIMIVICASSIALAAEDPVKEKSLKNNILEFFDYAFTGVFTVEMILKIIDLGIILHPGSYCRDLWNILDATVVICALVAFIMGQKPSPTGNKLRGSSAKNLNTIKSLRVLRVLRPLKTINRVPKLKAVFDCVVSSLKNVFNILIVYILFQFIFAVIAVQLFQGKFFYCNDASKSSRETCRGYFFDYAGRST--PETKKRLWQHHDFHFDNILYAMLTLFTVTTGEGWPTVLKNSMESTNIDNGPIADYRQEMAXXXXXXXXXXXXXXXXXXXALIIITFQEQGENELIDLDLDKNQKQCIDFAINEKPLCRYMPKDKTTIKYRVWRLVVSTPFEYFIMVMIALNTLILMMKYYREEKKASSAATHDREQQAYLNYCNTLIFLNSAFTVMFSIECVLKIMAFGPKNYFRDPWNIFDFITVIGSITDVLVSE--------------LQDXXXXXXXXXXXXXXXXXXXXXXQGYTIRILLWTFIQSFKALPYVCLLIAMLFFIYSIIGMQVFGNIKLISEYQINRHNNFQTFTNGLLLLFRCATGESWQEIMLACDNNKPCEKDIENTNNFD----CGSNFTYIYFVSFIFLCSFLMLNLFVAVIMDNFDYLTRDSSILGPHHLDEYIRVWAEYDPGAIGRIHHSEMYEMLRNMEPPVGFGKKCPYRLAYRKLIRMNMPVDENGTVNFTTTLFALIRESLNIKMSTAEYMDIKDMELRQTICKMWPVQAKKKLNLIVPPDSELVFHKMTVGKIYAGYLIVENWRAYKNSQEQG----PRSSPAVSIKSVTK------PVVKEEKSANLLAK 5506
            T   ++L   + +N IR+    I+EW PFE ++LLTI ANC+ L++    P+ D       LE  E  FL IF VEA LK++A G   H  AYLRN WN++DF++VV G     L     +D +          D++ LRA RVLRPL+LV+G PSLQVVL SII+AM PLL I LLVLF I I+AIIGLE + G  H TC+  N + + + +P E+   PC+  + G G     C     CK  W+GP +GIT+FDN  +AMLTVFQCITMEGWTD++Y   DA+G    W+YFV L+I GSFF+LNLVLGVLSGEF+KERE+ + R  F KLR +QQ E++  GY++WI +AE++   NE     EDK R   A      QK             + S+P  E E       T+++ G        G R   R  K + + +WR    F R   R  VKS  FYW VI LVF NT+ +A EHY Q  WLT   + A    L LF  EM++KMY L ++ YF S FN FDC ++ G + E I       S  G+SVLR +RLLRIFK+TRYW SL NLV SLLNS+RSI SLL LLFLFI+IF+LLGMQLFGG+FNF+E +  ++ FD F ++LLTVFQILTGEDWN+VMY+GI + GG    G +  IYF++L + GNY LLNVFLAIAVDNLA+A+ LT+A++E+  E +R   A     E+K            ++ P V+          S+ +   S    ++ ++D     N +K P+      G ++     +   P P  +    ++ K  P+   SA FIFSP N  R  CH +VN   F   I+  I  SSI+LAAEDPV+  S +N+IL +FD  FT +FT+E+ LK+   G  LH GS+CR+ +NILD  VV  +L++F              G  +  +N +K LRVLRVLRPL+ INR   LK V  CV  +++ + NI+IV  L QF+FA I VQLF+GK + C+D+SK +   C+G +  Y       P  + R W++  F FDN+L AM+ LFTV+T EGWP +L  S++S   D GPI +YR E++IF+I++ I+  FF +NIFV  +I+TFQEQGE E  + +LDKNQ+QC+++A+  +PL RY+PK++   +Y+VW +V ST FEY + V+I LNT+ L M++Y                Q+ L +   +  LN  FT +F++E +LK++AF PK YF DPWN+FDF+ VIGSI DV++SE               +++S +S+ F RLFR  RL+KLL +G  IR LLWTFI+SF+ALPYV LLI MLFFIY++IGMQVFG I L    +INR+NNFQTF   +LLLFRCATGE+WQ+IMLAC   K C  + E +N+ +    CGS+F   YF+SF  LC+FL++NLFVAVIMDNFDYLTRD SILGPHHLDE+ R+WAEYDP A GRI H ++  +LR ++PP+GFGK CP+R+A ++L+ MNMP++ +GTV F  TLFAL+R +L IK  T   ++  + ELR  I K+W   + K L+ +VPP  +    ++TVGK YA +LI E +R +K  +EQG    P    A+S+++  +      P ++   S +L A+
Sbjct:  128 TRPPRALLCLTLKNPIRRACISIVEWKPFEIIILLTIFANCVALAIYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIAYGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKADGANALGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFMGKMHKTCY--NQEGI-IDVPAEEDPSPCA-LETGHG---RQCQNGTVCKPGWDGPKHGITNFDNFAFAMLTVFQCITMEGWTDVLYWMQDAMGYELPWVYFVSLVIFGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPENEDEGMDEDKPRNRGAPAGLHDQKKGKFAWFSHSTETHVSMPTSETESV----NTENVAGGDIEGENCGARLAHRISKSKFSRYWRRWNRFCRRKCRAAVKSNVFYWLVIFLVFLNTLTIASEHYNQPHWLTEVQDTANKALLALFTAEMLLKMYSLGLQAYFVSLFNRFDCFIVCGGILETILVETKIMSPLGISVLRCVRLLRIFKITRYWNSLSNLVASLLNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDEMQTRRSTFDNFPQSLLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYILLNVFLAIAVDNLADAESLTSAQKEEEEEKERKKLARTASPEKKQE---------VMEKPAVEESKEEKIELKSITADGESPPTTKINMDDLQPSENEDKSPHSNPDTAGEEDEEEPEMPVGPRPRPLSELHLKEKAVPMPEASAFFIFSPNNRFRLQCHRIVNDTIFTNLILFFILLSSISLAAEDPVQHTSFRNHILFYFDIVFTTIFTIEIALKMTAYGAFLHKGSFCRNYFNILDLLVVSVSLISF--------------GIQSSAINVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTTLLQFMFACIGVQLFKGKLYTCSDSSKQTEAECKGNYITYKDGEVDHPIIQPRSWENSKFDFDNVLAAMMALFTVSTFEGWPELLYRSIDSHTEDKGPIYNYRVEISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEQEYKNCELDKNQRQCVEYALKARPLRRYIPKNQH--QYKVWYVVNSTYFEYLMFVLILLNTICLAMQHY---------------GQSCL-FKIAMNILNMLFTGLFTVEMILKLIAFKPKGYFSDPWNVFDFLIVIGSIIDVILSETNPAEHTQCSPSMSAEENSRISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQVFGKIALNDTTEINRNNNFQTFPQAVLLLFRCATGEAWQDIMLACMPGKKCAPESEPSNSTEGETPCGSSFAVFYFISFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVSMNMPLNSDGTVMFNATLFALVRTALRIK--TEGNLEQANEELRAIIKKIWKRTSMKLLDQVVPPAGD---DEVTVGKFYATFLIQEYFRKFKKRKEQGLVGKPSQRNALSLQAGLRTLHDIGPEIRRAISGDLTAE 1731          
BLAST of Voltage dependent L type calcium channel subunit vs. Ensembl Mouse
Match: Cacna1c (calcium channel, voltage-dependent, L type, alpha 1C subunit [Source:MGI Symbol;Acc:MGI:103013])

HSP 1 Score: 1237.63 bits (3201), Expect = 0.000e+0
Identity = 762/1654 (46.07%), Postives = 1031/1654 (62.33%), Query Frame = 2
Query:  686 TSTSKSLFIFSEENVIRKYAKIIIEWGPFEYMVLLTILANCIVLSMERHLPKKDKTLLAGQLELTEKYFLGIFCVEALLKIVALGFCCHKEAYLRNVWNIMDFVVVVTGFLMMFLNIDNHSDSSTV--------DLRTLRAVRVLRPLKLVAGFPSLQVVLKSIIRAMAPLLQIGLLVLFAITIFAIIGLEFYSGAFHYTCFKANSDKLPLPIPTEKSLVPCSNSKNGSGLGAYTCPEDYQCKAYWEGPNYGITSFDNIGYAMLTVFQCITMEGWTDIMYHTNDAIGNRFNWLYFVPLIILGSFFMLNLVLGVLSGXXXXXXXXXXXXXXXLKLRRQQQTEKEFNGYMEWIQKAEEV-LLNEATTTSEDKMRIIAARRRAEKQKYKLLGKNQSIPDFEYEDTELYSETKSMKGNIFIRSYAGIR---RRRKERCTSFWRTEKHF-RFSVRRLVKSQPFYWAVIILVFFNTVCVAIEHYEQGKWLTLFLNYAEYVFLCLFMMEMMIKMYGLSIRVYFQSSFNIFDCVVIAGSLFEIIYGIFVQDSSFGLSVLRALRLLRIFKVTRYWAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMQLFGGEFNFEEGKPPQN-FDTFVKALLTVFQILTGEDWNTVMYNGIQSKGGVKERGTVFSIYFVLLVVFGNYTLLNVFLAIAVDNLANXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSSDNFIGRLPLSIDPPMVQVCPPSPQTANSLISKNFSFDHNQVEVNDKGCLLNTNK-PNGKLGMLGHDNTNFNSLESDPVPNKIEPETIQRK--PVLPYSAMFIFSPLNSLRRFCHFVVNLRYFDLFIMIVICASSIALAAEDPVKEKSLKNNILEFFDYAFTGVFTVEMILKIIDLGIILHPGSYCRDLWNILDATVVICALVAFIMGQKPSPTGNKLRGSSAKNLNTIKSLRVLRVLRPLKTINRVPKLKAVFDCVVSSLKNVFNILIVYILFQFIFAVIAVQLFQGKFFYCNDASKSSRETCRGYFFDYAGRST--PETKKRLWQHHDFHFDNILYAMLTLFTVTTGEGWPTVLKNSMESTNIDNGPIADYRQEMAXXXXXXXXXXXXXXXXXXXALIIITFQEQGENELIDLDLDKNQKQCIDFAINEKPLCRYMPKDKTTIKYRVWRLVVSTPFEYFIMVMIALNTLILMMKYYREEKKASSAATHDREQQAYLNYCNTLIFLNSAFTVMFSIECVLKIMAFGPKNYFRDPWNIFDFITVIGSITDVLVSE--------------LQDXXXXXXXXXXXXXXXXXXXXXXQGYTIRILLWTFIQSFKALPYVCLLIAMLFFIYSIIGMQVFGNIKLISEYQINRHNNFQTFTNGLLLLFRCATGESWQEIMLACDNNKPCEKDIENTNNFD----CGSNFTYIYFVSFIFLCSFLMLNLFVAVIMDNFDYLTRDSSILGPHHLDEYIRVWAEYDPGAIGRIHHSEMYEMLRNMEPPVGFGKKCPYRLAYRKLIRMNMPVDENGTVNFTTTLFALIRESLNIKMSTAEYMDIKDMELRQTICKMWPVQAKKKLNLIVPPDSELVFHKMTVGKIYAGYLIVENWRAYKNSQEQG----PRSSPAVSIKSVTK------PVVKEEKSANLLAK 5506
            T   ++L   + +N IR+    I+EW PFE ++LLTI ANC+ L++    P+ D       LE  E  FL IF VEA LK++A G   H  AYLRN WN++DF++VV G     L     +D +          D++ LRA RVLRPL+LV+G PSLQVVL SII+AM PLL I LLVLF I I+AIIGLE + G  H TC+  N + + + +P E+   PC+  + G G     C     CK  W+GP +GIT+FDN  +AMLTVFQCITMEGWTD++Y   DA+G    W+YFV L+I GSFF+LNLVLGVLSGEF+KERE+ + R  F KLR +QQ E++  GY++WI +AE++   NE     EDK R                  N S+P  E E       T+++ G        G R   R  K + + +WR    F R   R  VKS  FYW VI LVF NT+ +A EHY Q  WLT   + A    L LF  EM++KMY L ++ YF S FN FDC ++ G + E I       S  G+SVLR +RLLRIFK+TRYW SL NLV SLLNS+RSI SLL LLFLFI+IF+LLGMQLFGG+FNF+E +  ++ FD F ++LLTVFQILTGEDWN+VMY+GI + GG    G +  IYF++L + GNY LLNVFLAIAVDNLA+A+ LT+A++E+  E +R   A     E+K            ++ P V+          S+ +   S    ++ ++D     N +K P+      G ++     +   P P  +    ++ K  P+   SA FIFSP N  R  CH +VN   F   I+  I  SSI+LAAEDPV+  S +N+IL   DY FT +FT+E+ILK+   G  LH GS+CR+ +NILD  VV  +L++F              G  +  +N +K LRVLRVLRPL+ INR   LK V  CV  +++ + NI+IV  L QF+FA I VQLF+GK + C+D+SK +   C+G +  Y       P  + R W++  F FDN+L AM+ LFTV+T EGWP +L  S++S   D GPI +YR E++IF+I++ I+  FF +NIFV  +I+TFQEQGE E  + +LDKNQ+QC+++A+  +PL RY+PK++   +Y+VW +V ST FEY + V+I LNT+ L M++Y                Q+ L +   +  LN  FT +F++E +LK++AF PK YF DPWN+FDF+ VIGSI DV++SE               +++S +S+ F RLFR  RL+KLL +G  IR LLWTFI+SF+ALPYV LLI MLFFIY++IGMQVFG I L    +INR+NNFQTF   +LLLFRCATGE+WQ+IMLAC   K C  + E +N+ +    CGS+F   YF+SF  LC+FL++NLFVAVIMDNFDYLTRD SILGPHHLDE+ R+WAEYDP A GRI H ++  +LR ++PP+GFGK CP+R+A ++L+ MNMP++ +GTV F  TLFAL+R +L IK  T   ++  + ELR  I K+W   + K L+ +VPP  +    ++TVGK YA +LI E +R +K  +EQG    P    A+S+++  +      P ++   S +L A+
Sbjct:   98 TRPPRALLCLTLKNPIRRACISIVEWKPFEIIILLTIFANCVALAIYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIAYGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKADGANALGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFMGKMHKTCY--NQEGI-IDVPAEEDPSPCA-LETGHG---RQCQNGTVCKPGWDGPKHGITNFDNFAFAMLTVFQCITMEGWTDVLYWMQDAMGYELPWVYFVSLVIFGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPENEDEGMDEDKPR------------------NMSMPTSETESV----NTENVAGGDIEGENCGARLAHRISKSKFSRYWRRWNRFCRRKCRAAVKSNVFYWLVIFLVFLNTLTIASEHYNQPHWLTEVQDTANKALLALFTAEMLLKMYSLGLQAYFVSLFNRFDCFIVCGGILETILVETKIMSPLGISVLRCVRLLRIFKITRYWNSLSNLVASLLNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDEMQTRRSTFDNFPQSLLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYILLNVFLAIAVDNLADAESLTSAQKEEEEEKERKKLARTASPEKKQE---------VMEKPAVEESKEEKIELKSITADGESPPTTKINMDDLQPSENEDKSPHSNPDTAGEEDEEEPEMPVGPRPRPLSELHLKEKAVPMPEASAFFIFSPNNRFRLQCHRIVNDTIFTNLILFFILLSSISLAAEDPVQHTSFRNHILGNADYVFTSIFTLEIILKMTAYGAFLHKGSFCRNYFNILDLLVVSVSLISF--------------GIQSSAINVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTTLLQFMFACIGVQLFKGKLYTCSDSSKQTEAECKGNYITYKDGEVDHPIIQPRSWENSKFDFDNVLAAMMALFTVSTFEGWPELLYRSIDSHTEDKGPIYNYRVEISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEQEYKNCELDKNQRQCVEYALKARPLRRYIPKNQH--QYKVWYVVNSTYFEYLMFVLILLNTICLAMQHY---------------GQSCL-FKIAMNILNMLFTGLFTVEMILKLIAFKPKGYFSDPWNVFDFLIVIGSIIDVILSETNPAEHTQCSPSMSAEENSRISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQVFGKIALNDTTEINRNNNFQTFPQAVLLLFRCATGEAWQDIMLACMPGKKCAPESEPSNSTEGETPCGSSFAVFYFISFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVSMNMPLNSDGTVMFNATLFALVRTALRIK--TEGNLEQANEELRAIIKKIWKRTSMKLLDQVVPPAGD---DEVTVGKFYATFLIQEYFRKFKKRKEQGLVGKPSQRNALSLQAGLRTLHDIGPEIRRAISGDLTAE 1676          
BLAST of Voltage dependent L type calcium channel subunit vs. UniProt/SwissProt
Match: sp|C9D7C2|CAC1A_APIME (Voltage-dependent calcium channel type A subunit alpha-1 OS=Apis mellifera OX=7460 GN=CAC PE=2 SV=1)

HSP 1 Score: 1695.25 bits (4389), Expect = 0.000e+0
Identity = 995/1734 (57.38%), Postives = 1216/1734 (70.13%), Query Frame = 2
Query:  695 SKSLFIFSEENVIRKYAKIIIEWGPFEYMVLLTILANCIVLSMERHLPKKDKTLLAGQLELTEKYFLGIFCVEALLKIVALGFCCHKEAYLRNVWNIMDFVVVVTGFLMMFLNIDNHSDSSTVDLRTLRAVRVLRPLKLVAGFPSLQVVLKSIIRAMAPLLQIGLLVLFAITIFAIIGLEFYSGAFHYTCFKANSDKLPLPIPTEKSLVPC-SNSKNGSGLGAYTCPEDYQ-CKAYWEGPNYGITSFDNIGYAMLTVFQCITMEGWTDIMYHTNDAIGNRFNWLYFVPLIILGSFFMLNLVLGVLSGXXXXXXXXXXXXXXXLKLRRQQQTEKEFNGYMEWIQKAEEVLLNEATTTSEDKMRIIAARRRAEKQKYKLLGKNQSIPDFEYEDTELYSETKSMKGNIFIRSYAGIRRRRKERCTSFWRTEKHFRFSVRRLVKSQPFYWAVIILVFFNTVCVAIEHYEQGKWLTLFLNYAEYVFLCLFMMEMMIKMYGLSIRVYFQSSFNIFDCVVIAGSLFEIIYGIFVQDSSFGLSVLRALRLLRIFKVTRYWAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMQLFGGEFNFEEGKPPQNFDTFVKALLTVFQILTGEDWNTVMYNGIQSKGGVKERGTVFSIYFVLLVVFGNYTLLNVFLAIAVDNLANXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSSDNFIGRLPLSIDPPMVQVCPPSPQTANSLISKNFSFDHNQVEVNDKGCLLNTNKPNGKLGMLGHDNTNFNSLESDPVPNKIEPETIQRKPVLPYSAMFIFSPLNSLRRFCHFVVNLRYFDLFIMIVICASSIALAAEDPVKEKSLKNNILEFFDYAFTGVFTVEMILKIIDLGIILHPGSYCRDLWNILDATVVICALVAFIMGQKPSPTGNKLRGSSA-KNLNTIKSLRVLRVLRPLKTINRVPKLKAVFDCVVSSLKNVFNILIVYILFQFIFAVIAVQLFQGKFFYCNDASKSSRETCRGYFFDYA-GRSTPETKKRLWQHHDFHFDNILYAMLTLFTVTTGEGWPTVLKNSMESTNIDNGPIADYRQEMAXXXXXXXXXXXXXXXXXXXALIIITFQEQGENELIDLDLDKNQKQCIDFAINEKPLCRYMPKDKTTIKYRVWRLVVSTPFEYFIMVMIALNTLILMMKYYREEKKASSAATHDREQQAYLNYCNTLIFLNSAFTVMFSIECVLKIMAFGPKNYFRDPWNIFDFITVIGSITDVLVSELQDXXXXXXXXXXXXXXXXXXXXXXQGYTIRILLWTFIQSFKALPYVCLLIAMLFFIYSIIGMQVFGNIKLISEYQINRHNNFQTFTNGLLLLFRCATGESWQEIMLACDNNKPCEKDIENTNNFDCGSNFTYIYFVSFIFLCSFLMLNLFVAVIMDNFDYLTRDSSILGPHHLDEYIRVWAEYDPGAIGRIHHSEMYEMLRNMEPPVGFGKKCPYRLAYRKLIRMNMPVDENGTVNFTTTLFALIRESLNIKMSTAEYMDIKDMELRQTICKMWPVQAKKKLNLIVPPDSELVFHKMTVGKIYAGYLIVENWRAYKNSQEQGPRSSPAVSIKSVTKPVVKEEKSANLLAKFFVAFKSNTNKSNISLDSHHERDEERFSIDHTYGE-DYDANRRYSYLRRGSKPRGSKEIYSDLTPTQDYSYGLRPEH-------------ATIPG-MPAPRKFGNRPRSPMYSLSELETKDRANTP 5839
            + SLFI SE+N IRK+ + IIEW PFEY VLLTI+ANC+VL++E HLPK+DKT+LA +LE TE YFLGIFCVEA LKI+ALGF  H+ +YLRN+WNIMDF VVVTGF+  F    +      +DLRTLRA+RVLRPLKLV+G PSLQVVLKSII+AMAPLLQIGLLVLFAI IFAIIGLEFYSG  H TC+      + +    + S  PC +++K+ +  GA+ C  +   C  +WEGPN+GITSFDNIG+AMLTVFQCITMEGWT I+Y TNDA+G+ +NW+YF+PLI+LGSFFMLNLVLGVLSGEFAKERE+VE R++FLKLRRQQQ E E   Y+ WI KAEEV+L E  TT E+K  I+  R+RAE +K KL     +  + E  D +      S               + K  C  FW  EK FR+ +R+ VKSQ FYW VI+LVFFNTVCVA+EHY Q +WLT FL +AE+VFL LFM+EM IK+Y L  R YF SSFN FDCVVI+GS+FE+I+   V+  SFGLSVLRALRLLRIFKVT+YW SLRNLV+SLL+SMRSIISLLFLLFLFILIFALLGMQLFGG+FNF+ G PP NF+TF  ALLTVFQILTGEDWN VMY GI+S+GG K +G ++S+YF++LV+FGNYTLLNVFLAIAVDNLANAQEL+AAE E+  E ++       +  +   +      P     P V++CPP                                  NGK G    +       + D  P          KP+LPYS+MFI SP N +RR  H+VVNLRYFD FIM+VI  SSIALAAEDPV E S +N +L +FDYAFTGVFTVEMILKIIDLGIILHPGSY R+ WNI+DA VVICA V+F            + GSSA +NL+TIKSLRVLRVLRPLKTI RVPKLKAVFDCVV+SLKNV NILIVYILFQFIFAVIAVQLF GKFFYC+D SK +++ C+G +F +  G   PE KKR WQ   FH+DN++ AMLTLF V TGEGWP +L+NSM +T  D GPI ++R EM+IFYIV+FIVFPFFFVNIFVALIIITFQEQGE EL D ++DKNQK CIDF I  +PL RYMPK++ ++KY++WR+VVSTPFEYFIM +I LNT++LMMK++R+                   Y NTL ++N  FT MF++EC+LKI AFG +N+F+D WN FDFITVIGSI D LV E  ++            A  +  L  QGYTIRILLWTF+QSFKALPYVCLLIAMLFFIY+IIGMQVFGNI L ++  I +HNNFQ+F  GL+LLFRCATGE+W  IML+C   +PC+          CGSN  Y YFVSFIF CSFLMLNLFVAVIMDNFDYLTRDSSILG HHLDE++R+WAEYDP A G+IH++EMY+ML+NM+PP+GFG KCP RLAY+KLIRMNMPVD +  VNFTTTLFALIRE+LNIK+  A   +  + ELR TI  +WP+QAKK L+L++P + E+   KMTVGKIY   LI+E+WR  +  Q +     P + ++ V   VV + ++ +L +   +          +    H  R     S+ H+ G   YD +  Y +     +  G  +  S++   Q +++   P               +T P   P+P    +R R   Y  + LE + R+ +P
Sbjct:  145 TTSLFILSEDNCIRKHTRFIIEWPPFEYAVLLTIIANCVVLALEEHLPKQDKTILAQKLEATEIYFLGIFCVEASLKILALGFVLHRGSYLRNIWNIMDFFVVVTGFITAF----SQGIELDMDLRTLRAIRVLRPLKLVSGIPSLQVVLKSIIKAMAPLLQIGLLVLFAIVIFAIIGLEFYSGTLHKTCYSIRDINVIVKEGEQAS--PCNTDNKSEAPFGAHVCDANISTCMDHWEGPNFGITSFDNIGFAMLTVFQCITMEGWTAILYWTNDALGSTYNWIYFIPLIVLGSFFMLNLVLGVLSGEFAKEREKVENRQSFLKLRRQQQLEHELYCYLNWICKAEEVILAEERTTEEEKKHILEGRKRAEAKKKKLGKSKSTDTEEEEGDDDQDDGELSSS------------TKEKGPCKQFWLAEKRFRYWIRKSVKSQKFYWFVIVLVFFNTVCVAVEHYGQPQWLTDFLYFAEFVFLALFMLEMFIKVYALGPRTYFDSSFNRFDCVVISGSIFEVIWSE-VKSGSFGLSVLRALRLLRIFKVTKYWKSLRNLVISLLSSMRSIISLLFLLFLFILIFALLGMQLFGGQFNFDSGTPPTNFNTFPIALLTVFQILTGEDWNEVMYQGIESQGGHK-KGMIYSLYFIVLVLFGNYTLLNVFLAIAVDNLANAQELSAAENEEEEEDKQKQAQEIEKEIQSLQN------PKDGGAPKVEICPP----------------------------------NGKGGKQSSEEEKKQDEDDDTGP----------KPMLPYSSMFILSPTNPVRRAAHWVVNLRYFDFFIMVVISLSSIALAAEDPVWEDSPRNEVLNYFDYAFTGVFTVEMILKIIDLGIILHPGSYLREFWNIMDAVVVICAAVSFAF---------DMTGSSAGQNLSTIKSLRVLRVLRPLKTIKRVPKLKAVFDCVVNSLKNVINILIVYILFQFIFAVIAVQLFNGKFFYCSDESKYTQQDCQGQYFVFEDGALLPEPKKREWQSQFFHYDNVMAAMLTLFAVQTGEGWPQILQNSMAATYEDKGPIQNFRIEMSIFYIVYFIVFPFFFVNIFVALIIITFQEQGEAELQDGEIDKNQKSCIDFTIQARPLERYMPKERNSVKYKIWRIVVSTPFEYFIMGLIVLNTVLLMMKFHRQSDA----------------YKNTLKYMNMCFTGMFTVECILKIAAFGVRNFFKDAWNTFDFITVIGSIVDALVIEFGENFINVGFLRLFRAARLIKLLR-QGYTIRILLWTFVQSFKALPYVCLLIAMLFFIYAIIGMQVFGNIALDADTSITKHNNFQSFIQGLMLLFRCATGEAWPNIMLSCVKGRPCDAKAGKQEG-GCGSNIAYAYFVSFIFFCSFLMLNLFVAVIMDNFDYLTRDSSILGAHHLDEFVRIWAEYDPNATGKIHYTEMYDMLKNMDPPLGFGNKCPNRLAYKKLIRMNMPVDVDLKVNFTTTLFALIRENLNIKVRRASERNQANEELRDTIRSIWPLQAKKMLDLLIPRNEEIGRGKMTVGKIYVCLLILESWRTTRFGQIESA-GQPIMELQDV---VVSDSRAGSLES---LTHTGKRLHPPVQPVRHPSRSP---SLRHSPGRPGYDHHGHYYH-----EGPGFSDTVSNVVEIQRHTHHPHPSQYNHRHRMRGPWSASTSPARTPSPIHHIDRGRH--YGTTSLEQRSRSPSP 1764          
BLAST of Voltage dependent L type calcium channel subunit vs. UniProt/SwissProt
Match: sp|Q02485|CAC1S_RAT (Voltage-dependent L-type calcium channel subunit alpha-1S OS=Rattus norvegicus OX=10116 GN=Cacna1s PE=1 SV=2)

HSP 1 Score: 1238.4 bits (3203), Expect = 0.000e+0
Identity = 746/1633 (45.68%), Postives = 1026/1633 (62.83%), Query Frame = 2
Query:  641 SLAKRTINLSFPGMQTSTSKSLFIFSEENVIRKYAKIIIEWGPFEYMVLLTILANCIVLSMERHLPKKDKTLLAGQLELTEKYFLGIFCVEALLKIVALGFCCHKEAYLRNVWNIMDFVVVVTGFLMMFLNIDN---------HSDSSTVDLRTLRAVRVLRPLKLVAGFPSLQVVLKSIIRAMAPLLQIGLLVLFAITIFAIIGLEFYSGAFHYTCFKANSDKLPLPIPTEKSLVPCSNSKNGSGLGAYTCPEDYQCKAYWEGPNYGITSFDNIGYAMLTVFQCITMEGWTDIMYHTNDAIGNRFNWLYFVPLIILGSFFMLNLVLGVLSGXXXXXXXXXXXXXXXLKLRRQQQTEKEFNGYMEWIQKAEEVLLNEATTTSEDKMRIIAARRRAEKQKYKLLGKNQSIPDFEYEDTELYSETKSMKGNI-FIRSYAGIRRRRKERCTSFWRT-EKHFRFSVRRLVKSQPFYWAVIILVFFNTVCVAIEHYEQGKWLTLFLNYAEYVFLCLFMMEMMIKMYGLSIRVYFQSSFNIFDCVVIAGSLFEIIYGIFVQDSSFGLSVLRALRLLRIFKVTRYWAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMQLFGGEFNFEEGKPPQ-NFDTFVKALLTVFQILTGEDWNTVMYNGIQSKGGVKERGTVFSIYFVLLVVFGNYTLLNVFLAIAVDNLANXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSSDNFIGRLPLSIDPPMVQVCPPSPQTANSLISKNFSFDHNQVEVNDKGCLLNTNKPNGKLGMLGHDNTNFNSLESDPVPNKIEPETIQRK--PVLPYSAMFIFSPLNSLRRFCHFVVNLRYFDLFIMIVICASSIALAAEDPVKEKSLKNNILEFFDYAFTGVFTVEMILKIIDLGIILHPGSYCRDLWNILDATVVICALVAFIMGQKPSPTGNKLRGSSAKNLNTIKSLRVLRVLRPLKTINRVPKLKAVFDCVVSSLKNVFNILIVYILFQFIFAVIAVQLFQGKFFYCNDASKSSRETCRGYFFDYA-GRSTP-ETKKRLWQHHDFHFDNILYAMLTLFTVTTGEGWPTVLKNSMESTNIDNGPIADYRQEMAXXXXXXXXXXXXXXXXXXXALIIITFQEQGENELIDLDLDKNQKQCIDFAINEKPLCRYMPKDKTTIKYRVWRLVVSTPFEYFIMVMIALNTLILMMKYYREEKKASSAATHDREQQAYLNYCNTLIFLNSAFTVMFSIECVLKIMAFGPKNYFRDPWNIFDFITVIGSITDVLVSEL----------------------QDXXXXXXXXXXXXXXXXXXXXXXQGYTIRILLWTFIQSFKALPYVCLLIAMLFFIYSIIGMQVFGNIKLISEYQINRHNNFQTFTNGLLLLFRCATGESWQEIMLACDNNKPC--EKDIENTNNFDCGSNFTYIYFVSFIFLCSFLMLNLFVAVIMDNFDYLTRDSSILGPHHLDEYIRVWAEYDPGAIGRIHHSEMYEMLRNMEPPVGFGKKCPYRLAYRKLIRMNMPVDENGTVNFTTTLFALIRESLNIKMSTAEYMDIKDMELRQTICKMWPVQAKKKLNLIVPPDSELVFHKMTVGKIYAGYLIVENWRAYKNSQEQ 5419
             L K+      P +     ++LF  + +N +RK    ++EW PFE ++LLTI ANC+ L++   +P+ D   L   LE  E +FL +F +EA +KI+A GF  H++AYLR+ WN++DF++V  G     L   N          S  + +D++ LRA RVLRPL+LV+G PSLQVVL SI +AM PL  I LLVLF + I+AIIGLE + G  H TC+   +D     + T ++  P   ++ GSG          +C+  W GPN+GIT FDN G++MLTV+QCI+MEGWTD++Y  NDAIGN + W+YFV LI+LGSFF+LNLVLGVLSGEF KERE+ + R  F KLR +QQ E++  GYM WI + E   + +     E K+ +                      D    DTE   E + +   I FIR                WR   + FR+    LVKS+ FYW VI++V  NT+ +A EH+ Q  WLT   + A  V L LF +EM++KMYGL +R YF S FN FDC V+   + EI+       +  G+SVLR +RLLR+FK+T+YW SL NLV SLLNS+RSI SLL LLFLF++IFALLGMQLFGG ++FE+ +  + NFD F +AL++VFQ+LTGEDWN+VMYNGI + GG    G +  IYF++L V GNY LLNVFLAIAVDNLA A+ LT+A++ KA E +R   +  L ++ +   + + +  L   P    +    P TA   I +   F+ N  EV D         P       G D  +   + + P P  +    ++ K  P+   S+ FIFSP N +R  CH +VN  +F  FI++ I  SS ALAAEDP++  S++N ILE+FDY FT VFTVE++LK+   G  LH GS+CR+ +NILD  VV  +L++               G  +  ++ +K LRVLRVLRPL+ INR   LK V  CV  +++ + NI++V  L QF+FA I VQLF+GKF+ CND SK + E CRGY++ Y  G  T  E + R W H+DFHFDN+L AM++LFTV+T EGWP +L  +++S   D GP+ + R EMAIF+I++ I+  FF +NIFV  +I+TFQEQGE E  + +LDKNQ+QC+ +A+  +PL  Y+PK+    +Y+VW +V S+ FEY +  +I LNT+ L M++Y + ++              +N+ + +  LN AFT++F++E +LK++AF P+ YF DPWN+FDF+ VIGSI DV++SE+                       +S+ +S  F RLFR  RLIKLL +   +R LLWTFI+SF+ALPYV LLI MLFFIY++IGMQ+FG I ++   QINR+NNFQTF   +LLLFRCATGE+WQEI+LAC   K C  E D      + CG+NF Y YF+SF  LC+FL++NLFVAVIMDNFDYLTRD SILGPHHLDE+  +WAEYDP A GRI H ++  +LR ++PP+GFGK CP+R+A ++L+ MNMP++ +GTV F  TLFAL+R +L IK  T    +  + ELR  I K+W   + K L+ ++PP  +    ++TVGK YA +LI E++R +   QE+
Sbjct:   10 GLRKKQPKKPVPEILPRPPRALFCLTLQNPLRKACISVVEWKPFETIILLTIFANCVALAVYLPMPEDDNNTLNLGLEKLEYFFLIVFSIEAAMKIIAYGFLFHQDAYLRSGWNVLDFIIVFLGVFTAILEQVNIIQTNTAPMSSKGAGLDVKALRAFRVLRPLRLVSGVPSLQVVLNSIFKAMLPLFHIALLVLFMVIIYAIIGLELFKGKMHKTCYFIGTDI----VATVENEKPSPCARTGSGRPCTI--NGSECRGGWPGPNHGITHFDNFGFSMLTVYQCISMEGWTDVLYWVNDAIGNEWPWIYFVTLILLGSFFILNLVLGVLSGEFTKEREKAKSRGTFQKLREKQQLEEDLRGYMSWITQGE---VMDVDDLREGKLSL----------------------DEGGSDTESLYEIEGLNKIIQFIRH---------------WRQWNRVFRWKCHDLVKSKVFYWLVILIVALNTLSIASEHHNQPLWLTHLQDVANRVLLALFTIEMLMKMYGLGLRQYFMSIFNRFDCFVVCSGILEILLVESGAMTPLGISVLRCIRLLRLFKITKYWTSLSNLVASLLNSIRSIASLLLLLFLFMIIFALLGMQLFGGRYDFEDTEVRRSNFDNFPQALISVFQVLTGEDWNSVMYNGIMAYGGPSYPGVLVCIYFIILFVCGNYILLNVFLAIAVDNLAEAESLTSAQKAKAEERKRRKMSRGLPDKSEEERSTMTK-KLEQKPKGEGI----PTTAKLKIDE---FESNVNEVKD---------PYPSADFPGDDEEDEPEIPASPRPRPLAELQLKEKAVPIPEASSFFIFSPTNKIRVLCHRIVNATWFTNFILLFILLSSAALAAEDPIRADSMRNQILEYFDYVFTAVFTVEIVLKMTTYGAFLHKGSFCRNYFNILDLLVVAVSLISM--------------GLESSAISVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVLVTTLLQFMFACIGVQLFKGKFYSCNDLSKMTEEECRGYYYIYKDGDPTQIELRPRQWIHNDFHFDNVLSAMMSLFTVSTFEGWPQLLYKAIDSNEEDTGPVYNNRVEMAIFFIIYIILIAFFMMNIFVGFVIVTFQEQGETEYKNCELDKNQRQCVQYALKARPLRCYIPKNP--YQYQVWYVVTSSYFEYLMFALIMLNTICLGMQHYNQSEQ--------------MNHISDI--LNVAFTIIFTLEMILKLIAFKPRGYFGDPWNVFDFLIVIGSIIDVILSEIDTLLASSGGLYCLGGGCGNVDPDESARISSAFFRLFRVMRLIKLLSRAEGVRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQMFGKIAMVDGTQINRNNNFQTFPQAVLLLFRCATGEAWQEILLACSYGKRCDPESDYAPGEEYACGTNFAYYYFISFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKAIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKFCPHRVACKRLVGMNMPLNSDGTVTFNATLFALVRTALKIK--TEGNFEQANEELRAIIKKIWKRTSMKLLDQVIPPIGD---DEVTVGKFYATFLIQEHFRKFMKRQEE 1542          
BLAST of Voltage dependent L type calcium channel subunit vs. UniProt/SwissProt
Match: sp|Q01815|CAC1C_MOUSE (Voltage-dependent L-type calcium channel subunit alpha-1C OS=Mus musculus OX=10090 GN=Cacna1c PE=1 SV=1)

HSP 1 Score: 1237.63 bits (3201), Expect = 0.000e+0
Identity = 762/1654 (46.07%), Postives = 1031/1654 (62.33%), Query Frame = 2
Query:  686 TSTSKSLFIFSEENVIRKYAKIIIEWGPFEYMVLLTILANCIVLSMERHLPKKDKTLLAGQLELTEKYFLGIFCVEALLKIVALGFCCHKEAYLRNVWNIMDFVVVVTGFLMMFLNIDNHSDSSTV--------DLRTLRAVRVLRPLKLVAGFPSLQVVLKSIIRAMAPLLQIGLLVLFAITIFAIIGLEFYSGAFHYTCFKANSDKLPLPIPTEKSLVPCSNSKNGSGLGAYTCPEDYQCKAYWEGPNYGITSFDNIGYAMLTVFQCITMEGWTDIMYHTNDAIGNRFNWLYFVPLIILGSFFMLNLVLGVLSGXXXXXXXXXXXXXXXLKLRRQQQTEKEFNGYMEWIQKAEEV-LLNEATTTSEDKMRIIAARRRAEKQKYKLLGKNQSIPDFEYEDTELYSETKSMKGNIFIRSYAGIR---RRRKERCTSFWRTEKHF-RFSVRRLVKSQPFYWAVIILVFFNTVCVAIEHYEQGKWLTLFLNYAEYVFLCLFMMEMMIKMYGLSIRVYFQSSFNIFDCVVIAGSLFEIIYGIFVQDSSFGLSVLRALRLLRIFKVTRYWAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMQLFGGEFNFEEGKPPQN-FDTFVKALLTVFQILTGEDWNTVMYNGIQSKGGVKERGTVFSIYFVLLVVFGNYTLLNVFLAIAVDNLANXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSSDNFIGRLPLSIDPPMVQVCPPSPQTANSLISKNFSFDHNQVEVNDKGCLLNTNK-PNGKLGMLGHDNTNFNSLESDPVPNKIEPETIQRK--PVLPYSAMFIFSPLNSLRRFCHFVVNLRYFDLFIMIVICASSIALAAEDPVKEKSLKNNILEFFDYAFTGVFTVEMILKIIDLGIILHPGSYCRDLWNILDATVVICALVAFIMGQKPSPTGNKLRGSSAKNLNTIKSLRVLRVLRPLKTINRVPKLKAVFDCVVSSLKNVFNILIVYILFQFIFAVIAVQLFQGKFFYCNDASKSSRETCRGYFFDYAGRST--PETKKRLWQHHDFHFDNILYAMLTLFTVTTGEGWPTVLKNSMESTNIDNGPIADYRQEMAXXXXXXXXXXXXXXXXXXXALIIITFQEQGENELIDLDLDKNQKQCIDFAINEKPLCRYMPKDKTTIKYRVWRLVVSTPFEYFIMVMIALNTLILMMKYYREEKKASSAATHDREQQAYLNYCNTLIFLNSAFTVMFSIECVLKIMAFGPKNYFRDPWNIFDFITVIGSITDVLVSE--------------LQDXXXXXXXXXXXXXXXXXXXXXXQGYTIRILLWTFIQSFKALPYVCLLIAMLFFIYSIIGMQVFGNIKLISEYQINRHNNFQTFTNGLLLLFRCATGESWQEIMLACDNNKPCEKDIENTNNFD----CGSNFTYIYFVSFIFLCSFLMLNLFVAVIMDNFDYLTRDSSILGPHHLDEYIRVWAEYDPGAIGRIHHSEMYEMLRNMEPPVGFGKKCPYRLAYRKLIRMNMPVDENGTVNFTTTLFALIRESLNIKMSTAEYMDIKDMELRQTICKMWPVQAKKKLNLIVPPDSELVFHKMTVGKIYAGYLIVENWRAYKNSQEQG----PRSSPAVSIKSVTK------PVVKEEKSANLLAK 5506
            T   ++L   + +N IR+    I+EW PFE ++LLTI ANC+ L++    P+ D       LE  E  FL IF VEA LK++A G   H  AYLRN WN++DF++VV G     L     +D +          D++ LRA RVLRPL+LV+G PSLQVVL SII+AM PLL I LLVLF I I+AIIGLE + G  H TC+  N + + + +P E+   PC+  + G G     C     CK  W+GP +GIT+FDN  +AMLTVFQCITMEGWTD++Y   DA+G    W+YFV L+I GSFF+LNLVLGVLSGEF+KERE+ + R  F KLR +QQ E++  GY++WI +AE++   NE     EDK R                  N S+P  E E       T+++ G        G R   R  K + + +WR    F R   R  VKS  FYW VI LVF NT+ +A EHY Q  WLT   + A    L LF  EM++KMY L ++ YF S FN FDC ++ G + E I       S  G+SVLR +RLLRIFK+TRYW SL NLV SLLNS+RSI SLL LLFLFI+IF+LLGMQLFGG+FNF+E +  ++ FD F ++LLTVFQILTGEDWN+VMY+GI + GG    G +  IYF++L + GNY LLNVFLAIAVDNLA+A+ LT+A++E+  E +R   A     E+K            ++ P V+          S+ +   S    ++ ++D     N +K P+      G ++     +   P P  +    ++ K  P+   SA FIFSP N  R  CH +VN   F   I+  I  SSI+LAAEDPV+  S +N+IL   DY FT +FT+E+ILK+   G  LH GS+CR+ +NILD  VV  +L++F              G  +  +N +K LRVLRVLRPL+ INR   LK V  CV  +++ + NI+IV  L QF+FA I VQLF+GK + C+D+SK +   C+G +  Y       P  + R W++  F FDN+L AM+ LFTV+T EGWP +L  S++S   D GPI +YR E++IF+I++ I+  FF +NIFV  +I+TFQEQGE E  + +LDKNQ+QC+++A+  +PL RY+PK++   +Y+VW +V ST FEY + V+I LNT+ L M++Y                Q+ L +   +  LN  FT +F++E +LK++AF PK YF DPWN+FDF+ VIGSI DV++SE               +++S +S+ F RLFR  RL+KLL +G  IR LLWTFI+SF+ALPYV LLI MLFFIY++IGMQVFG I L    +INR+NNFQTF   +LLLFRCATGE+WQ+IMLAC   K C  + E +N+ +    CGS+F   YF+SF  LC+FL++NLFVAVIMDNFDYLTRD SILGPHHLDE+ R+WAEYDP A GRI H ++  +LR ++PP+GFGK CP+R+A ++L+ MNMP++ +GTV F  TLFAL+R +L IK  T   ++  + ELR  I K+W   + K L+ +VPP  +    ++TVGK YA +LI E +R +K  +EQG    P    A+S+++  +      P ++   S +L A+
Sbjct:   98 TRPPRALLCLTLKNPIRRACISIVEWKPFEIIILLTIFANCVALAIYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIAYGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKADGANALGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFMGKMHKTCY--NQEGI-IDVPAEEDPSPCA-LETGHG---RQCQNGTVCKPGWDGPKHGITNFDNFAFAMLTVFQCITMEGWTDVLYWMQDAMGYELPWVYFVSLVIFGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPENEDEGMDEDKPR------------------NMSMPTSETESV----NTENVAGGDIEGENCGARLAHRISKSKFSRYWRRWNRFCRRKCRAAVKSNVFYWLVIFLVFLNTLTIASEHYNQPHWLTEVQDTANKALLALFTAEMLLKMYSLGLQAYFVSLFNRFDCFIVCGGILETILVETKIMSPLGISVLRCVRLLRIFKITRYWNSLSNLVASLLNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDEMQTRRSTFDNFPQSLLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYILLNVFLAIAVDNLADAESLTSAQKEEEEEKERKKLARTASPEKKQE---------VMEKPAVEESKEEKIELKSITADGESPPTTKINMDDLQPSENEDKSPHSNPDTAGEEDEEEPEMPVGPRPRPLSELHLKEKAVPMPEASAFFIFSPNNRFRLQCHRIVNDTIFTNLILFFILLSSISLAAEDPVQHTSFRNHILGNADYVFTSIFTLEIILKMTAYGAFLHKGSFCRNYFNILDLLVVSVSLISF--------------GIQSSAINVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTTLLQFMFACIGVQLFKGKLYTCSDSSKQTEAECKGNYITYKDGEVDHPIIQPRSWENSKFDFDNVLAAMMALFTVSTFEGWPELLYRSIDSHTEDKGPIYNYRVEISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEQEYKNCELDKNQRQCVEYALKARPLRRYIPKNQH--QYKVWYVVNSTYFEYLMFVLILLNTICLAMQHY---------------GQSCL-FKIAMNILNMLFTGLFTVEMILKLIAFKPKGYFSDPWNVFDFLIVIGSIIDVILSETNPAEHTQCSPSMSAEENSRISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQVFGKIALNDTTEINRNNNFQTFPQAVLLLFRCATGEAWQDIMLACMPGKKCAPESEPSNSTEGETPCGSSFAVFYFISFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVSMNMPLNSDGTVMFNATLFALVRTALRIK--TEGNLEQANEELRAIIKKIWKRTSMKLLDQVVPPAGD---DEVTVGKFYATFLIQEYFRKFKKRKEQGLVGKPSQRNALSLQAGLRTLHDIGPEIRRAISGDLTAE 1676          
BLAST of Voltage dependent L type calcium channel subunit vs. UniProt/SwissProt
Match: sp|P07293|CAC1S_RABIT (Voltage-dependent L-type calcium channel subunit alpha-1S OS=Oryctolagus cuniculus OX=9986 GN=CACNA1S PE=1 SV=1)

HSP 1 Score: 1235.71 bits (3196), Expect = 0.000e+0
Identity = 749/1632 (45.89%), Postives = 1025/1632 (62.81%), Query Frame = 2
Query:  641 SLAKRTINLSFPGMQTSTSKSLFIFSEENVIRKYAKIIIEWGPFEYMVLLTILANCIVLSMERHLPKKDKTLLAGQLELTEKYFLGIFCVEALLKIVALGFCCHKEAYLRNVWNIMDFVVVVTGFLMMFLNIDNHSDSST---------VDLRTLRAVRVLRPLKLVAGFPSLQVVLKSIIRAMAPLLQIGLLVLFAITIFAIIGLEFYSGAFHYTCFKANSDKLPLPIPTEKSLVPCSNSKNGSGLGAYTCPEDYQCKAYWEGPNYGITSFDNIGYAMLTVFQCITMEGWTDIMYHTNDAIGNRFNWLYFVPLIILGSFFMLNLVLGVLSGXXXXXXXXXXXXXXXLKLRRQQQTEKEFNGYMEWIQKAEEVLLNEATTTSEDKMRIIAARRRAEKQKYKLLGKNQSIPDFEYEDTELYSETKSMKGNIFIRSYAGIRRRRKERCTSFWRT-EKHFRFSVRRLVKSQPFYWAVIILVFFNTVCVAIEHYEQGKWLTLFLNYAEYVFLCLFMMEMMIKMYGLSIRVYFQSSFNIFDCVVIAGSLFEIIYGIFVQDSSFGLSVLRALRLLRIFKVTRYWAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMQLFGGEFNFEEGKPPQ-NFDTFVKALLTVFQILTGEDWNTVMYNGIQSKGGVKERGTVFSIYFVLLVVFGNYTLLNVFLAIAVDNLANXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSSDNFIGRLPLSIDPPMVQVCPPSPQTANSLISKNFSFDHNQVEVNDKGCLLNTNKPNGKLGMLGHDNTNFNSLESDPVPNKIEPETIQRK--PVLPYSAMFIFSPLNSLRRFCHFVVNLRYFDLFIMIVICASSIALAAEDPVKEKSLKNNILEFFDYAFTGVFTVEMILKIIDLGIILHPGSYCRDLWNILDATVVICALVAFIMGQKPSPTGNKLRGSSAKNLNTIKSLRVLRVLRPLKTINRVPKLKAVFDCVVSSLKNVFNILIVYILFQFIFAVIAVQLFQGKFFYCNDASKSSRETCRGYFFDYA-GRSTP-ETKKRLWQHHDFHFDNILYAMLTLFTVTTGEGWPTVLKNSMESTNIDNGPIADYRQEMAXXXXXXXXXXXXXXXXXXXALIIITFQEQGENELIDLDLDKNQKQCIDFAINEKPLCRYMPKDKTTIKYRVWRLVVSTPFEYFIMVMIALNTLILMMKYYREEKKASSAATHDREQQAYLNYCNTLIFLNSAFTVMFSIECVLKIMAFGPKNYFRDPWNIFDFITVIGSITDVLVSEL----------------------QDXXXXXXXXXXXXXXXXXXXXXXQGYTIRILLWTFIQSFKALPYVCLLIAMLFFIYSIIGMQVFGNIKLISEYQINRHNNFQTFTNGLLLLFRCATGESWQEIMLACDNNKPC--EKDIENTNNFDCGSNFTYIYFVSFIFLCSFLMLNLFVAVIMDNFDYLTRDSSILGPHHLDEYIRVWAEYDPGAIGRIHHSEMYEMLRNMEPPVGFGKKCPYRLAYRKLIRMNMPVDENGTVNFTTTLFALIRESLNIKMSTAEYMDIKDMELRQTICKMWPVQAKKKLNLIVPPDSELVFHKMTVGKIYAGYLIVENWRAYKNSQEQ 5419
             L K+      P +     ++LF  + +N +RK    I+EW PFE ++LLTI ANC+ L++   +P+ D   L   LE  E +FL +F +EA +KI+A GF  H++AYLR+ WN++DF++V  G     L   N   S+T         +D++ LRA RVLRPL+LV+G PSLQVVL SI +AM PL  I LLVLF + I+AIIGLE + G  H TC+   +D     + T ++  P   ++ GSG          +C+  W GPN+GIT FDN G++MLTV+QCITMEGWTD++Y  NDAIGN + W+YFV LI+LGSFF+LNLVLGVLSGEF KERE+ + R  F KLR +QQ E++  GYM WI + E   + +     E K+ +       E   Y++ G N+ I                     FIR                WR   + FR+    LVKS+ FYW VI++V  NT+ +A EH+ Q  WLT   + A  V L LF +EM++KMYGL +R YF S FN FDC V+   + E++       +  G+SVLR +RLLR+FK+T+YW SL NLV SLLNS+RSI SLL LLFLFI+IFALLGMQLFGG ++FE+ +  + NFD F +AL++VFQ+LTGEDWN+VMYNGI + GG    G +  IYF++L V GNY LLNVFLAIAVDNLA A+ LT+A++ KA E +R   +  L ++ +   + + +  L   P    +    P TA   + +   F+ N  EV D         P       G D  +   +   P P  +    ++ K  P+   S+ FIFSP N +R  CH +VN  +F  FI++ I  SS ALAAEDP++ +S++N IL +FD AFT VFTVE++LK+   G  LH GS+CR+ +NILD  VV  +L++               G  +  ++ +K LRVLRVLRPL+ INR   LK V  CV  +++ + NI++V  L QF+FA I VQLF+GKFF CND SK + E CRGY++ Y  G  T  E + R W H+DFHFDN+L AM++LFTV+T EGWP +L  +++S   D GP+ + R EMAIF+I++ I+  FF +NIFV  +I+TFQEQGE E  + +LDKNQ+QC+ +A+  +PL  Y+PK+    +Y+VW +V S+ FEY +  +I LNT+ L M++Y           H  E+   +N+ + +  LN AFT++F++E +LK++AF  + YF DPWN+FDF+ VIGSI DV++SE+                       +S+ +S  F RLFR  RLIKLL +   +R LLWTFI+SF+ALPYV LLI MLFFIY++IGMQ+FG I L+   QINR+NNFQTF   +LLLFRCATGE+WQEI+LAC   K C  E D      + CG+NF Y YF+SF  LC+FL++NLFVAVIMDNFDYLTRD SILGPHHLDE+  +WAEYDP A GRI H ++  +LR ++PP+GFGK CP+R+A ++L+ MNMP++ +GTV F  TLFAL+R +L IK  T    +  + ELR  I K+W   + K L+ ++PP  +    ++TVGK YA +LI E++R +   QE+
Sbjct:   10 GLRKKQPKKPLPEVLPRPPRALFCLTLQNPLRKACISIVEWKPFETIILLTIFANCVALAVYLPMPEDDNNSLNLGLEKLEYFFLTVFSIEAAMKIIAYGFLFHQDAYLRSGWNVLDFIIVFLGVFTAILEQVNVIQSNTAPMSSKGAGLDVKALRAFRVLRPLRLVSGVPSLQVVLNSIFKAMLPLFHIALLVLFMVIIYAIIGLELFKGKMHKTCYYIGTDI----VATVENEKPSPCARTGSGRPCTI--NGSECRGGWPGPNHGITHFDNFGFSMLTVYQCITMEGWTDVLYWVNDAIGNEWPWIYFVTLILLGSFFILNLVLGVLSGEFTKEREKAKSRGTFQKLREKQQLEEDLRGYMSWITQGE---VMDVEDLREGKLSLEEGGSDTESL-YEIEGLNKIIQ--------------------FIRH---------------WRQWNRVFRWKCHDLVKSRVFYWLVILIVALNTLSIASEHHNQPLWLTHLQDIANRVLLSLFTIEMLLKMYGLGLRQYFMSIFNRFDCFVVCSGILELLLVESGAMTPLGISVLRCIRLLRLFKITKYWTSLSNLVASLLNSIRSIASLLLLLFLFIIIFALLGMQLFGGRYDFEDTEVRRSNFDNFPQALISVFQVLTGEDWNSVMYNGIMAYGGPSYPGVLVCIYFIILFVCGNYILLNVFLAIAVDNLAEAESLTSAQKAKAEERKRRKMSRGLPDKTEEEKSVMAK-KLEQKPKGEGI----PTTAKLKVDE---FESNVNEVKD---------PYPSADFPGDDEEDEPEIPVSPRPRPLAELQLKEKAVPIPEASSFFIFSPTNKVRVLCHRIVNATWFTNFILLFILLSSAALAAEDPIRAESVRNQILGYFDIAFTSVFTVEIVLKMTTYGAFLHKGSFCRNYFNILDLLVVAVSLISM--------------GLESSTISVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVLVTTLLQFMFACIGVQLFKGKFFSCNDLSKMTEEECRGYYYVYKDGDPTQMELRPRQWIHNDFHFDNVLSAMMSLFTVSTFEGWPQLLYRAIDSNEEDMGPVYNNRVEMAIFFIIYIILIAFFMMNIFVGFVIVTFQEQGETEYKNCELDKNQRQCVQYALKARPLRCYIPKNP--YQYQVWYVVTSSYFEYLMFALIMLNTICLGMQHY-----------HQSEE---MNHISDI--LNVAFTIIFTLEMILKLLAFKARGYFGDPWNVFDFLIVIGSIIDVILSEIDTFLASSGGLYCLGGGCGNVDPDESARISSAFFRLFRVMRLIKLLSRAEGVRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQMFGKIALVDGTQINRNNNFQTFPQAVLLLFRCATGEAWQEILLACSYGKLCDPESDYAPGEEYTCGTNFAYYYFISFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKAIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKFCPHRVACKRLVGMNMPLNSDGTVTFNATLFALVRTALKIK--TEGNFEQANEELRAIIKKIWKRTSMKLLDQVIPPIGD---DEVTVGKFYATFLIQEHFRKFMKRQEE 1542          
BLAST of Voltage dependent L type calcium channel subunit vs. UniProt/SwissProt
Match: sp|Q02789|CAC1S_MOUSE (Voltage-dependent L-type calcium channel subunit alpha-1S OS=Mus musculus OX=10090 GN=Cacna1s PE=1 SV=2)

HSP 1 Score: 1232.62 bits (3188), Expect = 0.000e+0
Identity = 748/1634 (45.78%), Postives = 1022/1634 (62.55%), Query Frame = 2
Query:  638 RSLAKRTINLSFPGMQTSTSKSLFIFSEENVIRKYAKIIIEWGPFEYMVLLTILANCIVLSMERHLPKKDKTLLAGQLELTEKYFLGIFCVEALLKIVALGFCCHKEAYLRNVWNIMDFVVVVTGFLMMFLNIDN---------HSDSSTVDLRTLRAVRVLRPLKLVAGFPSLQVVLKSIIRAMAPLLQIGLLVLFAITIFAIIGLEFYSGAFHYTCFKANSDKLPLPIPTEKSLVPCSNSKNGSGLGAYTCPEDYQCKAYWEGPNYGITSFDNIGYAMLTVFQCITMEGWTDIMYHTNDAIGNRFNWLYFVPLIILGSFFMLNLVLGVLSGXXXXXXXXXXXXXXXLKLRRQQQTEKEFNGYMEWIQKAEEVLLNEATTTSEDKMRIIAARRRAEKQKYKLLGKNQSIPDFEYEDTELYSETKSMKGNI-FIRSYAGIRRRRKERCTSFWRT-EKHFRFSVRRLVKSQPFYWAVIILVFFNTVCVAIEHYEQGKWLTLFLNYAEYVFLCLFMMEMMIKMYGLSIRVYFQSSFNIFDCVVIAGSLFEIIYGIFVQDSSFGLSVLRALRLLRIFKVTRYWAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMQLFGGEFNFEEGKPPQ-NFDTFVKALLTVFQILTGEDWNTVMYNGIQSKGGVKERGTVFSIYFVLLVVFGNYTLLNVFLAIAVDNLANXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSSDNFIGRLPLSIDPPMVQVCPPSPQTANSLISKNFSFDHNQVEVNDKGCLLNTNKPNGKLGMLGHDNTNFNSLESDPVPNKIEPETIQRK--PVLPYSAMFIFSPLNSLRRFCHFVVNLRYFDLFIMIVICASSIALAAEDPVKEKSLKNNILEFFDYAFTGVFTVEMILKIIDLGIILHPGSYCRDLWNILDATVVICALVAFIMGQKPSPTGNKLRGSSAKNLNTIKSLRVLRVLRPLKTINRVPKLKAVFDCVVSSLKNVFNILIVYILFQFIFAVIAVQLFQGKFFYCNDASKSSRETCRGYFFDYA-GRSTP-ETKKRLWQHHDFHFDNILYAMLTLFTVTTGEGWPTVLKNSMESTNIDNGPIADYRQEMAXXXXXXXXXXXXXXXXXXXALIIITFQEQGENELIDLDLDKNQKQCIDFAINEKPLCRYMPKDKTTIKYRVWRLVVSTPFEYFIMVMIALNTLILMMKYYREEKKASSAATHDREQQAYLNYCNTLIFLNSAFTVMFSIECVLKIMAFGPKNYFRDPWNIFDFITVIGSITDVLVSEL----------------------QDXXXXXXXXXXXXXXXXXXXXXXQGYTIRILLWTFIQSFKALPYVCLLIAMLFFIYSIIGMQVFGNIKLISEYQINRHNNFQTFTNGLLLLFRCATGESWQEIMLACDNNKPC--EKDIENTNNFDCGSNFTYIYFVSFIFLCSFLMLNLFVAVIMDNFDYLTRDSSILGPHHLDEYIRVWAEYDPGAIGRIHHSEMYEMLRNMEPPVGFGKKCPYRLAYRKLIRMNMPVDENGTVNFTTTLFALIRESLNIKMSTAEYMDIKDMELRQTICKMWPVQAKKKLNLIVPPDSELVFHKMTVGKIYAGYLIVENWRAYKNSQEQ 5419
              L K+      P +     ++LF  + +N +RK    I+EW PFE ++LLTI ANC+ L++   +P+ D   L   LE  E +FL +F +EA +KI+A GF  H++AYLR+ WN++DF++V  G   + L   N          S  + +D++ LRA RVLRPL+LV+G PSLQVVL SI +AM PL  I LLVLF + I+AIIGLE + G  H TC+   +D     + T ++  P   ++ GSG          +C+  W GPN+GIT FDN G++MLTV+QCI+MEGWTD++Y  NDAIGN + W+YFV LI+LGSFF+LNLVLGVLSGEF KERE+ + R  F KLR +QQ E++  GYM WI + E   + +     E K+ +                      D    DTE   E + +   I FIR                WR   + FR+    LVKS+ FYW VI++V  NT+ +A EH+ Q  WLT   + A  V L LF +EM++KMYGL +R YF S FN FDC V+   + EI+       S  G+SVLR +RLLR+FK+T+YW SL NLV SLLNS+RSI SLL LLFLFI+IFALLGMQLFGG ++FE+ +  + NFD F +AL++VFQ+LTGEDWN+VMYNGI + GG    G +  IYF++L V GNY LLNVFLAIAVDNLA A+ LT+A++ KA E +R   +  L ++ +       R  ++            P TA   I +   F+ N  EV D         P       G D  +   +   P P  +    ++ K  P+   S+ FIFSP N +R  CH +VN  +F  FI++ I  SS ALAAEDP++  S++N ILE+FDY FT VFTVE++LK+   G  LH GS+CR+ +NILD  VV  +L++               G  +  ++ +K LRVLRVLRPL+ INR   LK V  CV  +++ + NI++V  L QF+FA I VQLF+GKF+ CND SK + E CRGY++ Y  G  T  E + R W H+DFHFDN+L AM++LFTV+T EGWP +L  +++S   D GP+ + R EMAIF+I++ I+  FF +NIFV  +I+TFQEQGE E  + +LDKNQ+QC+ +A+  +PL  Y+PK+    +Y+VW +V S+ FEY +  +I LNT+ L M++Y + ++              +N+ + +  LN AFT++F++E VLK++AF P+ YF DPWN+FDF+ VIGSI DV++SE+                       +S+ +S  F RLFR  RL+KLL +   +R LLWTFI+SF+ALPYV LLI MLFFIY++IGMQ+FG I ++   QINR+NNFQTF   +LLLFRCATGE+WQEI+LAC   K C  E D        CG+NF Y YF+SF  LC+FL++NLFVAVIMDNFDYLTRD SILGPHHLDE+  +WAEYDP A GRI H ++  +LR ++PP+GFGK CP+R+A ++L+ MNMP++ +GTV F  TLFAL+R +L IK  T    +  + ELR  I K+W   + K L+ ++PP  +    ++TVGK YA +LI E++R +   QE+
Sbjct:    9 EGLRKKQPKKPVPEILPRPPRALFCLTLQNPLRKACISIVEWKPFETIILLTIFANCVALAVYLPMPEDDNNTLNLGLEKLEYFFLIVFSIEAAMKIIAYGFLFHQDAYLRSGWNVLDFIIVFLGVFTVILEQVNIIQTNTAPMSSKGAGLDVKALRAFRVLRPLRLVSGVPSLQVVLNSIFKAMLPLFHIALLVLFMVIIYAIIGLELFKGKMHKTCYFIGTDI----VATVENEKPSPCARTGSGRPCTI--NGSECRGGWPGPNHGITHFDNFGFSMLTVYQCISMEGWTDVLYWVNDAIGNEWPWIYFVTLILLGSFFILNLVLGVLSGEFTKEREKAKSRGTFQKLREKQQLEEDLRGYMSWITQGE---VMDVDDLREGKLSL----------------------DEGGSDTESLYEIEGLNKIIQFIRH---------------WRQWNRVFRWKCHDLVKSKVFYWLVILIVALNTLSIASEHHNQPLWLTHLQDVANRVLLTLFTIEMLMKMYGLGLRQYFMSIFNRFDCFVVCSGILEILLVESGAMSPLGISVLRCIRLLRLFKITKYWTSLSNLVASLLNSIRSIASLLLLLFLFIIIFALLGMQLFGGRYDFEDTEVRRSNFDNFPQALISVFQVLTGEDWNSVMYNGIMAYGGPTYPGVLVCIYFIILFVCGNYILLNVFLAIAVDNLAEAESLTSAQKAKAEERKRRKMSKGLPDKSEEE-----RATVTKKLEQKSKGEGIPTTAKLKIDE---FESNVNEVKD---------PYPSADFPGDDEEDEPEIPVSPRPRPLAELQLKEKAVPIPEASSFFIFSPTNKIRVLCHRIVNATWFTNFILLFILLSSAALAAEDPIRADSMRNQILEYFDYVFTAVFTVEIVLKMTTYGAFLHKGSFCRNYFNILDLLVVAVSLISM--------------GLESSAISVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVLVTTLLQFMFACIGVQLFKGKFYSCNDLSKMTEEECRGYYYIYKDGDPTQIELRPRQWIHNDFHFDNVLSAMMSLFTVSTFEGWPQLLYKAIDSNEEDTGPVYNNRVEMAIFFIIYIILIAFFMMNIFVGFVIVTFQEQGETEYKNCELDKNQRQCVQYALKARPLRCYIPKNP--YQYQVWYVVTSSYFEYLMFALIMLNTICLGMQHYNQSEQ--------------MNHISDI--LNVAFTIIFTLEMVLKLIAFKPRAYFGDPWNVFDFLIVIGSIIDVILSEIDTFLASSGGLYCLGGGCGNVDPDESARISSAFFRLFRVMRLVKLLNRAEGVRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQMFGKIAMVDGTQINRNNNFQTFPQAVLLLFRCATGEAWQEILLACSYGKLCDPESDYAPGEEHTCGTNFAYYYFISFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKAIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKFCPHRVACKRLVGMNMPLNSDGTVTFNATLFALVRTALKIK--TEGNFEQANEELRAIIKKIWKRTSMKLLDQVIPPIGD---DEVTVGKFYATFLIQEHFRKFMKRQEE 1542          
BLAST of Voltage dependent L type calcium channel subunit vs. TrEMBL
Match: A0A4Z2CWT3 (Voltage-dependent calcium channel type A subunit alpha-1 OS=Schistosoma japonicum OX=6182 GN=EWB00_006874 PE=3 SV=1)

HSP 1 Score: 2102.02 bits (5445), Expect = 0.000e+0
Identity = 1166/1676 (69.57%), Postives = 1340/1676 (79.95%), Query Frame = 2
Query:  623 KTTSMRSLAKRTINLSFPGMQTSTSKSLFIFSEENVIRKYAKIIIEWGPFEYMVLLTILANCIVLSMERHLPKKDKTLLAGQLELTEKYFLGIFCVEALLKIVALGFCCHKEAYLRNVWNIMDFVVVVTGFLMMFLNIDNHSDSSTVDLRTLRAVRVLRPLKLVAGFPSLQVVLKSIIRAMAPLLQIGLLVLFAITIFAIIGLEFYSGAFHYTCFKA-NSDKLPLPIPTEKSLVPCSNSKNGSGL-------GAYTCPEDYQCKAYWEGPNYGITSFDNIGYAMLTVFQCITMEGWTDIMYHTNDAIGNRFNWLYFVPLIILGSFFMLNLVLGVLSGXXXXXXXXXXXXXXXLKLRRQQQTEKEFNGYMEWIQKAEEVLLNEATTTSEDKMRIIAARRRAEKQKYKLLGKNQSIPDFEYEDTELYSETKSMKGNIFIRSYAGIRRRRKERCTSFWRTEKHFRFSVRRLVKSQPFYWAVIILVFFNTVCVAIEHYEQGKWLTLFLNYAEYVFLCLFMMEMMIKMYGLSIRVYFQSSFNIFDCVVIAGSLFEIIYGIFVQDSSFGLSVLRALRLLRIFKVTRYWAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMQLFGGEFNFEEGKPPQNFDTFVKALLTVFQILTGEDWNTVMYNGIQSKGGVKERGTVFSIYFVLLVVFGNYTLLNVFLAIAVDNLANXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSSDNFIGRLPLSIDPPMVQVCPPSPQTANSLISKNFSFDHNQVEVNDKGCLLNTNKPNGKLGMLG--HDNTNFN--------SLESDPVPNKIEPETIQRKPVLPYSAMFIFSPLNSLRRFCHFVVNLRYFDLFIMIVICASSIALAAEDPVKEKSLKNNILEFFDYAFTGVFTVEMILKIIDLGIILHPGSYCRDLWNILDATVVICALVAFIMGQKPSPTGNKLRGSSAKNLNTIKSLRVLRVLRPLKTINRVPKLKAVFDCVVSSLKNVFNILIVYILFQFIFAVIAVQLFQGKFFYCNDASKSSRETCRGYFFDYAGRSTPETKKRLWQHHDFHFDNILYAMLTLFTVTTGEGWPTVLKNSMESTNIDNGPIADYRQEMAXXXXXXXXXXXXXXXXXXXALIIITFQEQGENELIDLDLDKNQKQCIDFAINEKPLCRYMPKDKTTIKYRVWRLVVSTPFEYFIMVMIALNTLILMMKYYREEKKASSAATHDREQQAYLNYCNTLIFLNSAFTVMFSIECVLKIMAFGPKNYFRDPWNIFDFITVIGSITDVLVSELQDXXXXXXXXXXXXXXXXXXXXXXQGYTIRILLWTFIQSFKALPYVCLLIAMLFFIYSIIGMQVFGNIKLISEYQINRHNNFQTFTNGLLLLFRCATGESWQEIMLACDNNKPCEKDIENTNNFDCGSNFTYIYFVSFIFLCSFLMLNLFVAVIMDNFDYLTRDSSILGPHHLDEYIRVWAEYDPGAIGRIHHSEMYEMLRNMEPPVGFGKKCPYRLAYRKLIRMNMPVDENGTVNFTTTLFALIRESLNIKMSTAEYMDIKDMELRQTICKMWPVQAKKKLNLIVPPDSELVFHKMTVGKIYAGYLIVENWRAYKNSQEQGPRSSPAVSIKSVTKPVVKEEKSANLLAKFFVAFKSNTNKSNISLDSHHERDEERFSID 5596
            K  +MR+LA+RT+ +  PG+  S+ K+LFIFSEEN IRKY+KIIIEWGPFEYMVL TILANCIVL+ME HLP  DKT L+ +LE TE YFL IFCVEALLKIVALGF  H+ AYLRN+WNIMDF+VVVTG L   L          ++   +RA+RVLRPLKLV GF SLQ+VLKSIIRAMAPLLQI LLVLFAI IFAIIGLEFYSG FH TCF   N D LPL +P   SL PCS S NGS         GA+ CP +Y CK YWEGPNYGITSFDNIGYAMLTVFQCITMEGWT+IMY TNDA G+RFN+LYFVPLIILGSFFMLNLVLGVLSGEFAKERERVEKRRAFLKLRRQQQTEKEFNGYM+WIQKAEEV+L E TTT++++MRII+ARRRA KQ+ K  GK+ S  D  +ED+EL++E+KS        SY  + +RRKERC   WR EK  R+++RR+VKSQPFYW VIILVF NTVC AIEH+ Q  WL+ FL YAE+VFL LF+ EM++K+YGL++R+YF+SSFNIFDCVVI GSLFEII+G F  D+SFG+SVLRALRLLRIFKVTRYWASLRNLVLSLLNSMRSI+SLLFLLFLFILIFALLGMQLFGG+FNF+EG+P QNFDTFVKALLTVFQILTGEDWNT+MYNGI+++GGV   G ++S+YFV+++VFGNYTLLNVFLAIAVDNLANAQELT AEEE+A   +    A          D        S +         + QT  +LI      ++N+  V+D    +  N         G   DN  FN        SLESD          IQ KPVLPYS+MFIF+P N++RRFCHFVVNLRYFDLFIMIVICASSIALAAEDP+ E+S +N ILE FDYAFTGVFT+E+ILK+IDLG++LHPGSY RD WNILDA VV  ALVAF++ +  +  G     +SAKNLNTIKSLRVLRVLRPLKTINRVPKLKAVFDCV+SSLKNVFNILIVY LFQFIFAVIAVQLFQGKFFYCND SK +R+ C+G F DY  R  P  + R W+  DF++DN+++A+LTLFTVTTGEGWP VLKNS++ST  D GP  D+RQEMAIFY+VFFIVFPFFFVNIFVALIIITFQ QGENELI++DLDKNQK+CIDFAIN +PLCRYMPKD+ ++KYRVWRLVVSTPFEY+IMVMIA+NTLILMMKY+R+E+K+   A+ D EQQAY NYCNTL++ NSAFTVMFS+EC+LKIMAFGPKNYFRD WNIFDFITVIGSITDVLVSELQ+S+FLSLGFLRLFRAARLIKLLRQGY+IRI+LWTFIQS KALPYVCLLI MLFFIY I+GMQVFGNIK     Q+N HNNFQTF +G+LLLFRCATGE+WQEIML C   K CE   E+     CGS++TY+YF +F FLCSF+MLNLFVAVIMDNFDYLTRDSSILGPHHLDE++RVWAEYDPGA G IHH ++YEMLRNMEPPVGFGK CPYRLAYRKLIRMNMPVDE G V+FTTTL ALIRESL IK    E MD +DMELR+TICK+WPV  KK L+L+VPPDSEL++HKMTVGKIYA YLI+ENWRA +    +G  S                 KSA++LA+FF A K NT+  NI+     E ++E+ S+D
Sbjct:  166 KDETMRNLARRTLAIGIPGLHPSSHKTLFIFSEENAIRKYSKIIIEWGPFEYMVLSTILANCIVLAMEMHLPSNDKTTLSEKLEQTETYFLIIFCVEALLKIVALGFAFHRNAYLRNIWNIMDFIVVVTGLLAYIL--------PNLNQPAVRALRVLRPLKLVTGFESLQIVLKSIIRAMAPLLQISLLVLFAIIIFAIIGLEFYSGGFHMTCFDLYNPDYLPLSLPNRPSLAPCSLS-NGSATSTGSVPHGAFVCPTNYVCKGYWEGPNYGITSFDNIGYAMLTVFQCITMEGWTEIMYSTNDAFGDRFNYLYFVPLIILGSFFMLNLVLGVLSGEFAKERERVEKRRAFLKLRRQQQTEKEFNGYMDWIQKAEEVILAEDTTTADERMRIISARRRAAKQRLKQTGKDPSFNDSNFEDSELFAESKSHS------SYGDLLKRRKERCQGCWRREKRIRYAIRRMVKSQPFYWVVIILVFLNTVCGAIEHHGQPVWLSTFLYYAEFVFLGLFITEMLLKVYGLNVRIYFESSFNIFDCVVIIGSLFEIIWGFFHPDTSFGISVLRALRLLRIFKVTRYWASLRNLVLSLLNSMRSILSLLFLLFLFILIFALLGMQLFGGDFNFDEGRPTQNFDTFVKALLTVFQILTGEDWNTIMYNGIRAQGGVTGGGAIYSVYFVVVMVFGNYTLLNVFLAIAVDNLANAQELTEAEEEQAKLQEEIHLAEESAEMRSLVD------AKSNNNNNNNGNIKNIQTTGNLID-----NYNKSNVHDAANTIQENLNENNQNRTGVKRDNFMFNHMSNLNFTSLESDDTAKLQGSSQIQGKPVLPYSSMFIFAPTNAIRRFCHFVVNLRYFDLFIMIVICASSIALAAEDPISEQSKRNTILEHFDYAFTGVFTIELILKVIDLGVVLHPGSYFRDTWNILDAIVVFFALVAFVV-RSATSLGRIGTSTSAKNLNTIKSLRVLRVLRPLKTINRVPKLKAVFDCVISSLKNVFNILIVYWLFQFIFAVIAVQLFQGKFFYCNDVSKVTRDDCQGQFIDYNERGDPFLQNRTWRTRDFNYDNVIHAILTLFTVTTGEGWPAVLKNSIDSTVADRGPTPDFRQEMAIFYVVFFIVFPFFFVNIFVALIIITFQNQGENELIEMDLDKNQKRCIDFAINARPLCRYMPKDRRSMKYRVWRLVVSTPFEYYIMVMIAINTLILMMKYHRQEQKSYFTASVDIEQQAYHNYCNTLLYFNSAFTVMFSVECMLKIMAFGPKNYFRDRWNIFDFITVIGSITDVLVSELQESAFLSLGFLRLFRAARLIKLLRQGYSIRIILWTFIQSIKALPYVCLLITMLFFIYCIVGMQVFGNIKTDPHSQLNNHNNFQTFGDGILLLFRCATGENWQEIMLDCAAGKECEGSGES-----CGSSYTYLYFSTFNFLCSFIMLNLFVAVIMDNFDYLTRDSSILGPHHLDEFVRVWAEYDPGAKGLIHHRDVYEMLRNMEPPVGFGKNCPYRLAYRKLIRMNMPVDETGCVHFTTTLLALIRESLGIKTGPTEIMDQRDMELRETICKLWPVHGKKMLHLLVPPDSELLYHKMTVGKIYASYLIIENWRATRAFHGKGGTS-----------------KSASILARFFGAVKQNTHHPNIN----SETEDEKGSLD 1788          
BLAST of Voltage dependent L type calcium channel subunit vs. TrEMBL
Match: A0A4E0RL13 (Voltage dependent L type calcium channel subunit OS=Fasciola hepatica OX=6192 GN=D915_000024 PE=3 SV=1)

HSP 1 Score: 2100.48 bits (5441), Expect = 0.000e+0
Identity = 1146/1666 (68.79%), Postives = 1333/1666 (80.01%), Query Frame = 2
Query:  605 SIDDGSKTTSMRSLAKRTINLSFPGMQTSTSKSLFIFSEENVIRKYAKIIIEWGPFEYMVLLTILANCIVLSMERHLPKKDKTLLAGQLELTEKYFLGIFCVEALLKIVALGFCCHKEAYLRNVWNIMDFVVVVTGFLMMFLNIDNHSDSSTVDLRTLRAVRVLRPLKLVAGFPSLQVVLKSIIRAMAPLLQIGLLVLFAITIFAIIGLEFYSGAFHYTCFKANS-DKLPLPIPTEKSLVPCS----NSKNGSGL--GAYTCPEDYQCKAYWEGPNYGITSFDNIGYAMLTVFQCITMEGWTDIMYHTNDAIGNRFNWLYFVPLIILGSFFMLNLVLGVLSGXXXXXXXXXXXXXXXLKLRRQQQTEKEFNGYMEWIQKAEEVLLNEATTTSEDKMRIIAARRRAEKQKYKLLGKNQSIPDFEYEDTELYSETKSMKGNIFIRSYAGIRRRRKERCTSFWRTEKHFRFSVRRLVKSQPFYWAVIILVFFNTVCVAIEHYEQGKWLTLFLNYAEYVFLCLFMMEMMIKMYGLSIRVYFQSSFNIFDCVVIAGSLFEIIYGIFVQDSSFGLSVLRALRLLRIFKVTRYWAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMQLFGGEFNFEEGKPPQNFDTFVKALLTVFQILTGEDWNTVMYNGIQSKGGVKERGTVFSIYFVLLVVFGNYTLLNVFLAIAVDNLANXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSSDNFIGRL--PLSIDPPMVQVCPPSPQTANSLISKNFSFDHNQVEVNDKGCLLNTNK-PNGKLGMLGHDNTNFNSLESDPVPN-KIEPETIQRKPVLPYSAMFIFSPLNSLRRFCHFVVNLRYFDLFIMIVICASSIALAAEDPVKEKSLKNNILEFFDYAFTGVFTVEMILKIIDLGIILHPGSYCRDLWNILDATVVICALVAFIMGQKPSPTGNKLRGSSAKNLNTIKSLRVLRVLRPLKTINRVPKLKAVFDCVVSSLKNVFNILIVYILFQFIFAVIAVQLFQGKFFYCNDASKSSRETCRGYFFDYAGRSTPETKKRLWQHHDFHFDNILYAMLTLFTVTTGEGWPTVLKNSMESTNIDNGPIADYRQEMAXXXXXXXXXXXXXXXXXXXALIIITFQEQGENELIDLDLDKNQKQCIDFAINEKPLCRYMPKDKTTIKYRVWRLVVSTPFEYFIMVMIALNTLILMMKYYREEKKASSAATHDREQQAYLNYCNTLIFLNSAFTVMFSIECVLKIMAFGPKNYFRDPWNIFDFITVIGSITDVLVSELQDXXXXXXXXXXXXXXXXXXXXXXQGYTIRILLWTFIQSFKALPYVCLLIAMLFFIYSIIGMQVFGNIKLISEYQINRHNNFQTFTNGLLLLFRCATGESWQEIMLACDNNKPCEKDIENTNNFDCGSNFTYIYFVSFIFLCSFLMLNLFVAVIMDNFDYLTRDSSILGPHHLDEYIRVWAEYDPGAIGRIHHSEMYEMLRNMEPPVGFGKKCPYRLAYRKLIRMNMPVDENGTVNFTTTLFALIRESLNIKMSTAEYMDIKDMELRQTICKMWPVQAKKKLNLIVPPDSELVFHKMTVGKIYAGYLIVENWRAYKNSQEQGPRSSPAVSIKSVTKPVVKEEKSANLLAKFFVAFKSNTNKSNISLDSHHE 5569
            S +D S+  SMR LAKRT+++  PG+Q ++ K+LF+FSEEN IRKY+KIIIEWGPFEYMVLLTILANCIVL+ME HLP  DKT L+  LE TE YFL IFCVEA LKIVALGF  H+ AYLRN+WNI+DF+VVVTG L   L          ++   +RA+RVLRPLKLV GF SLQ+VLKSIIRAMAPLLQI LLVLFAITIFAIIGLEFYSG FH TCF   S D LP  +P   +L PCS     S N  G+  GA+ CP+DY CK YWEGPNYGITSFDNIGYAMLTVFQCITMEGWT+IMY TNDA G+RFN+LYFVPLIILGSFFMLNLVLGVLSGEFAKERERVEKRRAFLKLRRQQQTEKEFNGYM+WIQ+AEEV+L E TTT+E+++RII+ARRRAEKQ+ K  GK     D   +D E + E+K   G +F  SY  + R+RKERC   WRTEK  R+++RR+VKSQPFYW VI+LVFFNTVC AIEH+ Q  WL+ FL YAE+ FL LF++EM++KMYGL IR+YF+SSFNIFDC VI   +FEII+G    D+SFG+SVLRA+RLLRIFK+TRYWASLRNLVLSLLNSMRSIISLLFLLFLFILIFALLGMQLFGG+FNF+EG+P QNFD+FVKALLTVFQILTGEDWN+VMYNGI+++GGV   G ++S+YFVL+++FGNYTLLNVFLAIAVDNLANAQELT AEE+ A   ++AA+ A         +  +  +  P    P        S  + N + +   + D  Q        L N N  P GK+ +      NFNS+ESD           +Q KPVLPYS+MFIF+P N++RRFCHFVVNLRYFDLFIMIVICASSIALAAEDPV E + +N ILE FDYAFTGVFTVE++LK+IDLG++LHPGSY RD WNILDA VV  ALVAF++ +  +  G     +SAKNLNTIKSLRVLRVLRPLKTINRVPKLKAVFDCVVSSLKNV +I IVY LFQFIFAVIAVQLFQGKFFYCND SK +RE C+GYFF++  R  P  + R W   DF++DN++ AMLTLFTVT+GEGWP VLK+S++ST +D GP  D+RQEMAI+Y+VFFIVFPFFFVNIFVALIIITFQ+QGENELI+L++DKNQK+CIDFAIN +PLCRYMPKD+ ++KYRVWRLVVSTPFEY+IMVMIA+NTLILMMKY+R+E+K+    + D +QQAY +YCNTL++ NSAFTVMFSIEC+LKIMAFGPKNYFRD WNIFDFITVIGSITDVLVSELQ+S+FLSLGFLRLFRAARLIKLLRQGY+IRI+ WTFIQS KALPYVCLLIAMLFFIY IIGMQVFGNI+     Q+N HNNF++F++GLLLLFRCATGE+WQEIML C   + CE   +      CGS FTY YF++F FLCSFLMLNLFVAVIMDNFDYLTRDSSILGPHHLDE++RVWAEYDP A G IHH EMYEMLRNMEPPVGFGK CP RLAYRKL+RMNMPVDENG V+FTTTLFALIRESL IK    E+MD +D ELR+TICKMWPV+ +K L++++PPDSELV+HKMTVGKIYA +LI+ENWR  +  Q +G  +                 KSA++LA+FF A K N +KS    D   E
Sbjct:   98 SPNDTSRENSMRILAKRTLHIDLPGLQPASQKALFLFSEENAIRKYSKIIIEWGPFEYMVLLTILANCIVLAMEEHLPSHDKTTLSETLEQTETYFLIIFCVEASLKIVALGFLFHRGAYLRNIWNIVDFIVVVTGLLAYIL--------PNLNQPAVRALRVLRPLKLVTGFESLQIVLKSIIRAMAPLLQISLLVLFAITIFAIIGLEFYSGGFHMTCFSVYSPDTLPTSLPNRPNLAPCSLPNGTSTNSGGIPQGAFVCPQDYICKGYWEGPNYGITSFDNIGYAMLTVFQCITMEGWTEIMYSTNDAFGDRFNYLYFVPLIILGSFFMLNLVLGVLSGEFAKERERVEKRRAFLKLRRQQQTEKEFNGYMDWIQRAEEVILAEDTTTAEERLRIISARRRAEKQRLKQHGKESGQTDMAPDDVEFFEESK---GYLFGHSYTDLVRKRKERCQGCWRTEKRIRYAIRRMVKSQPFYWFVIMLVFFNTVCGAIEHHGQPPWLSSFLYYAEFFFLGLFIIEMLLKMYGLKIRIYFESSFNIFDCAVIVVGIFEIIWGFVHPDASFGISVLRAVRLLRIFKITRYWASLRNLVLSLLNSMRSIISLLFLLFLFILIFALLGMQLFGGDFNFDEGRPTQNFDSFVKALLTVFQILTGEDWNSVMYNGIRAQGGVTSGGAIYSVYFVLVMLFGNYTLLNVFLAIAVDNLANAQELTEAEEKLAKCREQAAEEALAAETNTGENGEVNEVSQPRCTLPQNSNSQTHSNTSQNRICTSPLAEDEKQTNGQLDMSLANQNGLPMGKMPLNHVGMMNFNSMESDDTARLHGSGVQVQGKPVLPYSSMFIFAPTNAIRRFCHFVVNLRYFDLFIMIVICASSIALAAEDPVSENARRNTILEHFDYAFTGVFTVELVLKVIDLGVVLHPGSYFRDAWNILDAIVVFFALVAFVV-RSATSLGRIGSNTSAKNLNTIKSLRVLRVLRPLKTINRVPKLKAVFDCVVSSLKNVSSIFIVYWLFQFIFAVIAVQLFQGKFFYCNDVSKMTREECQGYFFEFNDRGEPFVQNRTWNMWDFNYDNVVNAMLTLFTVTSGEGWPAVLKHSIDSTMVDRGPATDFRQEMAIYYVVFFIVFPFFFVNIFVALIIITFQKQGENELIELEIDKNQKRCIDFAINARPLCRYMPKDRQSLKYRVWRLVVSTPFEYYIMVMIAINTLILMMKYHRQEQKSFMTVSVDTDQQAYHSYCNTLLYFNSAFTVMFSIECMLKIMAFGPKNYFRDRWNIFDFITVIGSITDVLVSELQESAFLSLGFLRLFRAARLIKLLRQGYSIRIIFWTFIQSIKALPYVCLLIAMLFFIYCIIGMQVFGNIRTDPLSQLNNHNNFKSFSDGLLLLFRCATGENWQEIMLDCTAGRECESAGDT-----CGSTFTYPYFITFYFLCSFLMLNLFVAVIMDNFDYLTRDSSILGPHHLDEFVRVWAEYDPEAKGLIHHKEMYEMLRNMEPPVGFGKNCPCRLAYRKLVRMNMPVDENGCVHFTTTLFALIRESLGIKTGPTEFMDQRDNELRETICKMWPVRGRKMLHILIPPDSELVYHKMTVGKIYASFLIIENWRTTRAFQGKGGTA-----------------KSASILARFFGAVKKNVHKSTPGSDEEEE 1729          
BLAST of Voltage dependent L type calcium channel subunit vs. TrEMBL
Match: A0A0X3PSD7 (Ca_chan_IQ domain-containing protein OS=Schistocephalus solidus OX=70667 GN=TR117297 PE=3 SV=1)

HSP 1 Score: 2053.48 bits (5319), Expect = 0.000e+0
Identity = 1161/1706 (68.05%), Postives = 1328/1706 (77.84%), Query Frame = 2
Query:  689 STSKSLFIFSEENVIRKYAKIIIEWGPFEYMVLLTILANCIVLSMERHLPKKDKTLLAGQLELTEKYFLGIFCVEALLKIVALGFCCHKEAYLRNVWNIMDFVVVVTGFLMMFLNIDNHSDSSTVDLRTLRAVRVLRPLKLVAGFPSLQVVLKSIIRAMAPLLQIGLLVLFAITIFAIIGLEFYSGAFHYTCF-KANSDKLPLPIPTEKSLVPCSNSKNGS--------GLGAYTCPEDYQCKAYWEGPNYGITSFDNIGYAMLTVFQCITMEGWTDIMYHTNDAIGNRFNWLYFVPLIILGSFFMLNLVLGVLSGXXXXXXXXXXXXXXXLKLRRQQQTEKEFNGYMEWIQKAEEVLLNEATTTSEDKMRIIAARRRAEKQKYKLLGKNQSIPDFEYEDTELYSETKSMKGNIFIRSYAGIRRRRKERCTSFWRTEKHFRFSVRRLVKSQPFYWAVIILVFFNTVCVAIEHYEQGKWLTLFLNYAEYVFLCLFMMEMMIKMYGLSIRVYFQSSFNIFDCVVIAGSLFEIIYGIFVQDSSFGLSVLRALRLLRIFKVTRYWAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMQLFGGEFNFEEGKPPQNFDTFVKALLTVFQILTGEDWNTVMYNGIQSKGGVKERGTVFSIYFVLLVVFGNYTLLNVFLAIAVDNLANXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSSDNFIGRLPLSIDPPMVQVCP-PSPQTANSLISKNFSFDHNQVEVNDKGCLLNTNKPNGKL-GMLGHDN--------TNFNSLESDPVPNKIEPETI-QRKPVLPYSAMFIFSPLNSLRRFCHFVVNLRYFDLFIMIVICASSIALAAEDPVKEKSLKNNILEFFDYAFTGVFTVEMILKIIDLGIILHPGSYCRDLWNILDATVVICALVAFIMGQKPSPTGNKLRGSSAKNLNTIKSLRVLRVLRPLKTINRVPKLKAVFDCVVSSLKNVFNILIVYILFQFIFAVIAVQLFQGKFFYCNDASKSSRETCRGYFFDYAGRSTPETKKRLWQHHDFHFDNILYAMLTLFTVTTGEGWPTVLKNSMESTNIDNGPIADYRQEMAXXXXXXXXXXXXXXXXXXXALIIITFQEQGENELIDLDLDKNQKQCIDFAINEKPLCRYMPKDKTTIKYRVWRLVVSTPFEYFIMVMIALNTLILMMKYYREEKKASSAATHDREQQAYLNYCNTLIFLNSAFTVMFSIECVLKIMAFGPKNYFRDPWNIFDFITVIGSITDVLVSELQDXXXXXXXXXXXXXXXXXXXXXXQGYTIRILLWTFIQSFKALPYVCLLIAMLFFIYSIIGMQVFGNIKLISEYQINRHNNFQTFTNGLLLLFRCATGESWQEIMLACDNNKPCEKDIENTNNFDCGSNFTYIYFVSFIFLCSFLMLNLFVAVIMDNFDYLTRDSSILGPHHLDEYIRVWAEYDPGAIGRIHHSEMYEMLRNMEPPVGFGKKCPYRLAYRKLIRMNMPVDENGTVNFTTTLFALIRESLNIKMSTAEYMDIKDMELRQTICKMWPVQAKKKLNLIVPPDSELVFHKMTVGKIYAGYLIVENWRAYKNSQEQGPRSSPAVSIKSVTKPVVKEEKSANLLAKFFVAFKSNTNKSNISLDSHHE-----------------RDEERFSIDHTYGEDYDANRRYSYL--RRGSKPRGSKEIYSD 5689
            + +K LFIFSEEN+IRK A+III+WGPFEYMVLLTI ANCIVL+MERH P  DK+ L   LE +EKYFLGIFCVEALLKI ALGF  ++ AYLR++WNI+DF+VVVTG L   L          ++   LRA+RVLRPLKLV GF SLQ+VLKSIIRAMAPLLQIGLL+LFAITIFAIIGLEFYSG FH TCF + N + LP  IP  +SLVPC N  NGS          GA+ CP  Y CK YWEGPNYGITSFDNIGYAMLTVFQCITMEGWTDIMY T+DAIG+RFN LYFVPLI+LGSFFMLNL+LGVLSGEFAKE+ERVEKRRAFLKLRRQQQTEKEF+GYM+WIQ AEEV+L E TT++ED++RII+ARRRA+K++     K Q++PD   +DTELYS+T+   GN+F   Y  + R  K R  S +R EK  R+++RR+ KSQP YW VIILVF NT+CVAIEH  Q  WLT FL YAEYVFL LFM EM++KMYGL  R+YFQSSFNIFDCVVI GSLFEII+     D+SFG+SVLRALRLLRIFK+TRYWA LRNLVLSLLNSMRSI+SLLFLLFLFILIFALLGMQLFGGEFNF EG PPQNFDTF+KALLTVFQILTGEDWN++MYNGI+S+GG    GT++ IYFVLLV+FGNYTLLNVFLAIAVDNLANAQ+L+ AE E+  E +   +         + D  +    + I     ++ P    + A +L +   +  H+   V D G    T + N KL G     N          F S+ESD   +  + ET  Q KPVLPYS+MFIF+P N +RRFCHFVVNLRYFDLFIMIVICASSIALA EDPV E S +N ILE FDYAFTGVFTVEM+LKIIDLG++ HPG+YCRD WNILDA VV+CALVAF M +     G     +SAKNLNTIKSLRVLRVLRPLKTINRVPKLKAVFDCVVSSL+NVFNILIV+ LFQFIFAVIAVQL QGKFFYCNDASK S+E C+G FF+Y  +  P    R W    F++DN+ YAMLTLFTVTTGEGWPTVLKNSM++T ++ GPI DYRQEMAIFY+ FFIVFPFFFVNIFVALIIITFQ+QGENEL +L+LDKNQK+C+DFAIN  PLCRYMPKD+ + KYRVWRLVVSTPFEY+IMVMIALNTLILMMKY+R+E+K S A T D  QQ Y NYCNTLIFLNSAFTVMFS ECVLKIMAFGPKNYFRD WNIFDFITVIGSITDVLVSELQ S+FLSLGFLRLFRAARLIKLLRQGYTIRILLWTFIQS KALPYVCLLIAMLFFIY IIGMQVFGNIK     Q+N HNNFQTF +GLLLLFRCATGE+WQE+ML CD  + CE   E+     CGS  TY+YFV+FIFLCSFLMLNLFVAVIMDNFDYLTRDSSILGPHHLDEY+RVWAEYDP A G++HH++MYEMLRNMEPPVGFGKKCPYRLAYRKLIRMNMPVDENG V+FTTTLFALIRESL IK+   E MD +D ELR  +C++WPVQAK+ LN++VPPDSEL ++KMTVGKIYAG L++EN R  K  Q Q    SP     S      + EKSA+LLA+FF      +++S  + ++  +                 R EE         +    NR+ + L  +RG KP+ +   + D
Sbjct:   74 TGNKLLFIFSEENIIRKCARIIIDWGPFEYMVLLTITANCIVLAMERHFPMNDKSRLTETLEQSEKYFLGIFCVEALLKITALGFVLNEGAYLRSIWNILDFIVVVTGLLAYIL--------PNLNQPALRALRVLRPLKLVTGFESLQIVLKSIIRAMAPLLQIGLLLLFAITIFAIIGLEFYSGGFHMTCFDERNPEVLPESIPNSRSLVPC-NVGNGSTTKASSTAAQGAFRCPPGYICKGYWEGPNYGITSFDNIGYAMLTVFQCITMEGWTDIMYTTDDAIGDRFNALYFVPLIVLGSFFMLNLILGVLSGEFAKEKERVEKRRAFLKLRRQQQTEKEFSGYMDWIQHAEEVILAEDTTSAEDRLRIISARRRAQKERRSRAAKGQAVPDLNMDDTELYSDTR---GNVF-NQYGFLLRPGKSRFESCFRYEKRVRYAIRRMAKSQPSYWCVIILVFLNTICVAIEHTGQPAWLTSFLYYAEYVFLGLFMTEMLLKMYGLGFRLYFQSSFNIFDCVVIIGSLFEIIWAYIHPDTSFGISVLRALRLLRIFKITRYWADLRNLVLSLLNSMRSILSLLFLLFLFILIFALLGMQLFGGEFNFIEGLPPQNFDTFIKALLTVFQILTGEDWNSIMYNGIRSQGGATSGGTIYCIYFVLLVLFGNYTLLNVFLAIAVDNLANAQDLSEAETEELKEGKEKKEDECSG----TEDAILAANQILIGTTKPRILPWVKDKDALNLPTDVNNILHDPRNVKDTG--EPTQQGNAKLNGKCITKNPFTTTGFGQQFVSVESDDTGHVTKTETKRQGKPVLPYSSMFIFAPNNGIRRFCHFVVNLRYFDLFIMIVICASSIALATEDPVAENSTRNKILEHFDYAFTGVFTVEMVLKIIDLGVVFHPGAYCRDPWNILDAIVVLCALVAFTMNRNAVRLGKPGTSASAKNLNTIKSLRVLRVLRPLKTINRVPKLKAVFDCVVSSLRNVFNILIVFCLFQFIFAVIAVQLLQGKFFYCNDASKLSKEECQGQFFEYNEQGVPTVVWRQWNSQGFNYDNVYYAMLTLFTVTTGEGWPTVLKNSMDATYVNQGPIEDYRQEMAIFYVTFFIVFPFFFVNIFVALIIITFQKQGENELFNLELDKNQKRCVDFAINAHPLCRYMPKDRRSWKYRVWRLVVSTPFEYYIMVMIALNTLILMMKYHRQERKTSMATTIDTAQQNYHNYCNTLIFLNSAFTVMFSFECVLKIMAFGPKNYFRDRWNIFDFITVIGSITDVLVSELQQSAFLSLGFLRLFRAARLIKLLRQGYTIRILLWTFIQSVKALPYVCLLIAMLFFIYCIIGMQVFGNIKNDPMTQMNIHNNFQTFASGLLLLFRCATGENWQEVMLDCDAGRECEGAGES-----CGSKMTYLYFVTFIFLCSFLMLNLFVAVIMDNFDYLTRDSSILGPHHLDEYVRVWAEYDPTARGKVHHTDMYEMLRNMEPPVGFGKKCPYRLAYRKLIRMNMPVDENGMVHFTTTLFALIRESLGIKIGPTEVMDQRDNELRYCLCRLWPVQAKRMLNILVPPDSELTYYKMTVGKIYAGLLMLENHRLEK--QPQCKDQSPDRRKLSSADTSPQSEKSADLLARFFGGVVHASHRSPRTSETEDDLNNVPRWRSPLKVISPSRQEEFGKFTKMAADKASDNRKLNDLLMKRGQKPKETANPHPD 1753          
BLAST of Voltage dependent L type calcium channel subunit vs. TrEMBL
Match: A0A5K3F6C1 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 2049.25 bits (5308), Expect = 0.000e+0
Identity = 1147/1746 (65.69%), Postives = 1331/1746 (76.23%), Query Frame = 2
Query:  686 TSTSKSLFIFSEENVIRKYAKIIIEWGPFEYMVLLTILANCIVLSMERHLPKKDKTLLAGQLELTEKYFLGIFCVEALLKIVALGFCCHKEAYLRNVWNIMDFVVVVTGFLMMFLNIDNHSDSSTVDLRTLRAVRVLRPLKLVAGFPSLQVVLKSIIRAMAPLLQIGLLVLFAITIFAIIGLEFYSGAFHYTCF-KANSDKLPLPIPTEKSLVPC-----SNSKN--GSGLGAYTCPEDYQCKAYWEGPNYGITSFDNIGYAMLTVFQCITMEGWTDIMYHTNDAIGNRFNWLYFVPLIILGSFFMLNLVLGVLSGXXXXXXXXXXXXXXXLKLRRQQQTEKEFNGYMEWIQKAEEVLLNEATTTSEDKMRIIAARRRAEKQKYKLLGKNQSIPDFEYEDTELYSETKSMKGNIFIRSYAGIRRRRKERCTSFWRTEKHFRFSVRRLVKSQPFYWAVIILVFFNTVCVAIEHYEQGKWLTLFLNYAEYVFLCLFMMEMMIKMYGLSIRVYFQSSFNIFDCVVIAGSLFEIIYGIFVQDSSFGLSVLRALRLLRIFKVTRYWAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMQLFGGEFNFEEGKPPQNFDTFVKALLTVFQILTGEDWNTVMYNGIQSKGGVKERGTVFSIYFVLLVVFGNYTLLNVFLAIAVDNLANXXXXXXXXXXXXXXXXXXXXXXXX---XXXXXSSDNFIGRLPLSIDPPMVQVCPPSPQTANSLISKNFSFDHNQVEVNDKGCLLNTNKPNGKLGMLGHDN------TNFNSLESDPVPNKIEPETIQR-KPVLPYSAMFIFSPLNSLRRFCHFVVNLRYFDLFIMIVICASSIALAAEDPVKEKSLKNNILEFFDYAFTGVFTVEMILKIIDLGIILHPGSYCRDLWNILDATVVICALVAFIMGQKPSPTGNKLRGSSAKNLNTIKSLRVLRVLRPLKTINRVPKLKAVFDCVVSSLKNVFNILIVYILFQFIFAVIAVQLFQGKFFYCNDASKSSRETCRGYFFDYAGRSTPETKKRLWQHHDFHFDNILYAMLTLFTVTTGEGWPTVLKNSMESTNIDNGPIADYRQEMAXXXXXXXXXXXXXXXXXXXALIIITFQEQGENELIDLDLDKNQKQCIDFAINEKPLCRYMPKDKTTIKYRVWRLVVSTPFEYFIMVMIALNTLILMMKYYREEKKASSAATHDREQQAYLNYCNTLIFLNSAFTVMFSIECVLKIMAFGPKNYFRDPWNIFDFITVIGSITDVLVSELQDXXXXXXXXXXXXXXXXXXXXXXQGYTIRILLWTFIQSFKALPYVCLLIAMLFFIYSIIGMQVFGNIKLISEYQINRHNNFQTFTNGLLLLFRCATGESWQEIMLACDNNKPCEKDIENTNNFDCGSNFTYIYFVSFIFLCSFLMLNLFVAVIMDNFDYLTRDSSILGPHHLDEYIRVWAEYDPGAIGRIHHSEMYEMLRNMEPPVGFGKKCPYRLAYRKLIRMNMPVDENGTVNFTTTLFALIRESLNIKMSTAEYMDIKDMELRQTICKMWPVQAKKKLNLIVPPDSELVFHKMTVGKIYAGYLIVENWRAYKNSQEQGPRSSPAVSIKSVTKPVVKEEKSANLLAKFFVAFKSNTNKSNISLDSHHERDEERFSIDHTYGEDYDANRRYSYLRRGSKPRGSKEIYSDLTPTQDYSYGLRPEH--------ATIPGMPAPRKFG--NRPRSPMYSLSELETKDRANTP 5839
            +S +K LFIFSEENVIRKYA+IIIEWGPFEYMVLLTI ANCIVL+MERH P  DK+ L+  LE TEKYFLGIFCVEALLKI ALGF  ++ AYLR++WNI+DF+VV TG L   L          ++   LRA+RVLRPLKLV GF SLQ+VLKSI RAMAPLLQIGLL+ FAITIFAI+GLEFYSG FH TCF + N D LP  IP  K+LVPC     S+SK    S  G++ C   Y CK YWEGPN+GITSFDNIGYAMLTVFQCITMEGWTDIMY T DA+G+RF+  YF PLI+LGSFFMLNL+LGVLSGEFAKE+ERVEKRRAFLKLRRQQQTEKEF GYM+WIQ AEEV+L E TT++ED++RIIAAR+RA+K+  K   ++    D  +ED +L+S+ K   GN+F   +  + R+   R  + WR E+ FR++VRRL KSQ  YW+VI+LVF NT+CVAIEHY Q  WLT FL YAEYVFL LFM EM++KMYGL  R+YFQSSFNIFDCVVI GSLFEI+  +   D+SFG+SVLRALRLLRIFKVTRYWA LRNLVLSLL+SMRSIISL+FLLFLFILIFALLGMQLFGGEFNFEEG PPQNFD+FVKALLTVFQILTGEDWN+VMYNGI+S+GG    G ++ IYFVLLV+ GNYTLLNVFLAIAVDNLANA +L+ AE     E Q  A  A      N + S  N +  LP    P     CP               F  + +   ++   L   K NG   +   DN       N  S ESD      + E     KPVLPYS+MFIF+P N +RRFCHFVVNLRYFDLFIMIVICASSIALAAEDPV E S KN ILE FDYAFTGVFTVEM+LK+IDLG++LHPG+YCRD WNILDA VV CALVAF M +     G     +SAKNLNTIKSLRVLRVLRPLKTI RVPKLKAVFDCV+SSL+NV NILIV++LFQFIFAVIAVQLFQGKFFYCNDASK +R+ C+G FF+Y     P T  R W+ H F++DN+ YAMLTLFTVTTGEGWP VLKNSM++T+++ GP+ DY+Q+++IFYI FF+VFPFFFVNIFVALIIITFQ+QGENELIDL+LDKNQK+C+DFAIN  PLCRYMPKDK + KYR+WRLVVSTPFEY+IMVMIALNTLILMMKY+R+E++   A   D  QQ Y NYCNTLIFLNSAFT+MFS+ECVLKIMAFGPKNYFRD WNIFDFITVIGSITDVLVSELQ S+FLSLGFLRLFRAARLIKLLRQGYT+RILLWTFIQS KALPYVCLLI +LFFIY IIGMQVFGNIK     Q+N HNNFQTF +G+LLLFRCATGE+WQE+ML CD  + CE      +   CGS  TY+YFV+FIFL SFLMLNLFVAVIMDNFDYLTRDSSILGPHHLDE++RVWAEYDP A GRIHHS+MYEMLRNMEPPVGFGKKCPYRLAYRKLIRMNMPVD+NGTV+FTTTLFALIRESL IKM  AE MD +D ELR ++ K+WPVQAK+ +N++VPPDSELV+HKMTVGKIYAG LI+EN+R  K    +                   + KSA+LLA+FF A   N ++S     + +   E+    D T+   + +  +   ++RG K   + ++ S  T  +     + PEH        A    +P P + G  ++P S   + S+L + +    P
Sbjct:   79 SSGNKLLFIFSEENVIRKYARIIIEWGPFEYMVLLTITANCIVLAMERHYPSGDKSALSESLEQTEKYFLGIFCVEALLKIAALGFVLNEGAYLRSIWNIIDFLVVATGLLAYIL--------PNLNQPALRALRVLRPLKLVTGFESLQIVLKSIFRAMAPLLQIGLLLFFAITIFAIVGLEFYSGGFHMTCFDERNPDLLPDSIPNSKTLVPCNIGNESSSKGFFNSAHGSFRCDPGYICKGYWEGPNFGITSFDNIGYAMLTVFQCITMEGWTDIMYMTFDAVGDRFSAFYFGPLIVLGSFFMLNLILGVLSGEFAKEKERVEKRRAFLKLRRQQQTEKEFGGYMDWIQHAEEVILAEDTTSAEDRIRIIAARKRAQKEVSKKNARDSQGHDVNFEDADLFSDNK---GNVF-NQHGLLLRQGSGRFEACWRNERRFRYAVRRLAKSQLAYWSVIVLVFLNTICVAIEHYGQPAWLTSFLYYAEYVFLGLFMTEMLLKMYGLGFRLYFQSSFNIFDCVVIIGSLFEILLALVQPDTSFGISVLRALRLLRIFKVTRYWADLRNLVLSLLSSMRSIISLVFLLFLFILIFALLGMQLFGGEFNFEEGLPPQNFDSFVKALLTVFQILTGEDWNSVMYNGIRSQGGTNGGGFIYCIYFVLLVLIGNYTLLNVFLAIAVDNLANAHDLSDAEHADQKEEQSKAAKAQGLDPSNLDLSDPNAMHLLPWIRTPTKENSCP--------------CFSADPLNAVERTSQLGDPKANGNF-LSTPDNKQLRKTQNCISFESDETGQLQDSEAATHGKPVLPYSSMFIFAPTNGIRRFCHFVVNLRYFDLFIMIVICASSIALAAEDPVAENSTKNKILEHFDYAFTGVFTVEMVLKVIDLGVVLHPGAYCRDPWNILDAIVVFCALVAFTMNRNAVRLGKPATSASAKNLNTIKSLRVLRVLRPLKTIKRVPKLKAVFDCVISSLRNVLNILIVFVLFQFIFAVIAVQLFQGKFFYCNDASKLTRDECQGQFFEYNADGVPSTVWREWKSHGFNYDNVYYAMLTLFTVTTGEGWPGVLKNSMDATHVNQGPLEDYQQQVSIFYITFFVVFPFFFVNIFVALIIITFQKQGENELIDLELDKNQKRCVDFAINAHPLCRYMPKDKRSWKYRIWRLVVSTPFEYYIMVMIALNTLILMMKYHRQERRPLVATHIDTAQQNYHNYCNTLIFLNSAFTIMFSVECVLKIMAFGPKNYFRDRWNIFDFITVIGSITDVLVSELQQSAFLSLGFLRLFRAARLIKLLRQGYTVRILLWTFIQSVKALPYVCLLIVILFFIYCIIGMQVFGNIKNDPMTQMNNHNNFQTFGSGILLLFRCATGENWQEVMLDCDAGRECEG-----SGTSCGSKATYLYFVTFIFLSSFLMLNLFVAVIMDNFDYLTRDSSILGPHHLDEFVRVWAEYDPTARGRIHHSDMYEMLRNMEPPVGFGKKCPYRLAYRKLIRMNMPVDDNGTVHFTTTLFALIRESLGIKMGPAEIMDQRDNELRYSLLKLWPVQAKRMMNVLVPPDSELVYHKMTVGKIYAGLLILENYRLSKQPHSK------------------DQSKSADLLARFFGAVTHNVHRS-----ARNSETED----DSTHTGRWKSPTK-GLMKRGPKALSTAKVISMTTQPECTKPLVGPEHQKAAPTSAANEDKIPRPPEAGETDKPLSYATNPSDLSSIEEVQEP 1764          

HSP 2 Score: 125.946 bits (315), Expect = 1.014e-24
Identity = 99/338 (29.29%), Postives = 150/338 (44.38%), Query Frame = 2
Query: 2936 NDKGCLLNTNKPNGKLGMLGHDNTNFNSLESDPVPNKIEPETIQRKPVLPYSAMFIFSPLNSLRRFCHFVVNLRYFDLFIMIVICASSIALAAED--PVKEKSLKNNILEFFDYAFTGVFTVEMILKIIDLGIILHPGSYCRDLWNILDATVVICALVAFIMGQKPSPTGNKLRGSSAKNLNTIKSLRVLRVLRPLKTINRVPKLKAVFDCVVSSLKNVFNILIVYILFQFIFAVIAVQLFQGKFFY-----------------------CNDASKSSRETCRGYFFDYAG--RSTPE-TKKRLWQHHDF---HFDNILYAMLTLFTVTTGEGWPTVL 3856
            N     LN   P  K     H+N+   + E+DP    I               +FIFS  N +R++   ++    F+  +++ I A+ I LA E   P  +KS  +  LE  +  F G+F VE +LKI  LG +L+ G+Y R +WNI+D  VV   L+A+I+                 NLN   +LR LRVLRPLK +     L+ V   +  ++  +  I ++      IFA++ ++ + G F                         CN  ++SS    +G+F    G  R  P    K  W+  +F    FDNI YAMLT+F   T EGW  ++
Sbjct:   47 NASSTALNLQNPQQK-----HENS-LGAAENDPAAQPISSGN---------KLLFIFSEENVIRKYARIIIEWGPFEYMVLLTITANCIVLAMERHYPSGDKSALSESLEQTEKYFLGIFCVEALLKIAALGFVLNEGAYLRSIWNIIDFLVVATGLLAYIL----------------PNLNQ-PALRALRVLRPLKLVTGFESLQIVLKSIFRAMAPLLQIGLLLFFAITIFAIVGLEFYSGGFHMTCFDERNPDLLPDSIPNSKTLVPCNIGNESS---SKGFFNSAHGSFRCDPGYICKGYWEGPNFGITSFDNIGYAMLTVFQCITMEGWTDIM 349          
BLAST of Voltage dependent L type calcium channel subunit vs. TrEMBL
Match: A0A0X3PE31 (Ca_chan_IQ domain-containing protein OS=Schistocephalus solidus OX=70667 GN=TR117297 PE=3 SV=1)

HSP 1 Score: 2045.78 bits (5299), Expect = 0.000e+0
Identity = 1156/1706 (67.76%), Postives = 1324/1706 (77.61%), Query Frame = 2
Query:  689 STSKSLFIFSEENVIRKYAKIIIEWGPFEYMVLLTILANCIVLSMERHLPKKDKTLLAGQLELTEKYFLGIFCVEALLKIVALGFCCHKEAYLRNVWNIMDFVVVVTGFLMMFLNIDNHSDSSTVDLRTLRAVRVLRPLKLVAGFPSLQVVLKSIIRAMAPLLQIGLLVLFAITIFAIIGLEFYSGAFHYTCF-KANSDKLPLPIPTEKSLVPCSNSKNGS--------GLGAYTCPEDYQCKAYWEGPNYGITSFDNIGYAMLTVFQCITMEGWTDIMYHTNDAIGNRFNWLYFVPLIILGSFFMLNLVLGVLSGXXXXXXXXXXXXXXXLKLRRQQQTEKEFNGYMEWIQKAEEVLLNEATTTSEDKMRIIAARRRAEKQKYKLLGKNQSIPDFEYEDTELYSETKSMKGNIFIRSYAGIRRRRKERCTSFWRTEKHFRFSVRRLVKSQPFYWAVIILVFFNTVCVAIEHYEQGKWLTLFLNYAEYVFLCLFMMEMMIKMYGLSIRVYFQSSFNIFDCVVIAGSLFEIIYGIFVQDSSFGLSVLRALRLLRIFKVTRYWAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMQLFGGEFNFEEGKPPQNFDTFVKALLTVFQILTGEDWNTVMYNGIQSKGGVKERGTVFSIYFVLLVVFGNYTLLNVFLAIAVDNLANXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSSDNFIGRLPLSIDPPMVQVCP-PSPQTANSLISKNFSFDHNQVEVNDKGCLLNTNKPNGKL-GMLGHDN--------TNFNSLESDPVPNKIEPETI-QRKPVLPYSAMFIFSPLNSLRRFCHFVVNLRYFDLFIMIVICASSIALAAEDPVKEKSLKNNILEFFDYAFTGVFTVEMILKIIDLGIILHPGSYCRDLWNILDATVVICALVAFIMGQKPSPTGNKLRGSSAKNLNTIKSLRVLRVLRPLKTINRVPKLKAVFDCVVSSLKNVFNILIVYILFQFIFAVIAVQLFQGKFFYCNDASKSSRETCRGYFFDYAGRSTPETKKRLWQHHDFHFDNILYAMLTLFTVTTGEGWPTVLKNSMESTNIDNGPIADYRQEMAXXXXXXXXXXXXXXXXXXXALIIITFQEQGENELIDLDLDKNQKQCIDFAINEKPLCRYMPKDKTTIKYRVWRLVVSTPFEYFIMVMIALNTLILMMKYYREEKKASSAATHDREQQAYLNYCNTLIFLNSAFTVMFSIECVLKIMAFGPKNYFRDPWNIFDFITVIGSITDVLVSELQDXXXXXXXXXXXXXXXXXXXXXXQGYTIRILLWTFIQSFKALPYVCLLIAMLFFIYSIIGMQVFGNIKLISEYQINRHNNFQTFTNGLLLLFRCATGESWQEIMLACDNNKPCEKDIENTNNFDCGSNFTYIYFVSFIFLCSFLMLNLFVAVIMDNFDYLTRDSSILGPHHLDEYIRVWAEYDPGAIGRIHHSEMYEMLRNMEPPVGFGKKCPYRLAYRKLIRMNMPVDENGTVNFTTTLFALIRESLNIKMSTAEYMDIKDMELRQTICKMWPVQAKKKLNLIVPPDSELVFHKMTVGKIYAGYLIVENWRAYKNSQEQGPRSSPAVSIKSVTKPVVKEEKSANLLAKFFVAFKSNTNKSNISLDSHHE-----------------RDEERFSIDHTYGEDYDANRRYSYL--RRGSKPRGSKEIYSD 5689
            + +K LFIFSEEN+IRK A+III+WGPFEYMVLLTI ANCIVL+MERH P  DK+ L   LE +EKYFLGIFCVEALLKI ALGF  ++ AYLR++WNI+DF+VVVTG L   L          ++   LRA+RVLRPLKLV GF SLQ+VLKSIIRAMAPLLQIGLL+LFAITIFAIIGLEFYSG FH TCF + N + LP  IP  +SLVPC N  NGS          GA+ CP  Y CK YWEGPNYGITSFDNIGYAMLTVFQCITMEGWTDIMY T+DAIG+RFN LYFVPLI+LGSFFMLNL+LGVLSGEFAKE+ERVEKRRAFLKLRRQQQTEKEF+GYM+WIQ AEEV+L E TT++ED++RII+ARRRA+K++     K Q++PD   +DTELYS+T+   GN+F   Y  + R  K R  S +R EK  R+++RR+ KSQP YW VIILVF NT+CVAIEH  Q  WLT FL YAEYVFL LFM EM++KMYGL  R+YFQSSFNIFDCVVI GSLFEII+     D+SFG+SVLRALRLLRIFK+TRYWA LRNLVLSLLNSMRSI+SLLFLLFLFILIFALLGMQLFGGEFNF EG PPQNFDTF+KALLTVFQILTGEDWN++MYNGI+S+GG    GT++ IYFVLLV+FGNYTLLNVFLAIAVDNLANAQ+L+ AE E+  E +   +         + D  +    + I     ++ P    + A +L +   +  H+   V D G    T + N KL G     N          F S+ESD   +  + ET  Q KPVLPYS+MFIF+P N +RRFCHFVVNLRYFDLFIMIVICASSIALA EDPV E S +N ILE FDYAFTGVFTVEM+LKIIDLG++ HPG+YCRD WNILDA VV+CALVAF M +     G     +SAKNLNTIKSLRVLRVLRPLKTINRVPKLKAVFDCVVSSL+NVFNILIV+ LFQFIFAVIAVQL QGKFFYCNDASK S+E C+G FF+Y  +  P    R W    F++DN+ YAMLTLFTVTTGEGWPTVLKNSM++T ++ GPI DYRQEMAIFY+ FFIVFPFFFVNIFVALIIITFQ+QGENEL +L+LDKNQK+C+DFAIN  PLCRYMPKD+ + KYRVWRLVVSTPFEY+IMVMIALNTLILMMKY+R+E+K S A T D  QQ Y NYCNTLIFLNSAFTVMFS ECVLKIMAFGPKNYFRD WNIFDFITVIGSITDVLVSELQ S+FLSLGFLRLFRAARLIKLLRQGYTIRILLWTFIQS KALPYVCLLIAMLFFIY IIGMQVFGNIK     Q+N HNNFQTF +GLLLLFRCATGE+WQE+ML CD  + CE   E+     CGS  TY+YFV+FIFLCSFLMLNLFVAVIMDNFDYLTRDSSILGPHHLDEY+RVWAEYDP A G++HH++MYEMLRNMEPPVGFGKKCPYRLAYRKLIRMNMPVDENG V+FTTTLFALIRESL IK+   E MD +D ELR  +C++WPVQAK+ LN++VPPDSEL ++KMTVGKIYAG L++EN R  K  Q +                   + KSA+LLA+FF      +++S  + ++  +                 R EE         +    NR+ + L  +RG KP+ +   + D
Sbjct:   74 TGNKLLFIFSEENIIRKCARIIIDWGPFEYMVLLTITANCIVLAMERHFPMNDKSRLTETLEQSEKYFLGIFCVEALLKITALGFVLNEGAYLRSIWNILDFIVVVTGLLAYIL--------PNLNQPALRALRVLRPLKLVTGFESLQIVLKSIIRAMAPLLQIGLLLLFAITIFAIIGLEFYSGGFHMTCFDERNPEVLPESIPNSRSLVPC-NVGNGSTTKASSTAAQGAFRCPPGYICKGYWEGPNYGITSFDNIGYAMLTVFQCITMEGWTDIMYTTDDAIGDRFNALYFVPLIVLGSFFMLNLILGVLSGEFAKEKERVEKRRAFLKLRRQQQTEKEFSGYMDWIQHAEEVILAEDTTSAEDRLRIISARRRAQKERRSRAAKGQAVPDLNMDDTELYSDTR---GNVF-NQYGFLLRPGKSRFESCFRYEKRVRYAIRRMAKSQPSYWCVIILVFLNTICVAIEHTGQPAWLTSFLYYAEYVFLGLFMTEMLLKMYGLGFRLYFQSSFNIFDCVVIIGSLFEIIWAYIHPDTSFGISVLRALRLLRIFKITRYWADLRNLVLSLLNSMRSILSLLFLLFLFILIFALLGMQLFGGEFNFIEGLPPQNFDTFIKALLTVFQILTGEDWNSIMYNGIRSQGGATSGGTIYCIYFVLLVLFGNYTLLNVFLAIAVDNLANAQDLSEAETEELKEGKEKKEDECSG----TEDAILAANQILIGTTKPRILPWVKDKDALNLPTDVNNILHDPRNVKDTG--EPTQQGNAKLNGKCITKNPFTTTGFGQQFVSVESDDTGHVTKTETKRQGKPVLPYSSMFIFAPNNGIRRFCHFVVNLRYFDLFIMIVICASSIALATEDPVAENSTRNKILEHFDYAFTGVFTVEMVLKIIDLGVVFHPGAYCRDPWNILDAIVVLCALVAFTMNRNAVRLGKPGTSASAKNLNTIKSLRVLRVLRPLKTINRVPKLKAVFDCVVSSLRNVFNILIVFCLFQFIFAVIAVQLLQGKFFYCNDASKLSKEECQGQFFEYNEQGVPTVVWRQWNSQGFNYDNVYYAMLTLFTVTTGEGWPTVLKNSMDATYVNQGPIEDYRQEMAIFYVTFFIVFPFFFVNIFVALIIITFQKQGENELFNLELDKNQKRCVDFAINAHPLCRYMPKDRRSWKYRVWRLVVSTPFEYYIMVMIALNTLILMMKYHRQERKTSMATTIDTAQQNYHNYCNTLIFLNSAFTVMFSFECVLKIMAFGPKNYFRDRWNIFDFITVIGSITDVLVSELQQSAFLSLGFLRLFRAARLIKLLRQGYTIRILLWTFIQSVKALPYVCLLIAMLFFIYCIIGMQVFGNIKNDPMTQMNIHNNFQTFASGLLLLFRCATGENWQEVMLDCDAGRECEGAGES-----CGSKMTYLYFVTFIFLCSFLMLNLFVAVIMDNFDYLTRDSSILGPHHLDEYVRVWAEYDPTARGKVHHTDMYEMLRNMEPPVGFGKKCPYRLAYRKLIRMNMPVDENGMVHFTTTLFALIRESLGIKIGPTEVMDQRDNELRYCLCRLWPVQAKRMLNILVPPDSELTYYKMTVGKIYAGLLMLENHRLEKQPQCK------------------DQSKSADLLARFFGGVVHASHRSPRTSETEDDLNNVPRWRSPLKVISPSRQEEFGKFTKMAADKASDNRKLNDLLMKRGQKPKETANPHPD 1737          
BLAST of Voltage dependent L type calcium channel subunit vs. Ensembl Cavefish
Match: cacna1sa (calcium channel, voltage-dependent, L type, alpha 1S subunit, a [Source:ZFIN;Acc:ZDB-GENE-090514-1])

HSP 1 Score: 1057.36 bits (2733), Expect = 0.000e+0
Identity = 683/1636 (41.75%), Postives = 961/1636 (58.74%), Query Frame = 2
Query:  623 KTTSMRSLAKRTINLSFPGMQTSTSKSLFIFSEENVIRKYAKIIIEWGPFEYMVLLTILANCIVLSMERHLPKKDKTLLAGQLELTEKYFLGIFCVEALLKIVALGFCCHKEAYLRNVWNIMDFVVVVTGFLMMFLNIDNH---------SDSSTVDLRTLRAVRVLRPLKLVAGFPSLQVVLKSIIRAMAPLLQIGLLVLFAITIFAIIGLEFYSGAFHYTCFKANSDKLPLPIPTEKSLVPCSNSKNGSGLGAYTCPEDYQCKAYWEGPNYGITSFDNIGYAMLTVFQCITMEGWTDIMYHTNDAIGNRFNWLYFVPLIILGSFFMLNLVLGVLSGXXXXXXXXXXXXXXXLKLRRQQQTEKEFNGYMEWIQKAEEVLLNEATTTSEDKMRIIAARRRAEKQKYKLLGKNQSIPDFEYEDTELYSETKSMKGNIFIRSYAGIRRRRKERCTSFWRTEKHFRFSVRRLVKSQPFYWAVIILVFFNTVCVAIEHYEQGKWLTLFLNYAEYVFLCLFMMEMMIKMYGLSIRVYFQSSFNIFDCVVIAGSLFEIIYGIFVQDSSFGLSVLRALRLLRIFKVTRYWAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMQLFGGEFNFEEGKPPQ-NFDTFVKALLTVFQILTGEDWNTVMYNGIQSKGGVKERGTVFSIYFVLLVVFGNYTLLNVFLAIAVDNLANXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSSDNFIGRLPLSIDPPMVQVCPPSPQTANSLISKNFSFDHNQVEVNDKGCLLNTNKPNGKLGMLGHDNTNFNSLESDPVPNKIEPETIQRK--PVLPYSAMFIFSPLNSLRRFCHFVVNLRYFDLFIMIVICASSIALAAEDPVKEKSLKNNILEFFDYAFTGVFTVEMILKIIDLGIILHPGSYCRDLWNILDATVVICALVAFIMGQKPSPTGNKLRGSSAKNLNTIKSLRVLRVLRPLKTINRVPKLKAVFDCVVSSLKNVFNILIVYILFQFIFAVIAVQLFQGKFFYCNDASKSSRETCRGYFFDYAGRSTP--ETKKRLWQHHDFHFDNILYAMLTLFTVTTGEGWPTVLKNSMESTNIDNGPIADYRQEMAXXXXXXXXXXXXXXXXXXXALIIITFQEQGENELIDLDLDKNQKQCIDFAINEKPLCRYMPKDKTTIKYRVWRLVVSTPFEYFIMVMIALNTLILMMKYYREEKKASSAATHDREQQAYLNYCNTLIFLNSAFTVMFSIECVLKIMAFGPKNYFRDPWNIFDFITVIGSITDVLVSEL--------------QDXXXXXXXXXXXXXXXXXXXXXXQGYTIRILLWTFIQSFKALPYVCLLIAMLFFIYSIIGMQVFGNIKLISEYQINRHNNFQTFTNGLLLLFRCATGESWQEIMLACDNNKPCE--KDIENTNNFDCGSNFTYIYFVSFIFLCSFLMLNLFVAVIMDNFDYLTRDSSILGPHHLDEYIRVWAEYDPGAIGRIHHSEMYEMLRNMEPPVGFGKKCPYRLAYRKLIRMNMPVDENGTVNFTTTLFALIRESLNIKMSTAEYMDIKDMELRQTICKMWPVQAKKKLNLIVPPDSELVFHKMTVGKIYAGYLIVENWRAYKNSQEQGPRSSPA 5440
            + T  R   ++   L   G     ++SL   + +N  RK    I+EW PFE ++L+TI ANC+ L++   +P++D       LE  E  FL IF +E  LKIVA G   H +AYLRN WNI+DFV+V  G   + ++  N+               D++ LRA RVLRPL+LV+G PSLQVV+ SI+++M PL  I LLV F +TI+AIIGLE +    H TC+ + +D +   +  EK+  PC+ + NG             CK  W GPN GIT FDN+G++MLTV+QCIT +GWTD++Y  NDAIG  + WLYFV LI+LGSFF+LN+VLGVL G F KERE+  +   + KLR +QQ +++  GYM+WI +A EV+ N+     +D+  ++  +                       DTE   E + +      R    +R  R        R  + FR   R  VKS+ FYW V +LVFFNT+ +A EH+ Q + LT F   +    LC+F +EM++KMY L +  YF S FN FDC V++  + E+I       S+ G+SV+R +RLLR+ KVT+YW SL NLV SLLNS+RSI SLL LLFLFI+IFALLGMQ+FGG+FNF + +  + NFD F +AL+TVFQILTGEDWN+VMY+GI + GG    G + SIYF++L V GNY LLNVFLAIAVDNLA A+ LT+A++EKA E +R     A  +++   D       L+      +  P + +       K   F+ N  E+ D         P       G D      + + P P  +    ++    P+   S+ FIF P N  R+ CH ++N   F   I++ I  SSI+LAAEDP+   S +N +L + D  FT VFT E++LK+   G  LH GS+CR+ +NILD  VV  +L++               G  +  ++ +K LRVLRVLRPL+ INR   LK V  CV  ++K + NI++V +L  F+FA I VQLF+GKFF+C D  K + E CRG +  Y   +    E ++R W +  F+FDNIL  ML LFTV+T EGWP +L  +++S + + GP+ + R E++IF+IV+ I+  FF +NIFV  +I+TFQEQGE E  + +LDKNQ+QC+ +A+  +PL  Y+PK+    +Y+VW +V S  FEY + ++I LNT+ L M++  +    S   TH  +             LN  FTV+F++E  LK+ AF  K YF DPWN+FDF+ V+GSI DV++SE+               ++  +S+   RLFR  RL+KLL +   IR LLWTFI+SF+ALPYV LLI MLFFIY++IGMQVFG I LI    INR+NNFQTF   +L+LFRCATGE WQE+M  C   + C+   D      + CG+ F  +YF+SF  L        F+  ++  + +     S+    H   ++      +    GRI H ++  +LR ++PP+GFGK CP+R+A ++LI MNMP++ +GTV F  TLFAL+R +L IK  T       + ELR  I K+W   + K L+ ++PP  +    ++TVGK YA +LI E++R +   QE+     PA
Sbjct:   16 EETLKRKQREKLKKLQATGGNPRPARSLLFLTLKNPFRKACISIVEWKPFEIIILVTIFANCVALAVFMPMPEEDTNNTNSNLESLEYIFLIIFTLECFLKIVAYGLLFHADAYLRNCWNILDFVIVTMGLFTIAVDFINNISGVEAPVEQKGGGFDMKALRAFRVLRPLRLVSGVPSLQVVMSSILKSMLPLFHISLLVFFMVTIYAIIGLELFKCKMHKTCYYSGTDIVA-TVENEKA-SPCAEAGNGRRCTV----NGTVCKPGWPGPNDGITHFDNLGFSMLTVYQCITTQGWTDVLYWVNDAIGMEWPWLYFVTLILLGSFFILNMVLGVLCGSFTKEREKSSRSGEYQKLRERQQLDEDLKGYMDWITQA-EVMEND-----QDRQGLLPLQEGG-------------------SDTESLYELEGLN-----RLMYYVRHAR--------RWNRFFRRKCRVWVKSRLFYWLVFLLVFFNTLVIATEHHMQSQSLTNFQENSNTALLCMFAVEMVLKMYALGLPSYFMSLFNRFDCFVVSVGMLELILVHMGVMSAMGISVMRCIRLLRLIKVTKYWTSLSNLVASLLNSVRSIASLLLLLFLFIVIFALLGMQVFGGKFNFPDQEVRRSNFDNFPQALITVFQILTGEDWNSVMYDGIMAHGGPVIPGILVSIYFIILFVCGNYILLNVFLAIAVDNLAEAESLTSAQKEKAEEKKRKKLLRANLSDKGDEDKSTLAKKLAEQRAKTEGIPTTAKL------KVDEFESNVNEIKD---------PFPPADFPGDDEEEEPEIPTSPRPRPMADLQLKETVVPMPEASSFFIFGPQNKFRKLCHRIINATTFTNIILLFILLSSISLAAEDPIDPMSFRNQVLAYADIVFTSVFTAEIVLKMTTYGAFLHTGSFCRNSFNILDLIVVGVSLLSM--------------GMESSAISVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIKTIGNIVLVTMLLDFMFACIGVQLFKGKFFFCTDPLKMTEEECRGTYIHYQENALHEMEVRQREWMNSGFNFDNILNGMLALFTVSTFEGWPKLLYTAIDSNSENMGPVYNNRTEISIFFIVYLILIAFFMMNIFVGFVIVTFQEQGEQEYKNCELDKNQRQCVQYALKARPLRCYIPKNP--YQYQVWYIVTSCYFEYLMFLLIMLNTMCLGMQHCNQ----SEHVTHLSDM------------LNVIFTVLFTVEMFLKLGAFKAKGYFGDPWNVFDFVIVVGSIVDVILSEIDVSIEVNPMQAIADSENMSVSITLFRLFRVMRLVKLLNRFEGIRNLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQVFGKIALIDGTVINRNNNFQTFPQAVLVLFRCATGEGWQEVMQGCLYGQRCDPKSDYLPGEEYTCGAGFAVLYFMSFYML-------FFIYAVIGIYIF-----SVFALFHFMHFMNC---MNAPCRGRIKHLDVVTLLRRIQPPLGFGKFCPHRVACKRLISMNMPLNSDGTVTFNATLFALVRTALRIK--TEGNFQQANEELRAIIKKIWKRTSMKLLDQVIPPIGD---DEVTVGKFYATFLIQEHFRKFMKRQEEYYGYRPA 1540          
BLAST of Voltage dependent L type calcium channel subunit vs. Ensembl Cavefish
Match: cacna1sa (calcium channel, voltage-dependent, L type, alpha 1S subunit, a [Source:ZFIN;Acc:ZDB-GENE-090514-1])

HSP 1 Score: 1056.97 bits (2732), Expect = 0.000e+0
Identity = 686/1638 (41.88%), Postives = 966/1638 (58.97%), Query Frame = 2
Query:  623 KTTSMRSLAKRTINLSFPGMQTSTSKSLFIFSEENVIRKYAKIIIEWGPFEYMVLLTILANCIVLSMERHLPKKDKTLLAGQLELTEKYFLGIFCVEALLKIVALGFCCHKEAYLRNVWNIMDFVVVVTGFLMMFLNIDNH---------SDSSTVDLRTLRAVRVLRPLKLVAGFPSLQVVLKSIIRAMAPLLQIGLLVLFAITIFAIIGLEFYSGAFHYTCFKANSDKLPLPIPTEKSLVPCSNSKNGSGLGAYTCPEDYQCKAYWEGPNYGITSFDNIGYAMLTVFQCITMEGWTDIMYHTNDAIGNRFNWLYFVPLIILGSFFMLNLVLGVLSGXXXXXXXXXXXXXXXLKLRRQQQTEKEFNGYMEWIQKAEEVLLNEATTTSEDKMRIIAARRRAEKQKYKLLGKNQSIPDFEYEDTELYSETKSMKGNIFIRSYAGIRRRRKERCTSFWRTEKHFRFSVRRLVKSQPFYWAVIILVFFNTVCVAIEHYEQGKWLTLFLNYAEYVFLCLFMMEMMIKMYGLSIRVYFQSSFNIFDCVVIAGSLFEIIYGIFVQDSSFGLSVLRALRLLRIFKVTRYWAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMQLFGGEFNFEEGKPPQ-NFDTFVKALLTVFQILTGEDWNTVMYNGIQSKGGVKERGTVFSIYFVLLVVFGNYTLLNVFLAIAVDNLANXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSSDNFIGRLPLSIDPPMVQVCPPSPQTANSLISKNFSFDHNQVEVNDKGCLLNTNKPNGKLGMLGHDNTNFNSLESDPVPNKIEPETIQRK--PVLPYSAMFIFSPLNSLRRFCHFVVNLRYFDLFIMIVICASSIALAAEDPVKEKSLKNNILEFFDYAFTGVFTVEMILKIIDLGIILHPGSYCRDLWNILDATVVICALVAFIMGQKPSPTGNKLRGSSAKNLNTIKSLRVLRVLRPLKTINRVPKLKAVFDCVVSSLKNVFNILIVYILFQFIFAVIAVQLFQGKFFYCNDASKSSRETCRGYFFDYAGRSTP--ETKKRLWQHHDFHFDNILYAMLTLFTVTTGEGWPTVLKNSMESTNIDNGPIADYRQEMAXXXXXXXXXXXXXXXXXXXALIIITFQEQGENELIDLDLDKNQKQCIDFAINEKPLCRYMPKDKTTIKYRVWRLVVSTPFEYFIMVMIALNTLILMMKYYREEKKASSAATHDREQQAYLNYCNTLIFLNSAFTVMFSIECVLKIMAFGPKNYFRDPWNIFDFITVIGSITDVLVSELQDXXXX---------------XXXXXXXXXXXXXXXXXXQGYTIRILLWTFIQSFKALPYVCLLIAMLFFIYSIIGMQVFGNIKLISEYQINRHNNFQTFTNGLLLLFRCATGESWQEIMLACDNNKPCE--KDIENTNNFDCGSNFTYIYFVSFIFL-CSFLMLNLFVAVIMDNFDYLTRDSSILGPHHLDEYIRVWAEYDPGAIGRIHHSEMYEMLRNMEPPVGFGKKCPYRLAYRKLIRMNMPVDENGTVNFTTTLFALIRESLNIKMSTAEYMDIKDMELRQTICKMWPVQAKKKLNLIVPPDSELVFHKMTVGKIYAGYLIVENWRAYKNSQEQGPRSSPA 5440
            + T  R   ++   L   G     ++SL   + +N  RK    I+EW PFE ++L+TI ANC+ L++   +P++D       LE  E  FL IF +E  LKIVA G   H +AYLRN WNI+DFV+V  G   + ++  N+               D++ LRA RVLRPL+LV+G PSLQVV+ SI+++M PL  I LLV F +TI+AIIGLE +    H TC+ + +D +   +  EK+  PC+ + NG             CK  W GPN GIT FDN+G++MLTV+QCIT +GWTD++Y  NDAIG  + WLYFV LI+LGSFF+LN+VLGVL G F KERE+  +   + KLR +QQ +++  GYM+WI +A EV+ N+     +D+  ++  +                       DTE   E + +      R    +R  R        R  + FR   R  VKS+ FYW V +LVFFNT+ +A EH+ Q + LT F   +    LC+F +EM++KMY L +  YF S FN FDC V++  + E+I       S+ G+SV+R +RLLR+ KVT+YW SL NLV SLLNS+RSI SLL LLFLFI+IFALLGMQ+FGG+FNF + +  + NFD F +AL+TVFQILTGEDWN+VMY+GI + GG    G + SIYF++L V GNY LLNVFLAIAVDNLA A+ LT+A++EKA E +R     A  +++   D       L+      +  P + +       K   F+ N  E+ D         P       G D      + + P P  +    ++    P+   S+ FIF P N  R+ CH ++N   F   I++ I  SSI+LAAEDP+   S +N +L + D  FT VFT E++LK+   G  LH GS+CR+ +NILD  VV  +L++  MG + S             ++ +K LRVLRVLRPL+ INR   LK V  CV  ++K + NI++V +L  F+FA I VQLF+GKFF+C D  K + E CRG +  Y   +    E ++R W +  F+FDNIL  ML LFTV+T EGWP +L  +++S + + GP+ + R E++IF+IV+ I+  FF +NIFV  +I+TFQEQGE E  + +LDKNQ+QC+ +A+  +PL  Y+PK+    +Y+VW +V S  FEY + ++I LNT+ L M++  +    S   TH  +             LN  FTV+F++E  LK+ AF  K YF DPWN+FDF+ V+GSI DV++SE+  +                  S+   RLFR  RL+KLL +   IR LLWTFI+SF+ALPYV LLI MLFFIY++IGMQVFG I LI    INR+NNFQTF   +L+LFRCATGE WQE+M  C   + C+   D      + CG+ F  +YF+SF  L   + ++ +++  +   F ++   + +  P       R  A+     +GRI H ++  +LR ++PP+GFGK CP+R+A ++LI MNMP++ +GTV F  TLFAL+R +L IK  T       + ELR  I K+W   + K L+ ++PP  +    ++TVGK YA +LI E++R +   QE+     PA
Sbjct:   14 EETLKRKQREKLKKLQATGGNPRPARSLLFLTLKNPFRKACISIVEWKPFEIIILVTIFANCVALAVFMPMPEEDTNNTNSNLESLEYIFLIIFTLECFLKIVAYGLLFHADAYLRNCWNILDFVIVTMGLFTIAVDFINNISGVEAPVEQKGGGFDMKALRAFRVLRPLRLVSGVPSLQVVMSSILKSMLPLFHISLLVFFMVTIYAIIGLELFKCKMHKTCYYSGTDIVA-TVENEKA-SPCAEAGNGRRCTV----NGTVCKPGWPGPNDGITHFDNLGFSMLTVYQCITTQGWTDVLYWVNDAIGMEWPWLYFVTLILLGSFFILNMVLGVLCGSFTKEREKSSRSGEYQKLRERQQLDEDLKGYMDWITQA-EVMEND-----QDRQGLLPLQEGG-------------------SDTESLYELEGLN-----RLMYYVRHAR--------RWNRFFRRKCRVWVKSRLFYWLVFLLVFFNTLVIATEHHMQSQSLTNFQENSNTALLCMFAVEMVLKMYALGLPSYFMSLFNRFDCFVVSVGMLELILVHMGVMSAMGISVMRCIRLLRLIKVTKYWTSLSNLVASLLNSVRSIASLLLLLFLFIVIFALLGMQVFGGKFNFPDQEVRRSNFDNFPQALITVFQILTGEDWNSVMYDGIMAHGGPVIPGILVSIYFIILFVCGNYILLNVFLAIAVDNLAEAESLTSAQKEKAEEKKRKKLLRANLSDKGDEDKSTLAKKLAEQRAKTEGIPTTAKL------KVDEFESNVNEIKD---------PFPPADFPGDDEEEEPEIPTSPRPRPMADLQLKETVVPMPEASSFFIFGPQNKFRKLCHRIINATTFTNIILLFILLSSISLAAEDPIDPMSFRNQVLAYADIVFTSVFTAEIVLKMTTYGAFLHTGSFCRNSFNILDLIVVGVSLLS--MGMESSA------------ISVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIKTIGNIVLVTMLLDFMFACIGVQLFKGKFFFCTDPLKMTEEECRGTYIHYQENALHEMEVRQREWMNSGFNFDNILNGMLALFTVSTFEGWPKLLYTAIDSNSENMGPVYNNRTEISIFFIVYLILIAFFMMNIFVGFVIVTFQEQGEQEYKNCELDKNQRQCVQYALKARPLRCYIPKNP--YQYQVWYIVTSCYFEYLMFLLIMLNTMCLGMQHCNQ----SEHVTHLSDM------------LNVIFTVLFTVEMFLKLGAFKAKGYFGDPWNVFDFVIVVGSIVDVILSEIDAALAAQGGLYCLTGCANMSVSITLFRLFRVMRLVKLLNRFEGIRNLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQVFGKIALIDGTVINRNNNFQTFPQAVLVLFRCATGEGWQEVMQGCLYGQRCDPKSDYLPGEEYTCGAGFAVLYFMSFYMLFFIYAVIGIYIFSVFALFHFMHFMNCMNAP------CRCLAK-----LGRIKHLDVVTLLRRIQPPLGFGKFCPHRVACKRLISMNMPLNSDGTVTFNATLFALVRTALRIK--TEGNFQQANEELRAIIKKIWKRTSMKLLDQVIPPIGD---DEVTVGKFYATFLIQEHFRKFMKRQEEYYGYRPA 1544          
BLAST of Voltage dependent L type calcium channel subunit vs. Ensembl Cavefish
Match: cacna1sa (calcium channel, voltage-dependent, L type, alpha 1S subunit, a [Source:ZFIN;Acc:ZDB-GENE-090514-1])

HSP 1 Score: 1022.31 bits (2642), Expect = 0.000e+0
Identity = 669/1640 (40.79%), Postives = 943/1640 (57.50%), Query Frame = 2
Query:  623 KTTSMRSLAKRTINLSFPGMQTSTSKSLFIFSEENVIRKYAKIIIEWGPFEYMVLLTILANCIVLSMERHLPKKDKTLLAGQLELTEKYFLGIFCVEALLKIVALGFCCHKEAYLRNVWNIMDFVVVVTGFLMMFLNIDNH---------SDSSTVDLRTLRAVRVLRPLKLVAGFPSLQVVLKSIIRAMAPLLQIGLLVLFAITIFAIIGLEFYSGAFHYTCFKANSDKLPLPIPTEKSLVPCSNSKNGSGLGAYTCPEDYQCKAYWEGPNYGITSFDNIGYAMLTVFQCITMEGWTDIMYHTNDAIGNRFNWLYFVPLIILGSFFMLNLVLGVLSGXXXXXXXXXXXXXXXLKLRRQQQTEKEFNGYMEWIQKAEEVLLNEATTTSEDKMRIIAARRRAEKQKYKLLGKNQSIPDFEYEDTELYSETKSMKGNIFIRSYAGIRRRRKERCTSFWRTEKHFRFSVRRLVKSQPFYWAVIILVFFNTVCVAIEHYEQGKWLTLFLNYAEYVFLCLFMMEMMIKMYGLSIRVYFQSSFNIFDCVVIAGSLFEIIYGIFVQDSSFGLSVLRALRLLRIFKVTRYWAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMQLFGGEFNFEEGKPPQ-NFDTFVKALLTVFQILTGEDWNTVMYNGIQSKGGVKERGTVFSIYFVLLVVFGNYTLLNVFLAIAVDNLANXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSSDNFIGRLPLSIDPPMVQVCPPSPQTANSLISKNFSFDHNQVEVNDKGCLLNTNKPNGKLGMLGHDNTNFNSLESDPVPNKIEPETIQRK--PVLPYSAMFIFSPLNSLRRFCHFVVNLRYFDLFIMIVICASSIALAAEDPVKEKSLKNNILEFFDYAFTGVFTVEMILKIIDLGIILHPGSYCRDLWNILDATVVICALVAFIMGQKPSPTGNKLRGSSAKNLNTIKSLRVLRVLRPLKTINRVPKLKAVFDCVVSSLKNVFNILIVYILFQFIFAVIAVQLFQGKFFYCNDASKSSRETCRGYFFDYAGRSTP--ETKKRLWQHHDFHFDNILYAMLTLFTVTTGEGWPTVLKNSMESTNIDNGPIADYRQEMAXXXXXXXXXXXXXXXXXXXALIIITFQEQGENELIDLDLDKNQKQCIDFAINEKPLCRYMPKDKTTIKYRVWRLVVSTPFEYFIMVMIALNTLILMMKYYREEKKASSAATHDREQQAYLNYCNTLIFLNSAFTVMFSIECVLKIMAFGPKNYFRDPWNIFDFITVIGSITDVLVSEL------------------QDXXXXXXXXXXXXXXXXXXXXXXQGYTIRILLWTFIQSFKALPYVCLLIAMLFFIYSIIGMQVFGNIKLISEYQINRHNNFQTFTNGLLLLFRCATGESWQEIMLACDNNKPCE--KDIENTNNFDCGSNFTYIYFVSFIFLCSFLMLNLFVAVIMDNFDYLTRDSSILGPHHLDEYIRVWAEYDPGAIGRIHHSEMYEMLRNMEPPVGFGKKCPYRLAYRKLIRMNMPVDENGTVNFTTTLFALIRESLNIKMSTAEYMDIKDMELRQTICKMWPVQAKKKLNLIVPPDSELVFHKMTVGKIYAGYLIVENWRAYKNSQEQGPRSSPA 5440
            + T  R   ++   L   G     ++SL   + +N  RK    I+EW PFE ++L+TI ANC+ L++   +P++D       LE  E  FL IF +E  LKIVA G   H +AYLRN WNI+DFV+V  G   + ++  N+               D++ LRA RVLRPL+LV+G PSLQVV+ SI+++M PL  I LLV F +TI+AIIGLE +    H TC+ + +D +   +  EK+  PC+ + NG             CK  W GPN GIT FDN+G++MLTV+QCIT +GWTD++Y  NDAIG  + WLYFV LI+LGSFF+LN+VLGVL G                                     +EE + ++        + +   ++R      KL G+ +S  D     T+  ++++S+              R   R   F+R +       R  VKS+ FYW V +LVFFNT+ +A EH+ Q + LT F   +    LC+F +EM++KMY L +  YF S FN FDC V++  + E+I       S+ G+SV+R +RLLR+ KVT+YW SL NLV SLLNS+RSI SLL LLFLFI+IFALLGMQ+FGG+FNF + +  + NFD F +AL+TVFQILTGEDWN+VMY+GI + GG    G + SIYF++L V GNY LLNVFLAIAVDNLA A+ LT+A++EKA E +R   A      ++       +L               P TA   + +   F+ N  E+ D         P       G D      + + P P  +    ++    P+   S+ FIF P N  R+ CH ++N   F   I++ I  SSI+LAAEDP+   S +N +L + D  FT VFT E++LK+   G  LH GS+CR+ +NILD  VV  +L++  MG + S             ++ +K LRVLRVLRPL+ INR   LK V  CV  ++K + NI++V +L  F+FA I VQLF+GKFF+C D  K + E CRG +  Y   +    E ++R W +  F+FDNIL  ML LFTV+T EGWP +L  +++S + + GP+ + R E++IF+IV+ I+  FF +NIFV  +I+TFQEQGE E  + +LDKNQ+QC+ +A+  +PL  Y+PK+    +Y+VW +V S  FEY + ++I LNT+ L M++  +    S   TH  +             LN  FTV+F++E  LK+ AF  K YF DPWN+FDF+ V+GSI DV++SE+                   ++  +S+   RLFR  RL+KLL +   IR LLWTFI+SF+ALPYV LLI MLFFIY++IGMQVFG I LI    INR+NNFQTF   +L+LFRCATGE WQE+M  C   + C+   D      + CG+ F  +YF+SF  L        F+  ++  + +     S+    H   ++      +    GRI H ++  +LR ++PP+GFGK CP+R+A ++LI MNMP++ +GTV F  TLFAL+R +L IK  T       + ELR  I K+W   + K L+ ++PP  +    ++TVGK YA +LI E++R +   QE+     PA
Sbjct:   23 EETLKRKQREKLKKLQATGGNPRPARSLLFLTLKNPFRKACISIVEWKPFEIIILVTIFANCVALAVFMPMPEEDTNNTNSNLESLEYIFLIIFTLECFLKIVAYGLLFHADAYLRNCWNILDFVIVTMGLFTIAVDFINNISGVEAPVEQKGGGFDMKALRAFRVLRPLRLVSGVPSLQVVMSSILKSMLPLFHISLLVFFMVTIYAIIGLELFKCKMHKTCYYSGTDIVA-TVENEKA-SPCAEAGNGRRCTV----NGTVCKPGWPGPNDGITHFDNLGFSMLTVYQCITTQGWTDVLYWVNDAIGMEWPWLYFVTLILLGSFFILNMVLGVLCGSV-----------------------------------SEESMAHD--------LLMFGIKKRV-----KLTGRTRSTMD---SQTQRQNQSESLIW------------RHARRWNRFFRRK------CRVWVKSRLFYWLVFLLVFFNTLVIATEHHMQSQSLTNFQENSNTALLCMFAVEMVLKMYALGLPSYFMSLFNRFDCFVVSVGMLELILVHMGVMSAMGISVMRCIRLLRLIKVTKYWTSLSNLVASLLNSVRSIASLLLLLFLFIVIFALLGMQVFGGKFNFPDQEVRRSNFDNFPQALITVFQILTGEDWNSVMYDGIMAHGGPVIPGILVSIYFIILFVCGNYILLNVFLAIAVDNLAEAESLTSAQKEKAEEKKRKKLANLSDKGDEDKSTLAKKL-----AEQRAKTEGIPTTAKLKVDE---FESNVNEIKD---------PFPPADFPGDDEEEEPEIPTSPRPRPMADLQLKETVVPMPEASSFFIFGPQNKFRKLCHRIINATTFTNIILLFILLSSISLAAEDPIDPMSFRNQVLAYADIVFTSVFTAEIVLKMTTYGAFLHTGSFCRNSFNILDLIVVGVSLLS--MGMESSA------------ISVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIKTIGNIVLVTMLLDFMFACIGVQLFKGKFFFCTDPLKMTEEECRGTYIHYQENALHEMEVRQREWMNSGFNFDNILNGMLALFTVSTFEGWPKLLYTAIDSNSENMGPVYNNRTEISIFFIVYLILIAFFMMNIFVGFVIVTFQEQGEQEYKNCELDKNQRQCVQYALKARPLRCYIPKNP--YQYQVWYIVTSCYFEYLMFLLIMLNTMCLGMQHCNQ----SEHVTHLSDM------------LNVIFTVLFTVEMFLKLGAFKAKGYFGDPWNVFDFVIVVGSIVDVILSEIDAALAAQGGLYCLTGCADSENMSVSITLFRLFRVMRLVKLLNRFEGIRNLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQVFGKIALIDGTVINRNNNFQTFPQAVLVLFRCATGEGWQEVMQGCLYGQRCDPKSDYLPGEEYTCGAGFAVLYFMSFYML-------FFIYAVIGIYIF-----SVFALFHFMHFMNC---MNAPCRGRIKHLDVVTLLRRIQPPLGFGKFCPHRVACKRLISMNMPLNSDGTVTFNATLFALVRTALRIK--TEGNFQQANEELRAIIKKIWKRTSMKLLDQVIPPIGD---DEVTVGKFYATFLIQEHFRKFMKRQEEYYGYRPA 1518          
BLAST of Voltage dependent L type calcium channel subunit vs. Ensembl Cavefish
Match: cacna1sb (calcium channel, voltage-dependent, L type, alpha 1S subunit, b [Source:ZFIN;Acc:ZDB-GENE-051227-1])

HSP 1 Score: 966.066 bits (2496), Expect = 0.000e+0
Identity = 643/1660 (38.73%), Postives = 912/1660 (54.94%), Query Frame = 2
Query:  638 RSLAKRTINLSFPGMQTSTSKSLFIFSEENVIRKYAKIIIEWGPFEYMVLLTILANCIVLSMERHLPKKDKTLLAGQLELTEKYFLGIFCVEALLKIVALGFCCHKEAYLRNVWNIMDFVVVVTGFLMMFLNIDNH------SDSSTVDLRTLRAVRVLRPLKLVAGFPSLQVVLKSIIRAMAPLLQIGLLVLFAITIFAIIGLEFYSGAFHYTCFKANSDKLPL---PIPTEKSLVPCSNSKNGSGLGAYTCP-EDYQCKAYWEGPNYGITSFDNIGYAMLTVFQCITMEGWTDIMYHTNDAIGNRFNWLYFVPLIILGSFFMLNLVLGVLSGXXXXXXXXXXXXXXXLKLRRQQQTEKEFNGYMEWIQKAEEVLLNEATTTSEDKMRIIAARRRAEKQKYKLLGKNQSIPDFEYEDTELYSETKSMKGNIFIRSYAGIRRRRKERCTSFWRTEKHFRFSVRRLVKSQPFYWAVIILVFFNTVCVAIEHYEQGKWLTLFLNYAEYVFLCLFMMEMMIKMYGLSIRVYFQSSFNIFDCVVIAGSLFEIIYGIFVQDSSFGLSVLRALRLLRIFKVTRYWAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMQLFGGEFNFEEGKPPQNFDTFVKALLTVFQILTGEDWNTVMYNGIQSKGGVKERGTVFSIYFVLLVVFGNYTLLNVFLAIAVDNLANXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSSDNFIGRLPLSIDPPMVQVCPPSPQTANSLISKNFSFDHNQVEVNDKGCLLNTNKPNGKLGMLGHDNTNFNSLESDPVPNKIEPETIQRKPV-LPYSAMF-IFSPLNSLRRFCHFVVNLRYFDLFIMIVICASSIALAAEDPVKEKSLKNNILEFFDYAFTGVFTVEMILKIIDLGIILHPGSYCRDLWNILDATVVICALVAFIMGQKPSPTGNKLRGSSAKNLNTIKSLRVLRVLRPLKTINRVPKLKAVFDCVVSSLKNVFNILIVYILFQFIFAVIAVQLFQGKFFYCNDASKSSRETCRGYFFDYAGRS--TPETKKRLWQHHDFHFDNILYAMLTLFTVTTGEGWPTVLKNSMESTNIDNGPIADYRQEMAXXXXXXXXXXXXXXXXXXXALIIITFQEQGENELIDLDLDKNQKQCIDFAINEKPLCRYMPKDKTTIKYRVWRLVVSTPFEYFIMVMIALNTLILMMKYYREEKKASSAATHDREQQAYLNYCNTLIFLNSAFTVMFSIECVLKIMAFGPKNYFRDPWNIFDFITVIGSITDVLVSELQDXX--------------------XXXXXXXXXXXXXXXXXXXXQGYTIRILLWTFIQSFKALPYVCLLIAMLFFIYSIIGMQVFGNIKLISEYQINRHNNFQTFTNGLLLLFRCATGESWQEIMLACDNNKPCE--KDIENTNNFDCGSNFTYIYFVSFIFLCSFLMLNLFVAVIMDNFDYLTRDSSILGPHHLDEYIRVWAEYDPGAIGRIHHSEMYEMLRNMEPPVGFGKKCPYRLAYRKLIRMNMPVDENGTVNFTTTLFALIRESLNIKMSTAEYMDIKDMELRQTICKMWPVQAKKKLNLIVPPDSELVFHKMTVGKIYAGYLIVENWRAYKNSQEQ----GPRSSPAVSIKSVTKPVVKEEKSANL 5497
            R   ++   L   G     ++SLF F+ +N  RK    I+EW PFE ++LLTI ANC+ L++   +P++D       LE  E  FL IF +E  LKI+A G   H+ AYLRN WNI+DFV+V  G   + ++  N             D++ LRA RVLRPL+LV+G PSLQVV+ SI++AM PL Q+ LLV F +T+FAI+GLE Y    H TC+   +D + L    +P+     PC+ + NG       C     +C+  W GPN+GIT FDN G+AMLTVFQCITME WT+++Y  NDA+GN + W+YFV +I+LGSFF+LNLVLGVLSGEF+KERE+   R  + KLR +QQ +++  GYMEWI  AE +                     A+++   LL     + D + E   L+    +++G   I  Y  + RR        W   + FR      VKS+ FYW VI++VF NT+ +A EH+ Q +  T F + A  + L  F  EM  KMY   +R YF S FN FD  V+   + EII       +  G+SV+R +RLLR  K+T+ +                                   +Q+  GE           +DT +              +N +M +G     G +  G + SIYF++L V GN+ LLNVFLAIAVDNL  A+ L++A++EK  E  R          E+     +                  P TA   + +   F+ N  EV D         P       G D      +   P P  +    ++   V +P ++ F IF P N  R+ CH  +N   F  FI+++I  SSI+LAAED +  KS +N IL + D  FT VFT+E++LK+   G ILH GS+CR+ +NILD  VV+ +L++               G  +  ++ IK LRVLRVLRPL+ +NR   LK      V SL+     L + +L + +F ++                     T +G F  +   S    E  +R W + DF+FDN+  AML LFTV+T EGWP +L  +++S   D GP+ + R + ++F++++ I+  FF +NIFV  +I+TF+EQGE E  + +LDKNQ+QC+ +A+  +PL  Y+PK+    +YRVW LV S  FEY + ++I LNT  L +++  +    +  A                  LN  FTV+F+ E ++K++AF  K YF DPWN+FDF+ VIGSI DV++S++  +                      +S+ F RLFR  RLIKLL +   IR LLWTFI+SF+A P+V LLI MLFFIY++IGMQVFG I L+   +INR+ NFQTF   +L+L+R  TGE WQ++MLAC + K C+   D      + CG+NF   YF+SF  +C FL++NLFVAVIMDNFDYLTRD SILGPHHLDE+ ++WAEYDP A GRI H ++  +LR ++PP+GFGK CP+R A R+LI MNMP++ +GTV F  TLFAL+R  L+IK  T    +  + ELR  I  +W   + K L+ ++PP  E    ++TVGK YA +LI E++R +   QE+     P    A  I++  +  ++EE +  L
Sbjct:   21 RKQREKLKKLQATGGNPRPARSLFFFTLKNPFRKACTKIVEWKPFEIIILLTIFANCVALAVFLPMPEEDTNYTNTTLESLEYIFLVIFTLECFLKIIAYGLLFHEGAYLRNCWNILDFVIVFMGLFTLAVDTINAIAGTPTEKGGGFDMKALRAFRVLRPLRLVSGVPSLQVVMNSILKAMIPLFQVVLLVFFLVTLFAIMGLELYKCKMHKTCYYEGTDIIALRENEVPS-----PCAQAGNGR-----RCTINGTECRGGWPGPNFGITHFDNFGFAMLTVFQCITMESWTNVLYWVNDAVGNEWAWIYFVTMILLGSFFVLNLVLGVLSGEFSKEREKCRSRGEYQKLRERQQMDEDLKGYMEWITHAEVL--------------------DADQEGQGLL----PLKDSDSESEILF----AIEGLNRIAYYYRLARR--------W--NRVFRLKCAVWVKSRMFYWLVILVVFLNTLVIACEHHPQSESATRFQDVANDILLTCFAFEMFAKMYAFGLRAYFMSVFNRFDFFVVTVGILEIILVAADVMTPLGISVMRCIRLLRFVKITKLYHIF--------------------------------IQVITGE----------EWDTIM--------------YNGIMAHG-----GPQSPGILVSIYFIILYVVGNFILLNVFLAIAVDNLTEAESLSSAQKEKEEEKARKKLMRTAPPHEEEKAKLVKS---------KHKTEGMPTTAKLKVDE---FESNVKEVKD---------PFPPADFPGDDEEEEPEIPISPRPRPMADLQLKETVVPMPEASSFFIFGPENKFRKLCHRAINATPFTNFILLLILLSSISLAAEDAIDPKSFRNKILAYADIVFTTVFTIEIVLKMTVYGAILHTGSFCRNAFNILDLIVVVVSLLSM--------------GLESSAISVIKILRVLRVLRPLRALNRAKGLK------VCSLETRIIQLNMNMLPEVLFTLLGT-------------------TVKGTFVKHVRNSLHDKEIGQRQWVNSDFNFDNVPNAMLALFTVSTFEGWPELLYKAIDSDAEDRGPVFNNRMDTSLFFVIYLIIIAFFMMNIFVGFVIVTFREQGEQEFKNCELDKNQRQCVQYALKARPLRCYIPKNP--YQYRVWYLVTSCYFEYLMFLLIILNTCSLGLQHCNQSDHITKLADT----------------LNVIFTVLFTFEMIVKLIAFKAKGYFGDPWNVFDFLIVIGSIVDVVLSQVDAALESSGGLYCLHGCTVNISLHCMVSITFFRLFRVLRLIKLLNRSEGIRNLLWTFIKSFQAFPHVALLIVMLFFIYAVIGMQVFGKIALVDGTEINRNANFQTFPQAILILYRTVTGEGWQKLMLACMSGKLCDPRSDYAPGEEYTCGTNFAVFYFLSFNMICGFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKKIWAEYDPEATGRIKHLDVVTLLRRIQPPLGFGKFCPHRSACRRLISMNMPLNSDGTVTFNATLFALVRTDLSIK--TEGNFEQANEELRLIIKSIWKRTSMKLLDQVIPPIGE---DEVTVGKFYATFLIQEHFRKFMKRQEEYYGYRPTKKSAAEIQAGLR-TIEEEAAPEL 1487          
BLAST of Voltage dependent L type calcium channel subunit vs. Ensembl Cavefish
Match: cacna1bb (calcium channel, voltage-dependent, N type, alpha 1B subunit, b [Source:ZFIN;Acc:ZDB-GENE-090514-4])

HSP 1 Score: 932.939 bits (2410), Expect = 0.000e+0
Identity = 493/844 (58.41%), Postives = 634/844 (75.12%), Query Frame = 2
Query: 2954 LNTNKPNGKLGMLGHDNTNFNSLE-SDPVPNKIEPETIQRKPVLPYSAMFIFSPLNSLRRFCHFVVNLRYFDLFIMIVICASSIALAAEDPVKEKSLKNNILEFFDYAFTGVFTVEMILKIIDLGIILHPGSYCRDLWNILDATVVICALVAFIMGQKPSPTGNKLRGSSAKNLNTIKSLRVLRVLRPLKTINRVPKLKAVFDCVVSSLKNVFNILIVYILFQFIFAVIAVQLFQGKFFYCNDASKSSRETCRGYFFDYAGRSTPETKKRLWQHHDFHFDNILYAMLTLFTVTTGEGWPTVLKNSMESTNIDNGPIADYRQEMAXXXXXXXXXXXXXXXXXXXALIIITFQEQGENELIDLDLDKNQKQCIDFAINEKPLCRYMPKDKTTIKYRVWRLVVSTPFEYFIMVMIALNTLILMMKYYREEKKASSAATHDREQQAYLNYCNTLIFLNSAFTVMFSIECVLKIMAFGPKNYFRDPWNIFDFITVIGSITDVLVSELQDXXXXXXXXXXXXXXXXXXXXXXQGYTIRILLWTFIQSFKALPYVCLLIAMLFFIYSIIGMQVFGNIKLISEYQINRHNNFQTFTNGLLLLFRCATGESWQEIMLACDNNKPCEKDIENTNNFDCGSNFTYIYFVSFIFLCSFLMLNLFVAVIMDNFDYLTRDSSILGPHHLDEYIRVWAEYDPGAIGRIHHSEMYEMLRNMEPPVGFGKKCPYRLAYRKLIRMNMPVDENGTVNFTTTLFALIRESLNIKMSTAEYMD-IKDMELRQTICKMWPVQAKKKLNLIVPPDSELVFHKMTVGKIYAGYLIVENWRA--YKNSQEQGPRSSPAVSIKSVTKPVV 5473
            +    P G+  ++  +N + +SL  S+   +  E   I  K +LPYS+MF+F   N +RR CH+VVNLRYF++ I+ VI  SSIALAAEDPV+  + +NN+L++ DY FTGVFT EM++K+IDLG++LHPGSY RDLWNILD  VV  ALVAF              GS  K++NTIKSLRVLRVLRPLKTI R+PKLKAVFDCVV+SLKNV NILIVYILF FIFAVIAVQLF+GKFFYC D SK+ ++ CRG F DY G      + R W+ ++FH+DN+L+A LTLFTV+TGEGWP VLK+S+++T  D GP   YR E +IFY+V+F+VFPFFFVNIFVALIIITFQEQG+  + D  L+KN++ CIDFAIN KPL RYMP+DK + +Y++W+ VVSTPFEY I+ MIA+NT++LMMK++   K                 Y + L +LN  FT +F++EC+LKI+AFG  NY ++ WNIFDF+TV+GSITD+LV+E++    ++L FLRLFRAARLIKLLRQGYTIRILLWTF+QSFKALPYVCLLIAMLFFIY+IIGMQVFGNI L  +  IN HNNF+TF   L+LLFR ATGE+W EIMLAC + KPC+  +  ++  +CGS F Y YFVSFIFLCSFLMLNLFVAVIMDNF+YLTRD+SILGPHHLDE+IRVWAEYDP A GRI + +MYEMLR+M PP+G GKKCP R+AY++L+RMNMP+ ++ TV+FT+TL ALIR +L+IK+++      + D++LR+ I K+WP    K ++L+V P      +++TVGK+YA  +I + ++    K  Q+Q P   P   + ++ KP++
Sbjct: 1048 VTVTAPPGETTIIPMNNIDGDSLLLSEEKKDLDELNQIPPKHILPYSSMFVFGQSNPVRRLCHYVVNLRYFEMCILTVITMSSIALAAEDPVQANAPRNNVLKYLDYVFTGVFTFEMVIKMIDLGLLLHPGSYFRDLWNILDFIVVTGALVAFACS-----------GSKGKDINTIKSLRVLRVLRPLKTIKRLPKLKAVFDCVVNSLKNVLNILIVYILFMFIFAVIAVQLFKGKFFYCTDESKALQKDCRGQFLDYDGDEV-SAQPREWKKYEFHYDNVLWAFLTLFTVSTGEGWPMVLKHSVDATYEDQGPSPGYRMETSIFYVVYFVVFPFFFVNIFVALIIITFQEQGDKAMSDCSLEKNERACIDFAINAKPLTRYMPQDKQSYQYKMWKFVVSTPFEYSILTMIAVNTVVLMMKFHEAPKP----------------YEDMLKWLNIIFTALFTLECILKIIAFGLLNYLKEAWNIFDFVTVLGSITDILVTEIKQDKLINLSFLRLFRAARLIKLLRQGYTIRILLWTFVQSFKALPYVCLLIAMLFFIYAIIGMQVFGNIDLNEDTSINHHNNFRTFFQALMLLFRSATGEAWHEIMLACLSEKPCDP-LSGSSEKECGSEFAYFYFVSFIFLCSFLMLNLFVAVIMDNFEYLTRDASILGPHHLDEFIRVWAEYDPAACGRISYLDMYEMLRHMSPPLGLGKKCPSRIAYKRLVRMNMPIADDNTVHFTSTLMALIRTALDIKLASGVLAQRLCDIDLRREINKVWPSLQPKTVDLLVTPHKH---NELTVGKVYAALMIFDYYKQNRAKRLQQQQPSVGPQSKMGALFKPML 1859          

HSP 2 Score: 717.613 bits (1851), Expect = 0.000e+0
Identity = 415/682 (60.85%), Postives = 507/682 (74.34%), Query Frame = 2
Query:  689 STSKSLFIFSEENVIRKYAKIIIEWGPFEYMVLLTILANCIVLSMERHLPKKDKTLLAGQLELTEKYFLGIFCVEALLKIVALGFCCHKEAYLRNVWNIMDFVVVVTGFLMMFLNIDNHSDSSTVDLRTLRAVRVLRPLKLVAGFPSLQVVLKSIIRAMAPLLQIGLLVLFAITIFAIIGLEFYSGAFHYTCFKANSDKLPLPIPTEKSLVPCSNSKNGSGLGAYTCPEDYQCKAYWEGPNYGITSFDNIGYAMLTVFQCITMEGWTDIMYHTNDAIGNRFNWLYFVPLIILGSFFMLNLVLGVLSGXXXXXXXXXXXXXXXLKLRRQQQTEKEFNGYMEWIQKAEEVLLNEATTTSEDKMRIIAARRRAEKQKYKLL-------GKNQSIPDFEYEDTELYSETKSMKGNIFIRSYAGIRRRRKERCTSFWRTEKHFRFSVRRLVKSQPFYWAVIILVFFNTVCVAIEHYEQGKWLTLFLNYAEYVFLCLFMMEMMIKMYGLSIRVYFQSSFNIFDCVVIAGSLFEIIYGIFVQDSSFGLSVLRALRLLRIFKVTRYWAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMQLFGGEFNFEEGKPPQNFDTFVKALLTVFQILTGEDWNTVMYNGIQSKGGVKERGTVFSIYFVLLVVFGNYTLLNVFLAIAVDNLAN 2713
            + ++SLFIFSE+NVIRKYAK I EW PFEYM+L TI+ANCIVL++E+HLP  DKT ++ +L+ TE YF+GIFC EA +KI+ALGF  HK +YLRN WN+MDFVVV+TG L            S  DLRTLRAVRVLRPLKLV+G PSLQVVLKSI++AM PLLQIGLL+ FAI +FAIIG+EFY G FH +CFK + +          S  PC     G+   +  CP    C+ YW+GPNYGIT+FDNI +A+LTVFQCITMEGW D++Y TNDA GN +NWLYF+PLII+GSFFMLNLVLGVLSGEFAKERERVEKR+ FLKLRRQQQ E+E  GY+EWI KAEEVLL E    +E+K  +  A  +  KQ   +L       GKN  I   E E+      + +  G+ F R  A ++  + +  + F R EK  RF +RR+VK+Q FYW V+ +V  NT+CVA+ HY+Q  WL+  L  AE+VFL LF+ EM +KMYGL  R YF SSFN FD  VI GS+FE+++      +SFG+SVLRALRLLRIFKVT+YW SLRNLV+SLLNSM+SIISLLFLLFLFI++FALLGMQLFGG+FNF++  P  NFD F  A++TVFQILTGEDWN VMY+GI+S+GGV+ RG   SIYF++L +FGNYTLLNVFLAIAVDNLAN
Sbjct:   55 TVNRSLFIFSEDNVIRKYAKRITEWPPFEYMILATIIANCIVLALEQHLPVGDKTPMSERLDDTEPYFIGIFCFEAGIKIIALGFVFHKGSYLRNGWNVMDFVVVLTGILATV--------GSDFDLRTLRAVRVLRPLKLVSGIPSLQVVLKSIMKAMVPLLQIGLLLFFAIVMFAIIGVEFYMGKFHTSCFKESGEL--------ASDWPC-----GTEAPSRLCPNGTVCRTYWKGPNYGITNFDNILFAVLTVFQCITMEGWVDVLYSTNDASGNTWNWLYFIPLIIIGSFFMLNLVLGVLSGEFAKERERVEKRQEFLKLRRQQQIERELTGYLEWICKAEEVLLAEEDQNAEEKSPLDGAWYK-RKQNNPVLKRAKVKKGKNDLISAEEGEERFTDISSVAPPGSPFAR--ASLKSSKNDSSSYFRRKEKRVRFFIRRMVKAQSFYWIVLCIVGLNTLCVAMVHYDQPDWLSQALYLAEFVFLGLFLSEMTLKMYGLGPRNYFHSSFNCFDFGVIVGSIFEVVWAAIQPGASFGISVLRALRLLRIFKVTKYWNSLRNLVVSLLNSMKSIISLLFLLFLFIVVFALLGMQLFGGQFNFDKETPTTNFDNFPAAIMTVFQILTGEDWNAVMYHGIESQGGVR-RGMFSSIYFIVLTLFGNYTLLNVFLAIAVDNLAN 711          

HSP 3 Score: 121.709 bits (304), Expect = 8.705e-27
Identity = 81/272 (29.78%), Postives = 139/272 (51.10%), Query Frame = 2
Query: 3092 AMFIFSPLNSLRRFCHFVVNLRYFDLFIMIVICASSIALAAED--PVKEKSLKNNILEFFDYAFTGVFTVEMILKIIDLGIILHPGSYCRDLWNILDATVVICALVAFIMGQKPSPTGNKLRGSSAKNLNTIKSLRVLRVLRPLKTINRVPKLKAVFDCVVSSLKNVFNILIVYILFQFIFAVIAVQLFQGKFFYCNDASKSSRETCRGY--FFDYAGRSTPETK--KRLWQHHDF---HFDNILYAMLTLFTVTTGEGWPTVLKNSMESTN 3880
            ++FIFS  N +R++   +     F+  I+  I A+ I LA E   PV +K+  +  L+  +  F G+F  E  +KII LG + H GSY R+ WN++D  VV+  ++A +             GS       +++LR +RVLRPLK ++ +P L+ V   ++ ++  +  I ++      +FA+I V+ + GKF       K S E    +    +   R  P     +  W+  ++   +FDNIL+A+LT+F   T EGW  VL ++ +++ 
Sbjct:   59 SLFIFSEDNVIRKYAKRITEWPPFEYMILATIIANCIVLALEQHLPVGDKTPMSERLDDTEPYFIGIFCFEAGIKIIALGFVFHKGSYLRNGWNVMDFVVVLTGILATV-------------GSDFD----LRTLRAVRVLRPLKLVSGIPSLQVVLKSIMKAMVPLLQIGLLLFFAIVMFAIIGVEFYMGKFH--TSCFKESGELASDWPCGTEAPSRLCPNGTVCRTYWKGPNYGITNFDNILFAVLTVFQCITMEGWVDVLYSTNDASG 311          

HSP 4 Score: 114.775 bits (286), Expect = 9.346e-25
Identity = 71/272 (26.10%), Postives = 133/272 (48.90%), Query Frame = 2
Query:  701 SLFIFSEENVIRKYAKIIIEWGPFEYMVLLTILANCIVLSMERHLPKKDKTLLAGQLELTEKYFLGIFCVEALLKIVALGFCCHKEAYLRNVWNIMDFVVVVTGFLMMFLNIDNHSDSSTVDLRTLRAVRVLRPLKLVAGFPSLQVVLKSIIRAMAPLLQIGLLVLFAITIFAIIGLEFYSGAFHYTCFKANSDKLPLPIPTEKSLVPCSNSKNGSGLGAYTCPEDYQCKAYWEGPNYGITSFDNIGYAMLTVFQCITMEGWTDIMYHTNDA 1516
            S+F+F + N +R+    ++    FE  +L  I  + I L+ E   P +        L+  +  F G+F  E ++K++ LG   H  +Y R++WNI+DF+VV    +    +     D +T+  ++LR +RVLRPLK +   P L+ V   ++ ++  +L I ++ +  + IFA+I ++ + G F Y   ++ +         +K         +G  + A   P +++   +          +DN+ +A LT+F   T EGW  ++ H+ DA
Sbjct: 1095 SMFVFGQSNPVRRLCHYVVNLRYFEMCILTVITMSSIALAAED--PVQANAPRNNVLKYLDYVFTGVFTFEMVIKMIDLGLLLHPGSYFRDLWNILDFIVVTGALVAFACSGSKGKDINTI--KSLRVLRVLRPLKTIKRLPKLKAVFDCVVNSLKNVLNILIVYILFMFIFAVIAVQLFKGKFFYCTDESKA--------LQKDCRGQFLDYDGDEVSAQ--PREWKKYEF---------HYDNVLWAFLTLFTVSTGEGWPMVLKHSVDA 1343          

HSP 5 Score: 97.0561 bits (240), Expect = 2.372e-19
Identity = 72/255 (28.24%), Postives = 139/255 (54.51%), Query Frame = 2
Query: 1970 EKHFRFSVRRLVKSQPFYWAVIILVFFNTVCVAIEHYEQGKWLTLFLNYAEYVFLCLFMMEMMIKMYGLSIRVYFQSSFNIFDCVVIAGSLFEIIYGIFVQDSSFGLSVLRALRLLRIFKVTRYWAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMQLFGG-EFNFEEG-KPPQNFDTFVKALLTVFQILTGEDWNTVMYNGIQSK-------GGVKERGTVFS-IYFVLLVVFGNYTLLNVFLAIAVDN 2704
            ++ +++ + + V S PF ++++ ++  NTV + ++ +E  K     L +   +F  LF +E ++K+    +  Y + ++NIFD V + GS+ +I+     QD    LS LR  R  R+ K+ R   ++R L+ + + S +++  +  L+ +   I+A++GMQ+FG  + N +       NF TF +AL+ +F+  TGE W+ +M   +  K          KE G+ F+  YFV  +   ++ +LN+F+A+ +DN
Sbjct: 1423 KQSYQYKMWKFVVSTPFEYSILTMIAVNTVVLMMKFHEAPKPYEDMLKWLNIIFTALFTLECILKIIAFGLLNYLKEAWNIFDFVTVLGSITDILVTEIKQDKLINLSFLRLFRAARLIKLLRQGYTIRILLWTFVQSFKALPYVCLLIAMLFFIYAIIGMQVFGNIDLNEDTSINHHNNFRTFFQALMLLFRSATGEAWHEIMLACLSEKPCDPLSGSSEKECGSEFAYFYFVSFIFLCSFLMLNLFVAVIMDN 1677          

HSP 6 Score: 90.8929 bits (224), Expect = 1.683e-17
Identity = 73/290 (25.17%), Postives = 141/290 (48.62%), Query Frame = 2
Query: 4097 YMPKDKTTIKYRVWRLVVSTPFEYFIMVMIALNTLILMMKYYREEKKASSAATHDREQQAYLNYCNTLIFLNSAFTVMFSIECVLKIMAFGPKNYFRDPWNIFDFITVIGSITDVLVSELQDXXXXXXXXXXXXXXXXXXXXXXQGYTIRILLWTFIQSFKALPYVCLLIAMLFFIYSIIGMQVFGNIKLISEYQINRH---NNFQTFTNGLLLLFRCATGESWQEIMLACDNNKPCEKDIENTNNFDCGSNFTYIYFVSFIFLCSFLMLNLFVAVIMDNF---DYLTRD 4948
            Y  + +  +++ + R+V +  F + ++ ++ LNTL + M +Y +    S A            Y    +FL      +F  E  LK+   GP+NYF   +N FDF  ++GSI +V+ + +Q  +   +  LR  R  R+ K+ +   ++R L+ + + S K++  +  L+ +   +++++GMQ+FG      ++  ++     NF  F   ++ +F+  TGE W  +M            IE+      G  F+ IYF+      ++ +LN+F+A+ +DN      LT+D
Sbjct:  460 YFRRKEKRVRFFIRRMVKAQSFYWIVLCIVGLNTLCVAMVHYDQPDWLSQAL-----------YLAEFVFLG-----LFLSEMTLKMYGLGPRNYFHSSFNCFDFGVIVGSIFEVVWAAIQPGASFGISVLRALRLLRIFKVTKYWNSLRNLVVSLLNSMKSIISLLFLLFLFIVVFALLGMQLFGG-----QFNFDKETPTTNFDNFPAAIMTVFQILTGEDWNAVMY---------HGIESQGGVRRGM-FSSIYFIVLTLFGNYTLLNVFLAIAVDNLANAQELTKD 718          

HSP 7 Score: 79.7221 bits (195), Expect = 4.942e-14
Identity = 74/292 (25.34%), Postives = 118/292 (40.41%), Query Frame = 2
Query:  767 PFEYMVLLTILANCIVLSMERHLPKKDKTLLAGQLELTEKYFLGIFCVEALLKIVALGFCCHKEAYLRNVWNIMDFVVVVTGFLMMFLNIDNHSDSSTVDLRTLRAVRVLRPLKLVAGFPSLQVVLKSIIRAMAPLLQIGLLVLFAITIFAIIGLEFYSGAFHYTCFKANSDKLPLPIPTEKSLVPCSNSKNGSGLGAYTCPEDYQCKAYWEGPNYGITSFDNIGYAMLTVFQCITMEGWTDIMY-------------HTNDAIGNRFNWLYFVPLIILGSFFMLNLVLGVL 1603
            PFEY +L  I  N +VL M+ H   K    +   L +    F  +F +E +LKI+A G       YL+  WNI DFV V+ G +   L  +   D   ++L  LR  R  R +KL+    +++++L + +++   L  + LL+     I+AIIG++ +                                      G     ED     +         +F     A++ +F+  T E W +IM               +    G+ F + YFV  I L SF MLNL + V+
Sbjct: 1438 PFEYSILTMIAVNTVVLMMKFHEAPKPYEDMLKWLNII---FTALFTLECILKIIAFGLL----NYLKEAWNIFDFVTVL-GSITDILVTEIKQD-KLINLSFLRLFRAARLIKLLRQGYTIRILLWTFVQSFKALPYVCLLIAMLFFIYAIIGMQVF--------------------------------------GNIDLNEDTSINHH--------NNFRTFFQALMLLFRSATGEAWHEIMLACLSEKPCDPLSGSSEKECGSEFAYFYFVSFIFLCSFLMLNLFVAVI 1674          

HSP 8 Score: 54.299 bits (129), Expect = 2.516e-6
Identity = 55/251 (21.91%), Postives = 117/251 (46.61%), Query Frame = 2
Query: 3122 LRRFCHFVVNLRYFDLFIMIVICASSIALAAEDPVKEKSLKNNILEFFDYAFTGVFTVEMILKIIDLGIILHPGSYCRDLWNILDATVVICALVAFIMGQKPSPTGNKLRGSSAKNLNTIKSLRVLRVLRPLKTINRVPKLKAVFDCVVSSLKNVFNILIVYILFQFIFAVIAVQLFQGKFFYCNDASKSSRETCRGYFFDYAGRSTPETKKRLWQHHDFHFDNILYAMLTLFTVTTGEGWPTVLKNSMES 3874
            +R F   +V  + F   ++ ++  +++ +A      +    +  L   ++ F G+F  EM LK+  LG    P +Y    +N  D  V++ ++   +           ++  ++  ++ +++LR+LR+ +  K  N    L+ +   +++S+K++ ++L +  LF  +FA++ +QLF G+F +                     + TP T          +FDN   A++T+F + TGE W  V+ + +ES
Sbjct:  468 VRFFIRRMVKAQSFYWIVLCIVGLNTLCVAMVH-YDQPDWLSQALYLAEFVFLGLFLSEMTLKMYGLG----PRNYFHSSFNCFDFGVIVGSIFEVVWA--------AIQPGASFGISVLRALRLLRIFKVTKYWN---SLRNLVVSLLNSMKSIISLLFLLFLFIVVFALLGMQLFGGQFNF--------------------DKETPTT----------NFDNFPAAIMTVFQILTGEDWNAVMYHGIES 672          
BLAST of Voltage dependent L type calcium channel subunit vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010500.1 (pep scaffold:Pmarinus_7.0:GL477503:21958:35427:1 gene:ENSPMAG00000009511.1 transcript:ENSPMAT00000010500.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 355.14 bits (910), Expect = 8.536e-112
Identity = 165/263 (62.74%), Postives = 209/263 (79.47%), Query Frame = 2
Query: 4571 SFKALPYVCLLIAMLFFIYSIIGMQVFGNIKLISEYQINRHNNFQTFTNGLLLLFRCATGESWQEIMLACDNNKPCEKDIENTNNFDCGSNFTYIYFVSFIFLCSFLMLNLFVAVIMDNFDYLTRDSSILGPHHLDEYIRVWAEYDPGAIGRIHHSEMYEMLRNMEPPVGFGKKCPYRLAYRKLIRMNMPVDENGTVNFTTTLFALIRESLNIKMSTAEYMDIK-DMELRQTICKMWPVQAKKKLNLIVPPDSELVFHKMTVG 5356
            S +ALPYVCLLIAMLFFIY+I+GMQVFGN+KL  E  I  HNNFQTF   L+LLFR ATGE+WQEIML+C + KPCE+   N  N  CGS+F Y YFVSFIFLCSFLMLNLFVAVIMDNF+YLTRDSSILGPHHLDE++R+W +YDP A GRI +++MYE+LR+M PP+G GKKCP R+AY++L+RM+MP+ E+ TV+FTTTL ALIR +L+IK++ A     + D ELR+ +  +WP  ++K L+++VPP   +    +TVG
Sbjct:    1 SLQALPYVCLLIAMLFFIYAIVGMQVFGNVKLDDEGGITEHNNFQTFFQALMLLFRSATGEAWQEIMLSCLSKKPCEQHSLNGENV-CGSDFAYFYFVSFIFLCSFLMLNLFVAVIMDNFEYLTRDSSILGPHHLDEFVRIWGDYDPAATGRITYTKMYELLRHMSPPLGLGKKCPVRIAYKRLVRMDMPIAEDNTVHFTTTLMALIRTALDIKIAKAGADKFECDSELRKEMMAIWPTLSQKTLDILVPPHRAV---DLTVG 259          

HSP 2 Score: 49.6766 bits (117), Expect = 3.858e-6
Identity = 32/96 (33.33%), Postives = 52/96 (54.17%), Query Frame = 2
Query: 2447 GMQLFGGEFNFEEGKPPQ--NFDTFVKALLTVFQILTGEDWNTVMYNGIQSK-------GGVKERGTVFS-IYFVLLVVFGNYTLLNVFLAIAVDN 2704
            GMQ+FG     +EG   +  NF TF +AL+ +F+  TGE W  +M + +  K        G    G+ F+  YFV  +   ++ +LN+F+A+ +DN
Sbjct:   23 GMQVFGNVKLDDEGGITEHNNFQTFFQALMLLFRSATGEAWQEIMLSCLSKKPCEQHSLNGENVCGSDFAYFYFVSFIFLCSFLMLNLFVAVIMDN 118          
BLAST of Voltage dependent L type calcium channel subunit vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005302.1 (pep scaffold:Pmarinus_7.0:GL483978:134:5921:-1 gene:ENSPMAG00000004828.1 transcript:ENSPMAT00000005302.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 330.487 bits (846), Expect = 1.536e-102
Identity = 157/266 (59.02%), Postives = 199/266 (74.81%), Query Frame = 2
Query: 4529 QGYTIRILLWTFIQSFKALPYVCLLIAMLFFIYSIIGMQVFGNIKLISEYQINRHNNFQTFTNGLLLLFRCATGESWQEIMLACDNNKPCEKDIENT--NNFDCGSNFTYIYFVSFIFLCSFLMLNLFVAVIMDNFDYLTRDSSILGPHHLDEYIRVWAEYDPGAIGRIHHSEMYEMLRNMEPPVGFGKKCPYRLAYRKLIRMNMPVDENGTVNFTTTLFALIRESLNIKMSTAEYMDIKDMELRQTICKMWPVQAKKKLNLIVPP 5320
            +G  IR LLWTFI+SF+ALPYV LLI MLFFIY++IGMQ+FG I +    QINR+NNFQTF   +LLLFRCATGE+WQ+IMLAC   + C+ D + +    F CGS+F   YFVSF  LC+FL++NLFVAVIMDNFDYLTRD SILGPHHLDE+ R+WAEYDP A GRI H ++  +LR ++PP+GFGK CP+R+A ++L+ MNMP++ +GTV F  TLFAL+R SL IK  T   ++  + ELR  I K+W     K L+ +VPP
Sbjct:   36 RGEGIRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQMFGKIAMQDGSQINRNNNFQTFPQAVLLLFRCATGEAWQDIMLACMPGRRCDPDADASVGEEFSCGSSFAIFYFVSFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWAEYDPEAKGRIKHVDVVTLLRRIQPPLGFGKLCPHRVACKRLVSMNMPLNSDGTVMFNATLFALVRTSLKIK--TDGNLEQANEELRAVIKKIWKRTNMKLLDQVVPP 299          
BLAST of Voltage dependent L type calcium channel subunit vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008632.1 (pep scaffold:Pmarinus_7.0:GL481395:151307:166184:-1 gene:ENSPMAG00000007818.1 transcript:ENSPMAT00000008632.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 330.872 bits (847), Expect = 2.556e-99
Identity = 239/522 (45.79%), Postives = 319/522 (61.11%), Query Frame = 2
Query: 1994 RRLVKSQPFYWAVIILVFFNTVCVAIEHYEQGKWLTLFLNYAEYVFLCLFMMEMMIKMYGLSIRVYFQSSFNIFDCVVIAGSLFEIIYGIFVQDSSFGLSVLRALRLLRIFKVTRYWAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMQLFGGEFNFEEGKPPQ-NFDTFVKALLTVF-QILTGEDWNTVMYNGIQSKGGVKERGTVFSIYFVLLVVFGNYTLLNVFLAIAVDNLANXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSSDNFIGRLPLSIDPPMVQVCPPSPQTANSLISKNFSFDHNQVEVNDKGCLLNTNKPNGKLGMLGHDNTNFNSLESDPVPNKIEPETIQRK--PVLPYSAMFIFSPLNSLRRFCHFVVNLRYFDLFIMIVICASSIALAAEDPVKEKSLKNNILEFFDYAFTGVFTVEMILKIIDLGIILHPGSYCRDLWNILDATVVICALVAFIMGQKPSPTGNKLRGSSAKNLNTIKSLRVLRVLRPLKTINRVPKLK 3547
            R  VKS  FYW VI+LVF NT+ +A EHY+Q +WLT   + A  V L LF +EM++K+Y L ++ YF S FN FDC V+ G + E I       S  G+SVLR +RLLRIFK TRYW SL NLV SLLNSMRSI SLL LLFLFI+IF+LLGMQLFGG+FNF+E +  + +FD F  ALLTVF QILTGEDWN+VMY+GI++ GG    G +  IYF++L + GNY LLNVFLAIAVDNLA+A+ LT+A+ E   E +R   A     E   + N          P +V VC          + K    D +  +  +K     +  P  +    G D+ +   +   P P ++    I+ K  P+   SA F+FS  N  R  CH ++N   F   I++ I  SS++LAAEDP++  S +N IL +FDYAFT +FT+E++LK+   G  +H GS+CR  +N+LD  VV  +L++F            ++ SSA  ++ +K LRVLRVLRPL+ INR   LK
Sbjct:   54 RAAVKSTAFYWMVIVLVFLNTLTIASEHYDQMQWLTHVQDTANKVLLALFTLEMLVKIYSLGLQAYFVSLFNRFDCFVVCGGIVETILVELKVMSPLGISVLRCVRLLRIFKATRYWNSLSNLVASLLNSMRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDETQVRRSSFDNFPTALLTVFQQILTGEDWNSVMYDGIRAYGGPSFPGMLVCIYFIILFICGNYILLNVFLAIAVDNLADAESLTSAQREAEEEKERKKIARITPRERVWNGN----------PGLVSVCVS--------VWKIPLDDPDGEDDKEKDPYPPSEYPGWRRHDTGDDDESEPEVPMGPRPRRLSELQIKEKVVPMPESSAFFLFSHTNPFRILCHHIINHTIFTNLILVFIMLSSVSLAAEDPIRSTSFRNEILGYFDYAFTTIFTIEIMLKMTAYGAFVHKGSFCRSYFNLLDLLVVGVSLISF-----------GIQWSSA--ISVVKILRVLRVLRPLRAINRAKGLK 544          

HSP 2 Score: 72.4034 bits (176), Expect = 6.804e-13
Identity = 129/554 (23.29%), Postives = 222/554 (40.07%), Query Frame = 2
Query:  770 FEYMVLLTILANCIVLSMERHLPKKDKTLLAGQLELTEKYFLGIFCVEALLKIVALGFCCHKEAYLRNVWNIMDFVVVVTGFLMMFLNIDNHSDSSTVDLRTLRAVRVLRPLKLVAGFPSLQVVLKSIIRAMAPLLQIGLLVLFAITIFAIIGLEFYSGAFHYTCFKANSDKLPLPIPTEKSLVPCSNSKNGSGLGAYTCPEDYQCKAYWEGPNYGITSFDNIGYAMLTVFQCI-TMEGWTDIMYHTNDAIGN-----RFNWLYFVPLIILGSFFMLNLVLGVL------SGXXXXXXXXXXXXXXXLKLRRQQQTEKEFNGYMEWIQKAEEVLLNEATTTSEDKMRIIAARRRAEKQKYKLLGKNQSIPDFEYEDTELYSETKSMKGNIFIRSYAGIRRRR------KERCTSFWRTEKHFRFS--------VRRLVKSQPFYWAVIILVFFNTVCVAIEH-YEQGKWLTLFLNYAEYVFLCLFMMEMMIKM--YGLSIR--VYFQSSFNIFDCVVIAGSLFEIIYGIFVQDSSFGLSVLRALRLLRIFKVTR 2338
            F +MV++ +  N + ++ E +        L    +   K  L +F +E L+KI +LG     +AY  +++N  D  VV  G +   L        S + +  LR VR+LR  K    + SL  ++ S++ +M  +  + LL+   I IF+++G++ + G F++                                      ++ Q +          +SFDN   A+LTVFQ I T E W  +MY    A G          +YF+ L I G++ +LN+ L +       +      +   E+ +   K+ R    E+ +NG    +     V             +I       E  K K        P +   DT    E++            G R RR      KE+      +   F FS           ++    F   +++ +  ++V +A E       +    L Y +Y F  +F +E+M+KM  YG  +    + +S FN+ D +V+  SL  I +GI  Q SS  +SV++ LR+LR+ +  R
Sbjct:   62 FYWMVIVLVFLNTLTIASEHY---DQMQWLTHVQDTANKVLLALFTLEMLVKIYSLGL----QAYFVSLFNRFDCFVVCGGIVETILV--ELKVMSPLGISVLRCVRLLRIFKATRYWNSLSNLVASLLNSMRSIASLLLLLFLFIIIFSLLGMQLFGGKFNF--------------------------------------DETQVRR---------SSFDNFPTALLTVFQQILTGEDWNSVMYDGIRAYGGPSFPGMLVCIYFIILFICGNYILLNVFLAIAVDNLADAESLTSAQREAEEEKERKKIARITPRERVWNGNPGLVSVCVSV------------WKIPLDDPDGEDDKEKDPYPPSEYPGWRRHDTGDDDESEP-------EVPMGPRPRRLSELQIKEKVVPMPESSAFFLFSHTNPFRILCHHIINHTIFTNLILVFIMLSSVSLAAEDPIRSTSFRNEILGYFDYAFTTIFTIEIMLKMTAYGAFVHKGSFCRSYFNLLDLLVVGVSL--ISFGI--QWSS-AISVVKILRVLRVLRPLR 535          

HSP 3 Score: 63.5438 bits (153), Expect = 3.875e-10
Identity = 72/264 (27.27%), Postives = 129/264 (48.86%), Query Frame = 2
Query: 4145 VVSTPFEYFIMVMIALNTLILMMKYYREEKKASSAATHDREQQAYLNYCNTLIFLNSAFTVMFSIECVLKIMAFGPKNYFRDPWNIFDFITVIGSITDVLVSELQDXXXXXXXXXXXXXXXXXXXXXXQGYTIRILLWTFIQSFKALPYVCLLIAMLFFIYSIIGMQVFGNIKLISEYQINRHNNFQTFTNGLLLLF-RCATGESWQEIMLACDNNKPCEKDIENTNNFDCGSNFTYIYFVSFIFLC-SFLMLNLFVAVIMDNF 4930
            V ST F + ++V++ LNTL +  ++Y              +Q  +L +       N     +F++E ++KI + G + YF   +N FD   V G I + ++ EL+  S L +  LR  R  R+ K  R   ++  L+ + + S +++  + LL+ +   I+S++GMQ+FG      E Q+ R ++F  F   LL +F +  TGE W  +M            I              IYF+  +F+C ++++LN+F+A+ +DN 
Sbjct:   57 VKSTAFYWMVIVLVFLNTLTIASEHY--------------DQMQWLTHVQDTA--NKVLLALFTLEMLVKIYSLGLQAYFVSLFNRFDCFVVCGGIVETILVELKVMSPLGISVLRCVRLLRIFKATRYWNSLSNLVASLLNSMRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDETQV-RRSSFDNFPTALLTVFQQILTGEDWNSVMY---------DGIRAYGGPSFPGMLVCIYFI-ILFICGNYILLNVFLAIAVDNL 293          

HSP 4 Score: 58.151 bits (139), Expect = 2.157e-8
Identity = 43/140 (30.71%), Postives = 71/140 (50.71%), Query Frame = 2
Query:  695 SKSLFIFSEENVIRKYAKIIIEWGPFEYMVLLTILANCIVLSMERHLPKKDKTLLAGQLELTEKYFLGIFCVEALLKIVALGFCCHKEAYLRNVWNIMDFVVVVTGFLMMFLNIDNHSDSSTVDLRTLRAVRVLRPLKLV 1114
            S + F+FS  N  R     II    F  ++L+ I+ + + L+ E   P +  +     L   +  F  IF +E +LK+ A G   HK ++ R+ +N++D +VV  G  ++   I   S  S V  + LR +RVLRPL+ +
Sbjct:  404 SSAFFLFSHTNPFRILCHHIINHTIFTNLILVFIMLSSVSLAAED--PIRSTSFRNEILGYFDYAFTTIFTIEIMLKMTAYGAFVHKGSFCRSYFNLLDLLVV--GVSLISFGIQWSSAISVV--KILRVLRVLRPLRAI 537          
BLAST of Voltage dependent L type calcium channel subunit vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008630.1 (pep scaffold:Pmarinus_7.0:GL481395:151307:166184:-1 gene:ENSPMAG00000007818.1 transcript:ENSPMAT00000008630.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 330.487 bits (846), Expect = 5.602e-99
Identity = 239/522 (45.79%), Postives = 319/522 (61.11%), Query Frame = 2
Query: 1994 RRLVKSQPFYWAVIILVFFNTVCVAIEHYEQGKWLTLFLNYAEYVFLCLFMMEMMIKMYGLSIRVYFQSSFNIFDCVVIAGSLFEIIYGIFVQDSSFGLSVLRALRLLRIFKVTRYWAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMQLFGGEFNFEEGKPPQ-NFDTFVKALLTVF-QILTGEDWNTVMYNGIQSKGGVKERGTVFSIYFVLLVVFGNYTLLNVFLAIAVDNLANXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSSDNFIGRLPLSIDPPMVQVCPPSPQTANSLISKNFSFDHNQVEVNDKGCLLNTNKPNGKLGMLGHDNTNFNSLESDPVPNKIEPETIQRK--PVLPYSAMFIFSPLNSLRRFCHFVVNLRYFDLFIMIVICASSIALAAEDPVKEKSLKNNILEFFDYAFTGVFTVEMILKIIDLGIILHPGSYCRDLWNILDATVVICALVAFIMGQKPSPTGNKLRGSSAKNLNTIKSLRVLRVLRPLKTINRVPKLK 3547
            R  VKS  FYW VI+LVF NT+ +A EHY+Q +WLT   + A  V L LF +EM++K+Y L ++ YF S FN FDC V+ G + E I       S  G+SVLR +RLLRIFK TRYW SL NLV SLLNSMRSI SLL LLFLFI+IF+LLGMQLFGG+FNF+E +  + +FD F  ALLTVF QILTGEDWN+VMY+GI++ GG    G +  IYF++L + GNY LLNVFLAIAVDNLA+A+ LT+A+ E   E +R   A     E   + N          P +V VC          + K    D +  +  +K     +  P  +    G D+ +   +   P P ++    I+ K  P+   SA F+FS  N  R  CH ++N   F   I++ I  SS++LAAEDP++  S +N IL +FDYAFT +FT+E++LK+   G  +H GS+CR  +N+LD  VV  +L++F            ++ SSA  ++ +K LRVLRVLRPL+ INR   LK
Sbjct:   74 RAAVKSTAFYWMVIVLVFLNTLTIASEHYDQMQWLTHVQDTANKVLLALFTLEMLVKIYSLGLQAYFVSLFNRFDCFVVCGGIVETILVELKVMSPLGISVLRCVRLLRIFKATRYWNSLSNLVASLLNSMRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDETQVRRSSFDNFPTALLTVFQQILTGEDWNSVMYDGIRAYGGPSFPGMLVCIYFIILFICGNYILLNVFLAIAVDNLADAESLTSAQREAEEEKERKKIARITPRERVWNGN----------PGLVSVCVS--------VWKIPLDDPDGEDDKEKDPYPPSEYPGWRRHDTGDDDESEPEVPMGPRPRRLSELQIKEKVVPMPESSAFFLFSHTNPFRILCHHIINHTIFTNLILVFIMLSSVSLAAEDPIRSTSFRNEILGYFDYAFTTIFTIEIMLKMTAYGAFVHKGSFCRSYFNLLDLLVVGVSLISF-----------GIQWSSA--ISVVKILRVLRVLRPLRAINRAKGLK 564          

HSP 2 Score: 73.1738 bits (178), Expect = 4.173e-13
Identity = 129/554 (23.29%), Postives = 222/554 (40.07%), Query Frame = 2
Query:  770 FEYMVLLTILANCIVLSMERHLPKKDKTLLAGQLELTEKYFLGIFCVEALLKIVALGFCCHKEAYLRNVWNIMDFVVVVTGFLMMFLNIDNHSDSSTVDLRTLRAVRVLRPLKLVAGFPSLQVVLKSIIRAMAPLLQIGLLVLFAITIFAIIGLEFYSGAFHYTCFKANSDKLPLPIPTEKSLVPCSNSKNGSGLGAYTCPEDYQCKAYWEGPNYGITSFDNIGYAMLTVFQCI-TMEGWTDIMYHTNDAIGN-----RFNWLYFVPLIILGSFFMLNLVLGVL------SGXXXXXXXXXXXXXXXLKLRRQQQTEKEFNGYMEWIQKAEEVLLNEATTTSEDKMRIIAARRRAEKQKYKLLGKNQSIPDFEYEDTELYSETKSMKGNIFIRSYAGIRRRR------KERCTSFWRTEKHFRFS--------VRRLVKSQPFYWAVIILVFFNTVCVAIEH-YEQGKWLTLFLNYAEYVFLCLFMMEMMIKM--YGLSIR--VYFQSSFNIFDCVVIAGSLFEIIYGIFVQDSSFGLSVLRALRLLRIFKVTR 2338
            F +MV++ +  N + ++ E +        L    +   K  L +F +E L+KI +LG     +AY  +++N  D  VV  G +   L        S + +  LR VR+LR  K    + SL  ++ S++ +M  +  + LL+   I IF+++G++ + G F++                                      ++ Q +          +SFDN   A+LTVFQ I T E W  +MY    A G          +YF+ L I G++ +LN+ L +       +      +   E+ +   K+ R    E+ +NG    +     V             +I       E  K K        P +   DT    E++            G R RR      KE+      +   F FS           ++    F   +++ +  ++V +A E       +    L Y +Y F  +F +E+M+KM  YG  +    + +S FN+ D +V+  SL  I +GI  Q SS  +SV++ LR+LR+ +  R
Sbjct:   82 FYWMVIVLVFLNTLTIASEHY---DQMQWLTHVQDTANKVLLALFTLEMLVKIYSLGL----QAYFVSLFNRFDCFVVCGGIVETILV--ELKVMSPLGISVLRCVRLLRIFKATRYWNSLSNLVASLLNSMRSIASLLLLLFLFIIIFSLLGMQLFGGKFNF--------------------------------------DETQVRR---------SSFDNFPTALLTVFQQILTGEDWNSVMYDGIRAYGGPSFPGMLVCIYFIILFICGNYILLNVFLAIAVDNLADAESLTSAQREAEEEKERKKIARITPRERVWNGNPGLVSVCVSV------------WKIPLDDPDGEDDKEKDPYPPSEYPGWRRHDTGDDDESEP-------EVPMGPRPRRLSELQIKEKVVPMPESSAFFLFSHTNPFRILCHHIINHTIFTNLILVFIMLSSVSLAAEDPIRSTSFRNEILGYFDYAFTTIFTIEIMLKMTAYGAFVHKGSFCRSYFNLLDLLVVGVSL--ISFGI--QWSS-AISVVKILRVLRVLRPLR 555          

HSP 3 Score: 63.5438 bits (153), Expect = 4.287e-10
Identity = 72/264 (27.27%), Postives = 129/264 (48.86%), Query Frame = 2
Query: 4145 VVSTPFEYFIMVMIALNTLILMMKYYREEKKASSAATHDREQQAYLNYCNTLIFLNSAFTVMFSIECVLKIMAFGPKNYFRDPWNIFDFITVIGSITDVLVSELQDXXXXXXXXXXXXXXXXXXXXXXQGYTIRILLWTFIQSFKALPYVCLLIAMLFFIYSIIGMQVFGNIKLISEYQINRHNNFQTFTNGLLLLF-RCATGESWQEIMLACDNNKPCEKDIENTNNFDCGSNFTYIYFVSFIFLC-SFLMLNLFVAVIMDNF 4930
            V ST F + ++V++ LNTL +  ++Y              +Q  +L +       N     +F++E ++KI + G + YF   +N FD   V G I + ++ EL+  S L +  LR  R  R+ K  R   ++  L+ + + S +++  + LL+ +   I+S++GMQ+FG      E Q+ R ++F  F   LL +F +  TGE W  +M            I              IYF+  +F+C ++++LN+F+A+ +DN 
Sbjct:   77 VKSTAFYWMVIVLVFLNTLTIASEHY--------------DQMQWLTHVQDTA--NKVLLALFTLEMLVKIYSLGLQAYFVSLFNRFDCFVVCGGIVETILVELKVMSPLGISVLRCVRLLRIFKATRYWNSLSNLVASLLNSMRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDETQV-RRSSFDNFPTALLTVFQQILTGEDWNSVMY---------DGIRAYGGPSFPGMLVCIYFI-ILFICGNYILLNVFLAIAVDNL 313          

HSP 4 Score: 57.7658 bits (138), Expect = 2.371e-8
Identity = 43/140 (30.71%), Postives = 71/140 (50.71%), Query Frame = 2
Query:  695 SKSLFIFSEENVIRKYAKIIIEWGPFEYMVLLTILANCIVLSMERHLPKKDKTLLAGQLELTEKYFLGIFCVEALLKIVALGFCCHKEAYLRNVWNIMDFVVVVTGFLMMFLNIDNHSDSSTVDLRTLRAVRVLRPLKLV 1114
            S + F+FS  N  R     II    F  ++L+ I+ + + L+ E   P +  +     L   +  F  IF +E +LK+ A G   HK ++ R+ +N++D +VV  G  ++   I   S  S V  + LR +RVLRPL+ +
Sbjct:  424 SSAFFLFSHTNPFRILCHHIINHTIFTNLILVFIMLSSVSLAAED--PIRSTSFRNEILGYFDYAFTTIFTIEIMLKMTAYGAFVHKGSFCRSYFNLLDLLVV--GVSLISFGIQWSSAISVV--KILRVLRVLRPLRAI 557          
BLAST of Voltage dependent L type calcium channel subunit vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003253.1 (pep scaffold:Pmarinus_7.0:GL478330:685:47673:1 gene:ENSPMAG00000002915.1 transcript:ENSPMAT00000003253.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 317.39 bits (812), Expect = 6.418e-91
Identity = 219/379 (57.78%), Postives = 265/379 (69.92%), Query Frame = 2
Query: 1655 LKLRRQQQTEKEFNGYMEWIQKAEEVLLNEATTTSEDKMRI-----------------IAAR-------RRA--EKQKYKLLGKNQSIPDFEYEDTELYSETKSMKGNIFIRSYAGIRRRRKERCTSFWRTEKHFRFSVRRLVKSQPFYWAVIILVFFNTVCVAIEHYEQGKWLTLFLNYAEYVFLCLFMMEMMIKMYGLSIRVYFQSSFNIFDCVVIAGSLFEIIYGIFVQDSSFGLSVLRALRLLRIFKVTRYWAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMQLFGGEFNFEEGKPPQNFDTFVKALLTVFQILTGEDWNTVMYNGIQSKGGVKERGTVFSIYFVLLVVFGNYTLLNVFLAIAVDNLAN 2713
            LKLRRQQQ E+E NGYMEWI KAEEV+L E    +EDK                    +++R       RRA  +K +  L+   + +        E +S+  S  G+ F R  A I   ++E  + F R EK  RF +RR+VKS  FYW V+ LV  NT+CVAI HY+Q   LT  L YAE+VFL LF+ EM++KMYGL  R YF SSFN FD  VI GS+FEII+      +SFG+ VLRALRLLRIFKVT+YWASLRNLV+SLLNSM+SIISLLFLLFLFI++FALLGMQLFGG+FNFEE  PP NFDTF  A++TVFQILTGEDWN VMY+ I+S+GG+  RGT+F IYF++L +FGNYTLLNVFLAIAVDNLAN
Sbjct:   20 LKLRRQQQIERELNGYMEWICKAEEVMLAEEDRNAEDKSAFDGEEITSGNPPPNSRPPLSSRWLNVTVLRRATLKKSRTDLIQAEEGL-------NERFSDITST-GSPFAR--ASIVSVKQETSSYFQRKEKRMRFFIRRMVKSHTFYWTVLCLVGLNTLCVAIVHYDQPVLLTDLLTYAEFVFLGLFLSEMLLKMYGLGTRSYFHSSFNCFDFGVIIGSIFEIIWATIQPGTSFGIRVLRALRLLRIFKVTKYWASLRNLVVSLLNSMKSIISLLFLLFLFIVVFALLGMQLFGGQFNFEECTPPTNFDTFPAAIMTVFQILTGEDWNVVMYDAIKSQGGIN-RGTIFCIYFIVLTLFGNYTLLNVFLAIAVDNLAN 387          

HSP 2 Score: 158.303 bits (399), Expect = 4.087e-39
Identity = 72/116 (62.07%), Postives = 91/116 (78.45%), Query Frame = 2
Query: 3065 QRKPVLPYSAMFIFSPLNSLRRFCHFVVNLRYFDLFIMIVICASSIALAAEDPVKEKSLKNNILEFFDYAFTGVFTVEMILKIIDLGIILHPGSYCRDLWNILDATVVICALVAFI 3412
            + KP+LPYS+MFIFS  N LRR CH++V LRYF++ I++VI  SSIALAAEDPV+  S  N IL  FDY FTGVFT E+ +K+IDLG++ HPG+Y RDLWNILD  VV  AL+A++
Sbjct:  796 RHKPILPYSSMFIFSSTNPLRRLCHYIVTLRYFEMCILLVIAMSSIALAAEDPVEADSPWNKILRNFDYVFTGVFTFELFIKMIDLGLVFHPGAYFRDLWNILDFIVVSGALMAYV 911          

HSP 3 Score: 80.1073 bits (196), Expect = 5.267e-15
Identity = 68/278 (24.46%), Postives = 136/278 (48.92%), Query Frame = 2
Query: 4097 YMPKDKTTIKYRVWRLVVSTPFEYFIMVMIALNTLILMMKYYREEKKASSAATHDREQQAYLNYCNTLIFLNSAFTVMFSIECVLKIMAFGPKNYFRDPWNIFDFITVIGSITDVLVSELQDXXXXXXXXXXXXXXXXXXXXXXQGYTIRILLWTFIQSFKALPYVCLLIAMLFFIYSIIGMQVFGNIKLISEYQINRHNNFQTFTNGLLLLFRCATGESWQEIMLACDNNKPCEKDIENTNNFDCGSNFTYIYFVSFIFLCSFLMLNLFVAVIMDNF 4930
            Y  + +  +++ + R+V S  F + ++ ++ LNTL + + +Y              +Q   L   + L +    F  +F  E +LK+   G ++YF   +N FDF  +IGSI +++ + +Q  +   +  LR  R  R+ K+ +   ++R L+ + + S K++  +  L+ +   +++++GMQ+FG      E       NF TF   ++ +F+  TGE W  +M            I++    + G+ F  IYF+      ++ +LN+F+A+ +DN 
Sbjct:  136 YFQRKEKRMRFFIRRMVKSHTFYWTVLCLVGLNTLCVAIVHY--------------DQPVLL--TDLLTYAEFVFLGLFLSEMLLKMYGLGTRSYFHSSFNCFDFGVIIGSIFEIIWATIQPGTSFGIRVLRALRLLRIFKVTKYWASLRNLVVSLLNSMKSIISLLFLLFLFIVVFALLGMQLFGGQFNFEE--CTPPTNFDTFPAAIMTVFQILTGEDWNVVMYDA---------IKSQGGINRGTIFC-IYFIVLTLFGNYTLLNVFLAIAVDNL 385          

HSP 4 Score: 65.855 bits (159), Expect = 1.032e-10
Identity = 39/110 (35.45%), Postives = 60/110 (54.55%), Query Frame = 2
Query:  701 SLFIFSEENVIRKYAKIIIEWGPFEYMVLLTILANCIVLSMERHLPKKDKTLLAGQLELTEKYFLGIFCVEALLKIVALGFCCHKEAYLRNVWNIMDFVVVVTGFLMMFL 1030
            S+FIFS  N +R+    I+    FE  +LL I  + I L+ E   P +  +     L   +  F G+F  E  +K++ LG   H  AY R++WNI+DF +VV+G LM ++
Sbjct:  805 SMFIFSSTNPLRRLCHYIVTLRYFEMCILLVIAMSSIALAAED--PVEADSPWNKILRNFDYVFTGVFTFELFIKMIDLGLVFHPGAYFRDLWNILDF-IVVSGALMAYV 911          

HSP 5 Score: 50.0618 bits (118), Expect = 6.806e-6
Identity = 72/305 (23.61%), Postives = 137/305 (44.92%), Query Frame = 2
Query:  701 SLFIFSEENVIRKYAKIIIEWGPFEYMVLLTILANCIVLSMERHLPKKDKTLLAGQLELTEKYFLGIFCVEALLKIVALGFCCHKEAYLRNVWNIMDFVVVVTG-FLMMFLNIDNHSDSSTVDLRTLRAVRVLRPLKLVAGFPSLQVVLKSIIRAMAPLLQIGLLVLFAITIFAIIGLEFYSGAFHYTCFKANSDKLPLPIPTEKSLVPCSNSKNGSGLGAYTCPEDYQCKAYWEGPNYGITSFDNIGYAMLTVFQCITMEGWTDIMYHTNDAIG--NRFN--WLYFVPLIILGSFFMLNLVLGV 1600
            S +   +E  +R + + +++   F + VL  +  N + +++  +       LL   L   E  FLG+F  E LLK+  LG      +Y  + +N  DF V++   F +++  I      ++  +R LRA+R+LR  K+   + SL+ ++ S++ +M  ++ +  L+   I +FA++G++ + G F++                E+   P                                T+FD    A++TVFQ +T E W  +MY    + G  NR     +YF+ L + G++ +LN+ L +
Sbjct:  134 SSYFQRKEKRMRFFIRRMVKSHTFYWTVLCLVGLNTLCVAIVHY---DQPVLLTDLLTYAEFVFLGLFLSEMLLKMYGLG----TRSYFHSSFNCFDFGVIIGSIFEIIWATI---QPGTSFGIRVLRALRLLRIFKVTKYWASLRNLVVSLLNSMKSIISLLFLLFLFIVVFALLGMQLFGGQFNF----------------EECTPP--------------------------------TNFDTFPAAIMTVFQILTGEDWNVVMYDAIKSQGGINRGTIFCIYFIVLTLFGNYTLLNVFLAI 380          
BLAST of Voltage dependent L type calcium channel subunit vs. Ensembl Yeast
Match: CCH1 (Voltage-gated high-affinity calcium channel; involved in calcium influx in response to some environmental stresses as well as exposure to mating pheromones; interacts and partially co-localizes with Mid1p; however, evidence suggests CCH1 is not required for Mid1p function [Source:SGD;Acc:S000003449])

HSP 1 Score: 159.073 bits (401), Expect = 4.486e-39
Identity = 192/824 (23.30%), Postives = 333/824 (40.41%), Query Frame = 2
Query: 2912 FDHNQVEVNDKGCLLNTNKPNGKLGMLGHDNTNFNSLESDPVPNKIEPETIQRKPVLPYSAMFIFSPLNSLRRFCHFVV---------NLRYF------------------DLFIMIVICASSIALAAEDPV------KEKSLKNNILEFFDYAFTGVFTVEMILKIIDLGIILHPGSYCRDLWNILDATVVICALVAFIMGQKPSPTGNKLRGSSAKNLNTIKSLRVLRVLRPLKTINRVPKLKAVFDCVV-SSLKNVFNILIVYILFQFIFAVIAVQLFQGKFFYCNDASKSSRETCRGYFFDYAGRSTPETKKRLWQHHDFHFDNILYAMLTLFTVTTGEGWPTVLKNSMESTNIDNGPIADYRQEMAXXXXXXXXXXXXXXXXXXXALIIITFQEQGENELIDLDLD---KNQKQCID---FAINEKP-------LCRYMPK------DKTTIKYRVWRLVVSTP---FEYFIMVMIALNTLILMMKYYREEKKASSAATHDREQQAYLNYCNTLIFLNSAFTVMFSIECVLKIMAFGPKNYFRDPWNIFDF-ITVIGSITDVLVSELQDXXXXXXXXXXXXXXXXXXXXXXQGYTIRILLWTFIQSFKALPYVCLLIAMLFFIYSIIGMQVFGNIKLISEYQINRHNNFQTFTNGLLLLFRCATGESWQEIMLACDNNKP-CEKDIENTNNFDCGS-NFTYIYFVSFIFLCSFLMLNLFVAVIMDNFDYLTRDS---SILGPHHLDEYIRVWAEYDPGAIGRIHHSEMYEMLRNMEPPVGFGKKCPYRLAYRKLIRMNMPVDENGTVNFTTTLFALIRE 5197
            F +N    N       TN  NG+  +L       N  E + +      + +++ P+  YS  F FSP +  RRFC  +V           R+F                  D+F+ I   A+ + +     V        K    N     D AF G F++E I+K +  G I  P +Y R+ WN +D  V+I   +  I   K +  GN  R          K L  LR LR L   N     +  F+ V+   L  +F   ++ +   F F V  + +F+G+   CND S   R  C   + +   +    +  R++Q    H D+   A  +L+ + + EGW  +L+N M S+ I                            +   AL ++ F       +++L +     NQ +      F I EK        L +  PK      + + ++   ++L V      +  F+ V++ L+ ++L+ + Y               Q  Y  +  ++          F I+  L +   GP+ YFR  WN     I +I  I + +   +  S +        F     + ++ Q  T+  LL T + S   +  +     +LF +Y+I   Q+FG  +L S    N   NF+T    +++LFRC+ GE W  IM     ++P C  D +N+   DCGS  + Y+  +S+  +  ++ +N+FV++I+ NF Y+ R     S +    + +YI  W+++D    G +  S +  ++ + + P+ F K    RL  + L+   M V+ +   +    L  L +E
Sbjct: 1107 FANNPFYKNSDVVFTETNDINGRTYIL-----ELNEYEDEKL------DYLKKYPLFNYSYYF-FSPQHRFRRFCQRLVPPSTGKRTDGSRFFEDSTDLYNKRSYFHHIERDVFVFIFALATILLIVCSCYVTPLYRMHHKMGTWNWSSALDCAFIGAFSIEFIVKTVADGFIYSPNAYLRNPWNFIDFCVLISMWINLIAYLKNN--GNLSR--------IFKGLTALRALRCLTISNTA---RQTFNLVMFDGLNKIFEAGLISLSLLFPFTVWGLSIFKGRLGTCNDGSL-GRADCYNEYSNSVFQWDIMS-PRVYQQPYLHLDSFASAFSSLYQIISLEGWVDLLENMMNSSGIGTPATV--------------------MGSAGNALFLVLFNFLSMVFILNLFVSFIVNNQARTTGSAYFTIEEKAWLESQKLLSQAKPKAIPNLIELSRVRQFFYQLAVEKKNFYYASFLQVVLYLHIIMLLSRSYNPGNLIGY-------QGVYFMFSTSV----------FLIQEALHMCGEGPRLYFRQKWNSIRLSIIIIAFIMNAVAFHVPASHYWFHNIKGFFLLVIFLFIIPQNDTLTELLETAMASLPPILSLTYTWGVLFLVYAIALNQIFGLTRLGSNTTDNI--NFRTVIKSMIVLFRCSFGEGWNYIMADLTVSEPYCSSD-DNSTYTDCGSETYAYLLLMSWNIISMYIFVNMFVSLIIGNFSYVYRSGGSRSGINRSEIKKYIEAWSKFDTDGTGELELSYLPRIMHSFDGPLSF-KIWEGRLTIKSLVENYMEVNPDDPYDVKIDLIGLNKE 1862          

HSP 2 Score: 80.8777 bits (198), Expect = 2.300e-15
Identity = 60/231 (25.97%), Postives = 113/231 (48.92%), Query Frame = 2
Query:  959 AYLRNVWNIMDFVVVVTGFLMMFLNIDNHSDSSTVDL-RTLRAVRVLRPLKLVAGFPSLQVVLKSIIRAMAPLLQIGLLVLFAITIFAIIGLEFYSGAFHYTCFKANSDKLPL---------------PIPTEKSLVPCSNSKNGSGLGAYTCPEDYQCKAYWEGPNYGITSFDNIGYAMLTVFQCITMEGWTDIMYHTNDAIGNRFNWLYFVPLIILGSFFMLNLVLGVL 1603
            A+ R+ WN +D V  V+ +L MFL+I ++   + + + + L  +R+LR + +  G PS   +L+ +   +  L+ +  ++++    F I+G++ + G+F   C   N +  P                P+   K      +   GS    + CP+  +C +    P  G  SFDNI  +M  VF  ++   +TD+MY+T D+       L+F+  I + + ++LNL++ VL
Sbjct:  488 AFARSSWNRIDLVSSVSFWLGMFLSIKSYDTKTGIRIFKPLAILRILRLVNVDTGMPS---ILRGLKYGIPQLVNVSSMLVYFWIFFGILGVQIFQGSFRRQCVWFNPED-PTDTYQYDMQFCGGYLDPVTKRKQNYIYEDGSEGSVSKGFLCPQYSKCVSN-ANPYNGRISFDNIVNSMELVFVIMSANTFTDLMYYTMDS-DEMAACLFFIVCIFVLTIWLLNLLIAVL 712          

HSP 3 Score: 71.633 bits (174), Expect = 1.514e-12
Identity = 69/293 (23.55%), Postives = 123/293 (41.98%), Query Frame = 2
Query:  770 FEYMVLLTILANCIVLSMERHLPKKDKTLLAGQLELTEKYFLGIFCVEALLKIVALGFCCHKEAYLRNVWNIMDFVVVVTGFLMMFLNIDNHSDSSTVDLRTLRAVRVLRPLKLVAGFPSLQVVLKSIIRAMAPLLQIGLLVLFAITIFAIIGLEFYSGAFHYTCFKANSDKLPLPIPTEKSLVPCSNSKNGSGLGAYTCPEDYQCKAY-WE--GPNYGITSF---DNIGYAMLTVFQCITMEGWTDIMYHTNDA---------IGNRFNWLYFVPLIILGSFFMLNLVLGVL 1603
            F    +L I+ +C V  + R   K      +  L+     F+G F +E ++K VA GF     AYLRN WN +DF V+++ ++ +   + N+ + S +  + L A+R LR L +     + Q     +   +  + + GL+ L  +  F + GL  + G    TC                         N   LG   C  +Y    + W+   P      +   D+   A  +++Q I++EGW D++ +  ++         +G+  N L+ V    L   F+LNL +  +
Sbjct: 1212 FALATILLIVCSCYVTPLYRMHHKMGTWNWSSALDCA---FIGAFSIEFIVKTVADGFIYSPNAYLRNPWNFIDFCVLISMWINLIAYLKNNGNLSRI-FKGLTALRALRCLTISNT--ARQTFNLVMFDGLNKIFEAGLISLSLLFPFTVWGLSIFKGRLG-TC-------------------------NDGSLGRADCYNEYSNSVFQWDIMSPRVYQQPYLHLDSFASAFSSLYQIISLEGWVDLLENMMNSSGIGTPATVMGSAGNALFLVLFNFLSMVFILNLFVSFI 1472          
BLAST of Voltage dependent L type calcium channel subunit vs. Ensembl Nematostella
Match: EDO46991 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNU9])

HSP 1 Score: 702.205 bits (1811), Expect = 0.000e+0
Identity = 417/981 (42.51%), Postives = 607/981 (61.88%), Query Frame = 2
Query: 2990 LGHDNTNFNSLESDPVPNKIEPETIQRKPVLPYSAMFIFSPLNSLRRFCHFVVNLRYFDLFIMIVICASSIALAAEDPVKEKSLKNNILEFFDYAFTGVFTVEMILKIIDLGIILHPGSYCRDLWNILDATVVICALVAFIMGQKPSPTGNKLRGSSAKNLNTIKSLRVLRVLRPLKTINRVPKLKAVFDCVVSSLKNVFNILIVYILFQFIFAVIAVQLFQGKFFYCNDASKSSRETCRGYFFDYAGR--STPETKKRLWQHHDFHFDNILYAMLTLFTVTTGEGWPTVLKNSMESTNIDNGPIADYRQEMAXXXXXXXXXXXXXXXXXXXALIIITFQEQGENELIDLDLDKNQKQCIDFAINEKPLCRYMPKDKTTIKYRVWRLVVSTPFEYFIMVMIALNTLILMMKYYREEKKASSAATHDREQQAYLNYCNTLIFLNSAFTVMFSIECVLKIMAFGPKNYFRDPWNIFDFITVIGSITDVLVSELQDXXXXXXXXXXXXXXXXXXXXXXQGYTIRILLWTFIQSFKALPYVCLLIAMLFFIYSIIGMQVFGNIKLISEYQINRHNNFQTFTNGLLLLFRCATGESWQEIMLACDN--NKPCEKDI--ENTNNFDCGSNFTYIYFVSFIFLCSFLMLNLFVAVIMDNFDYLTRDSSILGPHHLDEYIRVWAEYDPGAIGRIHHSEMYEMLRNMEPPVGFGKKCPYRLAYRKLIRMNMPVDENGTVNFTTTLFALIRESLNIKMSTAE-YMDIKDMELRQTICKMWPVQAKKKLNLIV-PPDSELVFHKMTVGKIYAGYLIVENWRAYK------NSQEQGPRSSPAVSIKSVT----KPVVKEEKSANL---LAKFFVAFKSNTNKSNISLDSHHERDEERF------SIDHTYGEDY---DANRRYSYLRRG-SKPRGSKEIYSDLTPTQDYSYGLRPEHATIPGMPAPRKFGNRPRSPMYSLSELETKDRANTP 5839
            L  D+    + + + V +    E +  +P+ P S++FIFS  N  R  CH +    YF  FI+++I  SS  LAAEDP+   S +N +L +FDY FT VFT+E+ +KII  G+ILH GS+CR  +N+LD  VV  ++V+             LR SS++ ++ ++ LRVLRVLRPL+ INR   LK V  CV  ++K + NI++V +LF F+FAVI VQLF+G FF C DA K ++  C+G + ++ G   + P  K R WQ   F+F+++  AMLTLFTV T EGWP +L++SM+ST++D GP  + R  +AI+Y+++ I+  FF +NIFV  +I+TFQ +GE E  D +LDKNQ++C++FA+  +P  RY+P ++  +++ VWR+V S PFEY I   I  NT++LMM+YY E K                 Y   L   N  FT +F +EC+LK+ AF PKNYF D WN+FDF+ V+GS+ D+ ++E+      + GF RLFRA RL+KLL QG  I+ LLWTFI+SF+ALPYV LLI M FFIY+++GMQ+FG I +  E QINR+NNFQTF   L++LFR ATGE+WQ IMLAC +  N  C+ +   ++T+   CG++F Y YF SF  +CSFL++NLFVAVIMDNFDYLTRD SILGPHHLDE++RVW+EYDP A G + H ++  +L+ + PP+GFGK CP+R A ++L+ MNMP++ +GTVNF  TLF L+R SL+IK    +  ++  + E+R  I K+WP  +++ L+ I+ PP  +    ++TVGK YA YLI E +R +K      N+Q Q   S+ A+     T     P ++   S +L     + F+       K +I   S H+R  E        S  H+         + R  +++++G S P   ++  S L  T  +S+G        P + + R+    P+    + ++ E+K  A+ P
Sbjct:  778 LAEDSKATLNRDHESVRSATSTEVMDHEPMPPESSLFIFSNTNCFRVVCHRIATNSYFVNFILLLIIVSSCMLAAEDPLNSNSKRNQVLNYFDYFFTAVFTIEITIKIIAYGVILHKGSFCRSAFNLLDFLVVAVSIVSI-----------ALRDSSSQ-ISVVRILRVLRVLRPLRAINRAKGLKHVVQCVFVAVKTIGNIMLVTVLFNFLFAVIGVQLFKGTFFSCTDAEKITKRECQGQYIEFKGPGLTNPVVKDREWQPQTFNFNDVPQAMLTLFTVMTFEGWPGILESSMDSTDVDEGPFLNNRPWVAIYYVIYIIIIAFFMINIFVGFVIVTFQNEGEEEFKDCELDKNQRKCVEFALKARPTRRYIPTNR--LQFHVWRVVTSQPFEYLIFAFITGNTILLMMQYYNEPKL----------------YTRVLDGFNIGFTSVFLLECILKLFAFKPKNYFLDRWNLFDFVVVVGSVVDITMNEVSSEQMFAFGFFRLFRALRLVKLLNQGSGIKTLLWTFIKSFQALPYVGLLIIMTFFIYAVVGMQMFGRIAIDPETQINRNNNFQTFPQSLMVLFRSATGENWQLIMLACTDTPNAKCDPNAYPQDTDGL-CGTDFAYAYFCSFYAICSFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFVRVWSEYDPEASGCVKHVDIVTVLKRIAPPLGFGKFCPHREACKRLVSMNMPLNRDGTVNFNATLFGLVRTSLSIKRPEGKGSLEKANEEMRAIIMKVWPKTSQEFLDEIIQPPGGD---DEVTVGKFYATYLIQEYFRRFKARQRAENAQYQDAHSTQALQAGLRTLHGLGPQLRRAISGHLDDDDEELFL-------KEDIQQKSQHKRFWESLKNAVTPSPRHSRPSSLRRPGSIRLSAFIKKGNSTPEAQRK--SSLPATLTFSHG--------PLLTSDRQLLVPPQQSDVNANDKESKQSAHVP 1707          

HSP 2 Score: 542.732 bits (1397), Expect = 1.257e-159
Identity = 331/657 (50.38%), Postives = 428/657 (65.14%), Query Frame = 2
Query:  767 PFEYMVLLTILANCIVLSMERHLPKKDKTLLAGQLELTEKYFLGIFCVEALLKIVALGFCCHKEAYLRNVWNIMDFVVVVTGFLMMFLNIDNHSDSSTVDLRTLRAVRVLRPLKLVAGFPSLQVVLKSIIRAMAPLLQIGLLVLFAITIFAIIGLEFYSGAFHYTCFKANSDKL----PLPIPTEKSLVPCSNSKNGSGLGAYTCPEDYQCKAYWEGPNYGITSFDNIGYAMLTVFQCITMEGWTDIMYHTNDAIGNRFNWLYFVPLIILGSFFMLNLVLGVLSGXXXXXXXXXXXXXXXLKLRRQQQTEKEFNGYMEWIQKAEEVLLNEATTTSEDKM--RIIAARRRAEKQKYKLLGKNQSIPDFEYEDTELYSETKSMKGNIFIRSYAGIRRRRKERCTSFWRTEKHFRFSVRRLVKSQPFYWAVIILVFFNTVCVAIEHYEQGKWLTLFLNYAEYVFLCLFMMEMMIKMYGLSIRVYFQSSFNIFDCVVIAGSLFEIIYGIFVQDSSFGLSVLRALRLLRIFKVTRYWAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMQLFGGEFNF-EEGKPPQNFDTFVKALLTVFQILTGEDWNTVMYNGIQSKGGVKERGTVFSI-YFVLLVVFGNYTLLNVFLAIAVDNLAN 2713
            PF+ M+L+TI ANC  L+  + LP++D +L+  +LE+ E  FLGIF +E++LKI+A GF  H  AYLRN WNI+DFV+VV G   + + +       + D++ LRA RVLRPL+LV+G PSLQVVL SII+A+ PL  I LLV+F + I+AIIG+E + G  H TC+   + +     P P  TE     CSN+  G             C   WEGPNYGIT+FDNIG A LTVFQCIT+EGWTD+MY  NDAIGN + WLYFV LII GSFF+LNLVLGVLSGEFAKE+ R +K   F KLR +Q  +  ++GY++WI +AE++  + +    E+    R  + RRR E        +NQ       ED+    +               I R++K       R     R S R+ VK+Q FYW VI+ VF N++ +A+EHY Q ++LT FL+ A  +FL LF +EM++KMY L    YF S FN FDC+V+  SL E+     +     G+S+LR +RLLRIFKVTRYW+SL NLV SLLNSMRSI+ LL LL LF++IF+LLGMQ+FGG+FN  +E  P  NFD+F +AL+TVFQILTGEDWN VMY GIQS GG+ E  +   I YF+ LVV GNY LLNVFLAIAVDNLA+
Sbjct:   75 PFDVMILITIFANCAALAAFQPLPEQDSSLINEELEVAEFVFLGIFTMESVLKIIAYGFVMHPGAYLRNGWNILDFVIVVVGLATIIVKL---YTPDSFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKALIPLFHIALLVVFVVIIYAIIGVELFMGKLHSTCYDNVTGQPTFDEPHPCSTESEGYSCSNAGPGQ-----------VCLKKWEGPNYGITNFDNIGLACLTVFQCITLEGWTDVMYSINDAIGNSWPWLYFVTLIIWGSFFVLNLVLGVLSGEFAKEKARAQKSGEFQKLREKQLVDDAYHGYLDWISQAEDIEGDSSAGEDEEGKADRKPSFRRRKENDDISKNKENQ-------EDSAASDQ-------------GWIDRKKK----ILKRFHHRLRRSCRKAVKTQWFYWTVIVFVFLNSLTLALEHYNQPEFLTQFLDKANKLFLALFTLEMVVKMYCLGFHGYFASLFNRFDCLVVISSLLELGLTEAMDQRPIGISMLRCVRLLRIFKVTRYWSSLSNLVASLLNSMRSIMGLLLLLSLFMVIFSLLGMQIFGGKFNLGDEDVPRSNFDSFWRALVTVFQILTGEDWNAVMYTGIQSWGGITESLSAIPILYFIFLVVVGNYILLNVFLAIAVDNLAD 693          

HSP 3 Score: 140.198 bits (352), Expect = 7.433e-33
Identity = 105/309 (33.98%), Postives = 156/309 (50.49%), Query Frame = 2
Query: 3008 NFNSLESDPVPNKIEPE-TIQRKP---VLPYSAMFIFSPLNSLRR-----FCHFVVNL--RYFDLFIMIVICASSIALAAEDPVKEK--SLKNNILEFFDYAFTGVFTVEMILKIIDLGIILHPGSYCRDLWNILDATVVICALVAFIMGQKPSPTGNKLRGSSAKNLNTIKSLRVLRVLRPLKTINRVPKLKAVFDCVVSSLKNVFNILIVYILFQFIFAVIAVQLFQGKFF---YCN-------DASKSSRETCRGYFFDYAGRSTPETKKRLWQHHDF---HFDNILYAMLTLFTVTTGEGWPTVL 3856
            N   L   P   K  P+   Q+KP   V P  A+F  +  N +R      F  F +++    FD+ I+I I A+  ALAA  P+ E+  SL N  LE  ++ F G+FT+E +LKII  G ++HPG+Y R+ WNILD  +V+  L   I+         KL    + +   +K+LR  RVLRPL+ ++ VP L+ V + ++ +L  +F+I ++ +    I+A+I V+LF GK     Y N       D          GY    AG      KK  W+  ++   +FDNI  A LT+F   T EGW  V+
Sbjct:   14 NRAKLNGQPKYGKPPPQPKRQKKPTNAVRPKRALFCLTLGNPIRSTAISLFTVFFLDVFRTPFDVMILITIFANCAALAAFQPLPEQDSSLINEELEVAEFVFLGIFTMESVLKIIAYGFVMHPGAYLRNGWNILDFVIVVVGLATIIV---------KLYTPDSFD---VKALRAFRVLRPLRLVSGVPSLQVVLNSIIKALIPLFHIALLVVFVVIIYAIIGVELFMGKLHSTCYDNVTGQPTFDEPHPCSTESEGYSCSNAGPGQVCLKK--WEGPNYGITNFDNIGLACLTVFQCITLEGWTDVM 308          

HSP 4 Score: 103.219 bits (256), Expect = 1.247e-21
Identity = 128/572 (22.38%), Postives = 243/572 (42.48%), Query Frame = 2
Query:  731 IRKYAKIIIEWGPFEYMVLLTILANCIVLSMERHLPKKDKTLLAGQLELTEKYFLGIFCVEALLKIVALGFCCHKEAYLRNVWNIMDFVVVVTGFLMMFLNIDNHSDSSTVDLRTLRAVRVLRPLKLVAGFPSLQVVLKSIIRAMAPLLQIGLLVLFAITIFAIIGLEFYSGAFHYTCFKANSDKLPLPIPTEKSLVPCSNSKNGSGLGAYTCPEDYQCKAYWEGPNYGITSFDNIGYAMLTVFQCITMEGWTDIMYHTNDAIG------NRFNWLYFVPLIILGSFFMLNLVLGVL--------SGXXXXXXXXXXXXXXXLKLRRQQQTEKEFNGYMEWIQKAEEVLLNEATTTSEDKMRIIAARRRAE------KQKYKLLGKNQSIPDFEYEDTELYSETKSMKGNIFIRSYAGIRRRRK-----------ERCTSFWRTEKHFRFSVRRLVKSQPFYWAVIILVFFNTVCVAIEH-YEQGKWLTLFLNYAEYVFLCLFMMEMMIKM--YGLSIR--VYFQSSFNIFDCVVIAGSLFEIIYGIFVQDSSFGLSVLRALRLLRIFKVTR 2338
            +R+  +  ++   F + V++ +  N + L++E +        L   L+   K FL +F +E ++K+  LGF      Y  +++N  D +VV++  L   L +    D   + +  LR VR+LR  K+   + SL  ++ S++ +M  ++ + LL+   + IF+++G++ + G F+                                LG    P                ++FD+   A++TVFQ +T E W  +MY    + G      +    LYF+ L+++G++ +LN+ L +         S    +E ++ E+        R ++ E   N  +E            A+T+S    R+I   +  E      K +   L K+   P  + E   L  ++K+       R +  +R               E     +     FR    R+  +  F   +++L+  ++  +A E            LNY +Y F  +F +E+ IK+  YG+ +    + +S+FN+ D +V+A S    I  I ++DSS  +SV+R LR+LR+ +  R
Sbjct:  447 LRRSCRKAVKTQWFYWTVIVFVFLNSLTLALEHY---NQPEFLTQFLDKANKLFLALFTLEMVVKMYCLGF----HGYFASLFNRFDCLVVISSLLE--LGLTEAMDQRPIGISMLRCVRLLRIFKVTRYWSSLSNLVASLLNSMRSIMGLLLLLSLFMVIFSLLGMQIFGGKFN--------------------------------LGDEDVPR---------------SNFDSFWRALVTVFQILTGEDWNAVMYTGIQSWGGITESLSAIPILYFIFLVVVGNYILLNVFLAIAVDNLADAESLTEMEEEKKKEREEELEMKLRMEEKESSSNKDLE---------NKRASTSSGKSHRLIKIWKTNELLHLAGKIRVSRLRKH---PITDAESPSLAEDSKATLN----RDHESVRSATSTEVMDHEPMPPESSLFIFSNTNCFRVVCHRIATNSYFVNFILLLIIVSSCMLAAEDPLNSNSKRNQVLNYFDYFFTAVFTIEITIKIIAYGVILHKGSFCRSAFNLLDFLVVAVS----IVSIALRDSSSQISVVRILRVLRVLRPLR 942          

HSP 5 Score: 99.7525 bits (247), Expect = 1.230e-20
Identity = 83/312 (26.60%), Postives = 152/312 (48.72%), Query Frame = 2
Query:  620 SKTTSMRSLAKRTINLSFPGMQTSTS------------KSLFIFSEENVIRKYAKIIIEWGPFEYMVLLTILANCIVLSMERHLPKKDKTLLAGQLELTEKYFLGIFCVEALLKIVALGFCCHKEAYLRNVWNIMDFVVVVTGFLMMFLNIDNHSDSSTVDLRTLRAVRVLRPLKLVAGFPSLQVVLKSIIRAMAPLLQIGLLVLFAITIFAIIGLEFYSGAFHYTCFKANSDKLPLPIPTEKSLVPCSNSKNGSGLGAYTCPE-DYQCKAYWEGPNYGITSFDNIGYAMLTVFQCITMEGWTDIMYHTNDA 1516
            +++ S+   +K T+N     ++++TS             SLFIFS  N  R     I     F   +LL I+ +  +L+ E  L    K      L   + +F  +F +E  +KI+A G   HK ++ R+ +N++DF+VV    + + L  D+ S  S V  R LR +RVLRPL+ +     L+ V++ +  A+  +  I L+ +    +FA+IG++ + G F ++C   +++K+     T++          G GL      + ++Q + +         +F+++  AMLT+F  +T EGW  I+  + D+
Sbjct:  773 AESPSLAEDSKATLNRDHESVRSATSTEVMDHEPMPPESSLFIFSNTNCFRVVCHRIATNSYFVNFILLLIIVSSCMLAAEDPLNSNSKR--NQVLNYFDYFFTAVFTIEITIKIIAYGVILHKGSFCRSAFNLLDFLVVAVSIVSIALR-DSSSQISVV--RILRVLRVLRPLRAINRAKGLKHVVQCVFVAVKTIGNIMLVTVLFNFLFAVIGVQLFKGTF-FSC--TDAEKI-----TKRECQGQYIEFKGPGLTNPVVKDREWQPQTF---------NFNDVPQAMLTLFTVMTFEGWPGILESSMDS 1062          

HSP 6 Score: 78.5666 bits (192), Expect = 3.406e-14
Identity = 78/320 (24.38%), Postives = 162/320 (50.62%), Query Frame = 2
Query: 3995 TFQEQGENELIDLDLDKNQKQCIDFAINEKPLCRYMPKDKTTIKY------RVWRLVVSTPFEYF-IMVMIALNTLILMMKYYREEKKASSAATHDREQQAYLNYCNTLIFLNSAFTVMFSIECVLKIMAFGPKNYFRDPWNIFDFITVIGSITDVLVSELQDXXXXXXXXXXXXXXXXXXXXXXQGYTIRILLWTFIQSFKALPYVCLLIAMLFFIYSIIGMQVFGNIKLISEYQINRHNNFQTFTNGLLLLFRCATGESWQEIMLACDNNKPCEKDIENTNNF-DCGSNFTYIYFVSFIFLCSFLMLNLFVAVIMDNF 4930
            +F+ + EN+    D+ KN++   D A +++    ++ + K  +K       R  R  V T + Y+ ++V + LN+L L +++Y + +  +           +L+  N L      F  +F++E V+K+   G   YF   +N FD + VI S+ ++ ++E  D   + +  LR  R  R+ K+ R   ++  L+ + + S +++  + LL+++   I+S++GMQ+FG    + +  + R +NF +F   L+ +F+  TGE W  +M            I++     +  S    +YF+  + + ++++LN+F+A+ +DN 
Sbjct:  405 SFRRRKEND----DISKNKENQEDSAASDQG---WIDRKKKILKRFHHRLRRSCRKAVKTQWFYWTVIVFVFLNSLTLALEHYNQPEFLTQ----------FLDKANKL------FLALFTLEMVVKMYCLGFHGYFASLFNRFDCLVVISSLLELGLTEAMDQRPIGISMLRCVRLLRIFKVTRYWSSLSNLVASLLNSMRSIMGLLLLLSLFMVIFSLLGMQIFGGKFNLGDEDVPR-SNFDSFWRALVTVFQILTGEDWNAVMYT---------GIQSWGGITESLSAIPILYFIFLVVVGNYILLNVFLAIAVDNL 691          

HSP 7 Score: 74.3294 bits (181), Expect = 6.689e-13
Identity = 69/269 (25.65%), Postives = 134/269 (49.81%), Query Frame = 2
Query: 1940 KERCTSFWRTEKHFRFSVRRLVKSQPFYWAVIILVFFNTVCVAIEHYEQGKWLTLFLNYAEYVFLCLFMMEMMIKMYGLSIRVYFQSSFNIFDCVVIAGSLFEIIYGIFVQDSSFGLSVLRALRLLRIFKVTRYWAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMQLFGGEFNFEEGKPPQ--NFDTFVKALLTVFQILTGEDWNTVMYNGIQSKGGVKER-----------GTVFS-IYFVLLVVFGNYTLLNVFLAIAVDN 2704
            K R T  +      +F V R+V SQPF + +   +  NT+ + +++Y + K  T  L+     F  +F++E ++K++    + YF   +N+FD VV+ GS+ +I       +  F     R  R LR+ K+    + ++ L+ + + S +++  +  L+ +   I+A++GMQ+FG      E +  +  NF TF ++L+ +F+  TGE+W  +M     +     +            GT F+  YF       ++ ++N+F+A+ +DN
Sbjct: 1130 KARPTRRYIPTNRLQFHVWRVVTSQPFEYLIFAFITGNTILLMMQYYNEPKLYTRVLDGFNIGFTSVFLLECILKLFAFKPKNYFLDRWNLFDFVVVVGSVVDITMNEVSSEQMFAFGFFRLFRALRLVKLLNQGSGIKTLLWTFIKSFQALPYVGLLIIMTFFIYAVVGMQMFGRIAIDPETQINRNNNFQTFPQSLMVLFRSATGENWQLIMLACTDTPNAKCDPNAYPQDTDGLCGTDFAYAYFCSFYAICSFLIINLFVAVIMDN 1398          

HSP 8 Score: 65.855 bits (159), Expect = 2.431e-10
Identity = 64/260 (24.62%), Postives = 114/260 (43.85%), Query Frame = 2
Query: 3116 NSLRRFCHFVVNLRYFDLFIMIVICASSIALAAEDPVKEKSLKNNILEFFDYA---FTGVFTVEMILKIIDLGIILHPGSYCRDLWNILDATVVICALVAF----IMGQKPSPTGNKLRGSSAKNLNTIKSLRVLRVLRPLKTINRVPKLKAVFDCVVSSLKNVFNILIVYILFQFIFAVIAVQLFQGKFFYCNDASKSSRETCRGYFFDYAGRSTPETKKRLWQHHDFHFDNILYAMLTLFTVTTGEGWPTVLKNSMES 3874
            + LRR C   V  ++F   +++ +  +S+ LA E   + + L     +F D A   F  +FT+EM++K+  LG       Y   L+N  D  VVI +L+       M Q+P                 I  LR +R+LR  K       L  +   +++S++++  +L++  LF  IF+++ +Q+F GKF                   +      P +          +FD+   A++T+F + TGE W  V+   ++S
Sbjct:  445 HRLRRSCRKAVKTQWFYWTVIVFVFLNSLTLALEHYNQPEFLT----QFLDKANKLFLALFTLEMVVKMYCLGF----HGYFASLFNRFDCLVVISSLLELGLTEAMDQRPI---------------GISMLRCVRLLRIFKVTRYWSSLSNLVASLLNSMRSIMGLLLLLSLFMVIFSLLGMQIFGGKF-------------------NLGDEDVPRS----------NFDSFWRALVTVFQILTGEDWNAVMYTGIQS 652          

HSP 9 Score: 64.3142 bits (155), Expect = 7.758e-10
Identity = 72/305 (23.61%), Postives = 130/305 (42.62%), Query Frame = 2
Query: 4145 VVSTPFEYFIMVMIALNTLILMMKYYREEKKASSAATHDREQQAYLNYCNTLIFLNSAFTVMFSIECVLKIMAFG----PKNYFRDPWNIFDFITVIGSITDVLVSELQDXXXXXXXXXXXXXXXXXXXXXXQGYTIRILLWTFIQSFKALPYVCLLIAMLFFIYSIIGMQVF--------------------------------------GNIKLISEYQINRH-NNFQTFTNGLLLLFRCATGESWQEIMLACDNNKPCEKDIENTNNFDCGSNFTYIYFVSFIFLCSFLMLNLFVAVIMDNF 4930
            V  TPF+  I++ I  N   L   +    ++ SS    + E   ++            F  +F++E VLKI+A+G    P  Y R+ WNI DF+ V+  +  ++V +L       +  LR FR  R ++L+    +++++L + I++   L ++ LL+  +  IY+IIG+++F                                      G + L      N    NF       L +F+C T E W ++M + ++                G+++ ++YFV+ I   SF +LNL + V+   F
Sbjct:   71 VFRTPFDVMILITIFANCAALA-AFQPLPEQDSSLINEELEVAEFV------------FLGIFTMESVLKIIAYGFVMHPGAYLRNGWNILDFVIVVVGLATIIV-KLYTPDSFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKALIPLFHIALLVVFVVIIYAIIGVELFMGKLHSTCYDNVTGQPTFDEPHPCSTESEGYSCSNAGPGQVCLKKWEGPNYGITNFDNIGLACLTVFQCITLEGWTDVMYSINDA--------------IGNSWPWLYFVTLIIWGSFFVLNLVLGVLSGEF 347          

HSP 10 Score: 53.9138 bits (128), Expect = 9.529e-7
Identity = 43/159 (27.04%), Postives = 77/159 (48.43%), Query Frame = 2
Query:  767 PFEYMVLLTILANCIVLSMERHLPKKDKTLLAGQLELTEKYFLGIFCVEALLKIVALGFCCHKEAYLRNVWNIMDFVVVVTGFLMMFLNIDNHSDSSTVDLRTLRAVRVLRPLKLVAGFPSLQVVLKSIIRAMAPLLQIGLLVLFAITIFAIIGLEFYS 1243
            PFEY++   I  N I+L M+ +   K  T +     +    F  +F +E +LK+    F    + Y  + WN+ DFVVVV   + + +N    S          R  R LR +KL+     ++ +L + I++   L  +GLL++    I+A++G++ + 
Sbjct: 1155 PFEYLIFAFITGNTILLMMQYYNEPKLYTRVLDGFNIG---FTSVFLLECILKL----FAFKPKNYFLDRWNLFDFVVVVGSVVDITMN--EVSSEQMFAFGFFRLFRALRLVKLLNQGSGIKTLLWTFIKSFQALPYVGLLIIMTFFIYAVVGMQMFG 1304          
BLAST of Voltage dependent L type calcium channel subunit vs. Ensembl Nematostella
Match: EDO35661 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKR1])

HSP 1 Score: 230.72 bits (587), Expect = 1.406e-60
Identity = 202/699 (28.90%), Postives = 358/699 (51.22%), Query Frame = 2
Query: 3143 VVNLRYFDLFIMIVICASSIALAAEDP-VKEKSLKNNILEFFDYAFTGVFTVEMILKIIDLGIILHPGSYCRDLWNILDATVVICALVAFIMGQKPSPTGNKLRGSSAKNLNTIKSLRVLRVLRPLKTINRVPKLKAVFDCVVSSLKNVFNILIVYILFQFIFAVIAVQLFQGKFFYCNDASKSSRETCRGYFFDYAGRSTPETKKRLWQHHDFHFDNILYAMLTLFTVTTGEGWPTVLKNSMESTNIDNGPIADYRQEMAXXXXXXXXXXXXXXXXXXXALIIITFQE-------QGENELIDLDLDKNQKQCIDFAINEKPLCRYMPKDKTTIKYRVWRLVVSTPFEYFIMVMIALNTLILMMKYYREEKKASSAATHDREQQAYLNYCNTLIFLNSAFTVMFSIECVLKIMAFGPKNYFRDPWNIFDFITVIGSITDVLVSELQDXXXXXXXXXXXXXXXXXXXXX---XQGYTIRILLWTFIQSFKALPYVCLLIAMLFFIYSIIGMQVFGNIKLISEYQINRHNNFQTFTNGLLLLFRCATGESWQEIMLACDNNKP-CEKDIENTNNFDCGSNFTY-IYFVSFIFLCSFLMLNLFVAVIMDNFDYLTRDSSI-LGPHHLDEYIRVWAEYDPGAIGRIHHSEMYEMLRNMEPPVGFGKKCPYRLAYRKLIRMNMPVDENGTVNFTTTLFALIRE 5197
            +V  + F+  I+ +I ASSI+LA ED  +  K     +L+  +  F  +FTVEM+LK I LG      +Y  + WNILD  +VI +    IM    +  GN         +  I+SLR LR  RPL+ I+R   +K V   ++ ++  + N+L+V ++F  IF+++ VQ+F GKF  C D      E C         ++   +    W++ + +FD +    L L  V T EGW  ++++++++T ID  PI +      +F++VF I+  FF +N+F+ +II  F +        G  ++      +N    +  A  +KP  R + + +   +  ++ +V S  FE FIM+ I +N +++M+++Y      S                     LN  FT +F +E +L+I+A   K YF +PWN+FDF+ VI SI  ++V  LQ S  ++   LR+ R  R+ +LL        IR LL++ + S  AL  +  L+ ++ FIY+IIGM +FG++K      +N   NF+TF +  +LLFR  T   W +I+     ++P C+ +     + +CG+ +   IY  SF+ +   +++N+++AVI++N++ +     I +    ++ + ++W  +DP A   I ++++ + +  ME  +   K  P + A   L   N+P+ +   ++    L AL++ 
Sbjct:  823 LVEHKVFEGIILFLIAASSISLAFEDVYLDSKPTLKQVLQILNILFAVIFTVEMLLKWIGLGF----KTYFTNPWNILDFVIVIVS----IMVSLATIFGND-------QIAFIRSLRTLRAFRPLRAISRFEGMKVVITSLLHAIPGIGNVLLVCLMFWLIFSIMGVQIFGGKFGKCVDEGG---EKCPASV--VPNKTVCLSNGYRWENSNINFDTVDQGFLALLQVATFEGWMEIMEDAVDATKIDEQPIEENNVSAYLFFVVFIILGTFFTLNLFIGVIIDNFNQLKQQMEAVGSMDVFLTSTQRNWMNALKSAATKKPKKR-IRRPQNKFQGELYDMVQSRKFEVFIMLFITINMVVMMVQHYDHLAVWSKQ------------------ILNLIFTSVFILEAILRIIALR-KGYFLNPWNVFDFVIVISSIIGIIVENLQTSLVINPSLLRVVRVFRVGRLLRFFEAARGIRRLLFSLVISTPALFNIGALLFLIIFIYAIIGMSIFGHVK--KTEALNDVVNFETFGSSFVLLFRLMTSAGWNDILDPLMISEPDCDPNYRGLPSGNCGNKYMAPIYLGSFVVIIFLILINMYIAVILENYNQVMEQEKIGITNEDIELFYQMWELFDPNATQYIPYADLSDFVHQMEGNLRIPK--PNKAACALL---NIPLVKGDKIHCLDLLQALVKR 1474          

HSP 2 Score: 160.614 bits (405), Expect = 3.395e-39
Identity = 108/325 (33.23%), Postives = 167/325 (51.38%), Query Frame = 2
Query:  695 SKSLFIFSEENVIRKYA-KIIIEWGPFEY-----MVLLTILANCIVLSMERHLPKKDKTLLAGQLELTEKYFLGIFCVEALLKIVALGFCCHKEAYLRNVWNIMDFVVVVTGFLMMFLNIDNHSDSSTVDLRTLRAVRVLRPLKLVAGFPSLQVVLKSIIRAMAPLLQIGLLVLFAITIFAIIGLEFYSGAFHYTCFKANSDKLPLPIPTEKS-----------LVPCSNSKNGSGLGAYTCPEDYQCKAYWEG-PNYGITSFDNIGYAMLTVFQCITMEGWTDIMYHTNDAIGNRFNW--LYFVPLIILGSFFMLNLVLGVLSG 1609
            SKSL++F  EN IR+++ K+I    P +       VLLTIL NC+ L+M                E  E  F  I+ +E   KI+A GF  H+ AYLR+ WN +DF+VV+ G      N+    D +  +L  +   RV R L+ ++    L+ ++ +++ +M  L  + +L LF I IFA+IG++ + G     C     + L +P  T  S            + C N+      G+ TCP +Y C  +  G PN+G TSFD+ G+A+LT FQ IT++ W ++    N+ I     W  +YF  +I  G FF++NLVL V++ 
Sbjct:   21 SKSLYLFGPENPIRQFSLKLITNQYPLQLHNRHMFVLLTILVNCVFLAM------------TNPPEQPEYVFAAIYTIEMFCKIIAKGFALHRYAYLRDKWNWLDFIVVILG------NVTISPDVA--NLSGIPTFRVFRALRTISAVKGLKAMVNTLLVSMKMLWDVMVLTLFFICIFALIGMQLFIGELRNKCALPVPENLSVPYRTYASNSSIWYLEDNEPILCGNTT-----GSRTCPTNYTCLPHAGGNPNFGYTSFDHFGWALLTGFQLITLDFWENVY---NNVIYTMGPWYVVYFAVVIFFGPFFLVNLVLAVVAA 317          

HSP 3 Score: 127.102 bits (318), Expect = 6.507e-29
Identity = 123/507 (24.26%), Postives = 209/507 (41.22%), Query Frame = 2
Query:  728 VIRKYAKIIIEWGPFEYMVLLTILANCIVLSMERHLPKKDKTLLAGQLELTEKYFLGIFCVEALLKIVALGFCCHKEAYLRNVWNIMDFVVVVTGFLMMFLNIDNHSDSSTVDLRTLRAVRVLRPLKLVAGFPSLQVVLKSIIRAMAPLLQIGLLVLFAITIFAIIGLEFYSGAFHYTCFKANSDKLPLPIPTEKSLVPCSNSKNGSGLGAYTCPEDYQCKAYWEGPNYGITSFDNIGYAMLTVFQCITMEGWTDIMYHTNDAI---------GNRFNWLYFVPLIILGSFFMLNLVLGVLSGXXXXXXXXXXXXXXXLKLRRQQQTEKEFNGYMEWIQKAEEVLLNEATTTSEDKMRIIAARRRAEKQKYKLLGKNQSIPDFEYEDTELYSETKSMKGNIFIRSYAGIRRRRKERCTSFWRTEKHFRFSVRRLVKSQPFYWAVIILVFFNTVCVAIEHYEQ-GKWLTLFLNYAEYVFLCLFMMEMMIKMYGLSIRVYFQSSFNIFD 2218
            V+R   + ++E   FE ++L  I A+ I L+ E  +    K  L   L++    F  IF VE LLK + LGF    + Y  N WNI+DFV+V+   ++    I    +     +R+LR +R  RPL+ ++ F  ++VV+ S++ A+  +  + L+ L    IF+I+G++ + G F   C     +K P  +   K++   +  +                   WE  N    +FD +    L + Q  T EGW +IM    DA           N   +L+FV  IILG+FF LNL +GV+   F              +L++Q +     + ++   Q+     L  A T    K      R R  + K++                ELY   +S K  +FI                                         ++ +  N V + ++HY+    W    LN    +F  +F++E ++++  L  + YF + +N+FD
Sbjct:  815 VMRYKVRRLVEHKVFEGIILFLIAASSISLAFE-DVYLDSKPTLKQVLQILNILFAVIFTVEMLLKWIGLGF----KTYFTNPWNILDFVIVIVSIMVSLATI--FGNDQIAFIRSLRTLRAFRPLRAISRFEGMKVVITSLLHAIPGIGNVLLVCLMFWLIFSIMGVQIFGGKFG-KCVDEGGEKCPASVVPNKTVCLSNGYR-------------------WENSN---INFDTVDQGFLALLQVATFEGWMEIMEDAVDATKIDEQPIEENNVSAYLFFVVFIILGTFFTLNLFIGVIIDNFN-------------QLKQQMEAVGSMDVFLTSTQRNWMNALKSAATKKPKK------RIRRPQNKFQ---------------GELYDMVQSRKFEVFI-----------------------------------------MLFITINMVVMMVQHYDHLAVWSKQILN---LIFTSVFILEAILRIIALR-KGYFLNPWNVFD 1212          

HSP 4 Score: 110.923 bits (276), Expect = 5.221e-24
Identity = 94/306 (30.72%), Postives = 146/306 (47.71%), Query Frame = 2
Query: 4118 TIKYRVWRLVVSTPFEYFIMVMIALNTLILMMKYYREEKKASSAATHDREQQAYLNYCNTLIFLNSAFTVMFSIECVLKIMAFGPKNYFRDPWNIFDFITVIGSITDVLVSELQDXXXXXXXXXXXXXXXXXXXXXXQGYTIRILLWTFIQSFKALPYVCLLIAMLFFIYSIIGMQVFGN----------------------IKLISEYQINRHN-NFQTFTNGLLLLFRCATGESWQEIML-ACDNNKPCEKDIENTNNFDCGSNFTYIYFVSFIFLCSFLMLNLFVAVIMDNFDYLTRDSSILG 4963
             ++Y+V RLV    FE  I+ +IA +++ L      E+    S  T  +  Q           LN  F V+F++E +LK +  G K YF +PWNI DF+ VI SI   L +   +     +  LR  RA R ++ + +   +++++ + + +   +  V L+  M + I+SI+G+Q+FG                       + L + Y+    N NF T   G L L + AT E W EIM  A D  K  E+ IE  N         Y++FV FI L +F  LNLF+ VI+DNF+ L +    +G
Sbjct:  815 VMRYKVRRLVEHKVFEGIILFLIAASSISLAF----EDVYLDSKPTLKQVLQ----------ILNILFAVIFTVEMLLKWIGLGFKTYFTNPWNILDFVIVIVSIMVSLATIFGNDQIAFIRSLRTLRAFRPLRAISRFEGMKVVITSLLHAIPGIGNVLLVCLMFWLIFSIMGVQIFGGKFGKCVDEGGEKCPASVVPNKTVCLSNGYRWENSNINFDTVDQGFLALLQVATFEGWMEIMEDAVDATKIDEQPIEENNVS------AYLFFVVFIILGTFFTLNLFIGVIIDNFNQLKQQMEAVG 1100          

HSP 5 Score: 90.1225 bits (222), Expect = 1.075e-17
Identity = 67/220 (30.45%), Postives = 124/220 (56.36%), Query Frame = 2
Query: 2030 VIILVFFNTVCVAIEHYEQGKWLTLFLNYAEYVFLCLFMMEMMIKMYGLSIRVYFQSSFNIFDCVVIAGSLFEIIYGIFVQDS-SFGLSVLRALRLLRIFKVTRYWAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMQLFGGEFN---FEEGKPPQNFDTFVKALLTVFQILTGEDWNTVMYNGIQSKGGVKERGTVFSIYFVLLVVFGNYTLLN 2677
            +I+ +  NT+ ++IEH      L   +N +  VF  +F++EM++K+  L    Y + ++NIFD +V+  S+ + I   FV D+   G+SVLR  RLLR+ K+ + W+++ +L+ ++  S+ ++ +L  +L + + IFA++GMQL G  +    F    P  NF  F  + + +F++L GE W   +++ + + G V        + FV   + GN+ +LN
Sbjct:  509 IIVCILLNTLVMSIEHPRLEDPLLTVVNISNEVFTFIFLLEMILKLIALGFLGYIRVAWNIFDGIVVIISIVDFIVNKFVPDAGGTGISVLRTFRLLRVLKLAKSWSTMNSLLATIGKSLGALGNLTVILAIIVYIFAVMGMQLLGNSYTPDKFGGSIPRWNFKDFPHSFMMIFRVLCGE-WIEPLWDCMLATGPVA------MLLFVPAFILGNFIILN 721          

HSP 6 Score: 89.7373 bits (221), Expect = 1.419e-17
Identity = 59/197 (29.95%), Postives = 100/197 (50.76%), Query Frame = 2
Query: 3092 AMFIFSPLNSLRRFC------HFVVNLRYFDLFIMIVICASSIALAAEDPVKEKSLKNNILEFFDYAFTGVFTVEMILKIIDLGIILHPGSYCRDLWNILDATVVICALVAFIMGQKPSPTGNKLRGSSAKNLNTIKSLRVLRVLRPLKTINRVPKLKAVFDCVVSSLKNVFNILIVYILFQFIFAVIAVQLFQGKF 3664
            ++++F P N +R+F        + + L    +F+++ I  + + LA  +P ++           +Y F  ++T+EM  KII  G  LH  +Y RD WN LD  VVI               GN        NL+ I + RV R LR   TI+ V  LKA+ + ++ S+K +++++++ + F  IFA+I +QLF G+ 
Sbjct:   23 SLYLFGPENPIRQFSLKLITNQYPLQLHNRHMFVLLTILVNCVFLAMTNPPEQP----------EYVFAAIYTIEMFCKIIAKGFALHRYAYLRDKWNWLDFIVVIL--------------GNVTISPDVANLSGIPTFRVFRALR---TISAVKGLKAMVNTLLVSMKMLWDVMVLTLFFICIFALIGMQLFIGEL 192          

HSP 7 Score: 80.8777 bits (198), Expect = 6.158e-15
Identity = 74/282 (26.24%), Postives = 140/282 (49.65%), Query Frame = 2
Query: 1952 TSFWRTEKHFRFSVRRLVKSQPFYWAVIILVFFNTVCVAIE--HYEQGKWLTLFLNYAEYVFLCLFMMEMMIKMYGLSIRVYFQSSFNIFDCVVIAGSLFEIIYGIFVQDSSFGLSVLRALRLLRIFKVTRYWAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMQLFGGEFN--FEEG--KPPQ---------------------NFDTFVKALLTVFQILTGEDWNTVMYNGIQS----KGGVKERGTVFSIYFVLLVVFGNYTLLNVFLAIAVDN 2704
            + F    K  R+ VRRLV+ + F   ++ L+  +++ +A E  + +    L   L     +F  +F +EM++K  GL  + YF + +NI D V++  S+   +  IF  D    +  LR LR  R  +    +  ++ ++ SLL+++  I ++L +  +F LIF+++G+Q+FGG+F    +EG  K P                      NFDT  +  L + Q+ T E W  +M + + +    +  ++E      ++FV+ ++ G +  LN+F+ + +DN
Sbjct:  807 SGFCAVWKVMRYKVRRLVEHKVFEGIILFLIAASSISLAFEDVYLDSKPTLKQVLQILNILFAVIFTVEMLLKWIGLGFKTYFTNPWNILDFVIVIVSIMVSLATIFGNDQIAFIRSLRTLRAFRPLRAISRFEGMKVVITSLLHAIPGIGNVLLVCLMFWLIFSIMGVQIFGGKFGKCVDEGGEKCPASVVPNKTVCLSNGYRWENSNINFDTVDQGFLALLQVATFEGWMEIMEDAVDATKIDEQPIEENNVSAYLFFVVFIILGTFFTLNLFIGVIIDN 1088          

HSP 8 Score: 79.337 bits (194), Expect = 1.735e-14
Identity = 70/209 (33.49%), Postives = 112/209 (53.59%), Query Frame = 2
Query: 4163 EYFIMVMIALNTLILMMKYYREEKKASSAATHDREQQAYLNYCNTLIFLNSAFTVMFSIECVLKIMAFGPKNYFRDPWNIFDFITVIGSITDVLVSE-LQDXXXXXXXXXXXXXXXXXXXXXXQGYTIRILLWTFIQSFKALPYVCLLIAMLFFIYSIIGMQVFGNIKLISEY--QINRHNNFQTFTNGLLLLFRCATGESWQEIMLAC 4780
            E FI+V I LNTL++ ++             H R +   L   N     N  FT +F +E +LK++A G   Y R  WNIFD I VI SI D +V++ + D+    +  LR FR  R++KL +   T+  LL T  +S  AL  + +++A++ +I++++GMQ+ GN     ++   I R  NF+ F +  +++FR   GE W E +  C
Sbjct:  506 EIFIIVCILLNTLVMSIE-------------HPRLEDPLLTVVN---ISNEVFTFIFLLEMILKLIALGFLGYIRVAWNIFDGIVVIISIVDFIVNKFVPDAGGTGISVLRTFRLLRVLKLAKSWSTMNSLLATIGKSLGALGNLTVILAIIVYIFAVMGMQLLGNSYTPDKFGGSIPRW-NFKDFPHSFMMIFRVLCGE-WIEPLWDC 696          

HSP 9 Score: 76.2554 bits (186), Expect = 1.616e-13
Identity = 69/251 (27.49%), Postives = 114/251 (45.42%), Query Frame = 2
Query: 3149 NLRYFDLFIMIVICASSIALAAEDPVKEKSLKNNILEFFDYAFTGVFTVEMILKIIDLGIILHPGSYCRDLWNILDATVVICALVAFIMGQKPSPTGNKLRGSSAKNLNTIKSLRVLRVLRPLKTINRVPKLKAVFDCVVSSLKNVFNILIVYILFQFIFAVIAVQLFQGKFFYCNDASKSSRETCRGYFFDYAGRSTPETKKRLWQHHDFHFDNILYAMLTLFTVTTGEGWPTVLKNSMESTNIDNGPIA 3901
            N +  ++FI++ I  +++ ++ E P  E  L   ++   +  FT +F +EMILK+I LG +     Y R  WNI D  VVI ++V FI+ +     G    G+    L T + LRVL++ +   T+N      ++   +  SL  + N+ ++  +  +IFAV+ +QL                     Y  D  G S P      W   DF      ++ + +F V  GE W   L + M +T    GP+A
Sbjct:  501 NGKVMEIFIIVCILLNTLVMSIEHPRLEDPLLT-VVNISNEVFTFIFLLEMILKLIALGFL----GYIRVAWNIFDGIVVIISIVDFIVNKFVPDAG----GTGISVLRTFRLLRVLKLAKSWSTMN------SLLATIGKSLGALGNLTVILAIIVYIFAVMGMQLLGNS-----------------YTPDKFGGSIPR-----WNFKDFP-----HSFMMIFRVLCGE-WIEPLWDCMLAT----GPVA 704          

HSP 10 Score: 73.9442 bits (180), Expect = 9.081e-13
Identity = 66/271 (24.35%), Postives = 122/271 (45.02%), Query Frame = 2
Query:  773 EYMVLLTILANCIVLSMERHLPKKDKTLLAGQLELTEKYFLGIFCVEALLKIVALGFCCHKEAYLRNVWNIMDFVVVVTGFLMMFLNIDNHSDSSTVDLRTLRAVRVLRPLKLVAGFPSLQVVLKSIIRAMAPLLQIGLLVLFAITIFAIIGLEFYSGAFHYTCFKANSDKLPLPIPTEKSLVPCSNSKNGSGLGAYTCPEDYQCKAYWEGPNYGITSFDNIGYAMLTVFQCITMEGWTDIMYHTNDAIGNRFNWLYFVPLIILGSFFMLN 1585
            E  +++ IL N +V+S+E   P+ +  LL   + ++ + F  IF +E +LK++ALGF      Y+R  WNI D +VV+   +   +N     D+    +  LR  R+LR LKL   + ++  +L +I +++  L  + +++   + IFA++G++    ++         DK    IP                               W        +F +  ++ + +F+ +  E W + ++    A G     L FVP  ILG+F +LN
Sbjct:  506 EIFIIVCILLNTLVMSIEH--PRLEDPLLT-VVNISNEVFTFIFLLEMILKLIALGFL----GYIRVAWNIFDGIVVIISIVDFIVN-KFVPDAGGTGISVLRTFRLLRVLKLAKSWSTMNSLLATIGKSLGALGNLTVILAIIVYIFAVMGMQLLGNSY-------TPDKFGGSIPR------------------------------W--------NFKDFPHSFMMIFRVLCGE-WIEPLWDCMLATG-PVAMLLFVPAFILGNFIILN 721          
BLAST of Voltage dependent L type calcium channel subunit vs. Ensembl Nematostella
Match: EDO36844 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SHI0])

HSP 1 Score: 223.402 bits (568), Expect = 2.962e-58
Identity = 168/618 (27.18%), Postives = 310/618 (50.16%), Query Frame = 2
Query: 3092 AMFIFSPLNSLRRFCHFVVNLRYFDLFIMIVICASSIALAAEDP-VKEKSLKNNILEFFDYAFTGVFTVEMILKIIDLGIILHPGSYCRDLWNILDATVVICALVAFIMGQKPSPTGNKLRGSSAKNLNTIKSLRVLRVLRPLKTINRVPKLKAVFDCVVSSLKNVFNILIVYILFQFIFAVIAVQLFQGKFFYCNDASKSSRETCRGYFFDYAGRSTPETKKRLWQHHDFHFDNILYAMLTLFTVTTGEGWPTVLKNSMESTNIDNGPIADYRQEMAXXXXXXXXXXXXXXXXXXXALIIITFQEQGENELIDLDLDKNQKQCIDFAI-------NEKPLCRYMPKDKTTIKYRVWRLVVSTPFEYFIMVMIALNTLILMMKYYREEKKASSAATHDREQQAYLNYCNTLIFLNSAFTVMFSIECVLKIMAFGPKNYFRDPWNIFDFITVIGSITDVLVSELQ-----DXXXXXXXXXXXXXXXXXXXXXXQGYTIRILLWTFIQSFKALPYVCLLIAMLFFIYSIIGMQVFGNIKL----ISEYQINRHNNFQTFTNGLLLLFRCATGESWQEIMLACDNNKPCEKDIENTNNFDCG--SNFTYIYFVSFIFLCSF 4888
            ++++F+P N  R     +   ++FD  +++ I  + + +A E P V   SL+  +++   Y F G+FT+EM++K+I LG+ + P +Y R  WN++D  +V+ + V  I+    + T N         L  ++  R LR LRPL+ I+R P LK V + ++SSLK + NI+++   F  IF ++ VQLF+GKF YC DA+     T +    +  G          W + +++FDN+  A+LTLF  +T +GW  ++ + +++  ID  PI ++ +   I+++ F ++  F  +N+ V +++  FQ+     LI+++   ++++              ++ L  + P+ +  I      +     F+  I  +IALN L + +++Y++    +          A+L   N +      FT +F +E +LKI A G K Y +D WN  D + VI SI  + + E+      + + + +  +        +    +G  IR LL T  Q+   +  + +L  ++FFI+S +G+++FG I      I+   ++ H NF++F   +L LFR +TG++W  I+    +   C  + E     DC    +   IYF  F+    F
Sbjct:  910 SLYVFAPDNRFRMLNKELYQNKWFDRTVLLFILLNCVVMALEGPSVLPGSLERRVIDICMYVFLGIFTIEMMVKVIALGLWIGPDAYLRSGWNVMDGFLVVISWVDVIV----TATTN----GQNSILGVLRVFRALRTLRPLRVISRAPGLKIVVETLISSLKPIGNIVLIAATFFIIFGILGVQLFKGKFHYCTDATVPV--TTKTECLENGGS---------WVNREYNFDNLAKALLTLFVFSTKDGWVNIMYDGIDAVGIDKQPIRNHARYNVIYFVGFLLLAGFVVLNMLVGVVVENFQKC--RTLIEMEKKIDEEKKNKKEEKMRREIAEDEALSEHYPRPRKFIH----AVCTHGYFDLGIAAVIALNVLCMALEHYQQPDGLT----------AFLKCANYV------FTAVFILEAILKIFALGIKRYIKDRWNQLDMLIVILSIVGIALEEMTMELPINPTIIRVMRVLRIARVLKLLKTAEG--IRKLLDTVAQALPQVGNLGMLFLLMFFIFSALGIELFGKIDCEKPGITCQGMDEHANFRSFGIAMLTLFRISTGDNWNGILKDTISPDVCRVNPE----IDCSMLEHVAPIYFAVFVLATQF 1480          

HSP 2 Score: 157.147 bits (396), Expect = 4.326e-38
Identity = 107/343 (31.20%), Postives = 178/343 (51.90%), Query Frame = 2
Query:  626 TTSMRSLAKRTINLSFPGMQTSTSK--SLFIFSEENVIRKYAKIIIEWGPFEYMVLLTILANCIVLSMERHLPKKDKTLLAGQLE-----LTEKYFLGIFCVEALLKIVALGFCCHKEAYLRNVWNIMD-FVVVVTGFLMMFLNIDNHSDSSTVDLRTLRAVRVLRPLKLVAGFPSLQVVLKSIIRAMAPLLQIGLLVLFAITIFAIIGLEFYSGAFHYTCFKANSDKLPLPIPTEKSLVPCSNSKNGSGLGAYTCPEDYQCKAYWEGPNYGITSFDNIGYAMLTVFQCITMEGWTDIMYHTNDAIG---------NRFNWLYFVPLIILGSFFMLNLVLGVL 1603
            T  M      T+++  P    S     SL++F+ +N  R   K + +   F+  VLL IL NC+V+++E        ++L G LE     +    FLGIF +E ++K++ALG     +AYLR+ WN+MD F+VV++   ++     N  +S    LR  RA+R LRPL++++  P L++V++++I ++ P+  I L+      IF I+G++ + G FHY C  A      +P+ T+   +     +NG                 W    Y   +FDN+  A+LT+F   T +GW +IMY   DA+G          R+N +YFV  ++L  F +LN+++GV+
Sbjct:  883 TPCMSPTDNPTVDIKVPTSCCSKRADWSLYVFAPDNRFRMLNKELYQNKWFDRTVLLFILLNCVVMALE------GPSVLPGSLERRVIDICMYVFLGIFTIEMMVKVIALGLWIGPDAYLRSGWNVMDGFLVVISWVDVIVTATTNGQNSILGVLRVFRALRTLRPLRVISRAPGLKIVVETLISSLKPIGNIVLIAATFFIIFGILGVQLFKGKFHY-CTDAT-----VPVTTKTECL-----ENGGS---------------WVNREY---NFDNLAKALLTLFVFSTKDGWVNIMYDGIDAVGIDKQPIRNHARYNVIYFVGFLLLAGFVVLNMLVGVV 1190          

HSP 3 Score: 140.198 bits (352), Expect = 6.393e-33
Identity = 106/300 (35.33%), Postives = 168/300 (56.00%), Query Frame = 2
Query: 1829 NQSIPDFEYEDTELYSETKSMKGNIFIRSYAGIRRRRKERCTSFWRTEKHFRFSVRRLVKSQPFYWAVIILVFFNTVCVAIEHYEQGKWLTLFLNYAEYVFLCLFMMEMMIKMYGLSIRVYFQSSFNIFDCVVIAGSLFEIIYGIFVQDSSFGLSVLRALRLLRIFKVTRYWAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMQLFGGEFNF--EEG---KPPQNFDTFVKALLTVFQILTGEDWNTVMYNGIQSKGGVKERGTVFSIYFVLLVVFGNYTLLNVFLAIAVDNLAN 2713
            N S  DF    +        + GN    S   +        +S  R  K FR      V S+ F + ++  +F NT+ + IE+Y Q + +T  L    Y+F  +F +EM++K+ GL    Y + +FNIFD  ++  S+ E    +F  D S G+SVLR+ RLLR+FK+ R+  +LR  +L ++++M ++++ L LL +F+   ++LGM LFGG++ F  +EG       NFD    A++TVFQ+LT EDWN VMY+G+++    K  G    +YF+LL+  GNY L N+ +AI V+  A+
Sbjct:  351 NASNADFNSGASTSEPPVSGVSGNSLAESETDLSDDEDTSESSPRRCAK-FRDGCASSVDSKWFMYVIMGAIFVNTLTMGIEYYGQPQKMTDVLEIFNYIFTAIFGIEMIMKLIGLGFYGYIKDAFNIFDGTIVIISVVE----LFGDDDS-GISVLRSFRLLRVFKLVRFLPALRRQLLVMIHTMDNVMTFLALLVIFMFTASILGMNLFGGKYRFPNDEGVMETSRANFDDLFWAIVTVFQVLTQEDWNIVMYDGMRATS--KWAG----LYFILLMTIGNYILFNLLVAILVEGFAS 638          

HSP 4 Score: 97.4413 bits (241), Expect = 6.762e-20
Identity = 67/252 (26.59%), Postives = 123/252 (48.81%), Query Frame = 2
Query: 3125 RRFCHFVVNLRYFDLFIMIVICASSIALAAEDPVKEKSLKNNILEFFDYAFTGVFTVEMILKIIDLGIILHPGSYCRDLWNILDATVVICALVAFIMGQKPSPTGNKLRGSSAKNLNTIKSLRVLRVLRPLKTINRVPKLKAVFDCVVSSLKNVFNILIVYILFQFIFAVIAVQLFQGKFFYCNDASKSSRETCRGYFFDYAGRSTPETKKRLWQHHDFHFDNILYAMLTLFTVTTGEGWPTVLKNSMESTN 3880
            R  C   V+ ++F   IM  I  +++ +  E   + + +  ++LE F+Y FT +F +EMI+K+I LG       Y +D +NI D T+VI ++V             +L G     ++ ++S R+LRV    K +  +P L+     ++ ++ NV   L + ++F F  +++ + LF GK+ + ND  +   ET R                        +FD++ +A++T+F V T E W  V+ + M +T+
Sbjct:  401 RDGCASSVDSKWFMYVIMGAIFVNTLTMGIEYYGQPQKM-TDVLEIFNYIFTAIFGIEMIMKLIGLGFY----GYIKDAFNIFDGTIVIISVV-------------ELFGDDDSGISVLRSFRLLRVF---KLVRFLPALRRQLLVMIHTMDNVMTFLALLVIFMFTASILGMNLFGGKYRFPND--EGVMETSRA-----------------------NFDDLFWAIVTVFQVLTQEDWNIVMYDGMRATS 606          

HSP 5 Score: 91.6633 bits (226), Expect = 3.501e-18
Identity = 63/221 (28.51%), Postives = 101/221 (45.70%), Query Frame = 2
Query: 1067 LRTLRAVRVLRPLKLVAGFPSLQVVLKSIIRAMAPLLQIGLLVLFAITIFAIIGLEFYSGAFHYTCFK-------------------ANSDKLPLPIPTEK-------SLVPCSNSKN---GSGLGAYTCPEDYQ------------CKAYWEGPNYGITSFDNIGYAMLTVFQCITMEGWTDIMYHTNDAIGNRFNWLYFVPLIILGSFFMLNLVLGVLS 1606
            +  +RA+RVLRPL+ +   PS+++++  ++  +  L  +  +     +IF I+G++ + G     C                       S  L   +P          + +P S +     G     Y+   +Y             C      P Y   SFDNI  A + +FQ IT+EGWTDIMY+  DA G  +N++YFV LI++GS+FM NL L V++
Sbjct:    1 MTAVRAIRVLRPLRAINRVPSIRILVTLLLDTLPMLGNVLAMCSLIFSIFGIVGVQMWQGVLRSRCVAQLPGNLSANQLNISAFYQPGGSSDLVCSLPENSGDKHCTSAFIPASTAHGRECGLTYEQYSNRSNYTNVCANWNQYYTLCADMGINPLYDAVSFDNILIAWVAIFQVITLEGWTDIMYYIQDAHG-FWNFIYFVVLIVIGSYFMTNLCLVVIT 220          

HSP 6 Score: 85.1149 bits (209), Expect = 4.030e-16
Identity = 68/280 (24.29%), Postives = 134/280 (47.86%), Query Frame = 2
Query:  770 FEYMVLLTILANCIVLSMERH-LPKKDKTLLAGQLELTEKYFLGIFCVEALLKIVALGFCCHKEAYLRNVWNIMDFVVVVTGFLMMFLNIDNHSDSSTVDLRTLRAVRVLRPLKLVAGFPSLQVVLKSIIRAMAPLLQ-IGLLVLFAITIFAIIGLEFYSGAFHYTCFKANSDKLPLPIPTEKSLVPCSNSKNGSGLGAYTCPEDYQCKAYWEGPNYGITSFDNIGYAMLTVFQCITMEGWTDIMYHTNDAIGNRFNWLYFVPLIILGSFFMLNLVLGVL 1603
            F Y+++  I  N + + +E +  P+K    +   LE+    F  IF +E ++K++ LGF      Y+++ +NI D  +V+   + +F + D+        +  LR+ R+LR  KLV   P+L+  L  +I  M  ++  + LLV+F  T  +I+G+  + G + +              P ++ ++  S +                             +FD++ +A++TVFQ +T E W  +MY    A  +++  LYF+ L+ +G++ + NL++ +L
Sbjct:  413 FMYVIMGAIFVNTLTMGIEYYGQPQK----MTDVLEIFNYIFTAIFGIEMIMKLIGLGF----YGYIKDAFNIFDGTIVIISVVELFGDDDS-------GISVLRSFRLLRVFKLVRFLPALRRQLLVMIHTMDNVMTFLALLVIFMFTA-SILGMNLFGGKYRF--------------PNDEGVMETSRA-----------------------------NFDDLFWAIVTVFQVLTQEDWNIVMYDGMRAT-SKWAGLYFILLMTIGNYILFNLLVAIL 632          

HSP 7 Score: 82.4185 bits (202), Expect = 2.339e-15
Identity = 65/228 (28.51%), Postives = 110/228 (48.25%), Query Frame = 2
Query: 4319 FTVMFSIECVLKIMAFG----PKNYFRDPWNIFDFITVIGSITDVLVSEL---QDXXXXXXXXXXXXXXXXXXXXXXQGYTIRILLWTFIQSFKALPYVCLLIAMLFFIYSIIGMQVF---------GNIKLISEYQ--------INRHNNFQTFTNGLLLLFRCATGESWQEIMLACDNNKPCEKDIENTNNFDCGSNFTYIYFVSFIFLCSFLMLNLFVAVIMDNF 4930
            F  +F+IE ++K++A G    P  Y R  WN+ D   V+ S  DV+V+     Q+S    L   R  R  R ++++ +   ++I++ T I S K +  + L+ A  F I+ I+G+Q+F           + + ++ +        +NR  NF      LL LF  +T + W  IM   D       D +   N    + +  IYFV F+ L  F++LN+ V V+++NF
Sbjct:  972 FLGIFTIEMMVKVIALGLWIGPDAYLRSGWNVMDGFLVVISWVDVIVTATTNGQNSILGVLRVFRALRTLRPLRVISRAPGLKIVVETLISSLKPIGNIVLIAATFFIIFGILGVQLFKGKFHYCTDATVPVTTKTECLENGGSWVNREYNFDNLAKALLTLFVFSTKDGWVNIMY--DGIDAVGIDKQPIRNH---ARYNVIYFVGFLLLAGFVVLNMLVGVVVENF 1194          

HSP 8 Score: 80.8777 bits (198), Expect = 7.723e-15
Identity = 79/277 (28.52%), Postives = 138/277 (49.82%), Query Frame = 2
Query: 1970 EKHFRFSVRRLVKSQPFYWAVIILVFFNTVCVAIEHYE--QGKWLTLFLNYAEYVFLCLFMMEMMIKMYGLSIRV----YFQSSFNIFDCVVIAGSLFEIIYGIFV--QDSSFG-LSVLRALRLLRIFKVTRYWAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMQLFGGEFNF---------------EEGKP----PQNFDTFVKALLTVFQILTGEDWNTVMYNGIQSKG----GVKERGTVFSIYFVLLVVFGNYTLLNVFLAIAVDN 2704
            +  FR   + L +++ F   V++ +  N V +A+E      G      ++   YVFL +F +EMM+K+  L + +    Y +S +N+ D  ++  S  ++I       Q+S  G L V RALR LR  +V      L+ +V +L++S++ I +++ +   F +IF +LG+QLF G+F++               E G        NFD   KALLT+F   T + W  +MY+GI + G     ++       IYFV  ++   + +LN+ + + V+N
Sbjct:  917 DNRFRMLNKELYQNKWFDRTVLLFILLNCVVMALEGPSVLPGSLERRVIDICMYVFLGIFTIEMMVKVIALGLWIGPDAYLRSGWNVMDGFLVVISWVDVIVTATTNGQNSILGVLRVFRALRTLRPLRVISRAPGLKIVVETLISSLKPIGNIVLIAATFFIIFGILGVQLFKGKFHYCTDATVPVTTKTECLENGGSWVNREYNFDNLAKALLTLFVFSTKDGWVNIMYDGIDAVGIDKQPIRNHARYNVIYFVGFLLLAGFVVLNMLVGVVVEN 1193          

HSP 9 Score: 79.337 bits (194), Expect = 1.949e-14
Identity = 62/204 (30.39%), Postives = 112/204 (54.90%), Query Frame = 2
Query: 2018 FYWAVIILVFFNTVCVAIEHYEQGKWLTLFLNYAEYVFLCLFMMEMMIKMYGLSIRVYFQSSFNIFDCVVIAGSLFEIIYGIFVQDSSFGLS-------VLRALRLLRIFKVTRYWAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMQLFGGEFNFEEGKPPQ------NFDTFVKALLTVFQILTGEDWNTVMYNGIQ 2590
            F   +  ++  N +C+A+EHY+Q   LT FL  A YVF  +F++E ++K++ L I+ Y +  +N  D +++  S    I GI +++ +  L        V+R LR+ R+ K+ +    +R L+ ++  ++  + +L  L  L   IF+ LG++LFG     + G   Q      NF +F  A+LT+F+I TG++WN ++ + I 
Sbjct: 1249 FDLGIAAVIALNVLCMALEHYQQPDGLTAFLKCANYVFTAVFILEAILKIFALGIKRYIKDRWNQLDMLIVILS----IVGIALEEMTMELPINPTIIRVMRVLRIARVLKLLKTAEGIRKLLDTVAQALPQVGNLGMLFLLMFFIFSALGIELFGKIDCEKPGITCQGMDEHANFRSFGIAMLTLFRISTGDNWNGILKDTIS 1448          

HSP 10 Score: 65.855 bits (159), Expect = 2.306e-10
Identity = 59/259 (22.78%), Postives = 112/259 (43.24%), Query Frame = 2
Query:  734 RKYAKIIIEWGPFEYMVLLTILANCIVLSMERHLPKKDKTLLAGQLELTEKYFLGIFCVEALLKIVALGFCCHKEAYLRNVWNIMDFVVVVTGFLMMFLN-IDNHSDSSTVDLRTLRAVRVLRPLKLVAGFPSLQVVLKSIIRAMAPLLQIGLLVLFAITIFAIIGLEFYSGAFHYTCFKANSDKLPLPIPTEKSLVPCSNSKNGSGLGAYTCPEDYQCKAYWEGPNYGITSFDNIGYAMLTVFQCITMEGWTDIMYHT 1507
            RK+   +   G F+  +   I  N + +++E H  + D   L   L+     F  +F +EA+LKI ALG     + Y+++ WN +D ++V+   + + L  +      +   +R +R +R+ R LKL+     ++ +L ++ +A+  +  +G+L L    IF+ +G+E +                   I  EK  + C       G+  +                    +F + G AMLT+F+  T + W  I+  T
Sbjct: 1237 RKFIHAVCTHGYFDLGIAAVIALNVLCMALE-HYQQPDG--LTAFLKCANYVFTAVFILEAILKIFALGI----KRYIKDRWNQLDMLIVILSIVGIALEEMTMELPINPTIIRVMRVLRIARVLKLLKTAEGIRKLLDTVAQALPQVGNLGMLFLLMFFIFSALGIELFGK-----------------IDCEKPGITC------QGMDEH-------------------ANFRSFGIAMLTLFRISTGDNWNGILKDT 1446          

HSP 11 Score: 61.2326 bits (147), Expect = 5.825e-9
Identity = 60/263 (22.81%), Postives = 107/263 (40.68%), Query Frame = 2
Query: 4160 FEYFIMVMIALNTLILMMKYYREEKKASSAATHDREQQAYLNYCNTLIFLNSAFTVMFSIECVLKIMAFGPKNYFRDPWNIFDFITVIGSITDVLVSELQDXXXXXXXXXXXXXXXXXXXXXXQGYTIRILLWTFIQSFKALPYVCLLIAMLFFIYSIIGMQVFG------NIKLISEYQINRHNNFQTFTNGLLLLFRCATGESWQEIMLACDNNKPCEKDIENTNNFDCGSNFTYIYFVSFIFLCSFLMLNLFVAVIMDNF 4930
            F Y IM  I +NTL + ++YY + +K +                + L   N  FT +F IE ++K++  G   Y +D +NIFD   VI S+ ++   +    S L    L                 +R  L   I +   +     L+ +  F  SI+GM +FG      N + + E       NF      ++ +F+  T E W  +M                +     S +  +YF+  + + ++++ NL VA++++ F
Sbjct:  413 FMYVIMGAIFVNTLTMGIEYYGQPQKMT----------------DVLEIFNYIFTAIFGIEMIMKLIGLGFYGYIKDAFNIFDGTIVIISVVELFGDDDSGISVLRSFRLLRVFKLVRFLP-----ALRRQLLVMIHTMDNVMTFLALLVIFMFTASILGMNLFGGKYRFPNDEGVME---TSRANFDDLFWAIVTVFQVLTQEDWNIVMY---------------DGMRATSKWAGLYFILLMTIGNYILFNLLVAILVEGF 636          

HSP 12 Score: 51.6026 bits (122), Expect = 4.860e-6
Identity = 44/185 (23.78%), Postives = 70/185 (37.84%), Query Frame = 2
Query: 3479 IKSLRVLRVLRPLKTINRVPKLKAVFDCVVSSLKNVFNILIVYILFQFIFAVIAVQLFQG---------------------KFFY---------CNDASKSSRETCRGYFF---------------DYAGRSTPETKKRLWQHH--------------DFHFDNILYAMLTLFTVTTGEGWPTVL 3856
            + ++R +RVLRPL+ INRVP ++ +   ++ +L  + N+L +  L   IF ++ VQ++QG                       FY         C+    S  + C   F                 Y+ RS        W  +                 FDNIL A + +F V T EGW  ++
Sbjct:    1 MTAVRAIRVLRPLRAINRVPSIRILVTLLLDTLPMLGNVLAMCSLIFSIFGIVGVQMWQGVLRSRCVAQLPGNLSANQLNISAFYQPGGSSDLVCSLPENSGDKHCTSAFIPASTAHGRECGLTYEQYSNRSNYTNVCANWNQYYTLCADMGINPLYDAVSFDNILIAWVAIFQVITLEGWTDIM 185          
BLAST of Voltage dependent L type calcium channel subunit vs. Ensembl Nematostella
Match: EDO46797 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RP56])

HSP 1 Score: 214.542 bits (545), Expect = 1.263e-55
Identity = 209/707 (29.56%), Postives = 355/707 (50.21%), Query Frame = 2
Query: 3146 VNLRYFDLFIMIVICASSIALAAED-PVKEKSLKNNILEFFDYAFTGVFTVEMILKIIDLGIILHPGSYCRDLWNILDATVV-ICALVAFIMGQKPSPTGNKLRGSSAKNLNTIKSLRVLRVLRPLKTINRVPKLKAVFDCVVSSLKNVFNILIVYILFQFIFAVIAVQLFQGKFFYCNDA--SKSSRETCRGYFFDYAGRSTPETKKRLWQHHDFHFDNILYAMLTLFTVTTGEGWPTVLKNSMESTNIDNGPIADYRQEMAXXXXXXXXXXXXXXXXXXXALIIITF----QEQGENELIDLDLDKNQKQCIDF----AINEKPLCRYMPKDKTTIKYRVWRLVVSTPFEYFIMVMIALNTLILMMKYYREEKKASSAATHDREQQAYLNYCNTLIFLNSAFTVMFSIECVLKIMAFGPKNYFRDPWNIFDFITVIGSITDV---LVSELQDXXXXXXXXXXXXXXXXXXXXXXQGYTIRILLWTFIQSFKALPYVCLLIAMLFFIYSIIGMQVFGNIKLISEYQINRHNNFQTFTNGLLLLFRCATGESWQEIMLACDNNKP-CEKDIENTNNFDCGSNFTYI-YFVSFIFLCSFLMLNLFVAVIMDNFDYLTRDSSI-LGPHHLDEYIRVWAEYDPGAIGRIHHSEMYEMLRNMEPPVGFGKKCPYRLAY--RKLIR-MNMPVDENGTVNFTTTLFALIRESL 5203
            V  RYF+ FI+  +  SS  L  ED  + +K      L F ++ F  +F++E ILK+I  G +    SY   +WN LDA +V +C  VA +  + P             NL+  +S R +R LRPL+ I+R+  +K V + + +++  + ++L+V +LF  +F++  VQLF GKF+ C +A   K S           A    P+ +   W + + +FDN++   L L  V T EGW  V+ ++++ST ID  P  +       +++VF IV  FF +N+FV +II  F    ++  E   + + L ++Q++ +      A  + P  R  P D    + +++ LV S  FE FI+ +I  N  ++M+++Y +    +             NY    IFL         +E ++KI+A    +YF+  W+IFDF+ V+ SI  +   + +E    S   L  LR+FR ARL+++++    IR LL   I S  AL  +  L+ ++ FIY+IIGM  FGNIK   +  +N   NF+TF++ ++L+FR  TG  W +I+ A     P C+ +     N +CG     + Y V++I     +++N+++AV++DN +    +    L       Y   +A +  G        + +  LR +   +    K P+++A+   +LIR M +PV E   V+    L  L+++ L
Sbjct:  790 VEHRYFEWFILFTVMVSSFTLVFEDIHLHQKPDLERALNFLNFLFAAIFSLEFILKVIGFGFV----SYFTSVWNCLDALIVSVCVSVACLF-ENP-------------NLSVFRSFRTVRGLRPLRAISRLGGMKVVINALFAAIPGIGSVLVVSMLFWLMFSISGVQLFAGKFYKCVNAEDEKLSPSVIPN---KTACLDHPDYR---WVNANVNFDNVINGFLALLQVATYEGWMEVMADAVDSTKIDQQPSYEANLIAYAYFVVFIIVGSFFVLNLFVGVIIDNFNTLKKKYEEINSMGMLLTESQRKWVQILMAAAKRKPPSNRLRPTD--CFRGKLFDLVSSNQFEVFILTVIMCNMGMMMVQHYDQPPLTTVIG----------NYVLVGIFL---------LEAIIKIIAMR-LHYFKKAWSIFDFVVVVSSIVGMYLGMSTESAVVSPGLLRVLRVFRVARLLRVVQFAKRIRQLLVAIIISMPALFNIGTLLFLVMFIYAIIGMSSFGNIK--KQGALNDLVNFETFSSSIILIFRLGTGTGWNDILDALVVQPPHCDPNFGGLPNGNCGFPIGAVFYLVTYIVSVFLIIVNMYIAVLLDNVNRAHENDEFGLSKDKFKSYYHTFANFSMG--------KQFLPLRVLPEFLAALDK-PFKIAHPSEELIRKMKIPVREGDLVHCFDLLKVLVKKIL 1439          

HSP 2 Score: 192.971 bits (489), Expect = 4.083e-49
Identity = 180/744 (24.19%), Postives = 350/744 (47.04%), Query Frame = 2
Query:  608 IDDGSKTTSMRSLAKRTINLSFPGMQTSTSKSLFIFSEENVIRKYAKIIIEWGPFEYMVLLTILANCIVLSMERHLPKKDKTLLAGQLELTEKYFLGIFCVEALLKIVALGFCCHKEAYLRNVWNIMDFVVVVTGFLMMFLNIDNHSDSSTVDLRTLRAVRVLRPLKLVAGFPSLQVVLKSIIRAMAPLLQIGLLVLFAITIFAIIGLEFYSGAFHYTCFKANSDKLPLPIPT-----EKSLVPCSNSKNGSGLGAYTCPEDYQCKAY-WEGPNYGITSFDNIGYAMLTVFQCITMEGWTDIMYHTNDAIGNRFNWLYFVPLIILGSFFMLNLVLGVLSGXXXXXXXXXXXXXXXLKLRRQQQTEKEFNG---YMEWI------------QKAEEVLLNEA------------TTTSEDKMRIIAARRRAEKQKYKLLGKNQS---IPDFEYEDTELYSETKSMKGNIFIRSYAGIRRRRKERCTSFWRTEKHFRFSVRRLVK--SQPFYWAVII-LVFFNTVCVAIEHYEQGKWLTLFLNYAEYVFLCLFMMEMMIKMYGLSIRVYFQSSFNIFDCVVIAGSLFEIIYGIFVQDSSFGLSVLRALRLLRIFKVTRYWAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMQLFGGEFNFE----EGKPPQNFDTFVKALLTVFQILTGEDWNTVMYNGIQSKGGVKERGTVFSIYFVLLVVFGNYTLLNVFLAIAVDNLA 2710
            I     T +   L+KR  +  +   + S + SL      + +R +  ++I    FE +V L IL NCI+L +    P ++           E  F  I+ +E + KI++ GF     AYLR+ WN +D +VV   +L +  +I          L  +R +RVLR  + ++    L+ ++ S++R++  L  + +L LF++ + A+IGL+ ++G     C    ++   +  P+     E   + C  S       A  CP +Y C A+    P++G T+FD+IG++++  FQ +TM+ W ++      ++G  +  +YFV  I   SF++LNLVL V+   +  E    +      ++     T+ +         W+             +  + L+ ++            T +   + R+  +R   +    ++L   +S    PD E E+T+  +   S+ G +      G  + +   C  + R  +    +   LV+   +P +  +I  L+  NTV + + ++     LT  L+    +F  LF++EM++K++   +  Y  + +N+FD V+I  S      G     +S G+S+ R LRLLR+  + + W ++  L+ ++ +S+  I ++  +L + I +FA++GM++FG  +  E     G P  NF  F  + + VF+IL  E W   +++ +      +   T   ++F+  ++ GN+ +LN+F+A+ +++ A
Sbjct:    9 ISQHPSTATFLILSKRFNSSGYQAYRFSRTASLLCLGPVHPLRMFCILLITHPYFEIIVTLVILVNCIILGLND--PPEE----------AEYIFTAIYTLEMICKIISRGFVKDSYAYLRDTWNWLDSLVVFLSYLSLAPDI--------ASLSGIRTLRVLRAFRTISALKGLRAMVNSLLRSLKLLTDVLVLFLFSLCVLALIGLQLFTGELRNKCVLETANATTINNPSSWYHREGEPLLCGFSST-----AGRCPANYTCVAHVGPNPDHGFTNFDDIGWSLVMAFQILTMDFWENLYDRVLRSMGEWY-MMYFVVGIFSCSFYLLNLVLAVVYMSYHHEMNLTDNEVTQSQVTHSPVTQSQVTHSPVTQSWVTHSPVTQSRVSQSRVTQSLVTQSWLMQSLVTQSPVTESRVSQSRVTQSRAHPKTDTIQVLEPLESHLYPPDEEEEETKPLTP-PSLNGIVL-----GEDQEKGVLCPKYPRLSR----ACSALVEFIQRPLFDGIIAGLILLNTVVLTMYYHGMPDDLTFVLDILNAIFTGLFILEMIVKIFAFGLVKYICNKWNLFDSVIIITSAVAYFLG-----TSTGVSIFRILRLLRVLYLAQSWETMAKLIRAIAHSVDPIFNITCILGVIIYVFAVVGMRVFGPHYTAEAFGSRGIPRWNFTDFTHSFMMVFRILCSE-WVEPLWDCM------RVTNTAALLFFLPALIVGNFIVLNLFVALLLNSFA 704          

HSP 3 Score: 109.768 bits (273), Expect = 1.077e-23
Identity = 150/686 (21.87%), Postives = 285/686 (41.55%), Query Frame = 2
Query:  770 FEYMVLLTILANCIVLSMERHLPKKDKTLLAGQLELTEKYFLGIFCVEALLKIVALGFCCHKEAYLRNVWNIMDFVVVVTGFLMMFLNIDNHSDSSTVDLRTLRAVRVLRPLKLVAGFPSLQVVLKSIIRAMAPLLQIGLLVLFAITIFAIIGLEFYSGAFHYTCFKANSDKLPLPIPTEKSLVPCSNSKNGSGLGAYTCPEDYQCKAYWEGPNYGITSFDNIGYAMLTVFQCITMEGWTDIMYHTNDAIGNRFNWLYFVPLIILGSFFMLNLVLGVLSGXXXXXXXXXXXXXXXLKLRRQQQTEKEFNGYMEWIQKAEEVLLNEATTTSEDKMRIIAARRRAEKQKY-KLLGKNQSIPDFEYEDTELYSETKSMKGNIFIRSYAGIRRRRKERCTSFWRTEKHFRFSVRRLVKSQPFYWAVIILVFFNTVCVAIE--HYEQGKWLTLFLNYAEYVFLCLFMMEMMIKMYGLSIRVYFQSSFNIFDCVVIA-----GSLFEIIYGIFVQDSSFGLSVLRALRLLRIFKVTRYWAXXXXXXXXXXXXXXX---XXXXXXXXXXXXXXXXXXGMQLFGGEF----NFEEGK-PPQ---------------------NFDTFVKALLTVFQILTGEDWNTVMYNGIQS----KGGVKERGTVFSIYFVLLVVFGNYTLLNVFLAIAVDN 2704
            F+ ++   IL N +VL+M  H    D T +   L++    F G+F +E ++KI A G       Y+ N WN+ D V+++T  +  FL        ++  +   R +R+LR L L   + ++  ++++I  ++ P+  I  ++   I +FA++G+  +    HYT     S  +P                                   W        +F +  ++ + VF+ +  E W + ++     + N    L+F+P +I+G+F +LNL + +L   FA               ++++   +E          +E+  +N  +  +         R R  +  Y + +  N++   +  E  + + E           +  G    ++  C   W     FR  VR  V+ + F W ++  V  ++  +  E  H  Q   L   LN+  ++F  +F +E ++K+ G     YF S +N  D ++++       LFE          +  LSV R+ R +R  +  R  + L  + + +     +   I S+L +  LF L+F++ G+QLF G+F    N E+ K  P                      NFD  +   L + Q+ T E W  VM + + S    +    E   +   YFV+ ++ G++ +LN+F+ + +DN
Sbjct:  482 FDGIIAGLILLNTVVLTMYYHGMPDDLTFV---LDILNAIFTGLFILEMIVKIFAFGLV----KYICNKWNLFDSVIIITSAVAYFLG-------TSTGVSIFRILRLLRVLYLAQSWETMAKLIRAIAHSVDPIFNITCILGVIIYVFAVVGMRVFGP--HYTAEAFGSRGIP----------------------------------RW--------NFTDFTHSFMMVFRILCSE-WVEPLWDCMR-VTNTAALLFFLPALIVGNFIVLNLFVALLLNSFA---------------KKEEDLHRE---------ASEQPYVNPCSCLAH------LTRTRKTRMYYTQAVNNNKNTKRYIVEIDDCFPEC--------CMNACGCTSGQQHFC---WL---KFRCRVRCFVEHRYFEWFILFTVMVSSFTLVFEDIHLHQKPDLERALNFLNFLFAAIFSLEFILKVIGFGFVSYFTSVWNCLDALIVSVCVSVACLFE----------NPNLSVFRSFRTVRGLRPLRAISRLGGMKVVINALFAAIPGIGSVLVVSMLFWLMFSISGVQLFAGKFYKCVNAEDEKLSPSVIPNKTACLDHPDYRWVNANVNFDNVINGFLALLQVATYEGWMEVMADAVDSTKIDQQPSYEANLIAYAYFVVFIIVGSFFVLNLFVGVIIDN 1053          

HSP 4 Score: 101.293 bits (251), Expect = 4.626e-21
Identity = 85/301 (28.24%), Postives = 142/301 (47.18%), Query Frame = 2
Query:  734 RKYAKIIIEWGPFEYMVLLTILANCIVLSMER-HLPKKDKTLLAGQLELTEKYFLGIFCVEALLKIVALGFCCHKEAYLRNVWNIMDFVVVVTGFLMMFLNIDNHSDSSTVDLRTLRAVRVLRPLKLVAGFPSLQVVLKSIIRAMAPLLQIGLLVLFAITIFAIIGLEFYSGAFHYTCFKANSDKL-PLPIPTEKSLVPCSNSKNGSGLGAYTCPEDYQCKAYWEGPNYGITSFDNIGYAMLTVFQCITMEGWTDIMYHTNDAI---------GNRFNWLYFVPLIILGSFFMLNLVLGVL 1603
            R   +  +E   FE+ +L T++ +   L  E  HL +K    L   L      F  IF +E +LK++  GF     +Y  +VWN +D ++V     +  L  +N + S     R+ R VR LRPL+ ++    ++VV+ ++  A+  +  + ++ +    +F+I G++ ++G F Y C  A  +KL P  IP + +   C +              DY+    W   N    +FDN+    L + Q  T EGW ++M    D+           N   + YFV  II+GSFF+LNL +GV+
Sbjct:  783 RCRVRCFVEHRYFEWFILFTVMVSSFTLVFEDIHLHQKPD--LERALNFLNFLFAAIFSLEFILKVIGFGFV----SYFTSVWNCLDALIVSVCVSVACL-FENPNLSV---FRSFRTVRGLRPLRAISRLGGMKVVINALFAAIPGIGSVLVVSMLFWLMFSISGVQLFAGKF-YKCVNAEDEKLSPSVIPNKTA---CLDHP------------DYR----WVNAN---VNFDNVINGFLALLQVATYEGWMEVMADAVDSTKIDQQPSYEANLIAYAYFVVFIIVGSFFVLNLFVGVI 1050          

HSP 5 Score: 97.8265 bits (242), Expect = 5.112e-20
Identity = 56/192 (29.17%), Postives = 102/192 (53.12%), Query Frame = 2
Query: 3089 SAMFIFSPLNSLRRFCHFVVNLRYFDLFIMIVICASSIALAAEDPVKEKSLKNNILEFFDYAFTGVFTVEMILKIIDLGIILHPGSYCRDLWNILDATVVICALVAFIMGQKPSPTGNKLRGSSAKNLNTIKSLRVLRVLRPLKTINRVPKLKAVFDCVVSSLKNVFNILIVYILFQFIFAVIAVQLFQGKF 3664
            +++    P++ LR FC  ++   YF++ + +VI  + I L   DP +E           +Y FT ++T+EMI KII  G +    +Y RD WN LD+ VV  + +                 S A ++ ++  +R LRVLR  +TI+ +  L+A+ + ++ SLK + ++L++++    + A+I +QLF G+ 
Sbjct:   39 ASLLCLGPVHPLRMFCILLITHPYFEIIVTLVILVNCIILGLNDPPEEA----------EYIFTAIYTLEMICKIISRGFVKDSYAYLRDTWNWLDSLVVFLSYL-----------------SLAPDIASLSGIRTLRVLRAFRTISALKGLRAMVNSLLRSLKLLTDVLVLFLFSLCVLALIGLQLFTGEL 203          

HSP 6 Score: 73.9442 bits (180), Expect = 8.695e-13
Identity = 53/158 (33.54%), Postives = 87/158 (55.06%), Query Frame = 2
Query:  770 FEYMVLLTILANCIVLSMERHLPKKDKTLLAGQLELTEKYFLGIFCVEALLKIVALGFCCHKEAYLRNVWNIMDFVVVVTGFLMMFLNIDNHSDSSTVD---LRTLRAVRVLRPLKLVAGFPSLQVVLKSIIRAMAPLLQIGLLVLFAITIFAIIGLE 1234
            FE  +L  I+ N + + M +H  +   T + G   L     +GIF +EA++KI+A+     +  Y +  W+I DFVVVV+  + M+L +   ++S+ V    LR LR  RV R L++V     ++ +L +II +M  L  IG L+   + I+AIIG+ 
Sbjct: 1114 FEVFILTVIMCN-MGMMMVQHYDQPPLTTVIGNYVL-----VGIFLLEAIIKIIAM-----RLHYFKKAWSIFDFVVVVSSIVGMYLGMS--TESAVVSPGLLRVLRVFRVARLLRVVQFAKRIRQLLVAIIISMPALFNIGTLLFLVMFIYAIIGMS 1258          

HSP 7 Score: 67.781 bits (164), Expect = 6.650e-11
Identity = 75/292 (25.68%), Postives = 147/292 (50.34%), Query Frame = 2
Query: 1880 TKSMKGNIFIRSYAGIRRRRKERCTSFWRTEKHFRFSVRRLVKSQPFYWAVIILVFFNTVCVAIEHYEQGKWLTLFLNYAEYVFLCLFMMEMMIKMYGLSIRVYFQSSFNIFDCVVIAGSLFEIIYGIFVQDSSFG---LSVLRALRLLRIFKVTRYWAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMQLFGGEFNFEEGKPPQNFDTFVKALLTVFQILTGEDWNTVM-------------YNGIQSKGGVKERGTVFSIYFVLLVVFGNYTLLNVFLAIAVDNL 2707
            T+S +  + I   A  R+    R     R    FR  +  LV S  F   ++ ++  N   + ++HY+Q    T+  NY   V + +F++E +IK+  + +  YF+ +++IFD VV+  S+  +  G+  + +      L VLR  R+ R+ +V ++   +R L+++++ SM ++ ++  LLFL + I+A++GM  FG            NF+TF  +++ +F++ TG  WN ++             + G+ +       G VF  Y V  +V     ++N+++A+ +DN+
Sbjct: 1072 TESQRKWVQILMAAAKRKPPSNRL----RPTDCFRGKLFDLVSSNQFEVFILTVIMCNMGMMMVQHYDQPPLTTVIGNY---VLVGIFLLEAIIKIIAMRLH-YFKKAWSIFDFVVVVSSIVGMYLGMSTESAVVSPGLLRVLRVFRVARLLRVVQFAKRIRQLLVAIIISMPALFNIGTLLFLVMFIYAIIGMSSFGNIKKQGALNDLVNFETFSSSIILIFRLGTGTGWNDILDALVVQPPHCDPNFGGLPNGNCGFPIGAVF--YLVTYIVSVFLIIVNMYIAVLLDNV 1353          

HSP 8 Score: 61.6178 bits (148), Expect = 4.367e-9
Identity = 61/261 (23.37%), Postives = 116/261 (44.44%), Query Frame = 2
Query: 4160 FEYFIMVMIALNTLILMMKYYREEKKASSAATHDREQQAYLNYCNTLIFLNSAFTVMFSIECVLKIMAFGPKNYFRDPWNIFDFITVIGSITDVLVSELQDXXXXXXXXXXXXXXXXXXXXXXQGY-TIRILLWTFIQSFKALPYVCLLIAMLFFIYSIIGMQVFG---NIKLISEYQINRHNNFQTFTNGLLLLFRCATGESWQEIMLACDNNKPCEKDIENTNNFDCGSNFTYIYFVSFIFLCSFLMLNLFVAVIMDNF 4930
            F+  I  +I LNT++L M Y+      +                  L  LN+ FT +F +E ++KI AFG   Y  + WN+FD + +I S     +         +   +        +  L Q + T+  L+     S   +  +  ++ ++ ++++++GM+VFG     +      I R  NF  FT+  +++FR    E W E +  C         + NT           ++F+  + + +F++LNLFVA+++++F
Sbjct:  482 FDGIIAGLILLNTVVLTMYYHGMPDDLTFV----------------LDILNAIFTGLFILEMIVKIFAFGLVKYICNKWNLFDSVIIITSAVAYFLGT------STGVSIFRILRLLRVLYLAQSWETMAKLIRAIAHSVDPIFNITCILGVIIYVFAVVGMRVFGPHYTAEAFGSRGIPRW-NFTDFTHSFMMVFRILCSE-WVEPLWDC-------MRVTNTA--------ALLFFLPALIVGNFIVLNLFVALLLNSF 703          

HSP 9 Score: 57.7658 bits (138), Expect = 6.351e-8
Identity = 40/160 (25.00%), Postives = 76/160 (47.50%), Query Frame = 2
Query: 3251 ILEFFDYAFTGVFTVEMILKIIDLGIILHPGSYCRDLWNILDATVVICALVAFIMGQKPSPTGNKLRGSSAKNLNTIKSLRVLRVLRPLKTINRVPKLKAVFDCVVSSLKNVFNILIVYILFQFIFAVIAVQLFQGKFFYCNDASKSSRETCRGYFFDYA 3730
            +L+  +  FTG+F +EMI+KI   G++     Y  + WN+ D+ ++I + VA+ +G   + TG             +   R+LR+LR L        +  +   +  S+  +FNI  +  +  ++FAV+ +++F   +      +  SR   R  F D+ 
Sbjct:  511 VLDILNAIFTGLFILEMIVKIFAFGLV----KYICNKWNLFDSVIIITSAVAYFLG---TSTG-------------VSIFRILRLLRVLYLAQSWETMAKLIRAIAHSVDPIFNITCILGVIIYVFAVVGMRVFGPHY---TAEAFGSRGIPRWNFTDFT 647          
BLAST of Voltage dependent L type calcium channel subunit vs. Ensembl Nematostella
Match: EDO35497 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLD1])

HSP 1 Score: 194.512 bits (493), Expect = 1.939e-52
Identity = 154/554 (27.80%), Postives = 286/554 (51.62%), Query Frame = 2
Query: 3143 VVNLRYFDLFIMIVICASSIALAAEDP-VKEKSLKNNILEFFDYAFTGVFTVEMILKIIDLGIILHPGSYCRDLWNILDATVVICALVAFIMGQKPSPTGNKLRGSSAKNLNTIKSLRVLRVLRPLKTINRVPKLKAVFDCVVSSLKNVFNILIVYILFQFIFAVIAVQLFQGKFFYC-NDASKSSRETCRGYFFDYAGRSTPETKKRLWQHHDFHFDNILYAMLTLFTVTTGEGWPTVLKNSMESTNIDNGPIADYRQEMAXXXXXXXXXXXXXXXXXXXALIIITFQEQGENELIDLDLDKNQKQCIDFAINEKPLCRYMPKDKTTIKYRVWRLVVSTPFEYFIMVMIALNTLILMMKYYREEKKASSAATHDREQQAYLNYCNTLIFLNSAFTVMFSIECVLKIMAFGPKNYFRDPWNIFDFITVIGSITDVL------VSELQDXXXXXXXXXXXXXXXXXXXXXXQGYTIRILLWTFIQSFKALPYVCLLIAMLFFIYSIIGMQVFGNIKLISEYQ---INRHNNFQTFTNGLLLLFRCATGESWQEIM 4771
            V + R FD  I++ I  S   LA E P + E+ LK  I++     FT +FT+EM++K++ +G++L PG+Y RD W++LD  +V+ + +  I+              S + L T++  R LR LRPL+ I R P LK V   ++ SLK + N +++  +F  +F ++ VQLF+GKF+YC  D+   S++ C              + +  W +  ++FD++L A+++LF V+T +GW  ++ + +++ ++D  PI +Y +   +++I F ++  F  +N+ V +++  FQ   E   +D +      +    A N+     Y  +    ++ ++  +     ++  I  +I +N + + +++Y+               Q ++   N        FT +F IE V+K++A G   Y +D WN+ D   V+ S+T ++      V  L + + +    +        +  L +G  +R LL T  ++   +P + LL  +LFFIYS +G+Q+FG+++   +Y     NRH +F+ F   +L LFR ATG++W  I+
Sbjct:   15 VCSHRAFDYVILVFIIFSCAVLAIEAPDIAEQGLKRQIIDISMLVFTIIFTIEMLIKLVAMGLVLGPGTYLRDGWDVLDGFLVMVSWIDIIVTYTSH--------VSPEVLGTLRVFRALRTLRPLRVIRRAPGLKLVVQTLLYSLKPIGNTVLIAAIFFVMFGILGVQLFKGKFYYCEGDSHVISKQEC------------ANSTRGQWVNRRYNFDDLLQALISLFVVSTKDGWVEIMHHGIDAVDVDVQPIVNYAEWRLVYFIPFLLLGGFLVLNMIVGVVVENFQRCRER--MDEEEQARPHRKGKKARNQMQDSLYY-ESYGPLRLKIHFICTHRNWDITIAAIICINVICMSLEHYKMP-------------QVFVETTNYF------FTSVFVIEVVVKVIALGFVRYPKDRWNLIDLAIVLLSVTGIVLELLVKVDHLFNPTVIRTLRVLRITRVLKLVKLAKG--VRSLLDTLFEALPQVPNLGLLFFLLFFIYSCLGIQLFGSLECSHDYPCQGFNRHAHFRDFGTAMLTLFRIATGDNWNGIL 524          

HSP 2 Score: 111.309 bits (277), Expect = 6.423e-25
Identity = 80/301 (26.58%), Postives = 157/301 (52.16%), Query Frame = 2
Query:  734 RKYAKIIIEWGPFEYMVLLTILANCIVLSMERHLPKKDKTLLAGQL-ELTEKYFLGIFCVEALLKIVALGFCCHKEAYLRNVWNIMDFVVVVTGFLMMFLNIDNHSDSSTVD-LRTLRAVRVLRPLKLVAGFPSLQVVLKSIIRAMAPLLQIGLLVLFAITIFAIIGLEFYSGAFHYTCFKANSDKLPLPIPTEKSLVPCSNSKNGSGLGAYTCPEDYQCKAYWEGPNYGITSFDNIGYAMLTVFQCITMEGWTDIMYHTNDAIG-------NRFNW--LYFVPLIILGSFFMLNLVLGVL 1603
            R+  + +     F+Y++L+ I+ +C VL++E   P   +  L  Q+ +++   F  IF +E L+K+VA+G       YLR+ W+++D  +V+  ++ + +   +H     +  LR  RA+R LRPL+++   P L++V+++++ ++ P+    L+      +F I+G++ + G F+Y   + +S  +        S   C+NS  G                 W    Y   +FD++  A++++F   T +GW +IM+H  DA+        N   W  +YF+P ++LG F +LN+++GV+
Sbjct:    9 RQRMRAVCSHRAFDYVILVFIIFSCAVLAIEA--PDIAEQGLKRQIIDISMLVFTIIFTIEMLIKLVAMGLVLGPGTYLRDGWDVLDGFLVMVSWIDIIVTYTSHVSPEVLGTLRVFRALRTLRPLRVIRRAPGLKLVVQTLLYSLKPIGNTVLIAAIFFVMFGILGVQLFKGKFYYC--EGDSHVI--------SKQECANSTRGQ----------------WVNRRY---NFDDLLQALISLFVVSTKDGWVEIMHHGIDAVDVDVQPIVNYAEWRLVYFIPFLLLGGFLVLNMIVGVV 278          

HSP 3 Score: 71.2478 bits (173), Expect = 2.906e-12
Identity = 64/252 (25.40%), Postives = 118/252 (46.83%), Query Frame = 2
Query: 3104 FSPLNSLRRFCHFVVNLRYFDLFIMIVICASSIALAAEDPVKEKSLKNNILEFFDYAFTGVFTVEMILKIIDLGIILHPGSYCRDLWNILDATVVICALVAFIMGQKPSPTGNKLRGSSAKNLNTIKSLRVLRVLRPLKTINRVPKLKAVFDCVVSSLKNVFNILIVYILFQFIFAVIAVQLFQGKFFYCNDASKSSRETCRGYFFDYAGRSTPETKKRLWQHHDFHFDNILYAMLTLFTVTTGEGWPTVLK 3859
            +     LR   HF+   R +D+ I  +IC + I ++ E       +    +E  +Y FT VF +E+++K+I LG + +P    +D WN++D  +V+ ++   ++          ++     N   I++LRVLR+ R LK +     ++++ D +  +L  V N+ +++ L  FI++ + +QLF            S    C+G+                  +   HF +   AMLTLF + TG+ W  +LK
Sbjct:  314 YESYGPLRLKIHFICTHRNWDITIAAIICINVICMSLE----HYKMPQVFVETTNYFFTSVFVIEVVVKVIALGFVRYP----KDRWNLIDLAIVLLSVTGIVLELL-------VKVDHLFNPTVIRTLRVLRITRVLKLVKLAKGVRSLLDTLFEALPQVPNLGLLFFLLFFIYSCLGIQLF-------GSLECSHDYPCQGF------------------NRHAHFRDFGTAMLTLFRIATGDNWNGILK 525          

HSP 4 Score: 70.8626 bits (172), Expect = 3.998e-12
Identity = 63/229 (27.51%), Postives = 118/229 (51.53%), Query Frame = 2
Query: 4316 AFTVMFSIECVLKIMA----FGPKNYFRDPWNIFDFITVIGSITDVLV---SELQDXXXXXXXXXXXXXXXXXXXXXXQGYTIRILLWTFIQSFKALPYVCLLIAMLFFIYSIIGMQVF--------GNIKLISEYQ---------INRHNNFQTFTNGLLLLFRCATGESWQEIMLACDNNKPCEKDIENTNNFDCGSNFTYIYFVSFIFLCSFLMLNLFVAVIMDNF 4930
             FT++F+IE ++K++A     GP  Y RD W++ D   V+ S  D++V   S +      +L   R  R  R ++++R+   +++++ T + S K +    L+ A+ F ++ I+G+Q+F        G+  +IS+ +         +NR  NF      L+ LF  +T + W EIM         + D++   N+   + +  +YF+ F+ L  FL+LN+ V V+++NF
Sbjct:   59 VFTIIFTIEMLIKLVAMGLVLGPGTYLRDGWDVLDGFLVMVSWIDIIVTYTSHVSPEVLGTLRVFRALRTLRPLRVIRRAPGLKLVVQTLLYSLKPIGNTVLIAAIFFVMFGILGVQLFKGKFYYCEGDSHVISKQECANSTRGQWVNRRYNFDDLLQALISLFVVSTKDGWVEIM--HHGIDAVDVDVQPIVNY---AEWRLVYFIPFLLLGGFLVLNMIVGVVVENF 282          

HSP 5 Score: 56.9954 bits (136), Expect = 8.708e-8
Identity = 60/238 (25.21%), Postives = 107/238 (44.96%), Query Frame = 2
Query:  794 ILANCIVLSMERHLPKKDKTLLAGQLELTEKYFLGIFCVEALLKIVALGFCCHKEAYLRNVWNIMDFVVV---VTGFLMMFLNIDNHSDSSTVDLRTLRAVRVLRPLKLVAGFPSLQVVLKSIIRAMAPLLQIGLLVLFAITIFAIIGLEFYSGAFHYTCFKANSDKLPLPIPTEKSLVPCSNSKNGSGLGAYTCPEDYQCKAYWEGPNYGITSFDNIGYAMLTVFQCITMEGWTDIM 1498
            I  N I +S+E +  K  +  +    E T  +F  +F +E ++K++ALGF      Y ++ WN++D  +V   VTG ++  L   +H  + TV +RTLR +R+ R LKLV     ++ +L ++  A+  +  +GLL      I++ +G++ +                                      G+  C  DY C+ +    +     F + G AMLT+F+  T + W  I+
Sbjct:  341 ICINVICMSLEHY--KMPQVFV----ETTNYFFTSVFVIEVVVKVIALGFV----RYPKDRWNLIDLAIVLLSVTGIVLELLVKVDHLFNPTV-IRTLRVLRITRVLKLVKLAKGVRSLLDTLFEALPQVPNLGLLFFLLFFIYSCLGIQLF--------------------------------------GSLECSHDYPCQGFNRHAH-----FRDFGTAMLTLFRIATGDNWNGIL 524          

HSP 6 Score: 51.2174 bits (121), Expect = 4.732e-6
Identity = 59/231 (25.54%), Postives = 121/231 (52.38%), Query Frame = 2
Query: 1922 GIRRRRKERCTSFWRTEKHFRFSVRRLVKSQPFYWAVIILVFFNTVCVAIEHYEQGKWLTLFLNYAEYVFLCLFMMEMMIKMYGLSIRVYFQSSFNIFDCVVIAGSLFEIIYGIFVQ-DSSFGLSVLRALRLLRI---FKVTRYWAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMQLFGGEFNFEEGKPPQNFD------TFVKALLTVFQILTGEDWNTVMYNG 2584
            G + R + + + ++ +    R  +  +   + +   +  ++  N +C+++EHY+  +   +F+    Y F  +F++E+++K+  L    Y +  +N+ D  ++  S+  I+  + V+ D  F  +V+R LR+LRI    K+ +    +R+L+ +L  ++  + +L  L FL   I++ LG+QLFG         P Q F+       F  A+LT+F+I TG++WN ++  G
Sbjct:  301 GKKARNQMQDSLYYESYGPLRLKIHFICTHRNWDITIAAIICINVICMSLEHYKMPQ---VFVETTNYFFTSVFVIEVVVKVIALGFVRYPKDRWNLIDLAIVLLSVTGIVLELLVKVDHLFNPTVIRTLRVLRITRVLKLVKLAKGVRSLLDTLFEALPQVPNLGLLFFLLFFIYSCLGIQLFG-SLECSHDYPCQGFNRHAHFRDFGTAMLTLFRIATGDNWNGILKVG 527          
BLAST of Voltage dependent L type calcium channel subunit vs. Ensembl Medaka
Match: cacna1c (voltage-dependent L-type calcium channel subunit alpha-1C [Source:NCBI gene;Acc:101173517])

HSP 1 Score: 1234.94 bits (3194), Expect = 0.000e+0
Identity = 746/1598 (46.68%), Postives = 1014/1598 (63.45%), Query Frame = 2
Query:  704 LFIFSEENVIRKYAKIIIEWGPFEYMVLLTILANCIVLSMERHLPKKDKTLLAGQLELTEKYFLGIFCVEALLKIVALGFCCHKEAYLRNVWNIMDFVVVVTGFLMMFLNIDNHSDSST--------VDLRTLRAVRVLRPLKLVAGFPSLQVVLKSIIRAMAPLLQIGLLVLFAITIFAIIGLEFYSGAFHYTCFKANSDKLPLPIPTEKSLVPCSNSKNGSGLGAYTCPEDYQCKAYWEGPNYGITSFDNIGYAMLTVFQCITMEGWTDIMYHTNDAIGNRFNWLYFVPLIILGSFFMLNLVLGVLSGXXXXXXXXXXXXXXXLKLRRQQQTEKEFNGYMEWIQKAEEV-LLNEATTTSEDKMRIIAARRRAEKQKYKLLGKNQSIPDFEYEDTELYSETKSMKGNIFIRSYAGIRRRRKERCTSFWRTEKHFRFSVRRLVKSQPFYWAVIILVFFNTVCVAIEHYEQGKWLTLFLNYAEYVFLCLFMMEMMIKMYGLSIRVYFQSSFNIFDCVVIAGSLFEIIYGIFVQDSSFGLSVLRALRLLRIFKVTRYWAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMQLFGGEFNFEEGKPPQNFDTFVKALLTVFQILTGEDWNTVMYNGIQSKGGVKERGTVFSIYFVLLVVFGNYTLLNVFLAIAVDNLANXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSSDNFIGRLPLSIDPPMVQVCPPSPQTANSLISKNFSFDHNQVEVNDKGCLLNTNK---PNGKLGMLGHDNTNFNSLESDPVPNKIEPETIQRK--PVLPYSAMFIFSPLNSLRRFCHFVVNLRYFDLFIMIVICASSIALAAEDPVKEKSLKNNILEFFDYAFTGVFTVEMILKIIDLGIILHPGSYCRDLWNILDATVVICALVAFIMGQKPSPTGNKLRGSSAKNLNTIKSLRVLRVLRPLKTINRVPKLKAVFDCVVSSLKNVFNILIVYILFQFIFAVIAVQLFQGKFFYCNDASKSSRETCRGYFFDY--AGRSTPETKKRLWQHHDFHFDNILYAMLTLFTVTTGEGWPTVLKNSMESTNIDNGPIADYRQEMAXXXXXXXXXXXXXXXXXXXALIIITFQEQGENELIDLDLDKNQKQCIDFAINEKPLCRYMPKDKTTIKYRVWRLVVSTPFEYFIMVMIALNTLILMMKYYREEKKASSAATHDREQQAYLNYCNTLIFLNSAFTVMFSIECVLKIMAFGPKNYFRDPWNIFDFITVIGSITDVLVSEL------QDXXXXXXXXXXXXXXXXXXXXXXQGYTIRILLWTFIQSFKALPYVCLLIAMLFFIYSIIGMQVFGNIKLISEYQINRHNNFQTFTNGLLLLFRCATGESWQEIMLACDNNKPCEKDIENTNNF---DCGSNFTYIYFVSFIFLCSFLMLNLFVAVIMDNFDYLTRDSSILGPHHLDEYIRVWAEYDPGAIGRIHHSEMYEMLRNMEPPVGFGKKCPYRLAYRKLIRMNMPVDENGTVNFTTTLFALIRESLNIKMSTAEYMDIKDMELRQTICKMWPVQAKKKLNLIVPPDSELVFHKMTVGKIYAGYLIVENWRAYKNSQEQG 5422
            L   + +N IR+    I+EW PFE ++L+TI ANC+ L++    P+ D       LE  E  FL IF VEA LK++A G   H  AYLRN WN++DF++VV G     L      D +T         D++ LRA RVLRPL+LV+G PSLQVVL SII+AM PLL I LLVLF I I+AIIGLE + G  H TC   ++      +  E+   PC+        G +      QC+  WEGPN GIT+FDN  +AMLTVFQCITMEGWTD++Y  NDA+  R+ W+YFV LII+GSFF+LNLVLGVLSGEF+KERE+ + R  F KLR +QQ E++  GY++WI +AE++   NE     +DK R ++              +N+S+        ++  ET   +  + IR    I + +  R +  W   + FR   R  VKSQ FYW VI LVF NT+ +A EH+ Q +WLT   + A  V L LF  EM++KMY L ++ YF S FN FD  V+ G + E I       S  G+SVLR +RLLRIFK+TRYW SL NLV SLLNS+RSI SLL LLFLFI+IF+LLGMQLFGG+FNF+E +    FD F ++LLTVFQILTGEDWN+VMY+GI + GG    G +  IYF++L + GNY LLNVFLAIAVDNLA+A+ LT+A++E+    +R   A     ++   +           PP+ +      +   S+ S   +    ++ ++D  C  + N+   P      +G D+     +   P P  +    ++ K  P+    A F+FS  N  R  CH +VN   F   I+  I  SSI+LAAEDPVK  S +N IL + D+ FTG+FT+E+ILK+   G  LH GS+CR+ +NILD  VV  +L++               G  +  +N +K LRVLRVLRPL+ INR   LK V  CV  +++ + NI+IV  L QF+FA I VQLF+GKFFYC D+SK ++  CRG +  Y       P    R+W++ DF+FD++L  M+ LF V+T EGWP +L  +++S + D GPI +YR  ++IF+I++ I+  FF +NIFV  +I+TFQEQGE E  + +LDKNQ+QC+++A+  +PL RY+PK+    +Y+VW +V ST FEY +  +I LNT+ L M+++ + K                N+ + +  LN  FT +F++E +LK++AF P+ YF DPWN+FDF+ VIGSI DV++SE+      ++++ +S+ F RLFR  RL+KLL +G  IR LLWTFI+SF+ALPYV LLI MLFFIY++IGMQ+FG I L    QINR+NNFQTF   +LLLFRCATGE+WQEIMLAC  N+PCEK   N N+    +CGS F  IYFVSF  LC+FL++NLFVAVIMDNFDYLTRD SILGPHHLDE+ R+WAEYDP A GRI H ++  +LR ++PP+GFGK CP+R+A ++L+ MNMP++ +GTV F  TLFAL+R +L IK  T   ++  + ELR  + K+W   + K L+ +VPP  +    ++TVGK YA +LI E +R +K  +EQG
Sbjct:  143 LLCLTLKNPIRRACISIVEWKPFEIIILMTIFANCVALAVYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIAYGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKGDGATPIGGKAAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFMGKMHKTCVHNHTG-----LNAEEKPAPCAPD---GAYGRHCTQNGTQCRVGWEGPNDGITNFDNFAFAMLTVFQCITMEGWTDVLYWVNDAVDYRWPWVYFVTLIIIGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPENEEEGLDDDKPRNLSMP----------ASENESVNTDNPPGGDVEGETCCTR--LAIR----ISKSKFSRYSRRW--NRLFRRKCRAAVKSQVFYWLVIFLVFLNTLTIASEHHRQPQWLTDVQDIANKVLLALFTGEMLLKMYSLGLQAYFVSLFNRFDSFVVCGGILETILVETKIMSPLGISVLRCVRLLRIFKITRYWNSLSNLVASLLNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDETRR-STFDNFPQSLLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYILLNVFLAIAVDNLADAESLTSAQKEEEEAKERKKLARLASPKKHEENE---------KPPLEEKKSEKIEL-KSITSDGETNPATKISMDD--CCGDENEEKNPYPANDYIGDDDEEEPEMPVGPRPRPLSDIHLKEKAVPMPEARAFFVFSHTNKFRVLCHKIVNHNIFTNLILFFILLSSISLAAEDPVKNDSFRNQILGYADHVFTGLFTIEIILKMTAYGAFLHKGSFCRNYFNILDLVVVSVSLIS--------------SGIQSSAINVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTTLLQFMFACIGVQLFKGKFFYCTDSSKQTQAECRGSYIMYKDGDVGKPGRSPRVWENSDFNFDDVLQGMMALFAVSTFEGWPGLLYRAIDSHSEDVGPIYNYRVVISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEQEYKNCELDKNQRQCVEYALKARPLRRYIPKNP--YQYKVWYVVNSTYFEYLMFTLILLNTICLAMQHHGQTK----------------NFNDAMNILNMLFTGLFTVEMILKLIAFKPRGYFSDPWNVFDFLIVIGSIIDVILSEINGLQNSEENARISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQMFGKIALRDLSQINRNNNFQTFPQAVLLLFRCATGEAWQEIMLACSPNRPCEKGSTNENSTASEECGSQFAIIYFVSFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVSMNMPLNSDGTVMFNATLFALVRTALRIK--TDGNLEQANEELRAIVKKIWKRTSMKLLDQVVPPAGD---DEVTVGKFYATFLIQEYFRKFKKRKEQG 1664          

HSP 2 Score: 89.3521 bits (220), Expect = 6.043e-17
Identity = 75/291 (25.77%), Postives = 134/291 (46.05%), Query Frame = 2
Query:  659 INLSFPGMQTSTSKSLFIFSEENVIRKYAKIIIEWGPFEYMVLLTILANCIVLSMERHLPKKDKTLLAGQLELTEKYFLGIFCVEALLKIVALGFCCHKEAYLRNVWNIMDFVVVVTGFLMMFLNIDNHSDSSTVD-LRTLRAVRVLRPLKLVAGFPSLQVVLKSIIRAMAPLLQIGLLVLFAITIFAIIGLEFYSGAFHYTCFKANSDKLPLPIPTEKSLVPCSNS----KNGSGLGAYTCPEDYQCKAYWEGPNYGITSFDNIGYAMLTVFQCITMEGWTDIMYHTNDA 1516
            I+L    +    +++ F+FS  N  R     I+    F  ++L  IL + I L+ E   P K+ +     L   +  F G+F +E +LK+ A G   HK ++ RN +NI+D VVV    +   +       SS ++ ++ LR +RVLRPL+ +     L+ V++ +  A+  +  I ++      +FA IG++ + G F Y C  +          ++++   C  S    K+G        P        WE  ++   +FD++   M+ +F   T EGW  ++Y   D+
Sbjct:  900 IHLKEKAVPMPEARAFFVFSHTNKFRVLCHKIVNHNIFTNLILFFILLSSISLAAED--PVKNDSFRNQILGYADHVFTGLFTIEIILKMTAYGAFLHKGSFCRNYFNILDLVVVSVSLISSGIQ------SSAINVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTTLLQFMFACIGVQLFKGKFFY-CTDS----------SKQTQAECRGSYIMYKDGDVGKPGRSPR------VWENSDF---NFDDVLQGMMALFAVSTFEGWPGLLYRAIDS 1162          
BLAST of Voltage dependent L type calcium channel subunit vs. Ensembl Medaka
Match: cacna1c (voltage-dependent L-type calcium channel subunit alpha-1C [Source:NCBI gene;Acc:101173517])

HSP 1 Score: 1225.31 bits (3169), Expect = 0.000e+0
Identity = 745/1609 (46.30%), Postives = 1012/1609 (62.90%), Query Frame = 2
Query:  704 LFIFSEENVIRKYAKIIIEWGPFEYMVLLTILANCIVLSMERHLPKKDKTLLAGQLELTEKYFLGIFCVEALLKIVALGFCCHKEAYLRNVWNIMDFVVVVTGFLMMFLNIDNHSDSST--------VDLRTLRAVRVLRPLKLVAGFPSLQVVLKSIIRAMAPLLQIGLLVLFAITIFAIIGLEFYSGAFHYTCFKANSDKLPLPIPTEKSLVPCSNSKNGSGLGAYTCPEDYQCKAYWEGPNYGITSFDNIGYAMLTVFQCITMEGWTDIMYHTNDAIGNRFNWLYFVPLIILGSFFMLNLVLGVLSGXXXXXXXXXXXXXXXLKLRRQQQTEKEFNGYMEWIQKAEEV-LLNEATTTSEDKMR-----IIAARRRAEKQKYKLLGKNQSIPDFEYEDTELYS------ETKSMKGNIFIRSYAGIRRRRKERCTSFWRTEKHFRFSVRRLVKSQPFYWAVIILVFFNTVCVAIEHYEQGKWLTLFLNYAEYVFLCLFMMEMMIKMYGLSIRVYFQSSFNIFDCVVIAGSLFEIIYGIFVQDSSFGLSVLRALRLLRIFKVTRYWAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMQLFGGEFNFEEGKPPQNFDTFVKALLTVFQILTGEDWNTVMYNGIQSKGGVKERGTVFSIYFVLLVVFGNYTLLNVFLAIAVDNLANXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSSDNFIGRLPLSIDPPMVQVCPPSPQTANSLISKNFSFDHNQVEVNDKGCLLNTNK---PNGKLGMLGHDNTNFNSLESDPVPNKIEPETIQRK--PVLPYSAMFIFSPLNSLRRFCHFVVNLRYFDLFIMIVICASSIALAAEDPVKEKSLKNNILEFFDYAFTGVFTVEMILKIIDLGIILHPGSYCRDLWNILDATVVICALVAFIMGQKPSPTGNKLRGSSAKNLNTIKSLRVLRVLRPLKTINRVPKLKAVFDCVVSSLKNVFNILIVYILFQFIFAVIAVQLFQGKFFYCNDASKSSRETCRGYFFDY--AGRSTPETKKRLWQHHDFHFDNILYAMLTLFTVTTGEGWPTVLKNSMESTNIDNGPIADYRQEMAXXXXXXXXXXXXXXXXXXXALIIITFQEQGENELIDLDLDKNQKQCIDFAINEKPLCRYMPKDKTTIKYRVWRLVVSTPFEYFIMVMIALNTLILMMKYYREEKKASSAATHDREQQAYLNYCNTLIFLNSAFTVMFSIECVLKIMAFGPKNYFRDPWNIFDFITVIGSITDVLVSEL------QDXXXXXXXXXXXXXXXXXXXXXXQGYTIRILLWTFIQSFKALPYVCLLIAMLFFIYSIIGMQVFGNIKLISEYQINRHNNFQTFTNGLLLLFRCATGESWQEIMLACDNNKPCEKDIENTNNF---DCGSNFTYIYFVSFIFLCSFLMLNLFVAVIMDNFDYLTRDSSILGPHHLDEYIRVWAEYDPGAIGRIHHSEMYEMLRNMEPPVGFGKKCPYRLAYRKLIRMNMPVDENGTVNFTTTLFALIRESLNIKMSTAEYMDIKDMELRQTICKMWPVQAKKKLNLIVPPDSELVFHKMTVGKIYAGYLIVENWRAYKNSQEQG 5422
            L   + +N IR+    I+EW PFE ++L+TI ANC+ L++    P+ D       LE  E  FL IF VEA LK++A G   H  AYLRN WN++DF++VV G     L      D +T         D++ LRA RVLRPL+LV+G PSLQVVL SII+AM PLL I LLVLF I I+AIIGLE + G  H TC   ++      +  E+   PC+        G +      QC+  WEGPN GIT+FDN  +AMLTVFQCITMEGWTD++Y   DA+G    W+YFV L+I GSFF+LNLVLGVLSGEF+KERE+ + R  F KLR +QQ E++  GY++WI +AE++   NE     +DK R        + R A K+    L K  S+P  E E     +      E ++    + IR    I + +  R +  W   + FR   R  VKSQ FYW VI LVF NT+ +A EH+ Q +WLT   + A  V L LF  EM++KMY L ++ YF S FN FD  V+ G + E I       S  G+SVLR +RLLRIFK+TRYW SL NLV SLLNS+RSI SLL LLFLFI+IF+LLGMQLFGG+FNF+E +    FD F ++LLTVFQILTGEDWN+VMY+GI + GG    G +  IYF++L + GNY LLNVFLAIAVDNLA+A+ LT+A++E+    +R   A     ++   +           PP+ +      +   S+ S   +    ++ ++D  C  + N+   P      +G D+     +   P P  +    ++ K  P+    A F+FS  N  R  CH +VN   F   I+  I  SSI+LAAEDPVK  S +N IL + D+ FTG+FT+E+ILK+   G  LH GS+CR+ +NILD  VV  +L++               G  +  +N +K LRVLRVLRPL+ INR   LK V  CV  +++ + NI+IV  L QF+FA I VQLF+GKFFYC D+SK ++  CRG +  Y       P    R+W++ DF+FD++L  M+ LF V+T EGWP +L  +++S + D GPI +YR  ++IF+I++ I+  FF +NIFV  +I+TFQEQGE E  + +LDKNQ+QC+++A+  +PL RY+PK+    +Y+VW +V ST FEY +  +I LNT+ L M+++ + K                N+ + +  LN  FT +F++E +LK++AF P++YF D WN FD + V+GSI D+ ++E+      ++++ +S+ F RLFR  RL+KLL +G  IR LLWTFI+SF+ALPYV LLI MLFFIY++IGMQ+FG I L    QINR+NNFQTF   +LLLFRCATGE+WQEIMLAC  N+PCEK   N N+    +CGS F  IYFVSF  LC+FL++NLFVAVIMDNFDYLTRD SILGPHHLDE+ R+WAEYDP A GRI H ++  +LR ++PP+GFGK CP+R+A ++L+ MNMP++ +GTV F  TLFAL+R +L IK  T   ++  + ELR  + K+W   + K L+ +VPP  +    ++TVGK YA +LI E +R +K  +EQG
Sbjct:  165 LLCLTLKNPIRRACISIVEWKPFEIIILMTIFANCVALAVYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIAYGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKGDGATPIGGKAAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFMGKMHKTCVHNHTG-----LNAEEKPAPCAPD---GAYGRHCTQNGTQCRVGWEGPNDGITNFDNFAFAMLTVFQCITMEGWTDVLYWMQDAMGYELPWVYFVSLVIFGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPENEEEGLDDDKPRNRKNHHFLSLRGAVKKNAAFLRKALSMPASENESVNTDNPPGGDVEGETCCTRLAIR----ISKSKFSRYSRRW--NRLFRRKCRAAVKSQVFYWLVIFLVFLNTLTIASEHHRQPQWLTDVQDIANKVLLALFTGEMLLKMYSLGLQAYFVSLFNRFDSFVVCGGILETILVETKIMSPLGISVLRCVRLLRIFKITRYWNSLSNLVASLLNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDETRR-STFDNFPQSLLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYILLNVFLAIAVDNLADAESLTSAQKEEEEAKERKKLARLASPKKHEENE---------KPPLEEKKSEKIEL-KSITSDGETNPATKISMDD--CCGDENEEKNPYPANDYIGDDDEEEPEMPVGPRPRPLSDIHLKEKAVPMPEARAFFVFSHTNKFRVLCHKIVNHNIFTNLILFFILLSSISLAAEDPVKNDSFRNQILGYADHVFTGLFTIEIILKMTAYGAFLHKGSFCRNYFNILDLVVVSVSLIS--------------SGIQSSAINVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTTLLQFMFACIGVQLFKGKFFYCTDSSKQTQAECRGSYIMYKDGDVGKPGRSPRVWENSDFNFDDVLQGMMALFAVSTFEGWPGLLYRAIDSHSEDVGPIYNYRVVISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEQEYKNCELDKNQRQCVEYALKARPLRRYIPKNP--YQYKVWYVVNSTYFEYLMFTLILLNTICLAMQHHGQTK----------------NFNDAMNILNMLFTGLFTVEMILKLIAFKPRHYFVDAWNTFDALIVVGSIVDIAITEVNGLQNSEENARISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQMFGKIALRDLSQINRNNNFQTFPQAVLLLFRCATGEAWQEIMLACSPNRPCEKGSTNENSTASEECGSQFAIIYFVSFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVSMNMPLNSDGTVMFNATLFALVRTALRIK--TDGNLEQANEELRAIVKKIWKRTSMKLLDQVVPPAGD---DEVTVGKFYATFLIQEYFRKFKKRKEQG 1709          

HSP 2 Score: 88.9669 bits (219), Expect = 7.295e-17
Identity = 75/291 (25.77%), Postives = 134/291 (46.05%), Query Frame = 2
Query:  659 INLSFPGMQTSTSKSLFIFSEENVIRKYAKIIIEWGPFEYMVLLTILANCIVLSMERHLPKKDKTLLAGQLELTEKYFLGIFCVEALLKIVALGFCCHKEAYLRNVWNIMDFVVVVTGFLMMFLNIDNHSDSSTVD-LRTLRAVRVLRPLKLVAGFPSLQVVLKSIIRAMAPLLQIGLLVLFAITIFAIIGLEFYSGAFHYTCFKANSDKLPLPIPTEKSLVPCSNS----KNGSGLGAYTCPEDYQCKAYWEGPNYGITSFDNIGYAMLTVFQCITMEGWTDIMYHTNDA 1516
            I+L    +    +++ F+FS  N  R     I+    F  ++L  IL + I L+ E   P K+ +     L   +  F G+F +E +LK+ A G   HK ++ RN +NI+D VVV    +   +       SS ++ ++ LR +RVLRPL+ +     L+ V++ +  A+  +  I ++      +FA IG++ + G F Y C  +          ++++   C  S    K+G        P        WE  ++   +FD++   M+ +F   T EGW  ++Y   D+
Sbjct:  945 IHLKEKAVPMPEARAFFVFSHTNKFRVLCHKIVNHNIFTNLILFFILLSSISLAAED--PVKNDSFRNQILGYADHVFTGLFTIEIILKMTAYGAFLHKGSFCRNYFNILDLVVVSVSLISSGIQ------SSAINVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTTLLQFMFACIGVQLFKGKFFY-CTDS----------SKQTQAECRGSYIMYKDGDVGKPGRSPR------VWENSDF---NFDDVLQGMMALFAVSTFEGWPGLLYRAIDS 1207          
BLAST of Voltage dependent L type calcium channel subunit vs. Ensembl Medaka
Match: cacna1c (voltage-dependent L-type calcium channel subunit alpha-1C [Source:NCBI gene;Acc:101173517])

HSP 1 Score: 1224.92 bits (3168), Expect = 0.000e+0
Identity = 745/1609 (46.30%), Postives = 1012/1609 (62.90%), Query Frame = 2
Query:  704 LFIFSEENVIRKYAKIIIEWGPFEYMVLLTILANCIVLSMERHLPKKDKTLLAGQLELTEKYFLGIFCVEALLKIVALGFCCHKEAYLRNVWNIMDFVVVVTGFLMMFLNIDNHSDSST--------VDLRTLRAVRVLRPLKLVAGFPSLQVVLKSIIRAMAPLLQIGLLVLFAITIFAIIGLEFYSGAFHYTCFKANSDKLPLPIPTEKSLVPCSNSKNGSGLGAYTCPEDYQCKAYWEGPNYGITSFDNIGYAMLTVFQCITMEGWTDIMYHTNDAIGNRFNWLYFVPLIILGSFFMLNLVLGVLSGXXXXXXXXXXXXXXXLKLRRQQQTEKEFNGYMEWIQKAEEV-LLNEATTTSEDKMR-----IIAARRRAEKQKYKLLGKNQSIPDFEYEDTELYS------ETKSMKGNIFIRSYAGIRRRRKERCTSFWRTEKHFRFSVRRLVKSQPFYWAVIILVFFNTVCVAIEHYEQGKWLTLFLNYAEYVFLCLFMMEMMIKMYGLSIRVYFQSSFNIFDCVVIAGSLFEIIYGIFVQDSSFGLSVLRALRLLRIFKVTRYWAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMQLFGGEFNFEEGKPPQNFDTFVKALLTVFQILTGEDWNTVMYNGIQSKGGVKERGTVFSIYFVLLVVFGNYTLLNVFLAIAVDNLANXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSSDNFIGRLPLSIDPPMVQVCPPSPQTANSLISKNFSFDHNQVEVNDKGCLLNTNK---PNGKLGMLGHDNTNFNSLESDPVPNKIEPETIQRK--PVLPYSAMFIFSPLNSLRRFCHFVVNLRYFDLFIMIVICASSIALAAEDPVKEKSLKNNILEFFDYAFTGVFTVEMILKIIDLGIILHPGSYCRDLWNILDATVVICALVAFIMGQKPSPTGNKLRGSSAKNLNTIKSLRVLRVLRPLKTINRVPKLKAVFDCVVSSLKNVFNILIVYILFQFIFAVIAVQLFQGKFFYCNDASKSSRETCRGYFFDY--AGRSTPETKKRLWQHHDFHFDNILYAMLTLFTVTTGEGWPTVLKNSMESTNIDNGPIADYRQEMAXXXXXXXXXXXXXXXXXXXALIIITFQEQGENELIDLDLDKNQKQCIDFAINEKPLCRYMPKDKTTIKYRVWRLVVSTPFEYFIMVMIALNTLILMMKYYREEKKASSAATHDREQQAYLNYCNTLIFLNSAFTVMFSIECVLKIMAFGPKNYFRDPWNIFDFITVIGSITDVLVSEL------QDXXXXXXXXXXXXXXXXXXXXXXQGYTIRILLWTFIQSFKALPYVCLLIAMLFFIYSIIGMQVFGNIKLISEYQINRHNNFQTFTNGLLLLFRCATGESWQEIMLACDNNKPCEKDIENTNNF---DCGSNFTYIYFVSFIFLCSFLMLNLFVAVIMDNFDYLTRDSSILGPHHLDEYIRVWAEYDPGAIGRIHHSEMYEMLRNMEPPVGFGKKCPYRLAYRKLIRMNMPVDENGTVNFTTTLFALIRESLNIKMSTAEYMDIKDMELRQTICKMWPVQAKKKLNLIVPPDSELVFHKMTVGKIYAGYLIVENWRAYKNSQEQG 5422
            L   + +N IR+    I+EW PFE ++L+TI ANC+ L++    P+ D       LE  E  FL IF VEA LK++A G   H  AYLRN WN++DF++VV G     L      D +T         D++ LRA RVLRPL+LV+G PSLQVVL SII+AM PLL I LLVLF I I+AIIGLE + G  H TC   ++      +  E+   PC+        G +      QC+  WEGPN GIT+FDN  +AMLTVFQCITMEGWTD++Y   DA+G    W+YFV L+I GSFF+LNLVLGVLSGEF+KERE+ + R  F KLR +QQ E++  GY++WI +AE++   NE     +DK R        + R A K+    L K  S+P  E E     +      E ++    + IR    I + +  R +  W   + FR   R  VKSQ FYW VI LVF NT+ +A EH+ Q +WLT   + A  V L LF  EM++KMY L ++ YF S FN FD  V+ G + E I       S  G+SVLR +RLLRIFK+TRYW SL NLV SLLNS+RSI SLL LLFLFI+IF+LLGMQLFGG+FNF+E +    FD F ++LLTVFQILTGEDWN+VMY+GI + GG    G +  IYF++L + GNY LLNVFLAIAVDNLA+A+ LT+A++E+    +R   A     ++   +           PP+ +      +   S+ S   +    ++ ++D  C  + N+   P      +G D+     +   P P  +    ++ K  P+    A F+FS  N  R  CH +VN   F   I+  I  SSI+LAAEDPVK  S +N IL + D+ FTG+FT+E+ILK+   G  LH GS+CR+ +NILD  VV  +L++               G  +  +N +K LRVLRVLRPL+ INR   LK V  CV  +++ + NI+IV  L QF+FA I VQLF+GKFFYC D+SK ++  CRG +  Y       P    R+W++ DF+FD++L  M+ LF V+T EGWP +L  +++S + D GPI +YR  ++IF+I++ I+  FF +NIFV  +I+TFQEQGE E  + +LDKNQ+QC+++A+  +PL RY+PK+    +Y+VW +V ST FEY +  +I LNT+ L M+++ + K                N+ + +  LN  FT +F++E +LK++AF P++YF D WN FD + V+GSI D+ ++E+      ++++ +S+ F RLFR  RL+KLL +G  IR LLWTFI+SF+ALPYV LLI MLFFIY++IGMQ+FG I L    QINR+NNFQTF   +LLLFRCATGE+WQEIMLAC  N+PCEK   N N+    +CGS F  IYFVSF  LC+FL++NLFVAVIMDNFDYLTRD SILGPHHLDE+ R+WAEYDP A GRI H ++  +LR ++PP+GFGK CP+R+A ++L+ MNMP++ +GTV F  TLFAL+R +L IK  T   ++  + ELR  + K+W   + K L+ +VPP  +    ++TVGK YA +LI E +R +K  +EQG
Sbjct:  165 LLCLTLKNPIRRACISIVEWKPFEIIILMTIFANCVALAVYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIAYGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKGDGATPIGGKAAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFMGKMHKTCVHNHTG-----LNAEEKPAPCAPD---GAYGRHCTQNGTQCRVGWEGPNDGITNFDNFAFAMLTVFQCITMEGWTDVLYWMQDAMGYELPWVYFVSLVIFGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPENEEEGLDDDKPRNRKNHHFLSLRGAVKKNAAFLRKALSMPASENESVNTDNPPGGDVEGETCCTRLAIR----ISKSKFSRYSRRW--NRLFRRKCRAAVKSQVFYWLVIFLVFLNTLTIASEHHRQPQWLTDVQDIANKVLLALFTGEMLLKMYSLGLQAYFVSLFNRFDSFVVCGGILETILVETKIMSPLGISVLRCVRLLRIFKITRYWNSLSNLVASLLNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDETRR-STFDNFPQSLLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYILLNVFLAIAVDNLADAESLTSAQKEEEEAKERKKLARLASPKKHEENE---------KPPLEEKKSEKIEL-KSITSDGETNPATKISMDD--CCGDENEEKNPYPANDYIGDDDEEEPEMPVGPRPRPLSDIHLKEKAVPMPEARAFFVFSHTNKFRVLCHKIVNHNIFTNLILFFILLSSISLAAEDPVKNDSFRNQILGYADHVFTGLFTIEIILKMTAYGAFLHKGSFCRNYFNILDLVVVSVSLIS--------------SGIQSSAINVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTTLLQFMFACIGVQLFKGKFFYCTDSSKQTQAECRGSYIMYKDGDVGKPGRSPRVWENSDFNFDDVLQGMMALFAVSTFEGWPGLLYRAIDSHSEDVGPIYNYRVVISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEQEYKNCELDKNQRQCVEYALKARPLRRYIPKNP--YQYKVWYVVNSTYFEYLMFTLILLNTICLAMQHHGQTK----------------NFNDAMNILNMLFTGLFTVEMILKLIAFKPRHYFVDAWNTFDALIVVGSIVDIAITEVNGLQNSEENARISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQMFGKIALRDLSQINRNNNFQTFPQAVLLLFRCATGEAWQEIMLACSPNRPCEKGSTNENSTASEECGSQFAIIYFVSFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVSMNMPLNSDGTVMFNATLFALVRTALRIK--TDGNLEQANEELRAIVKKIWKRTSMKLLDQVVPPAGD---DEVTVGKFYATFLIQEYFRKFKKRKEQG 1709          

HSP 2 Score: 88.9669 bits (219), Expect = 7.239e-17
Identity = 75/291 (25.77%), Postives = 134/291 (46.05%), Query Frame = 2
Query:  659 INLSFPGMQTSTSKSLFIFSEENVIRKYAKIIIEWGPFEYMVLLTILANCIVLSMERHLPKKDKTLLAGQLELTEKYFLGIFCVEALLKIVALGFCCHKEAYLRNVWNIMDFVVVVTGFLMMFLNIDNHSDSSTVD-LRTLRAVRVLRPLKLVAGFPSLQVVLKSIIRAMAPLLQIGLLVLFAITIFAIIGLEFYSGAFHYTCFKANSDKLPLPIPTEKSLVPCSNS----KNGSGLGAYTCPEDYQCKAYWEGPNYGITSFDNIGYAMLTVFQCITMEGWTDIMYHTNDA 1516
            I+L    +    +++ F+FS  N  R     I+    F  ++L  IL + I L+ E   P K+ +     L   +  F G+F +E +LK+ A G   HK ++ RN +NI+D VVV    +   +       SS ++ ++ LR +RVLRPL+ +     L+ V++ +  A+  +  I ++      +FA IG++ + G F Y C  +          ++++   C  S    K+G        P        WE  ++   +FD++   M+ +F   T EGW  ++Y   D+
Sbjct:  945 IHLKEKAVPMPEARAFFVFSHTNKFRVLCHKIVNHNIFTNLILFFILLSSISLAAED--PVKNDSFRNQILGYADHVFTGLFTIEIILKMTAYGAFLHKGSFCRNYFNILDLVVVSVSLISSGIQ------SSAINVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTTLLQFMFACIGVQLFKGKFFY-CTDS----------SKQTQAECRGSYIMYKDGDVGKPGRSPR------VWENSDF---NFDDVLQGMMALFAVSTFEGWPGLLYRAIDS 1207          
BLAST of Voltage dependent L type calcium channel subunit vs. Ensembl Medaka
Match: cacna1c (voltage-dependent L-type calcium channel subunit alpha-1C [Source:NCBI gene;Acc:101173517])

HSP 1 Score: 1219.91 bits (3155), Expect = 0.000e+0
Identity = 744/1626 (45.76%), Postives = 1011/1626 (62.18%), Query Frame = 2
Query:  704 LFIFSEENVIRKYAKIIIEWGPFEYMVLLTILANCIVLSMERHLPKKDKTLLAGQLELTEKYFLGIFCVEALLKIVALGFCCHKEAYLRNVWNIMDFVVVVTGFLMMFLNIDNHSDSST--------VDLRTLRAVRVLRPLKLVAGFPSLQVVLKSIIRAMAPLLQIGLLVLFAITIFAIIGLEFYSGAFHYTCFKANSDKLPLPIPTEKSLVPCSNSKNGSGLGAYTCPEDYQCKAYWEGPNYGITSFDNIGYAMLTVFQCITMEGWTDIMYHTNDAIGNRFNWLYFVPLIILGSFFMLNLVLGVLSGXXXXXXXXXXXXXXXLKLRRQQQTEKEFNGYMEWIQKAEEV-LLNEATTTSEDKMRIIAARRRAEKQKYKLLGKNQSIPDFEYEDTELYSETKSMKGNIFIRSYAGIRRRRKERCTSFWRTEKHFRFSVRRLVKSQPFYWAVIILVFFNTVCVAIEHYEQGKWLTLFLNYAEYVFLCLFMMEMMIKMYGLSIRVYFQSSFNIFDCVVIAGSLFEIIYGIFVQDSSFGLSVLRALRLLRIFKVTRYWAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMQLFGGEFNFEEGKPPQNFDTFVKALLTVFQILTGEDWNTVMYNGIQSKGGVKERGTVFSIYFVLLVVFGNYTLLNVFLAIAVDNLANXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSSDNFIGRLPLSIDPPMVQVCPPSPQTANSLISKNFSFDHNQVEVNDKGCLLNTNK---PNGKLGMLGHDNTNFNSLESDPVPNKIEPETIQRK--PVLPYSAMFIFSPLNSLRRFCHFVVNLRYFDLFIMIVICASSIALAAEDPVKEKSLKNNILEFFDYAFTGVFTVEMILKIIDLGIILHPGSYCRDLWNILDATVVICALVAFIMGQKPSPTGNKLRGSSAKNLNTIKSLRVLRVLRPLKTINRVPKLKAVFDCVVSSLKNVFNILIVYILFQFIFAVIAVQLFQGKFFYCNDASKSSRETCRGYFFDY--AGRSTPETKKRLWQHHDFHFDNILYAMLTLFTVTTGEGWPTVLKNSMESTNIDNGPIADYRQEMAXXXXXXXXXXXXXXXXXXXALIIITFQEQGENELIDLDLDKNQKQCIDFAINEKPLCRYMPKDKTTIKYRVWRLVVSTPFEYFIMVMIALNTLILMMKYYREEKKASSAATHDREQQAYLNYCNTLIFLNSAFTVMFSIECVLKIMAFGPKNYFRDPWNIFDFITVIGSITDVLVSEL----------------------------------QDXXXXXXXXXXXXXXXXXXXXXXQGYTIRILLWTFIQSFKALPYVCLLIAMLFFIYSIIGMQVFGNIKLISEYQINRHNNFQTFTNGLLLLFRCATGESWQEIMLACDNNKPCEKDIENTNNF---DCGSNFTYIYFVSFIFLCSFLMLNLFVAVIMDNFDYLTRDSSILGPHHLDEYIRVWAEYDPGAIGRIHHSEMYEMLRNMEPPVGFGKKCPYRLAYRKLIRMNMPVDENGTVNFTTTLFALIRESLNIKMSTAEYMDIKDMELRQTICKMWPVQAKKKLNLIVPPDSELVFHKMTVGKIYAGYLIVENWRAYKNSQEQG 5422
            L   + +N IR+    I+EW PFE ++L+TI ANC+ L++    P+ D       LE  E  FL IF VEA LK++A G   H  AYLRN WN++DF++VV G     L      D +T         D++ LRA RVLRPL+LV+G PSLQVVL SII+AM PLL I LLVLF I I+AIIGLE + G  H TC   ++      +  E+   PC+        G +      QC+  WEGPN GIT+FDN  +AMLTVFQCITMEGWTD++Y   DA+G    W+YFV L+I GSFF+LNLVLGVLSGEF+KERE+ + R  F KLR +QQ E++  GY++WI +AE++   NE     +DK R ++              +N+S+        ++  ET   +  + IR    I + +  R +  W   + FR   R  VKSQ FYW VI LVF NT+ +A EH+ Q +WLT   + A  V L LF  EM++KMY L ++ YF S FN FD  V+ G + E I       S  G+SVLR +RLLRIFK+TRYW SL NLV SLLNS+RSI SLL LLFLFI+IF+LLGMQLFGG+FNF+E +    FD F ++LLTVFQILTGEDWN+VMY+GI + GG    G +  IYF++L + GNY LLNVFLAIAVDNLA+A+ LT+A++E+    +R   A     ++   +           PP+ +      +   S+ S   +    ++ ++D  C  + N+   P      +G D+     +   P P  +    ++ K  P+    A F+FS  N  R  CH +VN   F   I+  I  SSI+LAAEDPVK  S +N IL + D+ FTG+FT+E+ILK+   G  LH GS+CR+ +NILD  VV  +L++               G  +  +N +K LRVLRVLRPL+ INR   LK V  CV  +++ + NI+IV  L QF+FA I VQLF+GKFFYC D+SK ++  CRG +  Y       P    R+W++ DF+FD++L  M+ LF V+T EGWP +L  +++S + D GPI +YR  ++IF+I++ I+  FF +NIFV  +I+TFQEQGE E  + +LDKNQ+QC+++A+  +PL RY+PK+    +Y+VW +V ST FEY +  +I LNT+ L M+++ + K                N+ + +  LN  FT +F++E +LK++AF P+ YF DPWN+FDF+ VIGSI DV++SE+                                  ++++ +S+ F RLFR  RL+KLL +G  IR LLWTFI+SF+ALPYV LLI MLFFIY++IGMQ+FG I L    QINR+NNFQTF   +LLLFRCATGE+WQEIMLAC  N+PCEK   N N+    +CGS F  IYFVSF  LC+FL++NLFVAVIMDNFDYLTRD SILGPHHLDE+ R+WAEYDP A GRI H ++  +LR ++PP+GFGK CP+R+A ++L+ MNMP++ +GTV F  TLFAL+R +L IK  T   ++  + ELR  + K+W   + K L+ +VPP  +    ++TVGK YA +LI E +R +K  +EQG
Sbjct:  143 LLCLTLKNPIRRACISIVEWKPFEIIILMTIFANCVALAVYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIAYGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKGDGATPIGGKAAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFMGKMHKTCVHNHTG-----LNAEEKPAPCAPD---GAYGRHCTQNGTQCRVGWEGPNDGITNFDNFAFAMLTVFQCITMEGWTDVLYWMQDAMGYELPWVYFVSLVIFGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPENEEEGLDDDKPRNLSMP----------ASENESVNTDNPPGGDVEGETCCTR--LAIR----ISKSKFSRYSRRW--NRLFRRKCRAAVKSQVFYWLVIFLVFLNTLTIASEHHRQPQWLTDVQDIANKVLLALFTGEMLLKMYSLGLQAYFVSLFNRFDSFVVCGGILETILVETKIMSPLGISVLRCVRLLRIFKITRYWNSLSNLVASLLNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDETR-RSTFDNFPQSLLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYILLNVFLAIAVDNLADAESLTSAQKEEEEAKERKKLARLASPKKHEENE---------KPPLEEKKSEKIEL-KSITSDGETNPATKISMDD--CCGDENEEKNPYPANDYIGDDDEEEPEMPVGPRPRPLSDIHLKEKAVPMPEARAFFVFSHTNKFRVLCHKIVNHNIFTNLILFFILLSSISLAAEDPVKNDSFRNQILGYADHVFTGLFTIEIILKMTAYGAFLHKGSFCRNYFNILDLVVVSVSLIS--------------SGIQSSAINVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTTLLQFMFACIGVQLFKGKFFYCTDSSKQTQAECRGSYIMYKDGDVGKPGRSPRVWENSDFNFDDVLQGMMALFAVSTFEGWPGLLYRAIDSHSEDVGPIYNYRVVISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEQEYKNCELDKNQRQCVEYALKARPLRRYIPKNP--YQYKVWYVVNSTYFEYLMFTLILLNTICLAMQHHGQTK----------------NFNDAMNILNMLFTGLFTVEMILKLIAFKPRGYFSDPWNVFDFLIVIGSIIDVILSEINPADSSSSSSSSSSSSSSSTSHPPVVRPMGLQNSEENARISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQMFGKIALRDLSQINRNNNFQTFPQAVLLLFRCATGEAWQEIMLACSPNRPCEKGSTNENSTASEECGSQFAIIYFVSFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVSMNMPLNSDGTVMFNATLFALVRTALRIK--TDGNLEQANEELRAIVKKIWKRTSMKLLDQVVPPAGD---DEVTVGKFYATFLIQEYFRKFKKRKEQG 1692          

HSP 2 Score: 88.9669 bits (219), Expect = 6.758e-17
Identity = 75/291 (25.77%), Postives = 134/291 (46.05%), Query Frame = 2
Query:  659 INLSFPGMQTSTSKSLFIFSEENVIRKYAKIIIEWGPFEYMVLLTILANCIVLSMERHLPKKDKTLLAGQLELTEKYFLGIFCVEALLKIVALGFCCHKEAYLRNVWNIMDFVVVVTGFLMMFLNIDNHSDSSTVD-LRTLRAVRVLRPLKLVAGFPSLQVVLKSIIRAMAPLLQIGLLVLFAITIFAIIGLEFYSGAFHYTCFKANSDKLPLPIPTEKSLVPCSNS----KNGSGLGAYTCPEDYQCKAYWEGPNYGITSFDNIGYAMLTVFQCITMEGWTDIMYHTNDA 1516
            I+L    +    +++ F+FS  N  R     I+    F  ++L  IL + I L+ E   P K+ +     L   +  F G+F +E +LK+ A G   HK ++ RN +NI+D VVV    +   +       SS ++ ++ LR +RVLRPL+ +     L+ V++ +  A+  +  I ++      +FA IG++ + G F Y C  +          ++++   C  S    K+G        P        WE  ++   +FD++   M+ +F   T EGW  ++Y   D+
Sbjct:  900 IHLKEKAVPMPEARAFFVFSHTNKFRVLCHKIVNHNIFTNLILFFILLSSISLAAED--PVKNDSFRNQILGYADHVFTGLFTIEIILKMTAYGAFLHKGSFCRNYFNILDLVVVSVSLISSGIQ------SSAINVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTTLLQFMFACIGVQLFKGKFFY-CTDS----------SKQTQAECRGSYIMYKDGDVGKPGRSPR------VWENSDF---NFDDVLQGMMALFAVSTFEGWPGLLYRAIDS 1162          
BLAST of Voltage dependent L type calcium channel subunit vs. Ensembl Medaka
Match: cacna1c (voltage-dependent L-type calcium channel subunit alpha-1C [Source:NCBI gene;Acc:101173517])

HSP 1 Score: 1219.14 bits (3153), Expect = 0.000e+0
Identity = 744/1626 (45.76%), Postives = 1011/1626 (62.18%), Query Frame = 2
Query:  704 LFIFSEENVIRKYAKIIIEWGPFEYMVLLTILANCIVLSMERHLPKKDKTLLAGQLELTEKYFLGIFCVEALLKIVALGFCCHKEAYLRNVWNIMDFVVVVTGFLMMFLNIDNHSDSST--------VDLRTLRAVRVLRPLKLVAGFPSLQVVLKSIIRAMAPLLQIGLLVLFAITIFAIIGLEFYSGAFHYTCFKANSDKLPLPIPTEKSLVPCSNSKNGSGLGAYTCPEDYQCKAYWEGPNYGITSFDNIGYAMLTVFQCITMEGWTDIMYHTNDAIGNRFNWLYFVPLIILGSFFMLNLVLGVLSGXXXXXXXXXXXXXXXLKLRRQQQTEKEFNGYMEWIQKAEEV-LLNEATTTSEDKMRIIAARRRAEKQKYKLLGKNQSIPDFEYEDTELYSETKSMKGNIFIRSYAGIRRRRKERCTSFWRTEKHFRFSVRRLVKSQPFYWAVIILVFFNTVCVAIEHYEQGKWLTLFLNYAEYVFLCLFMMEMMIKMYGLSIRVYFQSSFNIFDCVVIAGSLFEIIYGIFVQDSSFGLSVLRALRLLRIFKVTRYWAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMQLFGGEFNFEEGKPPQNFDTFVKALLTVFQILTGEDWNTVMYNGIQSKGGVKERGTVFSIYFVLLVVFGNYTLLNVFLAIAVDNLANXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSSDNFIGRLPLSIDPPMVQVCPPSPQTANSLISKNFSFDHNQVEVNDKGCLLNTNK---PNGKLGMLGHDNTNFNSLESDPVPNKIEPETIQRK--PVLPYSAMFIFSPLNSLRRFCHFVVNLRYFDLFIMIVICASSIALAAEDPVKEKSLKNNILEFFDYAFTGVFTVEMILKIIDLGIILHPGSYCRDLWNILDATVVICALVAFIMGQKPSPTGNKLRGSSAKNLNTIKSLRVLRVLRPLKTINRVPKLKAVFDCVVSSLKNVFNILIVYILFQFIFAVIAVQLFQGKFFYCNDASKSSRETCRGYFFDY--AGRSTPETKKRLWQHHDFHFDNILYAMLTLFTVTTGEGWPTVLKNSMESTNIDNGPIADYRQEMAXXXXXXXXXXXXXXXXXXXALIIITFQEQGENELIDLDLDKNQKQCIDFAINEKPLCRYMPKDKTTIKYRVWRLVVSTPFEYFIMVMIALNTLILMMKYYREEKKASSAATHDREQQAYLNYCNTLIFLNSAFTVMFSIECVLKIMAFGPKNYFRDPWNIFDFITVIGSITDVLVSEL----------------------------------QDXXXXXXXXXXXXXXXXXXXXXXQGYTIRILLWTFIQSFKALPYVCLLIAMLFFIYSIIGMQVFGNIKLISEYQINRHNNFQTFTNGLLLLFRCATGESWQEIMLACDNNKPCEKDIENTNNF---DCGSNFTYIYFVSFIFLCSFLMLNLFVAVIMDNFDYLTRDSSILGPHHLDEYIRVWAEYDPGAIGRIHHSEMYEMLRNMEPPVGFGKKCPYRLAYRKLIRMNMPVDENGTVNFTTTLFALIRESLNIKMSTAEYMDIKDMELRQTICKMWPVQAKKKLNLIVPPDSELVFHKMTVGKIYAGYLIVENWRAYKNSQEQG 5422
            L   + +N IR+    I+EW PFE ++L+TI ANC+ L++    P+ D       LE  E  FL IF VEA LK++A G   H  AYLRN WN++DF++VV G     L      D +T         D++ LRA RVLRPL+LV+G PSLQVVL SII+AM PLL I LLVLF I I+AIIGLE + G  H TC   ++      +  E+   PC+        G +      QC+  WEGPN GIT+FDN  +AMLTVFQCITMEGWTD++Y   DA+G    W+YFV L+I GSFF+LNLVLGVLSGEF+KERE+ + R  F KLR +QQ E++  GY++WI +AE++   NE     +DK R ++              +N+S+        ++  ET   +  + IR    I + +  R +  W   + FR   R  VKSQ FYW VI LVF NT+ +A EH+ Q +WLT   + A  V L LF  EM++KMY L ++ YF S FN FD  V+ G + E I       S  G+SVLR +RLLRIFK+TRYW SL NLV SLLNS+RSI SLL LLFLFI+IF+LLGMQLFGG+FNF+E +    FD F ++LLTVFQILTGEDWN+VMY+GI + GG    G +  IYF++L + GNY LLNVFLAIAVDNLA+A+ LT+A++E+    +R   A     ++   +           PP+ +      +   S+ S   +    ++ ++D  C  + N+   P      +G D+     +   P P  +    ++ K  P+    A F+FS  N  R  CH +VN   F   I+  I  SSI+LAAEDPVK  S +N IL + D+ FTG+FT+E+ILK+   G  LH GS+CR+ +NILD  VV  +L++               G  +  +N +K LRVLRVLRPL+ INR   LK V  CV  +++ + NI+IV  L QF+FA I VQLF+GKFFYC D+SK ++  CRG +  Y       P    R+W++ DF+FD++L  M+ LF V+T EGWP +L  +++S + D GPI +YR  ++IF+I++ I+  FF +NIFV  +I+TFQEQGE E  + +LDKNQ+QC+++A+  +PL RY+PK+    +Y+VW +V ST FEY +  +I LNT+ L M+++ + K                N+ + +  LN  FT +F++E +LK++AF P+ YF DPWN+FDF+ VIGSI DV++SE+                                  ++++ +S+ F RLFR  RL+KLL +G  IR LLWTFI+SF+ALPYV LLI MLFFIY++IGMQ+FG I L    QINR+NNFQTF   +LLLFRCATGE+WQEIMLAC  N+PCEK   N N+    +CGS F  IYFVSF  LC+FL++NLFVAVIMDNFDYLTRD SILGPHHLDE+ R+WAEYDP A GRI H ++  +LR ++PP+GFGK CP+R+A ++L+ MNMP++ +GTV F  TLFAL+R +L IK  T   ++  + ELR  + K+W   + K L+ +VPP  +    ++TVGK YA +LI E +R +K  +EQG
Sbjct:  143 LLCLTLKNPIRRACISIVEWKPFEIIILMTIFANCVALAVYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIAYGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKGDGATPIGGKAAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFMGKMHKTCVHNHTG-----LNAEEKPAPCAPD---GAYGRHCTQNGTQCRVGWEGPNDGITNFDNFAFAMLTVFQCITMEGWTDVLYWMQDAMGYELPWVYFVSLVIFGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPENEEEGLDDDKPRNLSMP----------ASENESVNTDNPPGGDVEGETCCTR--LAIR----ISKSKFSRYSRRW--NRLFRRKCRAAVKSQVFYWLVIFLVFLNTLTIASEHHRQPQWLTDVQDIANKVLLALFTGEMLLKMYSLGLQAYFVSLFNRFDSFVVCGGILETILVETKIMSPLGISVLRCVRLLRIFKITRYWNSLSNLVASLLNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDETR-RSTFDNFPQSLLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYILLNVFLAIAVDNLADAESLTSAQKEEEEAKERKKLARLASPKKHEENE---------KPPLEEKKSEKIEL-KSITSDGETNPATKISMDD--CCGDENEEKNPYPANDYIGDDDEEEPEMPVGPRPRPLSDIHLKEKAVPMPEARAFFVFSHTNKFRVLCHKIVNHNIFTNLILFFILLSSISLAAEDPVKNDSFRNQILGYADHVFTGLFTIEIILKMTAYGAFLHKGSFCRNYFNILDLVVVSVSLIS--------------SGIQSSAINVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTTLLQFMFACIGVQLFKGKFFYCTDSSKQTQAECRGSYIMYKDGDVGKPGRSPRVWENSDFNFDDVLQGMMALFAVSTFEGWPGLLYRAIDSHSEDVGPIYNYRVVISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEQEYKNCELDKNQRQCVEYALKARPLRRYIPKNP--YQYKVWYVVNSTYFEYLMFTLILLNTICLAMQHHGQTK----------------NFNDAMNILNMLFTGLFTVEMILKLIAFKPRGYFSDPWNVFDFLIVIGSIIDVILSEINPADSSSSSSSSSSSSSSSTSHPPVVRPMGLQNSEENARISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQMFGKIALRDLSQINRNNNFQTFPQAVLLLFRCATGEAWQEIMLACSPNRPCEKGSTNENSTASEECGSQFAIIYFVSFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVSMNMPLNSDGTVMFNATLFALVRTALRIK--TDGNLEQANEELRAIVKKIWKRTSMKLLDQVVPPAGD---DEVTVGKFYATFLIQEYFRKFKKRKEQG 1692          

HSP 2 Score: 88.5817 bits (218), Expect = 8.376e-17
Identity = 75/291 (25.77%), Postives = 134/291 (46.05%), Query Frame = 2
Query:  659 INLSFPGMQTSTSKSLFIFSEENVIRKYAKIIIEWGPFEYMVLLTILANCIVLSMERHLPKKDKTLLAGQLELTEKYFLGIFCVEALLKIVALGFCCHKEAYLRNVWNIMDFVVVVTGFLMMFLNIDNHSDSSTVD-LRTLRAVRVLRPLKLVAGFPSLQVVLKSIIRAMAPLLQIGLLVLFAITIFAIIGLEFYSGAFHYTCFKANSDKLPLPIPTEKSLVPCSNS----KNGSGLGAYTCPEDYQCKAYWEGPNYGITSFDNIGYAMLTVFQCITMEGWTDIMYHTNDA 1516
            I+L    +    +++ F+FS  N  R     I+    F  ++L  IL + I L+ E   P K+ +     L   +  F G+F +E +LK+ A G   HK ++ RN +NI+D VVV    +   +       SS ++ ++ LR +RVLRPL+ +     L+ V++ +  A+  +  I ++      +FA IG++ + G F Y C  +          ++++   C  S    K+G        P        WE  ++   +FD++   M+ +F   T EGW  ++Y   D+
Sbjct:  900 IHLKEKAVPMPEARAFFVFSHTNKFRVLCHKIVNHNIFTNLILFFILLSSISLAAED--PVKNDSFRNQILGYADHVFTGLFTIEIILKMTAYGAFLHKGSFCRNYFNILDLVVVSVSLISSGIQ------SSAINVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTTLLQFMFACIGVQLFKGKFFY-CTDS----------SKQTQAECRGSYIMYKDGDVGKPGRSPR------VWENSDF---NFDDVLQGMMALFAVSTFEGWPGLLYRAIDS 1162          
BLAST of Voltage dependent L type calcium channel subunit vs. Planmine SMEST
Match: SMESG000028279.1 (SMESG000028279.1)

HSP 1 Score: 4006.06 bits (10388), Expect = 0.000e+0
Identity = 2127/2142 (99.30%), Postives = 2130/2142 (99.44%), Query Frame = 2
Query:  779 MVLLTILANCIVLSMERHLPKKDKTLLAGQLELTEKYFLGIFCVEALLKIVALGFCCHKEAYLRNVWNIMDFVVVVTGFLMMFLNIDNHSDSSTVDLRTLRAVRVLRPLKLVAGFPSLQVVLKSIIRAMAPLLQIGLLVLFAITIFAIIGLEFYSGAFHYTCFKANSDKLPLPIPTEKSLVPCSNSKNGSGLGAYTCPEDYQCKAYWEGPNYGITSFDNIGYAMLTVFQCITMEGWTDIMYHTNDAIGNRFNWLYFVPLIILGSFFMLNLVLGVLSGXXXXXXXXXXXXXXXLKLRRQQQTEKEFNGYMEWIQKAEEVLLNEATTTSEDKMRIIAARRRAEKQKYKLLGKNQSIPDFEYEDTELYSETKSMKGNIFIRSYAGIRRRRKERCTSFWRTEKHFRFSVRRLVKSQPFYWAVIILVFFNTVCVAIEHYEQGKWLTLFLNYAEYVFLCLFMMEMMIKMYGLSIRVYFQSSFNIFDCVVIAGSLFEIIYGIFVQDSSFGLSVLRALRLLRIFKVTRYWAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMQLFGGEFNFEEGKPPQNFDTFVKALLTVFQILTGEDWNTVMYNGIQSKGGVKERGTVFSIYFVLLVVFGNYTLLNVFLAIAVDNLANXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSSDNFIGRLPLSIDPPMVQVCPPSPQTANSLISKNFSFDHNQVEVNDKGCLLNTNKPNGKLGMLGHDNTNFNSLESDPVPNKIEPETIQRKPVLPYSAMFIFSPLNSLRRFCHFVVNLRYFDLFIMIVICASSIALAAEDPVKEKSLKNNILEFFDYAFTGVFTVEMILKIIDLGIILHPGSYCRDLWNILDATVVICALVAFIMGQKPSPTGNKLRGSSAKNLNTIKSLRVLRVLRPLKTINRVPKLKAVFDCVVSSLKNVFNILIVYILFQFIFAVIAVQLFQGKFFYCNDASKSSRETCRGYFFDYAGRSTPETKKRLWQHHDFHFDNILYAMLTLFTVTTGEGWPTVLKNSMESTNIDNGPIADYRQEMAXXXXXXXXXXXXXXXXXXXALIIITFQEQGENELIDLDLDKNQKQCIDFAINEKPLCRYMPKDKTTIKYRVWRLVVSTPFEYFIMVMIALNTLILMMKYYREEKKASSAATHDREQQAYLNYCNTLIFLNSAFTVMFSIECVLKIMAFGPKNYFRDPWNIFDFITVIGSITDVLVSELQDXXXXXXXXXXXXXXXXXXXXXXQGYTIRILLWTFIQSFKALPYVCLLIAMLFFIYSIIGMQVFGNIKLISEYQINRHNNFQTFTNGLLLLFRCATGESWQEIMLACDNNKPCEKDIENTNNFDCGSNFTYIYFVSFIFLCSFLMLNLFVAVIMDNFDYLTRDSSILGPHHLDEYIRVWAEYDPGAIGRIHHSEMYEMLRNMEPPVGFGKKCPYRLAYRKLIRMNMPVDENGTVNFTTTLFALIRESLNIKMSTAEYMDIKDMELRQTICKMWPVQAKKKLNLIVPPDSELVFHKMTVGKIYAGYLIVENWRAYKNSQEQGPRSSPAVSIKSVTKPVVKEEKSANLLAKFFVAFKSNTNKSNISLDSHHERDEERFSIDHTYGEDYDANRRYSYLRRGSKPRGSKEIYSDLTPTQDYSYGLRPEHATIPGMPAPRKFGNRPRSPMYSLSELETKDRANTPQSLNSTISPTSGDRESDKFHRRSPAVSPSNPQYPFNFATAVNTIVHKANQIVEQDRRDRFYEVESEDDGIESKPNYKHQYSDDSDNKSSDTYKPSGKDRSYHVKSMTSSKYEGYINLTHSGRTTSLEVKSRSPSPVAEKKQKSNSFKEWTDLSTKYYGXXXXXXXXXXXXXINFSVCSPTIERRPNNFHREPLEESRIKYNEVYPQQKLPRIFPSPTVPKVVASDINDINFPRLNKSPTHSPTSSKFHAIPPPSADPPEDLFSSNLNDQESPPRMQTFSSYVPPLSPILYXXXXXXXXXXXXSIPLNEMEFYNDFYRTPIRNTSLQSFRDYSTYSNNFSPYFFSPQPPIHGIGQISNDNSFLLAQNDVWGMPQRSEYSGFTKTVXXXXXXXXXRTTEHSLVLSNTETSTPVNPPVSENLPLLSIRNNVSQNIRYPHERVRRNLQLXXXXXXXXWC 7204
            MVLLTILANCIVLSMERHLPKKDKTLLAGQLELTEKYFLGIFCVEALLKIVALGFCCHKEAYLRNVWNIMDFVVVVTGFLMMFLNIDNHSDSSTVDLRTLRAVRVLRPLKLVAGFPSLQVVLKSIIRAMAPLLQIGLLVLFAITIFAIIGLEFYSGAFHYTCFKANSDKLPLPIPTEKSLVPCSNSKNGSGLGAYTCPEDYQCKAYWEGPNYGITSFDNIGYAMLTVFQCITMEGWTDIMYHTNDAIGNRFNWLYFVPLIILGSFFMLNLVLGVLSGEFAKERERVEKRRAFLKLRRQQQTEKEFNGYMEWIQKAEEVLLNEATTTSEDKMRIIAARRRAEKQKYKLLGKNQSIPDFEYEDTELYSETKSMKGNIFIRSYAGIRRRRKERCTSFWRTEKHFRFSVRRLVKSQPFYWAVIILVFFNTVCVAIEHYEQGKWLTLFLNYAEYVFLCLFMMEMMIKMYGLSIRVYFQSSFNIFDCVVIAGSLFEIIYG+FVQDSSFGLSVLRALRLLRIFKVTRYWASLRNLVLSLLNSMRSIISLLFLLFLFILIFALLGMQLFGGEFNFEEGKPPQNFDTFVKALLTVFQILTGEDWNTVMYNGIQSKGGVKERGTVFSIYFVLLVVFGNYTLLNVFLAIAVDNLANAQELTAAEEEKAAELQRAADAAALQNEEKSSDNFIGRLPLSIDPPMVQVCPPSPQTANSLISKNFSFDHNQVEVNDKGCLLNTNKPNGKLGMLGHDNTNFNSLESDPVPNKIEPETIQRKPVLPYSAMFIFSPLNSLRRFCHFVVNLRYFDLFIMIVICASSIALAAEDPVKEKSLKNNILEFFDYAFTGVFTVEMILKIIDLGIILHPGSYCRDLWNILDATVVICALVAFIMGQKPSPTGNKLRGSSAKNLNTIKSLRVLRVLRPLKTINRVPKLKAVFDCVVSSLKNVFNILIVYILFQFIFAVIAVQLFQGKFFYCNDASKSSRETCRGYFFDYAGRSTPETKKRLWQHHDFHFDNILYAMLTLFTVTTGEGWPTVLKNSMESTNIDNGPIADYRQEMAIFYIVFFIVFPFFFVNIFVALIIITFQEQGENELIDLDLDKNQKQCIDFAINEKPLCRYMPKDKTTIKYRVWRLVVSTPFEYFIMVMIALNTLILMMKYYREEKKASSAATHDREQQAYLNYCNTLIFLNSAFTVMFSIECVLKIMAFGPKNYFRDPWNIFDFITVIGSITDVLVSELQDSSFLSLGFLRLFRAARLIKLLRQGYTIRILLWTFIQSFKALPYVCLLIAMLFFIYSIIGMQVFGNIKLISEYQINRHNNFQTFTNGLLLLFRCATGESWQEIMLACDNNKPCEKDIENTNNFDCGSNFTYIYFVSFIFLCSFLMLNLFVAVIMDNFDYLTRDSSILGPHHLDEYIRVWAEYDPGAIGRIHHSEMYEMLRNMEPPVGFGKKCPYRLAYRKLIRMNMPVDENGTVNFTTTLFALIRESLNIKMSTAEYMDIKDMELRQTICKMWPVQAKKKLNLIVPPDSELVFHKMTVGKIYAGYLIVENWRAYKNSQEQGPRSSPAVSIKSVTKPVVKEEKSANLLAKFFVAFKSNTNKSNISLDSHHERDEERFSIDHTYGEDYDANRRYSYLRRGSKPRGSKEIYSDLTPTQDYSYGLRPEHATIPGMPAPRKFGNRPRSPMYSLSELETKDRANTPQSLNSTISPTSGDRESDKFHRRSPAVSPSNPQYPFNFATAVNTIVHKANQIVEQDRRDRFY           KPNYKHQYSDDSDNKSSDTYKPSGKDRSYHVKSMTSSKYEGYINLTHSGRTTSLEVKSRSPSPVAEKKQKSN+FKEWTDLSTKYYGSSRLEERSRSPSLINFSVCSPTIERRPNNFHREPLEESRIKYNEVYPQQKLPRIFPSPTVPKVVASDINDINFPRLNKSPTHSPTSSKFHAIPPPSADPPEDLFSSNLNDQESPPRMQTFSSYVPP+SPILYDFDETDDTTFFDSIPLNEMEFYNDFYRTPIRNTSLQSFRDYSTYSNNFSPYFFSPQPPIHGIGQISNDNSFLLAQNDVWGMPQRSEYSGFTKTVSSPISISPPRTTEHSLVLSNTETSTPVNP VSENLPLLSIRNNVSQNIRYPHERVRRNLQLEEDEEDEEWC
Sbjct:    1 MVLLTILANCIVLSMERHLPKKDKTLLAGQLELTEKYFLGIFCVEALLKIVALGFCCHKEAYLRNVWNIMDFVVVVTGFLMMFLNIDNHSDSSTVDLRTLRAVRVLRPLKLVAGFPSLQVVLKSIIRAMAPLLQIGLLVLFAITIFAIIGLEFYSGAFHYTCFKANSDKLPLPIPTEKSLVPCSNSKNGSGLGAYTCPEDYQCKAYWEGPNYGITSFDNIGYAMLTVFQCITMEGWTDIMYHTNDAIGNRFNWLYFVPLIILGSFFMLNLVLGVLSGEFAKERERVEKRRAFLKLRRQQQTEKEFNGYMEWIQKAEEVLLNEATTTSEDKMRIIAARRRAEKQKYKLLGKNQSIPDFEYEDTELYSETKSMKGNIFIRSYAGIRRRRKERCTSFWRTEKHFRFSVRRLVKSQPFYWAVIILVFFNTVCVAIEHYEQGKWLTLFLNYAEYVFLCLFMMEMMIKMYGLSIRVYFQSSFNIFDCVVIAGSLFEIIYGLFVQDSSFGLSVLRALRLLRIFKVTRYWASLRNLVLSLLNSMRSIISLLFLLFLFILIFALLGMQLFGGEFNFEEGKPPQNFDTFVKALLTVFQILTGEDWNTVMYNGIQSKGGVKERGTVFSIYFVLLVVFGNYTLLNVFLAIAVDNLANAQELTAAEEEKAAELQRAADAAALQNEEKSSDNFIGRLPLSIDPPMVQVCPPSPQTANSLISKNFSFDHNQVEVNDKGCLLNTNKPNGKLGMLGHDNTNFNSLESDPVPNKIEPETIQRKPVLPYSAMFIFSPLNSLRRFCHFVVNLRYFDLFIMIVICASSIALAAEDPVKEKSLKNNILEFFDYAFTGVFTVEMILKIIDLGIILHPGSYCRDLWNILDATVVICALVAFIMGQKPSPTGNKLRGSSAKNLNTIKSLRVLRVLRPLKTINRVPKLKAVFDCVVSSLKNVFNILIVYILFQFIFAVIAVQLFQGKFFYCNDASKSSRETCRGYFFDYAGRSTPETKKRLWQHHDFHFDNILYAMLTLFTVTTGEGWPTVLKNSMESTNIDNGPIADYRQEMAIFYIVFFIVFPFFFVNIFVALIIITFQEQGENELIDLDLDKNQKQCIDFAINEKPLCRYMPKDKTTIKYRVWRLVVSTPFEYFIMVMIALNTLILMMKYYREEKKASSAATHDREQQAYLNYCNTLIFLNSAFTVMFSIECVLKIMAFGPKNYFRDPWNIFDFITVIGSITDVLVSELQDSSFLSLGFLRLFRAARLIKLLRQGYTIRILLWTFIQSFKALPYVCLLIAMLFFIYSIIGMQVFGNIKLISEYQINRHNNFQTFTNGLLLLFRCATGESWQEIMLACDNNKPCEKDIENTNNFDCGSNFTYIYFVSFIFLCSFLMLNLFVAVIMDNFDYLTRDSSILGPHHLDEYIRVWAEYDPGAIGRIHHSEMYEMLRNMEPPVGFGKKCPYRLAYRKLIRMNMPVDENGTVNFTTTLFALIRESLNIKMSTAEYMDIKDMELRQTICKMWPVQAKKKLNLIVPPDSELVFHKMTVGKIYAGYLIVENWRAYKNSQEQGPRSSPAVSIKSVTKPVVKEEKSANLLAKFFVAFKSNTNKSNISLDSHHERDEERFSIDHTYGEDYDANRRYSYLRRGSKPRGSKEIYSDLTPTQDYSYGLRPEHATIPGMPAPRKFGNRPRSPMYSLSELETKDRANTPQSLNSTISPTSGDRESDKFHRRSPAVSPSNPQYPFNFATAVNTIVHKANQIVEQDRRDRFY----------GKPNYKHQYSDDSDNKSSDTYKPSGKDRSYHVKSMTSSKYEGYINLTHSGRTTSLEVKSRSPSPVAEKKQKSNAFKEWTDLSTKYYGSSRLEERSRSPSLINFSVCSPTIERRPNNFHREPLEESRIKYNEVYPQQKLPRIFPSPTVPKVVASDINDINFPRLNKSPTHSPTSSKFHAIPPPSADPPEDLFSSNLNDQESPPRMQTFSSYVPPISPILYDFDETDDTTFFDSIPLNEMEFYNDFYRTPIRNTSLQSFRDYSTYSNNFSPYFFSPQPPIHGIGQISNDNSFLLAQNDVWGMPQRSEYSGFTKTVSSPISISPPRTTEHSLVLSNTETSTPVNPSVSENLPLLSIRNNVSQNIRYPHERVRRNLQLEEDEEDEEWC 2132          
BLAST of Voltage dependent L type calcium channel subunit vs. Planmine SMEST
Match: SMESG000028279.1 (SMESG000028279.1)

HSP 1 Score: 3984.49 bits (10332), Expect = 0.000e+0
Identity = 2113/2128 (99.30%), Postives = 2116/2128 (99.44%), Query Frame = 2
Query:  821 MERHLPKKDKTLLAGQLELTEKYFLGIFCVEALLKIVALGFCCHKEAYLRNVWNIMDFVVVVTGFLMMFLNIDNHSDSSTVDLRTLRAVRVLRPLKLVAGFPSLQVVLKSIIRAMAPLLQIGLLVLFAITIFAIIGLEFYSGAFHYTCFKANSDKLPLPIPTEKSLVPCSNSKNGSGLGAYTCPEDYQCKAYWEGPNYGITSFDNIGYAMLTVFQCITMEGWTDIMYHTNDAIGNRFNWLYFVPLIILGSFFMLNLVLGVLSGXXXXXXXXXXXXXXXLKLRRQQQTEKEFNGYMEWIQKAEEVLLNEATTTSEDKMRIIAARRRAEKQKYKLLGKNQSIPDFEYEDTELYSETKSMKGNIFIRSYAGIRRRRKERCTSFWRTEKHFRFSVRRLVKSQPFYWAVIILVFFNTVCVAIEHYEQGKWLTLFLNYAEYVFLCLFMMEMMIKMYGLSIRVYFQSSFNIFDCVVIAGSLFEIIYGIFVQDSSFGLSVLRALRLLRIFKVTRYWAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMQLFGGEFNFEEGKPPQNFDTFVKALLTVFQILTGEDWNTVMYNGIQSKGGVKERGTVFSIYFVLLVVFGNYTLLNVFLAIAVDNLANXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSSDNFIGRLPLSIDPPMVQVCPPSPQTANSLISKNFSFDHNQVEVNDKGCLLNTNKPNGKLGMLGHDNTNFNSLESDPVPNKIEPETIQRKPVLPYSAMFIFSPLNSLRRFCHFVVNLRYFDLFIMIVICASSIALAAEDPVKEKSLKNNILEFFDYAFTGVFTVEMILKIIDLGIILHPGSYCRDLWNILDATVVICALVAFIMGQKPSPTGNKLRGSSAKNLNTIKSLRVLRVLRPLKTINRVPKLKAVFDCVVSSLKNVFNILIVYILFQFIFAVIAVQLFQGKFFYCNDASKSSRETCRGYFFDYAGRSTPETKKRLWQHHDFHFDNILYAMLTLFTVTTGEGWPTVLKNSMESTNIDNGPIADYRQEMAXXXXXXXXXXXXXXXXXXXALIIITFQEQGENELIDLDLDKNQKQCIDFAINEKPLCRYMPKDKTTIKYRVWRLVVSTPFEYFIMVMIALNTLILMMKYYREEKKASSAATHDREQQAYLNYCNTLIFLNSAFTVMFSIECVLKIMAFGPKNYFRDPWNIFDFITVIGSITDVLVSELQDXXXXXXXXXXXXXXXXXXXXXXQGYTIRILLWTFIQSFKALPYVCLLIAMLFFIYSIIGMQVFGNIKLISEYQINRHNNFQTFTNGLLLLFRCATGESWQEIMLACDNNKPCEKDIENTNNFDCGSNFTYIYFVSFIFLCSFLMLNLFVAVIMDNFDYLTRDSSILGPHHLDEYIRVWAEYDPGAIGRIHHSEMYEMLRNMEPPVGFGKKCPYRLAYRKLIRMNMPVDENGTVNFTTTLFALIRESLNIKMSTAEYMDIKDMELRQTICKMWPVQAKKKLNLIVPPDSELVFHKMTVGKIYAGYLIVENWRAYKNSQEQGPRSSPAVSIKSVTKPVVKEEKSANLLAKFFVAFKSNTNKSNISLDSHHERDEERFSIDHTYGEDYDANRRYSYLRRGSKPRGSKEIYSDLTPTQDYSYGLRPEHATIPGMPAPRKFGNRPRSPMYSLSELETKDRANTPQSLNSTISPTSGDRESDKFHRRSPAVSPSNPQYPFNFATAVNTIVHKANQIVEQDRRDRFYEVESEDDGIESKPNYKHQYSDDSDNKSSDTYKPSGKDRSYHVKSMTSSKYEGYINLTHSGRTTSLEVKSRSPSPVAEKKQKSNSFKEWTDLSTKYYGXXXXXXXXXXXXXINFSVCSPTIERRPNNFHREPLEESRIKYNEVYPQQKLPRIFPSPTVPKVVASDINDINFPRLNKSPTHSPTSSKFHAIPPPSADPPEDLFSSNLNDQESPPRMQTFSSYVPPLSPILYXXXXXXXXXXXXSIPLNEMEFYNDFYRTPIRNTSLQSFRDYSTYSNNFSPYFFSPQPPIHGIGQISNDNSFLLAQNDVWGMPQRSEYSGFTKTVXXXXXXXXXRTTEHSLVLSNTETSTPVNPPVSENLPLLSIRNNVSQNIRYPHERVRRNLQLXXXXXXXXWC 7204
            MERHLPKKDKTLLAGQLELTEKYFLGIFCVEALLKIVALGFCCHKEAYLRNVWNIMDFVVVVTGFLMMFLNIDNHSDSSTVDLRTLRAVRVLRPLKLVAGFPSLQVVLKSIIRAMAPLLQIGLLVLFAITIFAIIGLEFYSGAFHYTCFKANSDKLPLPIPTEKSLVPCSNSKNGSGLGAYTCPEDYQCKAYWEGPNYGITSFDNIGYAMLTVFQCITMEGWTDIMYHTNDAIGNRFNWLYFVPLIILGSFFMLNLVLGVLSGEFAKERERVEKRRAFLKLRRQQQTEKEFNGYMEWIQKAEEVLLNEATTTSEDKMRIIAARRRAEKQKYKLLGKNQSIPDFEYEDTELYSETKSMKGNIFIRSYAGIRRRRKERCTSFWRTEKHFRFSVRRLVKSQPFYWAVIILVFFNTVCVAIEHYEQGKWLTLFLNYAEYVFLCLFMMEMMIKMYGLSIRVYFQSSFNIFDCVVIAGSLFEIIYG+FVQDSSFGLSVLRALRLLRIFKVTRYWASLRNLVLSLLNSMRSIISLLFLLFLFILIFALLGMQLFGGEFNFEEGKPPQNFDTFVKALLTVFQILTGEDWNTVMYNGIQSKGGVKERGTVFSIYFVLLVVFGNYTLLNVFLAIAVDNLANAQELTAAEEEKAAELQRAADAAALQNEEKSSDNFIGRLPLSIDPPMVQVCPPSPQTANSLISKNFSFDHNQVEVNDKGCLLNTNKPNGKLGMLGHDNTNFNSLESDPVPNKIEPETIQRKPVLPYSAMFIFSPLNSLRRFCHFVVNLRYFDLFIMIVICASSIALAAEDPVKEKSLKNNILEFFDYAFTGVFTVEMILKIIDLGIILHPGSYCRDLWNILDATVVICALVAFIMGQKPSPTGNKLRGSSAKNLNTIKSLRVLRVLRPLKTINRVPKLKAVFDCVVSSLKNVFNILIVYILFQFIFAVIAVQLFQGKFFYCNDASKSSRETCRGYFFDYAGRSTPETKKRLWQHHDFHFDNILYAMLTLFTVTTGEGWPTVLKNSMESTNIDNGPIADYRQEMAIFYIVFFIVFPFFFVNIFVALIIITFQEQGENELIDLDLDKNQKQCIDFAINEKPLCRYMPKDKTTIKYRVWRLVVSTPFEYFIMVMIALNTLILMMKYYREEKKASSAATHDREQQAYLNYCNTLIFLNSAFTVMFSIECVLKIMAFGPKNYFRDPWNIFDFITVIGSITDVLVSELQDSSFLSLGFLRLFRAARLIKLLRQGYTIRILLWTFIQSFKALPYVCLLIAMLFFIYSIIGMQVFGNIKLISEYQINRHNNFQTFTNGLLLLFRCATGESWQEIMLACDNNKPCEKDIENTNNFDCGSNFTYIYFVSFIFLCSFLMLNLFVAVIMDNFDYLTRDSSILGPHHLDEYIRVWAEYDPGAIGRIHHSEMYEMLRNMEPPVGFGKKCPYRLAYRKLIRMNMPVDENGTVNFTTTLFALIRESLNIKMSTAEYMDIKDMELRQTICKMWPVQAKKKLNLIVPPDSELVFHKMTVGKIYAGYLIVENWRAYKNSQEQGPRSSPAVSIKSVTKPVVKEEKSANLLAKFFVAFKSNTNKSNISLDSHHERDEERFSIDHTYGEDYDANRRYSYLRRGSKPRGSKEIYSDLTPTQDYSYGLRPEHATIPGMPAPRKFGNRPRSPMYSLSELETKDRANTPQSLNSTISPTSGDRESDKFHRRSPAVSPSNPQYPFNFATAVNTIVHKANQIVEQDRRDRFY           KPNYKHQYSDDSDNKSSDTYKPSGKDRSYHVKSMTSSKYEGYINLTHSGRTTSLEVKSRSPSPVAEKKQKSN+FKEWTDLSTKYYGSSRLEERSRSPSLINFSVCSPTIERRPNNFHREPLEESRIKYNEVYPQQKLPRIFPSPTVPKVVASDINDINFPRLNKSPTHSPTSSKFHAIPPPSADPPEDLFSSNLNDQESPPRMQTFSSYVPP+SPILYDFDETDDTTFFDSIPLNEMEFYNDFYRTPIRNTSLQSFRDYSTYSNNFSPYFFSPQPPIHGIGQISNDNSFLLAQNDVWGMPQRSEYSGFTKTVSSPISISPPRTTEHSLVLSNTETSTPVNP VSENLPLLSIRNNVSQNIRYPHERVRRNLQLEEDEEDEEWC
Sbjct:    1 MERHLPKKDKTLLAGQLELTEKYFLGIFCVEALLKIVALGFCCHKEAYLRNVWNIMDFVVVVTGFLMMFLNIDNHSDSSTVDLRTLRAVRVLRPLKLVAGFPSLQVVLKSIIRAMAPLLQIGLLVLFAITIFAIIGLEFYSGAFHYTCFKANSDKLPLPIPTEKSLVPCSNSKNGSGLGAYTCPEDYQCKAYWEGPNYGITSFDNIGYAMLTVFQCITMEGWTDIMYHTNDAIGNRFNWLYFVPLIILGSFFMLNLVLGVLSGEFAKERERVEKRRAFLKLRRQQQTEKEFNGYMEWIQKAEEVLLNEATTTSEDKMRIIAARRRAEKQKYKLLGKNQSIPDFEYEDTELYSETKSMKGNIFIRSYAGIRRRRKERCTSFWRTEKHFRFSVRRLVKSQPFYWAVIILVFFNTVCVAIEHYEQGKWLTLFLNYAEYVFLCLFMMEMMIKMYGLSIRVYFQSSFNIFDCVVIAGSLFEIIYGLFVQDSSFGLSVLRALRLLRIFKVTRYWASLRNLVLSLLNSMRSIISLLFLLFLFILIFALLGMQLFGGEFNFEEGKPPQNFDTFVKALLTVFQILTGEDWNTVMYNGIQSKGGVKERGTVFSIYFVLLVVFGNYTLLNVFLAIAVDNLANAQELTAAEEEKAAELQRAADAAALQNEEKSSDNFIGRLPLSIDPPMVQVCPPSPQTANSLISKNFSFDHNQVEVNDKGCLLNTNKPNGKLGMLGHDNTNFNSLESDPVPNKIEPETIQRKPVLPYSAMFIFSPLNSLRRFCHFVVNLRYFDLFIMIVICASSIALAAEDPVKEKSLKNNILEFFDYAFTGVFTVEMILKIIDLGIILHPGSYCRDLWNILDATVVICALVAFIMGQKPSPTGNKLRGSSAKNLNTIKSLRVLRVLRPLKTINRVPKLKAVFDCVVSSLKNVFNILIVYILFQFIFAVIAVQLFQGKFFYCNDASKSSRETCRGYFFDYAGRSTPETKKRLWQHHDFHFDNILYAMLTLFTVTTGEGWPTVLKNSMESTNIDNGPIADYRQEMAIFYIVFFIVFPFFFVNIFVALIIITFQEQGENELIDLDLDKNQKQCIDFAINEKPLCRYMPKDKTTIKYRVWRLVVSTPFEYFIMVMIALNTLILMMKYYREEKKASSAATHDREQQAYLNYCNTLIFLNSAFTVMFSIECVLKIMAFGPKNYFRDPWNIFDFITVIGSITDVLVSELQDSSFLSLGFLRLFRAARLIKLLRQGYTIRILLWTFIQSFKALPYVCLLIAMLFFIYSIIGMQVFGNIKLISEYQINRHNNFQTFTNGLLLLFRCATGESWQEIMLACDNNKPCEKDIENTNNFDCGSNFTYIYFVSFIFLCSFLMLNLFVAVIMDNFDYLTRDSSILGPHHLDEYIRVWAEYDPGAIGRIHHSEMYEMLRNMEPPVGFGKKCPYRLAYRKLIRMNMPVDENGTVNFTTTLFALIRESLNIKMSTAEYMDIKDMELRQTICKMWPVQAKKKLNLIVPPDSELVFHKMTVGKIYAGYLIVENWRAYKNSQEQGPRSSPAVSIKSVTKPVVKEEKSANLLAKFFVAFKSNTNKSNISLDSHHERDEERFSIDHTYGEDYDANRRYSYLRRGSKPRGSKEIYSDLTPTQDYSYGLRPEHATIPGMPAPRKFGNRPRSPMYSLSELETKDRANTPQSLNSTISPTSGDRESDKFHRRSPAVSPSNPQYPFNFATAVNTIVHKANQIVEQDRRDRFY----------GKPNYKHQYSDDSDNKSSDTYKPSGKDRSYHVKSMTSSKYEGYINLTHSGRTTSLEVKSRSPSPVAEKKQKSNAFKEWTDLSTKYYGSSRLEERSRSPSLINFSVCSPTIERRPNNFHREPLEESRIKYNEVYPQQKLPRIFPSPTVPKVVASDINDINFPRLNKSPTHSPTSSKFHAIPPPSADPPEDLFSSNLNDQESPPRMQTFSSYVPPISPILYDFDETDDTTFFDSIPLNEMEFYNDFYRTPIRNTSLQSFRDYSTYSNNFSPYFFSPQPPIHGIGQISNDNSFLLAQNDVWGMPQRSEYSGFTKTVSSPISISPPRTTEHSLVLSNTETSTPVNPSVSENLPLLSIRNNVSQNIRYPHERVRRNLQLEEDEEDEEWC 2118          
BLAST of Voltage dependent L type calcium channel subunit vs. Planmine SMEST
Match: SMESG000028279.1 (SMESG000028279.1)

HSP 1 Score: 3939.81 bits (10216), Expect = 0.000e+0
Identity = 2100/2149 (97.72%), Postives = 2110/2149 (98.19%), Query Frame = 2
Query:  767 PFEYMVLLTILANCIVLSMERHLPKKDKTLLAGQLELTEKYFLGIFCVEALLKIVALGFCCHKEAYLRNVWNIMDFVVVVTGFLMMFLNIDNHSDSSTVDLRTLRAVRVLRPLKLVAGFPSLQVVLKSIIRAMAPLLQIGLLVLFAITIFAIIGLEFYSGAFHYTCFKANSDKLPLPIPTEKSLVPCSNSKNGSGLGAYTCPEDYQCKAYWEGPNYGITSFDNIGYAMLTVFQCITMEGWTDIMYHTNDAIGNRFNWLYFVPLIILGSFFMLNLVLGVLSGXXXXXXXXXXXXXXXLKLRRQQQTEKEFNGYMEWIQKAEEVLLNEATTTSEDKMRIIAARRRAEKQKYKLLGKNQSIPDFEYEDTELYSETKSMKGNIFIRSYAGIRRRRKERCTSFWRTEKHFRFSVRRLVKSQPFYWAVIILVFFNTVCVAIEHYEQGKWLTLFLNYAEYVFLCLFMMEMMIKMYGLSIRVYFQSSFNIFDCVVIAGSLFEII---YGIFVQDSSFGLSVLRALRLLRIFKVTRYWAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMQLFGGEFNFEEGKPPQNFDTFVKALLTVFQILTGEDWNTVMYNGIQSKGGVKERGTVFSIYFVLLVVFGNYTLLNVFLAIAVDNLANXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSSDNFIGRLPLSIDPPMVQVCPPSPQTANSLISKNFSFDHNQVEVNDKGCLLNTNKPNGKLGMLGHDNTNFNSLESDPVPNKIEPETIQRKPVLPYSAMFIFSPLNSLRRFCHFVVNLRYFDLFIMIVICASSIALAAEDPVKEKSLKNNILEFFDYAFTGVFTVEMILKIIDLGIILHPGSYCRDLWNILDATVVICALVAFIMGQKPSPTGNKLRGSSAKNLNTIKSLRVLRVLRPLKTINRVPKLKAVFDCVVSSLKNVFNILIVYILFQFIFAVIAVQLFQGKFFYCNDASKSSRETCRGYFFDYAGRSTPETKKRLWQHHDFHFDNILYAMLTLFTVTTGEGWPTVLKNSMESTNIDNGPIADYRQEMAXXXXXXXXXXXXXXXXXXXALIIITFQEQGENELIDLDLDKNQKQCIDFAINEKPLCRYMPKDKTTIKYRVWRLVVSTPFEYFIMVMIALNTLILMMKYYREEKKASSAATHDREQQAYLNYCNTLIFLNSAFTVMFSIECVLKIMAFGPKNYFRDPWNIFDFITVIGSITDVLVSELQDXXXXXXXXXXXXXXXXXXXXXXQGYTIRILLWTFIQSFKALPYVCLLIAMLFFIYSIIGMQVFGNIKLISEYQINRHNNFQTFTNGLLLLFRCATGESWQEIMLACDNNKPCEKDIENTNNFDCGSNFTYIYFVSFIFLCSFLMLNLFVAVIMDNFDYLTRDSSILGPHHLDEYIRVWAEYDPGAIGRIHHSEMYEMLRNMEPPVGFGKKCPYRLAYRKLIRMNMPVDENGTVNFTTTLFALIRESLNIKMSTAEYMDIKDMELRQTICKMWPVQAKKKLNLIVPPDSELVFHKMTVGKIYAGYLIVENWRAYKNSQEQGPRSSPAVSIKSVTKPVVKEEKSANLLAKFFVAFKSNTNKSNISLDSHHERDEERFSIDHTYGEDYDANRRYSYLRRGSKPRGSKEIYSDLTPTQDYSYGLRPEHATIPGMPAPRKFGNRPRSPMYSLSELETKDRANTPQSLNSTISPTSGDRESDKFHRRSPAVSPSNPQYPFNFATAVNTIVHKANQIVEQDRRDRFYEVESEDDGIESKPNYKHQYSDDSDNKSSDTYKPSGKDRSYHVKSMTSSKYEGYINLTHSGRTTSLEVKSRSPSPVAEKKQKSNSFKEWTDLSTKYYGXXXXXXXXXXXXXINFSVCSPTIERRPNNFHREPLEESRIKYNEVYPQQKLPRIFPSPTVPKVVASDINDINFPRLNKSPTHSPTSSKFHAIPPPSADPPEDLFSSNLNDQESPPRMQTFSSYVPPLSPILYXXXXXXXXXXXXSIPLNEMEFYNDFYRTPIRNTSLQSFRDYSTYSNNFSPYFFSPQPPIHGIGQISNDNSFLLAQNDVWGMPQRSEYSGFTKTVXXXXXXXXXRTTEHSLVLSNTETSTPVNPPVSENLPLLSIRNNVSQNIRYPHERVRRNLQLXXXXXXXXWC 7204
            PFEYMVLLTILANCIVLSMERHLPKKDKTLLAGQLELTEKYFLGIFCVEALLKIVALGFCCHKEAYLRNVWNIMDFVVVVTG +   L         + D R LRA+RVLRPLKLV GF SLQVVLKSIIRAMAPLLQIGLLVLFAITIFAIIGLEFYSGAFHYTCFKANSDKLPLPIPTEKSLVPCSNSKNGSGLGAYTCPEDYQCKAYWEGPNYGITSFDNIGYAMLTVFQCITMEGWTDIMYHTNDAIGNRFNWLYFVPLIILGSFFMLNLVLGVLSGEFAKERERVEKRRAFLKLRRQQQTEKEFNGYMEWIQKAEEVLLNEATTTSEDKMRIIAARRRAEKQKYKLLGKNQSIPDFEYEDTELYSETKSMKGNIFIRSYAGIRRRRKERCTSFWRTEKHFRFSVRRLVKSQPFYWAVIILVFFNTVCVAIEHYEQGKWLTLFLNYAEYVFLCLFMMEMMIKMYGLSIRVYFQSSFNIFDCVVIAGSLFE++   YG F+   S G +V+RALRLLRIFKVTRYWASLRNLVLSLLNSMRSIISLLFLLFLFILIFALLGMQLFGGEFNFEEGKPPQNFDTFVKALLTVFQILTGEDWNTVMYNGIQSKGGVKERGTVFSIYFVLLVVFGNYTLLNVFLAIAVDNLANAQELTAAEEEKAAELQRAADAAALQNEEKSSDNFIGRLPLSIDPPMVQVCPPSPQTANSLISKNFSFDHNQVEVNDKGCLLNTNKPNGKLGMLGHDNTNFNSLESDPVPNKIEPETIQRKPVLPYSAMFIFSPLNSLRRFCHFVVNLRYFDLFIMIVICASSIALAAEDPVKEKSLKNNILEFFDYAFTGVFTVEMILKIIDLGIILHPGSYCRDLWNILDATVVICALVAFIMGQKPSPTGNKLRGSSAKNLNTIKSLRVLRVLRPLKTINRVPKLKAVFDCVVSSLKNVFNILIVYILFQFIFAVIAVQLFQGKFFYCNDASKSSRETCRGYFFDYAGRSTPETKKRLWQHHDFHFDNILYAMLTLFTVTTGEGWPTVLKNSMESTNIDNGPIADYRQEMAIFYIVFFIVFPFFFVNIFVALIIITFQEQGENELIDLDLDKNQKQCIDFAINEKPLCRYMPKDKTTIKYRVWRLVVSTPFEYFIMVMIALNTLILMMKYYREEKKASSAATHDREQQAYLNYCNTLIFLNSAFTVMFSIECVLKIMAFGPKNYFRDPWNIFDFITVIGSITDVLVSELQDSSFLSLGFLRLFRAARLIKLLRQGYTIRILLWTFIQSFKALPYVCLLIAMLFFIYSIIGMQVFGNIKLISEYQINRHNNFQTFTNGLLLLFRCATGESWQEIMLACDNNKPCEKDIENTNNFDCGSNFTYIYFVSFIFLCSFLMLNLFVAVIMDNFDYLTRDSSILGPHHLDEYIRVWAEYDPGAIGRIHHSEMYEMLRNMEPPVGFGKKCPYRLAYRKLIRMNMPVDENGTVNFTTTLFALIRESLNIKMSTAEYMDIKDMELRQTICKMWPVQAKKKLNLIVPPDSELVFHKMTVGKIYAGYLIVENWRAYKNSQEQGPRSSPAVSIKSVTKPVVKEEKSANLLAKFFVAFKSNTNKSNISLDSHHERDEERFSIDHTYGEDYDANRRYSYLRRGSKPRGSKEIYSDLTPTQDYSYGLRPEHATIPGMPAPRKFGNRPRSPMYSLSELETKDRANTPQSLNSTISPTSGDRESDKFHRRSPAVSPSNPQYPFNFATAVNTIVHKANQIVEQDRRDRFY           KPNYKHQYSDDSDNKSSDTYKPSGKDRSYHVKSMTSSKYEGYINLTHSGRTTSLEVKSRSPSPVAEKKQKSN+FKEWTDLSTKYYGSSRLEERSRSPSLINFSVCSPTIERRPNNFHREPLEESRIKYNEVYPQQKLPRIFPSPTVPKVVASDINDINFPRLNKSPTHSPTSSKFHAIPPPSADPPEDLFSSNLNDQESPPRMQTFSSYVPP+SPILYDFDETDDTTFFDSIPLNEMEFYNDFYRTPIRNTSLQSFRDYSTYSNNFSPYFFSPQPPIHGIGQISNDNSFLLAQNDVWGMPQRSEYSGFTKTVSSPISISPPRTTEHSLVLSNTETSTPVNP VSENLPLLSIRNNVSQNIRYPHERVRRNLQLEEDEEDEEWC
Sbjct:   20 PFEYMVLLTILANCIVLSMERHLPKKDKTLLAGQLELTEKYFLGIFCVEALLKIVALGFCCHKEAYLRNVWNIMDFVVVVTGLISHVL--------PSFDQRALRALRVLRPLKLVTGFESLQVVLKSIIRAMAPLLQIGLLVLFAITIFAIIGLEFYSGAFHYTCFKANSDKLPLPIPTEKSLVPCSNSKNGSGLGAYTCPEDYQCKAYWEGPNYGITSFDNIGYAMLTVFQCITMEGWTDIMYHTNDAIGNRFNWLYFVPLIILGSFFMLNLVLGVLSGEFAKERERVEKRRAFLKLRRQQQTEKEFNGYMEWIQKAEEVLLNEATTTSEDKMRIIAARRRAEKQKYKLLGKNQSIPDFEYEDTELYSETKSMKGNIFIRSYAGIRRRRKERCTSFWRTEKHFRFSVRRLVKSQPFYWAVIILVFFNTVCVAIEHYEQGKWLTLFLNYAEYVFLCLFMMEMMIKMYGLSIRVYFQSSFNIFDCVVIAGSLFELLGSHYGNFM---SLGFTVMRALRLLRIFKVTRYWASLRNLVLSLLNSMRSIISLLFLLFLFILIFALLGMQLFGGEFNFEEGKPPQNFDTFVKALLTVFQILTGEDWNTVMYNGIQSKGGVKERGTVFSIYFVLLVVFGNYTLLNVFLAIAVDNLANAQELTAAEEEKAAELQRAADAAALQNEEKSSDNFIGRLPLSIDPPMVQVCPPSPQTANSLISKNFSFDHNQVEVNDKGCLLNTNKPNGKLGMLGHDNTNFNSLESDPVPNKIEPETIQRKPVLPYSAMFIFSPLNSLRRFCHFVVNLRYFDLFIMIVICASSIALAAEDPVKEKSLKNNILEFFDYAFTGVFTVEMILKIIDLGIILHPGSYCRDLWNILDATVVICALVAFIMGQKPSPTGNKLRGSSAKNLNTIKSLRVLRVLRPLKTINRVPKLKAVFDCVVSSLKNVFNILIVYILFQFIFAVIAVQLFQGKFFYCNDASKSSRETCRGYFFDYAGRSTPETKKRLWQHHDFHFDNILYAMLTLFTVTTGEGWPTVLKNSMESTNIDNGPIADYRQEMAIFYIVFFIVFPFFFVNIFVALIIITFQEQGENELIDLDLDKNQKQCIDFAINEKPLCRYMPKDKTTIKYRVWRLVVSTPFEYFIMVMIALNTLILMMKYYREEKKASSAATHDREQQAYLNYCNTLIFLNSAFTVMFSIECVLKIMAFGPKNYFRDPWNIFDFITVIGSITDVLVSELQDSSFLSLGFLRLFRAARLIKLLRQGYTIRILLWTFIQSFKALPYVCLLIAMLFFIYSIIGMQVFGNIKLISEYQINRHNNFQTFTNGLLLLFRCATGESWQEIMLACDNNKPCEKDIENTNNFDCGSNFTYIYFVSFIFLCSFLMLNLFVAVIMDNFDYLTRDSSILGPHHLDEYIRVWAEYDPGAIGRIHHSEMYEMLRNMEPPVGFGKKCPYRLAYRKLIRMNMPVDENGTVNFTTTLFALIRESLNIKMSTAEYMDIKDMELRQTICKMWPVQAKKKLNLIVPPDSELVFHKMTVGKIYAGYLIVENWRAYKNSQEQGPRSSPAVSIKSVTKPVVKEEKSANLLAKFFVAFKSNTNKSNISLDSHHERDEERFSIDHTYGEDYDANRRYSYLRRGSKPRGSKEIYSDLTPTQDYSYGLRPEHATIPGMPAPRKFGNRPRSPMYSLSELETKDRANTPQSLNSTISPTSGDRESDKFHRRSPAVSPSNPQYPFNFATAVNTIVHKANQIVEQDRRDRFY----------GKPNYKHQYSDDSDNKSSDTYKPSGKDRSYHVKSMTSSKYEGYINLTHSGRTTSLEVKSRSPSPVAEKKQKSNAFKEWTDLSTKYYGSSRLEERSRSPSLINFSVCSPTIERRPNNFHREPLEESRIKYNEVYPQQKLPRIFPSPTVPKVVASDINDINFPRLNKSPTHSPTSSKFHAIPPPSADPPEDLFSSNLNDQESPPRMQTFSSYVPPISPILYDFDETDDTTFFDSIPLNEMEFYNDFYRTPIRNTSLQSFRDYSTYSNNFSPYFFSPQPPIHGIGQISNDNSFLLAQNDVWGMPQRSEYSGFTKTVSSPISISPPRTTEHSLVLSNTETSTPVNPSVSENLPLLSIRNNVSQNIRYPHERVRRNLQLEEDEEDEEWC 2147          

HSP 2 Score: 73.1738 bits (178), Expect = 3.033e-12
Identity = 74/311 (23.79%), Postives = 123/311 (39.55%), Query Frame = 2
Query: 4154 TPFEYFIMVMIALNTLILMMKYYREEKKASSAATHDREQQAYLNYCNTLIFLNSAFTVMFSIECVLKIMAFG----PKNYFRDPWNIFDFITVI-GSITDVLVSELQDXXXXXXXXXXXXXXXXXXXXXXQGY-TIRILLWTFIQSFKALPYVCLLIAMLFFIYSIIGMQVF--------------------------------------GNIKLISEYQINRH--------NNFQTFTNGLLLLFRCATGESWQEIMLACDNNKPCEKDIENTNNFDCGSNFTYIYFVSFIFLCSFLMLNLFVAVIMDNF 4930
            TPFEY +++ I  N ++L M+ +  +K  +  A      + Y             F  +F +E +LKI+A G     + Y R+ WNI DF+ V+ G I+ VL S  Q                     L  G+ +++++L + I++   L  + LL+     I++IIG++ +                                      G      +YQ   +         +F      +L +F+C T E W +IM              +TN+   G+ F ++YFV  I L SF MLNL + V+   F
Sbjct:   19 TPFEYMVLLTILANCIVLSMERHLPKKDKTLLAGQLELTEKY-------------FLGIFCVEALLKIVALGFCCHKEAYLRNVWNIMDFVVVVTGLISHVLPSFDQ--------RALRALRVLRPLKLVTGFESLQVVLKSIIRAMAPLLQIGLLVLFAITIFAIIGLEFYSGAFHYTCFKANSDKLPLPIPTEKSLVPCSNSKNGSGLGAYTCPEDYQCKAYWEGPNYGITSFDNIGYAMLTVFQCITMEGWTDIMY-------------HTND-AIGNRFNWLYFVPLIILGSFFMLNLVLGVLSGEF 294          
BLAST of Voltage dependent L type calcium channel subunit vs. Planmine SMEST
Match: SMESG000028279.1 (SMESG000028279.1)

HSP 1 Score: 3927.87 bits (10185), Expect = 0.000e+0
Identity = 2096/2145 (97.72%), Postives = 2106/2145 (98.18%), Query Frame = 2
Query:  779 MVLLTILANCIVLSMERHLPKKDKTLLAGQLELTEKYFLGIFCVEALLKIVALGFCCHKEAYLRNVWNIMDFVVVVTGFLMMFLNIDNHSDSSTVDLRTLRAVRVLRPLKLVAGFPSLQVVLKSIIRAMAPLLQIGLLVLFAITIFAIIGLEFYSGAFHYTCFKANSDKLPLPIPTEKSLVPCSNSKNGSGLGAYTCPEDYQCKAYWEGPNYGITSFDNIGYAMLTVFQCITMEGWTDIMYHTNDAIGNRFNWLYFVPLIILGSFFMLNLVLGVLSGXXXXXXXXXXXXXXXLKLRRQQQTEKEFNGYMEWIQKAEEVLLNEATTTSEDKMRIIAARRRAEKQKYKLLGKNQSIPDFEYEDTELYSETKSMKGNIFIRSYAGIRRRRKERCTSFWRTEKHFRFSVRRLVKSQPFYWAVIILVFFNTVCVAIEHYEQGKWLTLFLNYAEYVFLCLFMMEMMIKMYGLSIRVYFQSSFNIFDCVVIAGSLFEII---YGIFVQDSSFGLSVLRALRLLRIFKVTRYWAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMQLFGGEFNFEEGKPPQNFDTFVKALLTVFQILTGEDWNTVMYNGIQSKGGVKERGTVFSIYFVLLVVFGNYTLLNVFLAIAVDNLANXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSSDNFIGRLPLSIDPPMVQVCPPSPQTANSLISKNFSFDHNQVEVNDKGCLLNTNKPNGKLGMLGHDNTNFNSLESDPVPNKIEPETIQRKPVLPYSAMFIFSPLNSLRRFCHFVVNLRYFDLFIMIVICASSIALAAEDPVKEKSLKNNILEFFDYAFTGVFTVEMILKIIDLGIILHPGSYCRDLWNILDATVVICALVAFIMGQKPSPTGNKLRGSSAKNLNTIKSLRVLRVLRPLKTINRVPKLKAVFDCVVSSLKNVFNILIVYILFQFIFAVIAVQLFQGKFFYCNDASKSSRETCRGYFFDYAGRSTPETKKRLWQHHDFHFDNILYAMLTLFTVTTGEGWPTVLKNSMESTNIDNGPIADYRQEMAXXXXXXXXXXXXXXXXXXXALIIITFQEQGENELIDLDLDKNQKQCIDFAINEKPLCRYMPKDKTTIKYRVWRLVVSTPFEYFIMVMIALNTLILMMKYYREEKKASSAATHDREQQAYLNYCNTLIFLNSAFTVMFSIECVLKIMAFGPKNYFRDPWNIFDFITVIGSITDVLVSELQDXXXXXXXXXXXXXXXXXXXXXXQGYTIRILLWTFIQSFKALPYVCLLIAMLFFIYSIIGMQVFGNIKLISEYQINRHNNFQTFTNGLLLLFRCATGESWQEIMLACDNNKPCEKDIENTNNFDCGSNFTYIYFVSFIFLCSFLMLNLFVAVIMDNFDYLTRDSSILGPHHLDEYIRVWAEYDPGAIGRIHHSEMYEMLRNMEPPVGFGKKCPYRLAYRKLIRMNMPVDENGTVNFTTTLFALIRESLNIKMSTAEYMDIKDMELRQTICKMWPVQAKKKLNLIVPPDSELVFHKMTVGKIYAGYLIVENWRAYKNSQEQGPRSSPAVSIKSVTKPVVKEEKSANLLAKFFVAFKSNTNKSNISLDSHHERDEERFSIDHTYGEDYDANRRYSYLRRGSKPRGSKEIYSDLTPTQDYSYGLRPEHATIPGMPAPRKFGNRPRSPMYSLSELETKDRANTPQSLNSTISPTSGDRESDKFHRRSPAVSPSNPQYPFNFATAVNTIVHKANQIVEQDRRDRFYEVESEDDGIESKPNYKHQYSDDSDNKSSDTYKPSGKDRSYHVKSMTSSKYEGYINLTHSGRTTSLEVKSRSPSPVAEKKQKSNSFKEWTDLSTKYYGXXXXXXXXXXXXXINFSVCSPTIERRPNNFHREPLEESRIKYNEVYPQQKLPRIFPSPTVPKVVASDINDINFPRLNKSPTHSPTSSKFHAIPPPSADPPEDLFSSNLNDQESPPRMQTFSSYVPPLSPILYXXXXXXXXXXXXSIPLNEMEFYNDFYRTPIRNTSLQSFRDYSTYSNNFSPYFFSPQPPIHGIGQISNDNSFLLAQNDVWGMPQRSEYSGFTKTVXXXXXXXXXRTTEHSLVLSNTETSTPVNPPVSENLPLLSIRNNVSQNIRYPHERVRRNLQLXXXXXXXXWC 7204
            MVLLTILANCIVLSMERHLPKKDKTLLAGQLELTEKYFLGIFCVEALLKIVALGFCCHKEAYLRNVWNIMDFVVVVTG +   L         + D R LRA+RVLRPLKLV GF SLQVVLKSIIRAMAPLLQIGLLVLFAITIFAIIGLEFYSGAFHYTCFKANSDKLPLPIPTEKSLVPCSNSKNGSGLGAYTCPEDYQCKAYWEGPNYGITSFDNIGYAMLTVFQCITMEGWTDIMYHTNDAIGNRFNWLYFVPLIILGSFFMLNLVLGVLSGEFAKERERVEKRRAFLKLRRQQQTEKEFNGYMEWIQKAEEVLLNEATTTSEDKMRIIAARRRAEKQKYKLLGKNQSIPDFEYEDTELYSETKSMKGNIFIRSYAGIRRRRKERCTSFWRTEKHFRFSVRRLVKSQPFYWAVIILVFFNTVCVAIEHYEQGKWLTLFLNYAEYVFLCLFMMEMMIKMYGLSIRVYFQSSFNIFDCVVIAGSLFE++   YG F+   S G +V+RALRLLRIFKVTRYWASLRNLVLSLLNSMRSIISLLFLLFLFILIFALLGMQLFGGEFNFEEGKPPQNFDTFVKALLTVFQILTGEDWNTVMYNGIQSKGGVKERGTVFSIYFVLLVVFGNYTLLNVFLAIAVDNLANAQELTAAEEEKAAELQRAADAAALQNEEKSSDNFIGRLPLSIDPPMVQVCPPSPQTANSLISKNFSFDHNQVEVNDKGCLLNTNKPNGKLGMLGHDNTNFNSLESDPVPNKIEPETIQRKPVLPYSAMFIFSPLNSLRRFCHFVVNLRYFDLFIMIVICASSIALAAEDPVKEKSLKNNILEFFDYAFTGVFTVEMILKIIDLGIILHPGSYCRDLWNILDATVVICALVAFIMGQKPSPTGNKLRGSSAKNLNTIKSLRVLRVLRPLKTINRVPKLKAVFDCVVSSLKNVFNILIVYILFQFIFAVIAVQLFQGKFFYCNDASKSSRETCRGYFFDYAGRSTPETKKRLWQHHDFHFDNILYAMLTLFTVTTGEGWPTVLKNSMESTNIDNGPIADYRQEMAIFYIVFFIVFPFFFVNIFVALIIITFQEQGENELIDLDLDKNQKQCIDFAINEKPLCRYMPKDKTTIKYRVWRLVVSTPFEYFIMVMIALNTLILMMKYYREEKKASSAATHDREQQAYLNYCNTLIFLNSAFTVMFSIECVLKIMAFGPKNYFRDPWNIFDFITVIGSITDVLVSELQDSSFLSLGFLRLFRAARLIKLLRQGYTIRILLWTFIQSFKALPYVCLLIAMLFFIYSIIGMQVFGNIKLISEYQINRHNNFQTFTNGLLLLFRCATGESWQEIMLACDNNKPCEKDIENTNNFDCGSNFTYIYFVSFIFLCSFLMLNLFVAVIMDNFDYLTRDSSILGPHHLDEYIRVWAEYDPGAIGRIHHSEMYEMLRNMEPPVGFGKKCPYRLAYRKLIRMNMPVDENGTVNFTTTLFALIRESLNIKMSTAEYMDIKDMELRQTICKMWPVQAKKKLNLIVPPDSELVFHKMTVGKIYAGYLIVENWRAYKNSQEQGPRSSPAVSIKSVTKPVVKEEKSANLLAKFFVAFKSNTNKSNISLDSHHERDEERFSIDHTYGEDYDANRRYSYLRRGSKPRGSKEIYSDLTPTQDYSYGLRPEHATIPGMPAPRKFGNRPRSPMYSLSELETKDRANTPQSLNSTISPTSGDRESDKFHRRSPAVSPSNPQYPFNFATAVNTIVHKANQIVEQDRRDRFY           KPNYKHQYSDDSDNKSSDTYKPSGKDRSYHVKSMTSSKYEGYINLTHSGRTTSLEVKSRSPSPVAEKKQKSN+FKEWTDLSTKYYGSSRLEERSRSPSLINFSVCSPTIERRPNNFHREPLEESRIKYNEVYPQQKLPRIFPSPTVPKVVASDINDINFPRLNKSPTHSPTSSKFHAIPPPSADPPEDLFSSNLNDQESPPRMQTFSSYVPP+SPILYDFDETDDTTFFDSIPLNEMEFYNDFYRTPIRNTSLQSFRDYSTYSNNFSPYFFSPQPPIHGIGQISNDNSFLLAQNDVWGMPQRSEYSGFTKTVSSPISISPPRTTEHSLVLSNTETSTPVNP VSENLPLLSIRNNVSQNIRYPHERVRRNLQLEEDEEDEEWC
Sbjct:    1 MVLLTILANCIVLSMERHLPKKDKTLLAGQLELTEKYFLGIFCVEALLKIVALGFCCHKEAYLRNVWNIMDFVVVVTGLISHVL--------PSFDQRALRALRVLRPLKLVTGFESLQVVLKSIIRAMAPLLQIGLLVLFAITIFAIIGLEFYSGAFHYTCFKANSDKLPLPIPTEKSLVPCSNSKNGSGLGAYTCPEDYQCKAYWEGPNYGITSFDNIGYAMLTVFQCITMEGWTDIMYHTNDAIGNRFNWLYFVPLIILGSFFMLNLVLGVLSGEFAKERERVEKRRAFLKLRRQQQTEKEFNGYMEWIQKAEEVLLNEATTTSEDKMRIIAARRRAEKQKYKLLGKNQSIPDFEYEDTELYSETKSMKGNIFIRSYAGIRRRRKERCTSFWRTEKHFRFSVRRLVKSQPFYWAVIILVFFNTVCVAIEHYEQGKWLTLFLNYAEYVFLCLFMMEMMIKMYGLSIRVYFQSSFNIFDCVVIAGSLFELLGSHYGNFM---SLGFTVMRALRLLRIFKVTRYWASLRNLVLSLLNSMRSIISLLFLLFLFILIFALLGMQLFGGEFNFEEGKPPQNFDTFVKALLTVFQILTGEDWNTVMYNGIQSKGGVKERGTVFSIYFVLLVVFGNYTLLNVFLAIAVDNLANAQELTAAEEEKAAELQRAADAAALQNEEKSSDNFIGRLPLSIDPPMVQVCPPSPQTANSLISKNFSFDHNQVEVNDKGCLLNTNKPNGKLGMLGHDNTNFNSLESDPVPNKIEPETIQRKPVLPYSAMFIFSPLNSLRRFCHFVVNLRYFDLFIMIVICASSIALAAEDPVKEKSLKNNILEFFDYAFTGVFTVEMILKIIDLGIILHPGSYCRDLWNILDATVVICALVAFIMGQKPSPTGNKLRGSSAKNLNTIKSLRVLRVLRPLKTINRVPKLKAVFDCVVSSLKNVFNILIVYILFQFIFAVIAVQLFQGKFFYCNDASKSSRETCRGYFFDYAGRSTPETKKRLWQHHDFHFDNILYAMLTLFTVTTGEGWPTVLKNSMESTNIDNGPIADYRQEMAIFYIVFFIVFPFFFVNIFVALIIITFQEQGENELIDLDLDKNQKQCIDFAINEKPLCRYMPKDKTTIKYRVWRLVVSTPFEYFIMVMIALNTLILMMKYYREEKKASSAATHDREQQAYLNYCNTLIFLNSAFTVMFSIECVLKIMAFGPKNYFRDPWNIFDFITVIGSITDVLVSELQDSSFLSLGFLRLFRAARLIKLLRQGYTIRILLWTFIQSFKALPYVCLLIAMLFFIYSIIGMQVFGNIKLISEYQINRHNNFQTFTNGLLLLFRCATGESWQEIMLACDNNKPCEKDIENTNNFDCGSNFTYIYFVSFIFLCSFLMLNLFVAVIMDNFDYLTRDSSILGPHHLDEYIRVWAEYDPGAIGRIHHSEMYEMLRNMEPPVGFGKKCPYRLAYRKLIRMNMPVDENGTVNFTTTLFALIRESLNIKMSTAEYMDIKDMELRQTICKMWPVQAKKKLNLIVPPDSELVFHKMTVGKIYAGYLIVENWRAYKNSQEQGPRSSPAVSIKSVTKPVVKEEKSANLLAKFFVAFKSNTNKSNISLDSHHERDEERFSIDHTYGEDYDANRRYSYLRRGSKPRGSKEIYSDLTPTQDYSYGLRPEHATIPGMPAPRKFGNRPRSPMYSLSELETKDRANTPQSLNSTISPTSGDRESDKFHRRSPAVSPSNPQYPFNFATAVNTIVHKANQIVEQDRRDRFY----------GKPNYKHQYSDDSDNKSSDTYKPSGKDRSYHVKSMTSSKYEGYINLTHSGRTTSLEVKSRSPSPVAEKKQKSNAFKEWTDLSTKYYGSSRLEERSRSPSLINFSVCSPTIERRPNNFHREPLEESRIKYNEVYPQQKLPRIFPSPTVPKVVASDINDINFPRLNKSPTHSPTSSKFHAIPPPSADPPEDLFSSNLNDQESPPRMQTFSSYVPPISPILYDFDETDDTTFFDSIPLNEMEFYNDFYRTPIRNTSLQSFRDYSTYSNNFSPYFFSPQPPIHGIGQISNDNSFLLAQNDVWGMPQRSEYSGFTKTVSSPISISPPRTTEHSLVLSNTETSTPVNPSVSENLPLLSIRNNVSQNIRYPHERVRRNLQLEEDEEDEEWC 2124          
BLAST of Voltage dependent L type calcium channel subunit vs. Planmine SMEST
Match: SMESG000028279.1 (SMESG000028279.1)

HSP 1 Score: 3920.55 bits (10166), Expect = 0.000e+0
Identity = 2093/2146 (97.53%), Postives = 2099/2146 (97.81%), Query Frame = 2
Query:  767 PFEYMVLLTILANCIVLSMERHLPKKDKTLLAGQLELTEKYFLGIFCVEALLKIVALGFCCHKEAYLRNVWNIMDFVVVVTGFLMMFLNIDNHSDSSTVDLRTLRAVRVLRPLKLVAGFPSLQVVLKSIIRAMAPLLQIGLLVLFAITIFAIIGLEFYSGAFHYTCFKANSDKLPLPIPTEKSLVPCSNSKNGSGLGAYTCPEDYQCKAYWEGPNYGITSFDNIGYAMLTVFQCITMEGWTDIMYHTNDAIGNRFNWLYFVPLIILGSFFMLNLVLGVLSGXXXXXXXXXXXXXXXLKLRRQQQTEKEFNGYMEWIQKAEEVLLNEATTTSEDKMRIIAARRRAEKQKYKLLGKNQSIPDFEYEDTELYSETKSMKGNIFIRSYAGIRRRRKERCTSFWRTEKHFRFSVRRLVKSQPFYWAVIILVFFNTVCVAIEHYEQGKWLTLFLNYAEYVFLCLFMMEMMIKMYGLSIRVYFQSSFNIFDCVVIAGSLFEIIYGIFVQDSSFGLSVLRALRLLRIFKVTRYWAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMQLFGGEFNFEEGKPPQNFDTFVKALLTVFQILTGEDWNTVMYNGIQSKGGVKERGTVFSIYFVLLVVFGNYTLLNVFLAIAVDNLANXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSSDNFIGRLPLSIDPPMVQVCPPSPQTANSLISKNFSFDHNQVEVNDKGCLLNTNKPNGKLGMLGHDNTNFNSLESDPVPNKIEPETIQRKPVLPYSAMFIFSPLNSLRRFCHFVVNLRYFDLFIMIVICASSIALAAEDPVKEKSLKNNILEFFDYAFTGVFTVEMILKIIDLGIILHPGSYCRDLWNILDATVVICALVAFIMGQKPSPTGNKLRGSSAKNLNTIKSLRVLRVLRPLKTINRVPKLKAVFDCVVSSLKNVFNILIVYILFQFIFAVIAVQLFQGKFFYCNDASKSSRETCRGYFFDYAGRSTPETKKRLWQHHDFHFDNILYAMLTLFTVTTGEGWPTVLKNSMESTNIDNGPIADYRQEMAXXXXXXXXXXXXXXXXXXXALIIITFQEQGENELIDLDLDKNQKQCIDFAINEKPLCRYMPKDKTTIKYRVWRLVVSTPFEYFIMVMIALNTLILMMKYYREEKKASSAATHDREQQAYLNYCNTLIFLNSAFTVMFSIECVLKIMAFGPKNYFRDPWNIFDFITVIGSITDVLVSELQDXXXXXXXXXXXXXXXXXXXXXXQGYTIRILLWTFIQSFKALPYVCLLIAMLFFIYSIIGMQVFGNIKLISEYQINRHNNFQTFTNGLLLLFRCATGESWQEIMLACDNNKPCEKDIENTNNFDCGSNFTYIYFVSFIFLCSFLMLNLFVAVIMDNFDYLTRDSSILGPHHLDEYIRVWAEYDPGAIGRIHHSEMYEMLRNMEPPVGFGKKCPYRLAYRKLIRMNMPVDENGTVNFTTTLFALIRESLNIKMSTAEYMDIKDMELRQTICKMWPVQAKKKLNLIVPPDSELVFHKMTVGKIYAGYLIVENWRAYKNSQEQGPRSSPAVSIKSVTKPVVKEEKSANLLAKFFVAFKSNTNKSNISLDSHHERDEERFSIDHTYGEDYDANRRYSYLRRGSKPRGSKEIYSDLTPTQDYSYGLRPEHATIPGMPAPRKFGNRPRSPMYSLSELETKDRANTPQSLNSTISPTSGDRESDKFHRRSPAVSPSNPQYPFNFATAVNTIVHKANQIVEQDRRDRFYEVESEDDGIESKPNYKHQYSDDSDNKSSDTYKPSGKDRSYHVKSMTSSKYEGYINLTHSGRTTSLEVKSRSPSPVAEKKQKSNSFKEWTDLSTKYYGXXXXXXXXXXXXXINFSVCSPTIERRPNNFHREPLEESRIKYNEVYPQQKLPRIFPSPTVPKVVASDINDINFPRLNKSPTHSPTSSKFHAIPPPSADPPEDLFSSNLNDQESPPRMQTFSSYVPPLSPILYXXXXXXXXXXXXSIPLNEMEFYNDFYRTPIRNTSLQSFRDYSTYSNNFSPYFFSPQPPIHGIGQISNDNSFLLAQNDVWGMPQRSEYSGFTKTVXXXXXXXXXRTTEHSLVLSNTETSTPVNPPVSENLPLLSIRNNVSQNIRYPHERVRRNLQLXXXXXXXXWC 7204
            PFEYMVLLTILANCIVLSMERHLPKKDKTLLAGQLELTEKYFLGIFCVEALLKIVALGFCCHKEAYLRNVWNIMDFVVVVTG +   L         + D R LRA+RVLRPLKLV GF SLQVVLKSIIRAMAPLLQIGLLVLFAITIFAIIGLEFYSGAFHYTCFKANSDKLPLPIPTEKSLVPCSNSKNGSGLGAYTCPEDYQCKAYWEGPNYGITSFDNIGYAMLTVFQCITMEGWTDIMYHTNDAIGNRFNWLYFVPLIILGSFFMLNLVLGVLSGEFAKERERVEKRRAFLKLRRQQQTEKEFNGYMEWIQKAEEVLLNEATTTSEDKMRIIAARRRAEKQKYKLLGKNQSIPDFEYEDTELYSETKSMKGNIFIRSYAGIRRRRKERCTSFWRTEKHFRFSVRRLVKSQPFYWAVIILVFFNTVCVAIEHYEQGKWLTLFLNYAEYVFLCLFMMEMMIKMYGLSIRVYFQSSFNIFDCVVIAGSLFEIIYG+FVQDSSFGLSVLRALRLLRIFKVTRYWASLRNLVLSLLNSMRSIISLLFLLFLFILIFALLGMQLFGGEFNFEEGKPPQNFDTFVKALLTVFQILTGEDWNTVMYNGIQSKGGVKERGTVFSIYFVLLVVFGNYTLLNVFLAIAVDNLANAQELTAAEEEKAAELQRAADAAALQNEEKSSDNFIGRLPLSIDPPMVQVCPPSPQTANSLISKNFSFDHNQVEVNDKGCLLNTNKPNGKLGMLGHDNTNFNSLESDPVPNKIEPETIQRKPVLPYSAMFIFSPLNSLRRFCHFVVNLRYFDLFIMIVICASSIALAAEDPVKEKSLKNNILEFFDYAFTGVFTVEMILKIIDLGIILHPGSYCRDLWNILDATVVICALVAFIMGQKPSPTGNKLRGSSAKNLNTIKSLRVLRVLRPLKTINRVPKLKAVFDCVVSSLKNVFNILIVYILFQFIFAVIAVQLFQGKFFYCNDASKSSRETCRGYFFDYAGRSTPETKKRLWQHHDFHFDNILYAMLTLFTVTTGEGWPTVLKNSMESTNIDNGPIADYRQEMAIFYIVFFIVFPFFFVNIFVALIIITFQEQGENELIDLDLDKNQKQCIDFAINEKPLCRYMPKDKTTIKYRVWRLVVSTPFEYFIMVMIALNTLILMMKYYREEKKASSAATHDREQQAYLNYCNTLIFLNSAFTVMFSIECVLKIMAFGPKNYFRDPWNIFDFITVIGSITDVLVSELQDSSFLSLGFLRLFRAARLIKLLRQGYTIRILLWTFIQSFKALPYVCLLIAMLFFIYSIIGMQVFGNIKLISEYQINRHNNFQTFTNGLLLLFRCATGESWQEIMLACDNNKPCEKDIENTNNFDCGSNFTYIYFVSFIFLCSFLMLNLFVAVIMDNFDYLTRDSSILGPHHLDEYIRVWAEYDPGAIGRIHHSEMYEMLRNMEPPVGFGKKCPYRLAYRKLIRMNMPVDENGTVNFTTTLFALIRESLNIKMSTAEYMDIKDMELRQTICKMWPVQAKKKLNLIVPPDSELVFHKMTVGKIYAGYLIVENWRAYKNSQEQGPRS                 KSANLLAKFFVAFKSNTNKSNISLDSHHERDEERFSIDHTYGEDYDANRRYSYLRRGSKPRGSKEIYSDLTPTQDYSYGLRPEHATIPGMPAPRKFGNRPRSPMYSLSELETKDRANTPQSLNSTISPTSGDRESDKFHRRSPAVSPSNPQYPFNFATAVNTIVHKANQIVEQDRRDRFY           KPNYKHQYSDDSDNKSSDTYKPSGKDRSYHVKSMTSSKYEGYINLTHSGRTTSLEVKSRSPSPVAEKKQKSN+FKEWTDLSTKYYGSSRLEERSRSPSLINFSVCSPTIERRPNNFHREPLEESRIKYNEVYPQQKLPRIFPSPTVPKVVASDINDINFPRLNKSPTHSPTSSKFHAIPPPSADPPEDLFSSNLNDQESPPRMQTFSSYVPP+SPILYDFDETDDTTFFDSIPLNEMEFYNDFYRTPIRNTSLQSFRDYSTYSNNFSPYFFSPQPPIHGIGQISNDNSFLLAQNDVWGMPQRSEYSGFTKTVSSPISISPPRTTEHSLVLSNTETSTPVNP VSENLPLLSIRNNVSQNIRYPHERVRRNLQLEEDEEDEEWC
Sbjct:   20 PFEYMVLLTILANCIVLSMERHLPKKDKTLLAGQLELTEKYFLGIFCVEALLKIVALGFCCHKEAYLRNVWNIMDFVVVVTGLISHVL--------PSFDQRALRALRVLRPLKLVTGFESLQVVLKSIIRAMAPLLQIGLLVLFAITIFAIIGLEFYSGAFHYTCFKANSDKLPLPIPTEKSLVPCSNSKNGSGLGAYTCPEDYQCKAYWEGPNYGITSFDNIGYAMLTVFQCITMEGWTDIMYHTNDAIGNRFNWLYFVPLIILGSFFMLNLVLGVLSGEFAKERERVEKRRAFLKLRRQQQTEKEFNGYMEWIQKAEEVLLNEATTTSEDKMRIIAARRRAEKQKYKLLGKNQSIPDFEYEDTELYSETKSMKGNIFIRSYAGIRRRRKERCTSFWRTEKHFRFSVRRLVKSQPFYWAVIILVFFNTVCVAIEHYEQGKWLTLFLNYAEYVFLCLFMMEMMIKMYGLSIRVYFQSSFNIFDCVVIAGSLFEIIYGLFVQDSSFGLSVLRALRLLRIFKVTRYWASLRNLVLSLLNSMRSIISLLFLLFLFILIFALLGMQLFGGEFNFEEGKPPQNFDTFVKALLTVFQILTGEDWNTVMYNGIQSKGGVKERGTVFSIYFVLLVVFGNYTLLNVFLAIAVDNLANAQELTAAEEEKAAELQRAADAAALQNEEKSSDNFIGRLPLSIDPPMVQVCPPSPQTANSLISKNFSFDHNQVEVNDKGCLLNTNKPNGKLGMLGHDNTNFNSLESDPVPNKIEPETIQRKPVLPYSAMFIFSPLNSLRRFCHFVVNLRYFDLFIMIVICASSIALAAEDPVKEKSLKNNILEFFDYAFTGVFTVEMILKIIDLGIILHPGSYCRDLWNILDATVVICALVAFIMGQKPSPTGNKLRGSSAKNLNTIKSLRVLRVLRPLKTINRVPKLKAVFDCVVSSLKNVFNILIVYILFQFIFAVIAVQLFQGKFFYCNDASKSSRETCRGYFFDYAGRSTPETKKRLWQHHDFHFDNILYAMLTLFTVTTGEGWPTVLKNSMESTNIDNGPIADYRQEMAIFYIVFFIVFPFFFVNIFVALIIITFQEQGENELIDLDLDKNQKQCIDFAINEKPLCRYMPKDKTTIKYRVWRLVVSTPFEYFIMVMIALNTLILMMKYYREEKKASSAATHDREQQAYLNYCNTLIFLNSAFTVMFSIECVLKIMAFGPKNYFRDPWNIFDFITVIGSITDVLVSELQDSSFLSLGFLRLFRAARLIKLLRQGYTIRILLWTFIQSFKALPYVCLLIAMLFFIYSIIGMQVFGNIKLISEYQINRHNNFQTFTNGLLLLFRCATGESWQEIMLACDNNKPCEKDIENTNNFDCGSNFTYIYFVSFIFLCSFLMLNLFVAVIMDNFDYLTRDSSILGPHHLDEYIRVWAEYDPGAIGRIHHSEMYEMLRNMEPPVGFGKKCPYRLAYRKLIRMNMPVDENGTVNFTTTLFALIRESLNIKMSTAEYMDIKDMELRQTICKMWPVQAKKKLNLIVPPDSELVFHKMTVGKIYAGYLIVENWRAYKNSQEQGPRS-----------------KSANLLAKFFVAFKSNTNKSNISLDSHHERDEERFSIDHTYGEDYDANRRYSYLRRGSKPRGSKEIYSDLTPTQDYSYGLRPEHATIPGMPAPRKFGNRPRSPMYSLSELETKDRANTPQSLNSTISPTSGDRESDKFHRRSPAVSPSNPQYPFNFATAVNTIVHKANQIVEQDRRDRFY----------GKPNYKHQYSDDSDNKSSDTYKPSGKDRSYHVKSMTSSKYEGYINLTHSGRTTSLEVKSRSPSPVAEKKQKSNAFKEWTDLSTKYYGSSRLEERSRSPSLINFSVCSPTIERRPNNFHREPLEESRIKYNEVYPQQKLPRIFPSPTVPKVVASDINDINFPRLNKSPTHSPTSSKFHAIPPPSADPPEDLFSSNLNDQESPPRMQTFSSYVPPISPILYDFDETDDTTFFDSIPLNEMEFYNDFYRTPIRNTSLQSFRDYSTYSNNFSPYFFSPQPPIHGIGQISNDNSFLLAQNDVWGMPQRSEYSGFTKTVSSPISISPPRTTEHSLVLSNTETSTPVNPSVSENLPLLSIRNNVSQNIRYPHERVRRNLQLEEDEEDEEWC 2130          

HSP 2 Score: 73.1738 bits (178), Expect = 3.378e-12
Identity = 74/311 (23.79%), Postives = 123/311 (39.55%), Query Frame = 2
Query: 4154 TPFEYFIMVMIALNTLILMMKYYREEKKASSAATHDREQQAYLNYCNTLIFLNSAFTVMFSIECVLKIMAFG----PKNYFRDPWNIFDFITVI-GSITDVLVSELQDXXXXXXXXXXXXXXXXXXXXXXQGY-TIRILLWTFIQSFKALPYVCLLIAMLFFIYSIIGMQVF--------------------------------------GNIKLISEYQINRH--------NNFQTFTNGLLLLFRCATGESWQEIMLACDNNKPCEKDIENTNNFDCGSNFTYIYFVSFIFLCSFLMLNLFVAVIMDNF 4930
            TPFEY +++ I  N ++L M+ +  +K  +  A      + Y             F  +F +E +LKI+A G     + Y R+ WNI DF+ V+ G I+ VL S  Q                     L  G+ +++++L + I++   L  + LL+     I++IIG++ +                                      G      +YQ   +         +F      +L +F+C T E W +IM              +TN+   G+ F ++YFV  I L SF MLNL + V+   F
Sbjct:   19 TPFEYMVLLTILANCIVLSMERHLPKKDKTLLAGQLELTEKY-------------FLGIFCVEALLKIVALGFCCHKEAYLRNVWNIMDFVVVVTGLISHVLPSFDQ--------RALRALRVLRPLKLVTGFESLQVVLKSIIRAMAPLLQIGLLVLFAITIFAIIGLEFYSGAFHYTCFKANSDKLPLPIPTEKSLVPCSNSKNGSGLGAYTCPEDYQCKAYWEGPNYGITSFDNIGYAMLTVFQCITMEGWTDIMY-------------HTND-AIGNRFNWLYFVPLIILGSFFMLNLVLGVLSGEF 294          
The following BLAST results are available for this feature:
BLAST of Voltage dependent L type calcium channel subunit vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CACNA1S0.000e+045.94calcium voltage-gated channel subunit alpha1 S [So... [more]
CACNA1C0.000e+045.50calcium voltage-gated channel subunit alpha1 C [So... [more]
CACNA1C0.000e+045.50calcium voltage-gated channel subunit alpha1 C [So... [more]
CACNA1C0.000e+045.44calcium voltage-gated channel subunit alpha1 C [So... [more]
CACNA1C0.000e+045.44calcium voltage-gated channel subunit alpha1 C [So... [more]
back to top
BLAST of Voltage dependent L type calcium channel subunit vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc-22.442e-2565.10High voltage activated calcium channel alpha-1 sub... [more]
unc-22.247e-2555.42High voltage activated calcium channel alpha-1 sub... [more]
unc-22.542e-2555.42High voltage activated calcium channel alpha-1 sub... [more]
unc-22.227e-2555.42High voltage activated calcium channel alpha-1 sub... [more]
unc-22.658e-2565.10High voltage activated calcium channel alpha-1 sub... [more]
back to top
BLAST of Voltage dependent L type calcium channel subunit vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cac1.246e-2557.67gene:FBgn0263111 transcript:FBtr0332391[more]
cac1.432e-2557.17gene:FBgn0263111 transcript:FBtr0307313[more]
cac1.519e-2557.17gene:FBgn0263111 transcript:FBtr0307314[more]
cac1.420e-2557.11gene:FBgn0263111 transcript:FBtr0307316[more]
cac1.558e-2557.11gene:FBgn0263111 transcript:FBtr0307315[more]
back to top
BLAST of Voltage dependent L type calcium channel subunit vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cacna1sa0.000e+043.09calcium channel, voltage-dependent, L type, alpha ... [more]
cacna1sb0.000e+042.90calcium channel, voltage-dependent, L type, alpha ... [more]
cacna1bb3.983e-2660.67calcium channel, voltage-dependent, N type, alpha ... [more]
cacna1bb3.983e-2660.67calcium channel, voltage-dependent, N type, alpha ... [more]
cacna1ba1.159e-2557.80calcium channel, voltage-dependent, N type, alpha ... [more]
back to top
BLAST of Voltage dependent L type calcium channel subunit vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CACNA1C0.000e+045.72calcium channel, voltage-dependent, L type, alpha ... [more]
CACNA1C0.000e+045.45calcium channel, voltage-dependent, L type, alpha ... [more]
CACNA1C0.000e+044.87calcium channel, voltage-dependent, L type, alpha ... [more]
CACNA1C0.000e+044.94calcium channel, voltage-dependent, L type, alpha ... [more]
CACNA1C0.000e+045.18calcium channel, voltage-dependent, L type, alpha ... [more]
back to top
BLAST of Voltage dependent L type calcium channel subunit vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cacna1c0.000e+046.36calcium channel, voltage-dependent, L type, alpha ... [more]
Cacna1s0.000e+046.16calcium channel, voltage-dependent, L type, alpha ... [more]
Cacna1c0.000e+046.19calcium channel, voltage-dependent, L type, alpha ... [more]
Cacna1c0.000e+045.94calcium channel, voltage-dependent, L type, alpha ... [more]
Cacna1c0.000e+046.07calcium channel, voltage-dependent, L type, alpha ... [more]
back to top
BLAST of Voltage dependent L type calcium channel subunit vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|C9D7C2|CAC1A_APIME0.000e+057.38Voltage-dependent calcium channel type A subunit a... [more]
sp|Q02485|CAC1S_RAT0.000e+045.68Voltage-dependent L-type calcium channel subunit a... [more]
sp|Q01815|CAC1C_MOUSE0.000e+046.07Voltage-dependent L-type calcium channel subunit a... [more]
sp|P07293|CAC1S_RABIT0.000e+045.89Voltage-dependent L-type calcium channel subunit a... [more]
sp|Q02789|CAC1S_MOUSE0.000e+045.78Voltage-dependent L-type calcium channel subunit a... [more]
back to top
BLAST of Voltage dependent L type calcium channel subunit vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4Z2CWT30.000e+069.57Voltage-dependent calcium channel type A subunit a... [more]
A0A4E0RL130.000e+068.79Voltage dependent L type calcium channel subunit O... [more]
A0A0X3PSD70.000e+068.05Ca_chan_IQ domain-containing protein OS=Schistocep... [more]
A0A5K3F6C11.014e-2465.69Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A0X3PE310.000e+067.76Ca_chan_IQ domain-containing protein OS=Schistocep... [more]
back to top
BLAST of Voltage dependent L type calcium channel subunit vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cacna1sa0.000e+041.75calcium channel, voltage-dependent, L type, alpha ... [more]
cacna1sa0.000e+041.88calcium channel, voltage-dependent, L type, alpha ... [more]
cacna1sa0.000e+040.79calcium channel, voltage-dependent, L type, alpha ... [more]
cacna1sb0.000e+038.73calcium channel, voltage-dependent, L type, alpha ... [more]
cacna1bb8.705e-2758.41calcium channel, voltage-dependent, N type, alpha ... [more]
back to top
BLAST of Voltage dependent L type calcium channel subunit vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000010500.18.536e-11262.74pep scaffold:Pmarinus_7.0:GL477503:21958:35427:1 g... [more]
ENSPMAT00000005302.11.536e-10259.02pep scaffold:Pmarinus_7.0:GL483978:134:5921:-1 gen... [more]
ENSPMAT00000008632.12.556e-9945.79pep scaffold:Pmarinus_7.0:GL481395:151307:166184:-... [more]
ENSPMAT00000008630.15.602e-9945.79pep scaffold:Pmarinus_7.0:GL481395:151307:166184:-... [more]
ENSPMAT00000003253.16.418e-9157.78pep scaffold:Pmarinus_7.0:GL478330:685:47673:1 gen... [more]
back to top
BLAST of Voltage dependent L type calcium channel subunit vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
CCH14.486e-3923.30Voltage-gated high-affinity calcium channel; invol... [more]
back to top
BLAST of Voltage dependent L type calcium channel subunit vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO469911.257e-15942.51Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO356611.406e-6028.90Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO368442.962e-5827.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO467971.263e-5529.56Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO354971.939e-5227.80Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Voltage dependent L type calcium channel subunit vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cacna1c6.043e-1746.68voltage-dependent L-type calcium channel subunit a... [more]
cacna1c7.295e-1746.30voltage-dependent L-type calcium channel subunit a... [more]
cacna1c7.239e-1746.30voltage-dependent L-type calcium channel subunit a... [more]
cacna1c6.758e-1745.76voltage-dependent L-type calcium channel subunit a... [more]
cacna1c8.376e-1745.76voltage-dependent L-type calcium channel subunit a... [more]
back to top
BLAST of Voltage dependent L type calcium channel subunit vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000028279.10.000e+099.30SMESG000028279.1[more]
SMESG000028279.10.000e+099.30SMESG000028279.1[more]
SMESG000028279.13.033e-1297.72SMESG000028279.1[more]
SMESG000028279.10.000e+097.72SMESG000028279.1[more]
SMESG000028279.13.378e-1297.53SMESG000028279.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30028403 ID=SMED30028403|Name=Voltage dependent L type calcium channel subunit|organism=Schmidtea mediterranea sexual|type=transcript|length=7253bp
TGCTTATATTTCTTCTACATAATATCATGTACAATATATAGCATCGTTAT
GGTGTTTTTATTGATTAAGTAATCAATAAACATGATTATTGTGCAAACAT
ATTCTACATCACTTATTGGATATTCTTCTCAATTCCCGGAATCGCTGTGT
GTTGGCATATCAGATTAAAGGAGTAACAATGAATATTGGAGTGTAAATTG
CTTACTGGATTTTAATTCTATTATTGAAATTGATTCACAACTGATTTCTA
TGCCAAATCGTTTCCCATCCTACTACAACGAGTGAGATTCAGATTTCTAG
CCGATATAATTGTGGAAAATTGACAATTGACTTGTAAAAACACTTTCACA
GAAATTCTTTTCCAAATCCAATGAGATACAACGAATACGGTTCGACGGCG
ATCATTAAAAACGATGAAAAAAGTTCCGATCAGTCGACGTCGAGTGTTTC
CGAGGAAAACGACAACGCGGTTTTTGATAATGGAAATATTGACGGAAATT
GCCGATATCATTGTCAGAGAAAGGAAAACCAATCGGAATGTTTTGCCAGT
CCTTATATTCCATCGAATAATAAAAACCAACGAGGCATTCTGACGACCGT
GATGAGTATTGATGATGGATCTAAAACGACGTCTATGCGTTCACTGGCTA
AACGGACAATAAATCTCAGTTTTCCCGGAATGCAAACCTCAACCTCGAAA
TCTCTATTTATTTTTTCCGAAGAAAATGTTATTAGAAAATATGCCAAAAT
TATTATCGAATGGGGGCCTTTTGAATACATGGTTCTTCTGACGATCTTGG
CGAATTGCATAGTGCTTTCTATGGAGCGACATCTACCAAAAAAAGATAAA
ACTCTATTGGCAGGACAACTGGAGCTAACAGAAAAATATTTCTTGGGTAT
TTTTTGTGTCGAAGCACTTTTAAAGATTGTTGCCCTAGGATTTTGTTGTC
ATAAAGAGGCCTATTTACGAAACGTGTGGAATATCATGGATTTCGTTGTA
GTGGTTACCGGATTTTTAATGATGTTTCTGAACATTGATAACCACTCTGA
CTCTAGTACAGTGGATTTAAGGACTCTTCGAGCTGTGAGAGTTTTGCGAC
CATTAAAATTGGTAGCTGGTTTTCCGAGTCTTCAAGTCGTTTTGAAGTCC
ATCATTCGAGCAATGGCTCCATTGCTGCAAATCGGTTTGCTGGTTTTATT
TGCTATCACGATTTTTGCCATAATTGGTTTGGAATTCTACAGCGGCGCGT
TTCATTACACCTGCTTTAAAGCTAACAGTGACAAACTTCCACTCCCAATA
CCAACTGAAAAATCTCTAGTTCCGTGCTCTAATAGTAAAAATGGCTCTGG
TCTTGGTGCTTATACTTGTCCTGAAGATTATCAGTGCAAAGCTTATTGGG
AAGGTCCAAATTATGGAATTACAAGTTTCGACAACATTGGATACGCAATG
TTAACTGTGTTTCAATGTATTACAATGGAAGGATGGACGGATATAATGTA
TCACACAAATGATGCCATCGGAAATCGATTTAATTGGCTTTACTTTGTTC
CACTCATCATTCTGGGATCCTTCTTTATGCTAAATTTAGTTCTTGGTGTT
TTGTCAGGTGAATTTGCAAAAGAAAGAGAAAGAGTTGAAAAACGTCGAGC
ATTCTTGAAATTAAGACGTCAACAGCAAACGGAAAAAGAATTCAATGGAT
ACATGGAATGGATTCAAAAAGCTGAGGAAGTACTTCTCAATGAAGCTACA
ACAACATCAGAAGACAAAATGAGAATCATTGCGGCGCGTCGGAGAGCTGA
GAAACAAAAATACAAACTTCTTGGTAAAAATCAAAGTATTCCAGATTTCG
AATACGAAGATACAGAATTATATTCAGAAACGAAAAGTATGAAAGGTAAT
ATCTTTATTCGGTCGTATGCTGGAATAAGACGGAGAAGAAAAGAACGATG
CACTTCTTTTTGGAGAACAGAAAAACATTTTAGATTTTCAGTTAGAAGAT
TAGTAAAAAGTCAGCCCTTTTATTGGGCAGTTATTATATTGGTATTTTTC
AACACAGTCTGTGTAGCTATTGAACACTACGAACAAGGAAAGTGGTTGAC
GTTATTTTTAAATTATGCAGAATATGTTTTTCTCTGTCTTTTCATGATGG
AAATGATGATAAAAATGTACGGCCTTAGCATTAGAGTATATTTCCAATCA
TCATTCAATATATTCGATTGTGTAGTCATCGCCGGTAGTTTATTTGAAAT
AATATACGGTATATTTGTACAAGATTCTTCATTTGGGCTCAGTGTTTTAA
GAGCTTTAAGATTACTTCGCATTTTCAAAGTGACAAGATATTGGGCATCA
TTACGAAATCTCGTCCTATCTCTTCTAAATTCAATGCGCAGTATTATCAG
TCTTTTGTTTTTACTATTTCTTTTCATTCTAATATTTGCGTTACTTGGAA
TGCAACTTTTTGGAGGAGAATTCAATTTCGAGGAAGGAAAGCCGCCTCAG
AATTTTGACACATTTGTAAAAGCTTTATTGACTGTATTTCAGATATTGAC
CGGAGAAGATTGGAACACAGTAATGTACAATGGGATTCAGTCGAAAGGCG
GTGTCAAAGAAAGAGGGACAGTTTTTTCTATTTATTTTGTTTTGTTAGTC
GTATTCGGAAATTACACCCTCCTCAATGTCTTTCTGGCTATTGCTGTTGA
TAATCTGGCAAATGCTCAAGAACTAACAGCTGCCGAGGAAGAAAAAGCGG
CCGAACTTCAAAGAGCTGCTGATGCAGCCGCCCTGCAAAACGAAGAGAAA
AGTTCAGACAACTTTATTGGGCGACTTCCTTTATCAATCGATCCTCCAAT
GGTCCAAGTTTGCCCCCCTTCACCTCAGACTGCAAACAGTCTTATTTCAA
AGAACTTCAGTTTTGATCACAACCAAGTAGAAGTGAATGATAAAGGATGT
CTACTAAATACCAATAAACCCAACGGAAAACTTGGCATGTTAGGGCATGA
CAACACCAATTTCAATTCTTTGGAAAGCGATCCTGTGCCAAATAAAATAG
AACCAGAAACAATACAACGCAAACCAGTTTTACCTTATAGTGCAATGTTC
ATTTTCAGTCCATTAAATTCATTACGAAGATTTTGCCATTTTGTCGTGAA
TTTAAGATATTTTGATTTGTTCATTATGATTGTCATCTGTGCCAGTTCTA
TTGCTCTTGCTGCTGAAGATCCTGTTAAGGAAAAATCTTTAAAAAACAAT
ATTCTTGAATTTTTTGATTATGCATTTACTGGAGTTTTTACAGTTGAAAT
GATATTAAAGATTATAGATCTGGGTATTATCCTCCATCCCGGTTCCTATT
GTAGAGATTTATGGAATATTTTAGATGCTACTGTGGTCATATGTGCTTTA
GTTGCTTTTATAATGGGACAGAAACCTAGTCCTACCGGGAACAAACTTCG
CGGTAGCTCTGCAAAAAATTTAAATACGATCAAATCACTTCGAGTTTTGC
GTGTGTTAAGGCCTCTTAAAACTATTAATAGAGTTCCAAAATTAAAGGCT
GTGTTTGATTGTGTAGTCTCTTCTTTGAAAAATGTTTTCAACATACTTAT
TGTATACATTTTATTCCAATTTATATTCGCCGTTATCGCAGTGCAATTAT
TCCAGGGCAAATTCTTTTATTGTAATGACGCATCGAAGAGTTCTAGAGAA
ACATGCAGGGGATATTTTTTTGATTACGCTGGACGATCAACTCCCGAAAC
AAAGAAAAGACTATGGCAACATCATGATTTTCATTTCGATAACATTTTAT
ACGCAATGTTAACTCTTTTTACAGTTACAACTGGAGAAGGCTGGCCTACA
GTTCTCAAAAATTCAATGGAATCAACGAATATAGACAATGGACCAATAGC
AGATTATCGTCAAGAAATGGCAATATTCTACATAGTGTTTTTTATTGTTT
TCCCTTTCTTTTTTGTTAATATTTTTGTGGCCTTAATAATTATAACTTTC
CAAGAACAGGGAGAAAATGAACTAATTGATTTAGATTTAGATAAAAATCA
AAAACAATGTATTGACTTCGCAATAAACGAGAAACCGCTATGTCGGTATA
TGCCAAAGGATAAAACTACCATTAAATATAGAGTATGGCGGCTTGTTGTG
TCAACGCCATTTGAGTACTTTATAATGGTTATGATAGCCCTAAATACATT
AATTCTTATGATGAAGTACTATCGGGAGGAAAAGAAGGCGTCAAGTGCAG
CAACTCATGACCGAGAACAGCAAGCGTACCTTAATTATTGCAACACTCTC
ATATTTTTGAATTCTGCGTTCACTGTAATGTTTTCAATAGAATGTGTTTT
AAAGATTATGGCTTTTGGGCCAAAGAATTACTTTAGAGATCCATGGAATA
TATTTGATTTCATAACAGTCATAGGATCCATCACTGATGTATTGGTGTCA
GAATTGCAGGATTCTTCTTTTCTCAGTCTTGGATTTTTAAGATTATTCAG
AGCTGCCCGATTGATTAAGCTTCTTCGTCAAGGATATACAATAAGAATTC
TTCTGTGGACATTTATCCAGTCTTTCAAAGCACTGCCATATGTGTGTCTT
TTAATAGCAATGTTGTTTTTTATTTATTCAATTATTGGAATGCAAGTATT
TGGGAACATAAAATTAATAAGCGAATATCAAATAAATCGTCACAACAATT
TTCAAACCTTTACCAATGGTCTTCTGTTACTTTTCCGATGTGCTACTGGC
GAATCGTGGCAAGAAATAATGCTTGCATGTGATAACAATAAACCTTGTGA
AAAAGATATTGAAAACACTAATAATTTTGATTGTGGTTCAAATTTTACTT
ACATTTATTTTGTATCTTTTATATTTCTTTGTTCTTTTCTCATGCTCAAT
TTATTCGTGGCTGTTATTATGGACAATTTCGATTATCTCACTAGAGATTC
TTCAATATTGGGACCACATCATTTGGATGAGTATATACGAGTATGGGCAG
AATATGATCCAGGGGCAATAGGTCGAATACATCACAGTGAAATGTACGAA
ATGCTCCGAAATATGGAACCTCCAGTTGGTTTTGGTAAAAAATGCCCTTA
CCGATTGGCGTACCGAAAACTTATCCGAATGAATATGCCAGTCGATGAAA
ACGGAACAGTGAATTTCACTACAACATTATTTGCGTTAATTCGGGAATCA
CTCAACATTAAAATGTCGACAGCCGAATACATGGACATCAAAGATATGGA
ATTGCGACAAACCATTTGTAAAATGTGGCCAGTCCAAGCAAAGAAAAAAC
TGAATCTCATTGTACCACCAGATTCGGAATTGGTATTTCACAAAATGACA
GTCGGGAAAATCTACGCCGGATATTTGATTGTGGAAAACTGGCGCGCATA
TAAAAACAGCCAGGAACAAGGCCCGAGATCGTCTCCAGCTGTATCAATTA
AATCCGTGACTAAACCGGTTGTAAAAGAAGAGAAATCAGCGAATTTACTA
GCGAAATTCTTTGTGGCGTTTAAAAGTAATACAAACAAATCGAATATTTC
TTTGGATTCGCATCATGAGCGAGACGAGGAACGATTTAGTATTGATCATA
CATATGGAGAAGATTATGATGCAAATCGACGCTATAGTTATCTGCGGCGC
GGAAGCAAACCTCGCGGTAGCAAGGAAATCTATTCAGACCTTACACCAAC
TCAAGATTATTCATATGGATTAAGACCAGAACATGCAACTATTCCTGGAA
TGCCAGCTCCTCGGAAATTTGGAAATAGACCAAGAAGCCCCATGTATTCA
TTGTCCGAACTTGAAACGAAAGATAGAGCAAATACTCCTCAAAGCCTTAA
CTCAACAATTTCGCCAACAAGTGGAGATAGAGAAAGTGATAAATTTCACA
GGCGTTCTCCAGCAGTATCTCCATCTAACCCACAATATCCTTTTAATTTT
GCCACAGCAGTTAACACAATTGTTCATAAGGCTAATCAGATTGTTGAACA
AGACCGTAGAGATCGATTTTATGAAGTCGAATCCGAAGATGATGGAATTG
AAAGTAAACCAAATTACAAACATCAGTACTCCGACGACTCTGATAATAAA
TCAAGTGATACTTACAAACCTAGTGGAAAGGATCGTTCATATCATGTCAA
ATCTATGACAAGTTCTAAATATGAAGGATATATCAATTTAACACATTCTG
GAAGAACTACGAGTCTAGAAGTAAAATCCCGTTCTCCTTCTCCTGTTGCA
GAAAAGAAACAAAAATCAAATTCCTTTAAGGAATGGACTGATTTATCTAC
AAAGTATTATGGTTCTTCAAGACTTGAAGAAAGGTCTAGATCTCCTAGTC
TTATTAATTTTTCTGTTTGTAGTCCAACAATTGAGAGGCGACCTAACAAT
TTCCATCGAGAACCTCTTGAAGAATCTCGAATAAAATATAATGAAGTATA
TCCACAGCAGAAACTGCCTCGAATTTTCCCTAGTCCAACTGTGCCAAAGG
TCGTGGCCTCGGATATTAATGATATTAATTTCCCTAGGCTCAATAAATCC
CCTACTCATTCTCCCACTTCATCAAAGTTTCACGCAATACCTCCACCATC
TGCAGATCCCCCAGAAGATTTATTTTCGTCTAATCTTAATGATCAAGAAT
CACCTCCAAGAATGCAAACTTTCAGTTCTTATGTTCCTCCTCTTTCTCCG
ATATTATATGATTTCGATGAAACAGACGATACAACATTTTTTGATTCAAT
ACCATTAAATGAAATGGAATTTTATAATGATTTCTATAGAACCCCAATCA
GAAATACTTCGCTTCAATCTTTTAGAGATTATTCTACTTATTCCAATAAC
TTTAGTCCATATTTTTTTTCTCCTCAACCTCCAATTCATGGAATAGGTCA
AATATCTAATGATAATTCATTTCTGCTTGCCCAAAATGATGTGTGGGGAA
TGCCACAGCGATCGGAGTATTCTGGTTTTACTAAAACTGTTTCTTCACCA
ATTTCAATTTCTCCTCCTAGGACTACAGAACATTCTTTAGTGTTATCTAA
CACAGAAACATCGACTCCTGTTAACCCACCTGTTTCTGAAAATCTTCCAT
TGCTTTCAATAAGAAACAATGTCAGTCAAAATATCCGATATCCTCATGAA
AGAGTGAGGCGAAATTTACAATTAGAAGAAGATGAAGAAGATGAAGAATG
GTGCTGATAAAGTGTTTTCTATTTATTGAATCTGTTATTATTATTATTAT
TAT
back to top

protein sequence of SMED30028403-orf-1

>SMED30028403-orf-1 ID=SMED30028403-orf-1|Name=SMED30028403-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=2279bp
MRYNEYGSTAIIKNDEKSSDQSTSSVSEENDNAVFDNGNIDGNCRYHCQR
KENQSECFASPYIPSNNKNQRGILTTVMSIDDGSKTTSMRSLAKRTINLS
FPGMQTSTSKSLFIFSEENVIRKYAKIIIEWGPFEYMVLLTILANCIVLS
MERHLPKKDKTLLAGQLELTEKYFLGIFCVEALLKIVALGFCCHKEAYLR
NVWNIMDFVVVVTGFLMMFLNIDNHSDSSTVDLRTLRAVRVLRPLKLVAG
FPSLQVVLKSIIRAMAPLLQIGLLVLFAITIFAIIGLEFYSGAFHYTCFK
ANSDKLPLPIPTEKSLVPCSNSKNGSGLGAYTCPEDYQCKAYWEGPNYGI
TSFDNIGYAMLTVFQCITMEGWTDIMYHTNDAIGNRFNWLYFVPLIILGS
FFMLNLVLGVLSGEFAKERERVEKRRAFLKLRRQQQTEKEFNGYMEWIQK
AEEVLLNEATTTSEDKMRIIAARRRAEKQKYKLLGKNQSIPDFEYEDTEL
YSETKSMKGNIFIRSYAGIRRRRKERCTSFWRTEKHFRFSVRRLVKSQPF
YWAVIILVFFNTVCVAIEHYEQGKWLTLFLNYAEYVFLCLFMMEMMIKMY
GLSIRVYFQSSFNIFDCVVIAGSLFEIIYGIFVQDSSFGLSVLRALRLLR
IFKVTRYWASLRNLVLSLLNSMRSIISLLFLLFLFILIFALLGMQLFGGE
FNFEEGKPPQNFDTFVKALLTVFQILTGEDWNTVMYNGIQSKGGVKERGT
VFSIYFVLLVVFGNYTLLNVFLAIAVDNLANAQELTAAEEEKAAELQRAA
DAAALQNEEKSSDNFIGRLPLSIDPPMVQVCPPSPQTANSLISKNFSFDH
NQVEVNDKGCLLNTNKPNGKLGMLGHDNTNFNSLESDPVPNKIEPETIQR
KPVLPYSAMFIFSPLNSLRRFCHFVVNLRYFDLFIMIVICASSIALAAED
PVKEKSLKNNILEFFDYAFTGVFTVEMILKIIDLGIILHPGSYCRDLWNI
LDATVVICALVAFIMGQKPSPTGNKLRGSSAKNLNTIKSLRVLRVLRPLK
TINRVPKLKAVFDCVVSSLKNVFNILIVYILFQFIFAVIAVQLFQGKFFY
CNDASKSSRETCRGYFFDYAGRSTPETKKRLWQHHDFHFDNILYAMLTLF
TVTTGEGWPTVLKNSMESTNIDNGPIADYRQEMAIFYIVFFIVFPFFFVN
IFVALIIITFQEQGENELIDLDLDKNQKQCIDFAINEKPLCRYMPKDKTT
IKYRVWRLVVSTPFEYFIMVMIALNTLILMMKYYREEKKASSAATHDREQ
QAYLNYCNTLIFLNSAFTVMFSIECVLKIMAFGPKNYFRDPWNIFDFITV
IGSITDVLVSELQDSSFLSLGFLRLFRAARLIKLLRQGYTIRILLWTFIQ
SFKALPYVCLLIAMLFFIYSIIGMQVFGNIKLISEYQINRHNNFQTFTNG
LLLLFRCATGESWQEIMLACDNNKPCEKDIENTNNFDCGSNFTYIYFVSF
IFLCSFLMLNLFVAVIMDNFDYLTRDSSILGPHHLDEYIRVWAEYDPGAI
GRIHHSEMYEMLRNMEPPVGFGKKCPYRLAYRKLIRMNMPVDENGTVNFT
TTLFALIRESLNIKMSTAEYMDIKDMELRQTICKMWPVQAKKKLNLIVPP
DSELVFHKMTVGKIYAGYLIVENWRAYKNSQEQGPRSSPAVSIKSVTKPV
VKEEKSANLLAKFFVAFKSNTNKSNISLDSHHERDEERFSIDHTYGEDYD
ANRRYSYLRRGSKPRGSKEIYSDLTPTQDYSYGLRPEHATIPGMPAPRKF
GNRPRSPMYSLSELETKDRANTPQSLNSTISPTSGDRESDKFHRRSPAVS
PSNPQYPFNFATAVNTIVHKANQIVEQDRRDRFYEVESEDDGIESKPNYK
HQYSDDSDNKSSDTYKPSGKDRSYHVKSMTSSKYEGYINLTHSGRTTSLE
VKSRSPSPVAEKKQKSNSFKEWTDLSTKYYGSSRLEERSRSPSLINFSVC
SPTIERRPNNFHREPLEESRIKYNEVYPQQKLPRIFPSPTVPKVVASDIN
DINFPRLNKSPTHSPTSSKFHAIPPPSADPPEDLFSSNLNDQESPPRMQT
FSSYVPPLSPILYDFDETDDTTFFDSIPLNEMEFYNDFYRTPIRNTSLQS
FRDYSTYSNNFSPYFFSPQPPIHGIGQISNDNSFLLAQNDVWGMPQRSEY
SGFTKTVSSPISISPPRTTEHSLVLSNTETSTPVNPPVSENLPLLSIRNN
VSQNIRYPHERVRRNLQLEEDEEDEEWC*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000074oocyte
PLANA:0000099neuron
PLANA:0000231vitelline gland
PLANA:0000418head
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR002077VDCCAlpha1
IPR014873VDCC_a1su_IQ
IPR031649GPHH_dom
IPR027359Volt_channel_dom_sf
IPR005821Ion_trans_dom
Vocabulary: cellular component
TermDefinition
GO:0005891voltage-gated calcium channel complex
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: molecular function
TermDefinition
GO:0005245voltage-gated calcium channel activity
GO:0005216ion channel activity
GO:0005244voltage-gated ion channel activity
GO:0005262calcium channel activity
GO:0005509calcium ion binding
Vocabulary: biological process
TermDefinition
GO:0070588calcium ion transmembrane transport
GO:0055085transmembrane transport
GO:0006811ion transport
GO:0006816calcium ion transport
GO:0034765regulation of ion transmembrane transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 419..439
NoneNo IPR availableCOILSCoilCoilcoord: 779..799
NoneNo IPR availableGENE3DG3DSA:1.10.238.10coord: 1521..1645
e-value: 2.6E-31
score: 110.0
NoneNo IPR availableGENE3DG3DSA:1.10.287.70coord: 335..420
e-value: 9.0E-19
score: 69.4
coord: 1057..1215
e-value: 3.4E-18
score: 67.5
coord: 661..784
e-value: 2.6E-42
score: 145.2
coord: 1390..1520
e-value: 1.6E-25
score: 91.1
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 11..34
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1814..1854
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..34
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1886..1924
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1946..1965
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1815..1835
NoneNo IPR availablePANTHERPTHR45628FAMILY NOT NAMEDcoord: 895..1684
NoneNo IPR availablePANTHERPTHR45628:SF3VOLTAGE-DEPENDENT P/Q-TYPE CALCIUM CHANNEL SUBUNIT ALPHA-1Acoord: 895..1684
coord: 101..799
NoneNo IPR availablePANTHERPTHR45628FAMILY NOT NAMEDcoord: 101..799
NoneNo IPR availableSUPERFAMILYSSF81324Voltage-gated potassium channelscoord: 547..780
NoneNo IPR availableSUPERFAMILYSSF81324Voltage-gated potassium channelscoord: 928..1213
NoneNo IPR availableSUPERFAMILYSSF81324Voltage-gated potassium channelscoord: 134..419
NoneNo IPR availableSUPERFAMILYSSF81324Voltage-gated potassium channelscoord: 1262..1520
NoneNo IPR availableTMHMMTMhelixcoord: 612..634
NoneNo IPR availableTMHMMTMhelixcoord: 997..1016
NoneNo IPR availableTMHMMTMhelixcoord: 926..948
NoneNo IPR availableTMHMMTMhelixcoord: 1404..1423
NoneNo IPR availableTMHMMTMhelixcoord: 127..149
NoneNo IPR availableTMHMMTMhelixcoord: 549..568
NoneNo IPR availableTMHMMTMhelixcoord: 389..411
NoneNo IPR availableTMHMMTMhelixcoord: 675..697
NoneNo IPR availableTMHMMTMhelixcoord: 198..220
NoneNo IPR availableTMHMMTMhelixcoord: 1186..1208
NoneNo IPR availableTMHMMTMhelixcoord: 1257..1279
NoneNo IPR availableTMHMMTMhelixcoord: 268..290
NoneNo IPR availableTMHMMTMhelixcoord: 968..990
NoneNo IPR availableTMHMMTMhelixcoord: 1310..1332
NoneNo IPR availableTMHMMTMhelixcoord: 751..773
NoneNo IPR availableTMHMMTMhelixcoord: 1494..1516
NoneNo IPR availableTMHMMTMhelixcoord: 575..597
NoneNo IPR availableTMHMMTMhelixcoord: 169..191
NoneNo IPR availableTMHMMTMhelixcoord: 1072..1094
IPR002077Voltage-dependent calcium channel, alpha-1 subunitPRINTSPR00167CACHANNELcoord: 1394..1408
score: 88.23
coord: 710..736
score: 76.39
coord: 1208..1228
score: 57.74
coord: 255..270
score: 74.8
coord: 412..436
score: 70.19
coord: 373..390
score: 50.43
coord: 1442..1454
score: 64.54
IPR014873Voltage-dependent calcium channel, alpha-1 subunit, IQ domainSMARTSM01062Ca_chan_IQ_2coord: 1656..1690
e-value: 5.2E-8
score: 42.6
IPR014873Voltage-dependent calcium channel, alpha-1 subunit, IQ domainPFAMPF08763Ca_chan_IQcoord: 1600..1678
e-value: 2.4E-29
score: 101.4
IPR031649Voltage-dependent L-type calcium channel, IQ-associated domainPFAMPF16905GPHHcoord: 1537..1590
e-value: 1.7E-28
score: 98.2
IPR005821Ion transport domainPFAMPF00520Ion_transcoord: 1263..1527
e-value: 3.1E-65
score: 219.8
coord: 548..785
e-value: 6.6E-53
score: 179.5
coord: 134..422
e-value: 8.1E-68
score: 228.3
coord: 929..1216
e-value: 2.1E-62
score: 210.6
IPR027359Voltage-dependent channel domain superfamilyGENE3DG3DSA:1.20.120.350coord: 538..660
e-value: 5.5E-28
score: 99.4
coord: 920..1056
e-value: 5.7E-31
score: 109.0
coord: 123..252
e-value: 2.1E-27
score: 97.5
coord: 1251..1389
e-value: 1.3E-35
score: 124.0