IST1

Overview
NameIST1
Smed IDSMED30028398
Length (bp)1395
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of IST1 (SMED30028398) t-SNE clustered cells

Violin plots show distribution of expression levels for IST1 (SMED30028398) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of IST1 (SMED30028398) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for IST1 (SMED30028398) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30028398

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30028398SMESG000078030.1 Contig5569GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30028398SMESG000078030.1 dd_Smed_v4_2006_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30028398SMESG000078030.1 dd_Smed_v4_2006_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30028398SMESG000078030.1 dd_Smed_v4_2006_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of IST1 vs. Ensembl Human
Match: IST1 (IST1 factor associated with ESCRT-III [Source:HGNC Symbol;Acc:HGNC:28977])

HSP 1 Score: 254.603 bits (649), Expect = 1.498e-80
Identity = 152/335 (45.37%), Postives = 206/335 (61.49%), Query Frame = 1
Query:   67 KLKTNLRIVINRLKLLEKKNTEIALKSRKEIADYLSSAKYDRARIKVEMIIRQDYLVEVYELVEMFCDLLLARFGMIECQKEIDPGLEEQIATLIWVTPRLQTDVLELKIIADQLLLKYGREYGLACQSNSLNNVNEKVMEKLSIKAPPKRLVEQYLVEIAKSFDVPYEP---VEDIDPPATWNPNDFYAPVAPNLID--FLPEKPPLVNPNAAYNPGVLPHPMYDPTMQPPYPVMN-----NGPFPYPH-KKPMSDIDQPMSLPPKYEEFPNDGSSSQESAPPLPPDRTNDLFLPEIPT------DQNNTNQTPGSGSVDFDDLNRRFEELKRR 1020
            +L+ NLR+VINRLKLLEKK TE+A K+RKEIADYL++ K +RARI+VE IIR+DYLVE  E++E++CDLLLARFG+I+  KE+D GL E ++TLIW  PRLQ++V ELKI+ADQL  KY +EYG  C++N +  VN+++M KLS++APPK LVE+YL+EIAK+++VPYEP   V    PP           V  +LID  F  +                P    D T+  P P+       N PF YP  K P+ DI+   ++       P     +    P  P D  ++  LPE+P+        +    T  S  +DFDDL+RRFEELK++
Sbjct:   10 RLRVNLRLVINRLKLLEKKKTELAQKARKEIADYLAAGKDERARIRVEHIIREDYLVEAMEILELYCDLLLARFGLIQSMKELDSGLAESVSTLIWAAPRLQSEVAELKIVADQLCAKYSKEYGKLCRTNQIGTVNDRLMHKLSVEAPPKILVERYLIEIAKNYNVPYEPDSVVMAEAPPG----------VETDLIDVGFTDDVKKGGPGRGGSGGFTAPVGGPDGTVPMPMPMPMPMPSANTPFSYPLPKGPVDDINADKNISSAQIVGPGPKPEASAKLPSRPADNYDNFVLPELPSVPDTLPTASAGASTSASEDIDFDDLSRRFEELKKK 334          
BLAST of IST1 vs. Ensembl Human
Match: IST1 (IST1 factor associated with ESCRT-III [Source:HGNC Symbol;Acc:HGNC:28977])

HSP 1 Score: 245.743 bits (626), Expect = 1.014e-76
Identity = 159/366 (43.44%), Postives = 213/366 (58.20%), Query Frame = 1
Query:   67 KLKTNLRIVINRLKLLEKKNTEIALKSRKEIADYLSSAKYDRARIKVEMIIRQDYLVEVYELVEMFCDLLLARFGMIECQKEIDPGLEEQIATLIWVTPRLQTDVLELKIIADQLLLKYGREYGLACQSNSLNNVNEKVMEKLSIKAPPKRLVEQYLVEIAKSFDVPYEP---VEDIDPPATWNPNDFYAPVAPNLID--FLPEKPPLVNPNAAYNPGVLPHPMYDPTMQPPYPVMN-----NGPFPYPHKKPMSDIDQ-PM---------------SLPPKYEEFPN-----DGSSSQ-----------ESAPPLPPDRTNDLFLPEIPT------DQNNTNQTPGSGSVDFDDLNRRFEELKRR 1020
            +L+ NLR+VINRLKLLEKK TE+A K+RKEIADYL++ K +RARI+VE IIR+DYLVE  E++E++CDLLLARFG+I+  KE+D GL E ++TLIW  PRLQ++V ELKI+ADQL  KY +EYG  C++N +  VN+++M KLS++APPK LVE+YL+EIAK+++VPYEP   V    PP           V  +LID  F  +                P    D T+  P P+       N PF YP  K  SD +  PM               + PP YE   +     + SS+Q              P  P D  ++  LPE+P+        +    T  S  +DFDDL+RRFEELK++
Sbjct:   10 RLRVNLRLVINRLKLLEKKKTELAQKARKEIADYLAAGKDERARIRVEHIIREDYLVEAMEILELYCDLLLARFGLIQSMKELDSGLAESVSTLIWAAPRLQSEVAELKIVADQLCAKYSKEYGKLCRTNQIGTVNDRLMHKLSVEAPPKILVERYLIEIAKNYNVPYEPDSVVMAEAPPG----------VETDLIDVGFTDDVKKGGPGRGGSGGFTAPVGGPDGTVPMPMPMPMPMPSANTPFSYPLPKGPSDFNGLPMGTYQAFPNIHPPQIPATPPSYESVDDINADKNISSAQIVGPGPKPEASAKLPSRPADNYDNFVLPELPSVPDTLPTASAGASTSASEDIDFDDLSRRFEELKKK 365          
BLAST of IST1 vs. Ensembl Human
Match: IST1 (IST1 factor associated with ESCRT-III [Source:HGNC Symbol;Acc:HGNC:28977])

HSP 1 Score: 245.743 bits (626), Expect = 1.014e-76
Identity = 159/366 (43.44%), Postives = 213/366 (58.20%), Query Frame = 1
Query:   67 KLKTNLRIVINRLKLLEKKNTEIALKSRKEIADYLSSAKYDRARIKVEMIIRQDYLVEVYELVEMFCDLLLARFGMIECQKEIDPGLEEQIATLIWVTPRLQTDVLELKIIADQLLLKYGREYGLACQSNSLNNVNEKVMEKLSIKAPPKRLVEQYLVEIAKSFDVPYEP---VEDIDPPATWNPNDFYAPVAPNLID--FLPEKPPLVNPNAAYNPGVLPHPMYDPTMQPPYPVMN-----NGPFPYPHKKPMSDIDQ-PM---------------SLPPKYEEFPN-----DGSSSQ-----------ESAPPLPPDRTNDLFLPEIPT------DQNNTNQTPGSGSVDFDDLNRRFEELKRR 1020
            +L+ NLR+VINRLKLLEKK TE+A K+RKEIADYL++ K +RARI+VE IIR+DYLVE  E++E++CDLLLARFG+I+  KE+D GL E ++TLIW  PRLQ++V ELKI+ADQL  KY +EYG  C++N +  VN+++M KLS++APPK LVE+YL+EIAK+++VPYEP   V    PP           V  +LID  F  +                P    D T+  P P+       N PF YP  K  SD +  PM               + PP YE   +     + SS+Q              P  P D  ++  LPE+P+        +    T  S  +DFDDL+RRFEELK++
Sbjct:   10 RLRVNLRLVINRLKLLEKKKTELAQKARKEIADYLAAGKDERARIRVEHIIREDYLVEAMEILELYCDLLLARFGLIQSMKELDSGLAESVSTLIWAAPRLQSEVAELKIVADQLCAKYSKEYGKLCRTNQIGTVNDRLMHKLSVEAPPKILVERYLIEIAKNYNVPYEPDSVVMAEAPPG----------VETDLIDVGFTDDVKKGGPGRGGSGGFTAPVGGPDGTVPMPMPMPMPMPSANTPFSYPLPKGPSDFNGLPMGTYQAFPNIHPPQIPATPPSYESVDDINADKNISSAQIVGPGPKPEASAKLPSRPADNYDNFVLPELPSVPDTLPTASAGASTSASEDIDFDDLSRRFEELKKK 365          
BLAST of IST1 vs. Ensembl Human
Match: IST1 (IST1 factor associated with ESCRT-III [Source:HGNC Symbol;Acc:HGNC:28977])

HSP 1 Score: 245.743 bits (626), Expect = 1.014e-76
Identity = 159/366 (43.44%), Postives = 213/366 (58.20%), Query Frame = 1
Query:   67 KLKTNLRIVINRLKLLEKKNTEIALKSRKEIADYLSSAKYDRARIKVEMIIRQDYLVEVYELVEMFCDLLLARFGMIECQKEIDPGLEEQIATLIWVTPRLQTDVLELKIIADQLLLKYGREYGLACQSNSLNNVNEKVMEKLSIKAPPKRLVEQYLVEIAKSFDVPYEP---VEDIDPPATWNPNDFYAPVAPNLID--FLPEKPPLVNPNAAYNPGVLPHPMYDPTMQPPYPVMN-----NGPFPYPHKKPMSDIDQ-PM---------------SLPPKYEEFPN-----DGSSSQ-----------ESAPPLPPDRTNDLFLPEIPT------DQNNTNQTPGSGSVDFDDLNRRFEELKRR 1020
            +L+ NLR+VINRLKLLEKK TE+A K+RKEIADYL++ K +RARI+VE IIR+DYLVE  E++E++CDLLLARFG+I+  KE+D GL E ++TLIW  PRLQ++V ELKI+ADQL  KY +EYG  C++N +  VN+++M KLS++APPK LVE+YL+EIAK+++VPYEP   V    PP           V  +LID  F  +                P    D T+  P P+       N PF YP  K  SD +  PM               + PP YE   +     + SS+Q              P  P D  ++  LPE+P+        +    T  S  +DFDDL+RRFEELK++
Sbjct:   10 RLRVNLRLVINRLKLLEKKKTELAQKARKEIADYLAAGKDERARIRVEHIIREDYLVEAMEILELYCDLLLARFGLIQSMKELDSGLAESVSTLIWAAPRLQSEVAELKIVADQLCAKYSKEYGKLCRTNQIGTVNDRLMHKLSVEAPPKILVERYLIEIAKNYNVPYEPDSVVMAEAPPG----------VETDLIDVGFTDDVKKGGPGRGGSGGFTAPVGGPDGTVPMPMPMPMPMPSANTPFSYPLPKGPSDFNGLPMGTYQAFPNIHPPQIPATPPSYESVDDINADKNISSAQIVGPGPKPEASAKLPSRPADNYDNFVLPELPSVPDTLPTASAGASTSASEDIDFDDLSRRFEELKKK 365          
BLAST of IST1 vs. Ensembl Human
Match: IST1 (IST1 factor associated with ESCRT-III [Source:HGNC Symbol;Acc:HGNC:28977])

HSP 1 Score: 246.128 bits (627), Expect = 1.030e-76
Identity = 159/366 (43.44%), Postives = 213/366 (58.20%), Query Frame = 1
Query:   67 KLKTNLRIVINRLKLLEKKNTEIALKSRKEIADYLSSAKYDRARIKVEMIIRQDYLVEVYELVEMFCDLLLARFGMIECQKEIDPGLEEQIATLIWVTPRLQTDVLELKIIADQLLLKYGREYGLACQSNSLNNVNEKVMEKLSIKAPPKRLVEQYLVEIAKSFDVPYEP---VEDIDPPATWNPNDFYAPVAPNLID--FLPEKPPLVNPNAAYNPGVLPHPMYDPTMQPPYPVMN-----NGPFPYPHKKPMSDIDQ-PM---------------SLPPKYEEFPN-----DGSSSQ-----------ESAPPLPPDRTNDLFLPEIPT------DQNNTNQTPGSGSVDFDDLNRRFEELKRR 1020
            +L+ NLR+VINRLKLLEKK TE+A K+RKEIADYL++ K +RARI+VE IIR+DYLVE  E++E++CDLLLARFG+I+  KE+D GL E ++TLIW  PRLQ++V ELKI+ADQL  KY +EYG  C++N +  VN+++M KLS++APPK LVE+YL+EIAK+++VPYEP   V    PP           V  +LID  F  +                P    D T+  P P+       N PF YP  K  SD +  PM               + PP YE   +     + SS+Q              P  P D  ++  LPE+P+        +    T  S  +DFDDL+RRFEELK++
Sbjct:   23 RLRVNLRLVINRLKLLEKKKTELAQKARKEIADYLAAGKDERARIRVEHIIREDYLVEAMEILELYCDLLLARFGLIQSMKELDSGLAESVSTLIWAAPRLQSEVAELKIVADQLCAKYSKEYGKLCRTNQIGTVNDRLMHKLSVEAPPKILVERYLIEIAKNYNVPYEPDSVVMAEAPPG----------VETDLIDVGFTDDVKKGGPGRGGSGGFTAPVGGPDGTVPMPMPMPMPMPSANTPFSYPLPKGPSDFNGLPMGTYQAFPNIHPPQIPATPPSYESVDDINADKNISSAQIVGPGPKPEASAKLPSRPADNYDNFVLPELPSVPDTLPTASAGASTSASEDIDFDDLSRRFEELKKK 378          
BLAST of IST1 vs. Ensembl Celegans
Match: istr-1 (Increased Sodium Tolerance Related [Source:UniProtKB/TrEMBL;Acc:G5EDV6])

HSP 1 Score: 206.068 bits (523), Expect = 3.073e-61
Identity = 97/179 (54.19%), Postives = 134/179 (74.86%), Query Frame = 1
Query:   61 YNKLKTNLRIVINRLKLLEKKNTEIALKSRKEIADYLSSAKYDRARIKVEMIIRQDYLVEVYELVEMFCDLLLARFGMIECQKEIDPGLEEQIATLIWVTPRLQTDVLELKIIADQLLLKYGREYGLACQSNSLN---NVNEKVMEKLSIKAPPKRLVEQYLVEIAKSFDVPYEPVEDI 588
            Y KLKTNLR+ INRL+LL KK TE+A+K+R EIADY+++ K DRARI+VE IIR+DY+VE +E++EM+CDLLLARFG+IE  K +D G+ E + +++W  PRL TD+ E K I+DQL +KYG+ +  A ++N L     VN K++ KL   APPK LVE+Y++EIA +  VP+ P  D+
Sbjct:    9 YPKLKTNLRLGINRLQLLGKKKTEMAMKARTEIADYIAANKPDRARIRVEHIIREDYVVEAFEILEMYCDLLLARFGLIEQMKTLDDGIAEAVISIMWAAPRLATDIAEFKTISDQLTIKYGKPFAEAARANQLEFPARVNPKIISKLGAAAPPKLLVERYMIEIAAAAGVPFVPDPDV 187          
BLAST of IST1 vs. Ensembl Celegans
Match: istr-1 (Increased Sodium Tolerance Related [Source:UniProtKB/TrEMBL;Acc:G5EDV6])

HSP 1 Score: 206.068 bits (523), Expect = 3.073e-61
Identity = 97/179 (54.19%), Postives = 134/179 (74.86%), Query Frame = 1
Query:   61 YNKLKTNLRIVINRLKLLEKKNTEIALKSRKEIADYLSSAKYDRARIKVEMIIRQDYLVEVYELVEMFCDLLLARFGMIECQKEIDPGLEEQIATLIWVTPRLQTDVLELKIIADQLLLKYGREYGLACQSNSLN---NVNEKVMEKLSIKAPPKRLVEQYLVEIAKSFDVPYEPVEDI 588
            Y KLKTNLR+ INRL+LL KK TE+A+K+R EIADY+++ K DRARI+VE IIR+DY+VE +E++EM+CDLLLARFG+IE  K +D G+ E + +++W  PRL TD+ E K I+DQL +KYG+ +  A ++N L     VN K++ KL   APPK LVE+Y++EIA +  VP+ P  D+
Sbjct:    9 YPKLKTNLRLGINRLQLLGKKKTEMAMKARTEIADYIAANKPDRARIRVEHIIREDYVVEAFEILEMYCDLLLARFGLIEQMKTLDDGIAEAVISIMWAAPRLATDIAEFKTISDQLTIKYGKPFAEAARANQLEFPARVNPKIISKLGAAAPPKLLVERYMIEIAAAAGVPFVPDPDV 187          
BLAST of IST1 vs. Ensembl Celegans
Match: istr-1 (Increased Sodium Tolerance Related [Source:UniProtKB/TrEMBL;Acc:G5EDV6])

HSP 1 Score: 206.068 bits (523), Expect = 4.254e-61
Identity = 97/179 (54.19%), Postives = 134/179 (74.86%), Query Frame = 1
Query:   61 YNKLKTNLRIVINRLKLLEKKNTEIALKSRKEIADYLSSAKYDRARIKVEMIIRQDYLVEVYELVEMFCDLLLARFGMIECQKEIDPGLEEQIATLIWVTPRLQTDVLELKIIADQLLLKYGREYGLACQSNSLN---NVNEKVMEKLSIKAPPKRLVEQYLVEIAKSFDVPYEPVEDI 588
            Y KLKTNLR+ INRL+LL KK TE+A+K+R EIADY+++ K DRARI+VE IIR+DY+VE +E++EM+CDLLLARFG+IE  K +D G+ E + +++W  PRL TD+ E K I+DQL +KYG+ +  A ++N L     VN K++ KL   APPK LVE+Y++EIA +  VP+ P  D+
Sbjct:    9 YPKLKTNLRLGINRLQLLGKKKTEMAMKARTEIADYIAANKPDRARIRVEHIIREDYVVEAFEILEMYCDLLLARFGLIEQMKTLDDGIAEAVISIMWAAPRLATDIAEFKTISDQLTIKYGKPFAEAARANQLEFPARVNPKIISKLGAAAPPKLLVERYMIEIAAAAGVPFVPDPDV 187          
BLAST of IST1 vs. Ensembl Celegans
Match: istr-1 (Increased Sodium Tolerance Related [Source:UniProtKB/TrEMBL;Acc:G5EDV6])

HSP 1 Score: 206.068 bits (523), Expect = 4.254e-61
Identity = 97/179 (54.19%), Postives = 134/179 (74.86%), Query Frame = 1
Query:   61 YNKLKTNLRIVINRLKLLEKKNTEIALKSRKEIADYLSSAKYDRARIKVEMIIRQDYLVEVYELVEMFCDLLLARFGMIECQKEIDPGLEEQIATLIWVTPRLQTDVLELKIIADQLLLKYGREYGLACQSNSLN---NVNEKVMEKLSIKAPPKRLVEQYLVEIAKSFDVPYEPVEDI 588
            Y KLKTNLR+ INRL+LL KK TE+A+K+R EIADY+++ K DRARI+VE IIR+DY+VE +E++EM+CDLLLARFG+IE  K +D G+ E + +++W  PRL TD+ E K I+DQL +KYG+ +  A ++N L     VN K++ KL   APPK LVE+Y++EIA +  VP+ P  D+
Sbjct:    9 YPKLKTNLRLGINRLQLLGKKKTEMAMKARTEIADYIAANKPDRARIRVEHIIREDYVVEAFEILEMYCDLLLARFGLIEQMKTLDDGIAEAVISIMWAAPRLATDIAEFKTISDQLTIKYGKPFAEAARANQLEFPARVNPKIISKLGAAAPPKLLVERYMIEIAAAAGVPFVPDPDV 187          
BLAST of IST1 vs. Ensembl Fly
Match: CG10103 (gene:FBgn0035715 transcript:FBtr0330065)

HSP 1 Score: 219.55 bits (558), Expect = 1.896e-67
Identity = 104/175 (59.43%), Postives = 140/175 (80.00%), Query Frame = 1
Query:   55 PNYNKLKTNLRIVINRLKLLEKKNTEIALKSRKEIADYLSSAKYDRARIKVEMIIRQDYLVEVYELVEMFCDLLLARFGMIECQKEIDPGLEEQIATLIWVTPRLQTDVLELKIIADQLLLKYGREYGLACQSNSLNN-VNEKVMEKLSIKAPPKRLVEQYLVEIAKSFDVPYEP 576
            PNYNKLKTNLR+ +NRLKLLEKK  E+  KSRKEIADYL++ K +RARI+VE IIR+DYLVE  E+VEM+CDLLLARFG+I   KE+D G+ E +A+L+WV PRLQ+D+ ELKII+D  + KYG ++    ++ +  + V+EK+M KL+++APPK LVE YL+ IAK++++ YEP
Sbjct:    6 PNYNKLKTNLRLALNRLKLLEKKKAELTQKSRKEIADYLATGKTERARIRVEHIIREDYLVEAMEMVEMYCDLLLARFGLITQMKELDTGIAEPVASLVWVCPRLQSDIAELKIISDIFVTKYGPQFAEQSRTATGEHYVSEKLMHKLTLQAPPKLLVENYLIAIAKNYNIEYEP 180          
BLAST of IST1 vs. Ensembl Fly
Match: CG10103 (gene:FBgn0035715 transcript:FBtr0330062)

HSP 1 Score: 219.935 bits (559), Expect = 8.049e-67
Identity = 104/175 (59.43%), Postives = 140/175 (80.00%), Query Frame = 1
Query:   55 PNYNKLKTNLRIVINRLKLLEKKNTEIALKSRKEIADYLSSAKYDRARIKVEMIIRQDYLVEVYELVEMFCDLLLARFGMIECQKEIDPGLEEQIATLIWVTPRLQTDVLELKIIADQLLLKYGREYGLACQSNSLNN-VNEKVMEKLSIKAPPKRLVEQYLVEIAKSFDVPYEP 576
            PNYNKLKTNLR+ +NRLKLLEKK  E+  KSRKEIADYL++ K +RARI+VE IIR+DYLVE  E+VEM+CDLLLARFG+I   KE+D G+ E +A+L+WV PRLQ+D+ ELKII+D  + KYG ++    ++ +  + V+EK+M KL+++APPK LVE YL+ IAK++++ YEP
Sbjct:    6 PNYNKLKTNLRLALNRLKLLEKKKAELTQKSRKEIADYLATGKTERARIRVEHIIREDYLVEAMEMVEMYCDLLLARFGLITQMKELDTGIAEPVASLVWVCPRLQSDIAELKIISDIFVTKYGPQFAEQSRTATGEHYVSEKLMHKLTLQAPPKLLVENYLIAIAKNYNIEYEP 180          
BLAST of IST1 vs. Ensembl Fly
Match: CG10103 (gene:FBgn0035715 transcript:FBtr0330063)

HSP 1 Score: 219.55 bits (558), Expect = 8.815e-67
Identity = 104/175 (59.43%), Postives = 140/175 (80.00%), Query Frame = 1
Query:   55 PNYNKLKTNLRIVINRLKLLEKKNTEIALKSRKEIADYLSSAKYDRARIKVEMIIRQDYLVEVYELVEMFCDLLLARFGMIECQKEIDPGLEEQIATLIWVTPRLQTDVLELKIIADQLLLKYGREYGLACQSNSLNN-VNEKVMEKLSIKAPPKRLVEQYLVEIAKSFDVPYEP 576
            PNYNKLKTNLR+ +NRLKLLEKK  E+  KSRKEIADYL++ K +RARI+VE IIR+DYLVE  E+VEM+CDLLLARFG+I   KE+D G+ E +A+L+WV PRLQ+D+ ELKII+D  + KYG ++    ++ +  + V+EK+M KL+++APPK LVE YL+ IAK++++ YEP
Sbjct:    6 PNYNKLKTNLRLALNRLKLLEKKKAELTQKSRKEIADYLATGKTERARIRVEHIIREDYLVEAMEMVEMYCDLLLARFGLITQMKELDTGIAEPVASLVWVCPRLQSDIAELKIISDIFVTKYGPQFAEQSRTATGEHYVSEKLMHKLTLQAPPKLLVENYLIAIAKNYNIEYEP 180          
BLAST of IST1 vs. Ensembl Fly
Match: CG10103 (gene:FBgn0035715 transcript:FBtr0330061)

HSP 1 Score: 219.935 bits (559), Expect = 9.250e-67
Identity = 104/175 (59.43%), Postives = 140/175 (80.00%), Query Frame = 1
Query:   55 PNYNKLKTNLRIVINRLKLLEKKNTEIALKSRKEIADYLSSAKYDRARIKVEMIIRQDYLVEVYELVEMFCDLLLARFGMIECQKEIDPGLEEQIATLIWVTPRLQTDVLELKIIADQLLLKYGREYGLACQSNSLNN-VNEKVMEKLSIKAPPKRLVEQYLVEIAKSFDVPYEP 576
            PNYNKLKTNLR+ +NRLKLLEKK  E+  KSRKEIADYL++ K +RARI+VE IIR+DYLVE  E+VEM+CDLLLARFG+I   KE+D G+ E +A+L+WV PRLQ+D+ ELKII+D  + KYG ++    ++ +  + V+EK+M KL+++APPK LVE YL+ IAK++++ YEP
Sbjct:    6 PNYNKLKTNLRLALNRLKLLEKKKAELTQKSRKEIADYLATGKTERARIRVEHIIREDYLVEAMEMVEMYCDLLLARFGLITQMKELDTGIAEPVASLVWVCPRLQSDIAELKIISDIFVTKYGPQFAEQSRTATGEHYVSEKLMHKLTLQAPPKLLVENYLIAIAKNYNIEYEP 180          
BLAST of IST1 vs. Ensembl Fly
Match: CG10103 (gene:FBgn0035715 transcript:FBtr0330064)

HSP 1 Score: 219.55 bits (558), Expect = 9.283e-67
Identity = 104/175 (59.43%), Postives = 140/175 (80.00%), Query Frame = 1
Query:   55 PNYNKLKTNLRIVINRLKLLEKKNTEIALKSRKEIADYLSSAKYDRARIKVEMIIRQDYLVEVYELVEMFCDLLLARFGMIECQKEIDPGLEEQIATLIWVTPRLQTDVLELKIIADQLLLKYGREYGLACQSNSLNN-VNEKVMEKLSIKAPPKRLVEQYLVEIAKSFDVPYEP 576
            PNYNKLKTNLR+ +NRLKLLEKK  E+  KSRKEIADYL++ K +RARI+VE IIR+DYLVE  E+VEM+CDLLLARFG+I   KE+D G+ E +A+L+WV PRLQ+D+ ELKII+D  + KYG ++    ++ +  + V+EK+M KL+++APPK LVE YL+ IAK++++ YEP
Sbjct:    6 PNYNKLKTNLRLALNRLKLLEKKKAELTQKSRKEIADYLATGKTERARIRVEHIIREDYLVEAMEMVEMYCDLLLARFGLITQMKELDTGIAEPVASLVWVCPRLQSDIAELKIISDIFVTKYGPQFAEQSRTATGEHYVSEKLMHKLTLQAPPKLLVENYLIAIAKNYNIEYEP 180          
BLAST of IST1 vs. Ensembl Zebrafish
Match: ist1 (IST1 factor associated with ESCRT-III [Source:ZFIN;Acc:ZDB-GENE-030131-179])

HSP 1 Score: 238.039 bits (606), Expect = 2.600e-74
Identity = 108/170 (63.53%), Postives = 145/170 (85.29%), Query Frame = 1
Query:   67 KLKTNLRIVINRLKLLEKKNTEIALKSRKEIADYLSSAKYDRARIKVEMIIRQDYLVEVYELVEMFCDLLLARFGMIECQKEIDPGLEEQIATLIWVTPRLQTDVLELKIIADQLLLKYGREYGLACQSNSLNNVNEKVMEKLSIKAPPKRLVEQYLVEIAKSFDVPYEP 576
            +L+ NLR+VINRLKLLEKK TE+A K+RKEIADYLS+ K +RARI+VE IIR+DYLVE  E++E++CDLLL RFG+I+  KE+DPGL+E ++TLIW  PRLQ++V ELKI++DQL  KY +EYG  C++N +  VN+++M KLS++APPK LVE+YL+EIAK+++VPYEP
Sbjct:   10 RLRVNLRLVINRLKLLEKKKTELAQKARKEIADYLSAGKDERARIRVEHIIREDYLVEAMEILELYCDLLLTRFGLIQSMKELDPGLQEAVSTLIWAAPRLQSEVAELKIVSDQLCAKYSKEYGKLCRTNQIGTVNDRLMHKLSVEAPPKILVERYLIEIAKNYNVPYEP 179          
BLAST of IST1 vs. Ensembl Zebrafish
Match: ist1 (IST1 factor associated with ESCRT-III [Source:ZFIN;Acc:ZDB-GENE-030131-179])

HSP 1 Score: 237.654 bits (605), Expect = 4.630e-74
Identity = 108/170 (63.53%), Postives = 145/170 (85.29%), Query Frame = 1
Query:   67 KLKTNLRIVINRLKLLEKKNTEIALKSRKEIADYLSSAKYDRARIKVEMIIRQDYLVEVYELVEMFCDLLLARFGMIECQKEIDPGLEEQIATLIWVTPRLQTDVLELKIIADQLLLKYGREYGLACQSNSLNNVNEKVMEKLSIKAPPKRLVEQYLVEIAKSFDVPYEP 576
            +L+ NLR+VINRLKLLEKK TE+A K+RKEIADYLS+ K +RARI+VE IIR+DYLVE  E++E++CDLLL RFG+I+  KE+DPGL+E ++TLIW  PRLQ++V ELKI++DQL  KY +EYG  C++N +  VN+++M KLS++APPK LVE+YL+EIAK+++VPYEP
Sbjct:   10 RLRVNLRLVINRLKLLEKKKTELAQKARKEIADYLSAGKDERARIRVEHIIREDYLVEAMEILELYCDLLLTRFGLIQSMKELDPGLQEAVSTLIWAAPRLQSEVAELKIVSDQLCAKYSKEYGKLCRTNQIGTVNDRLMHKLSVEAPPKILVERYLIEIAKNYNVPYEP 179          
BLAST of IST1 vs. Ensembl Xenopus
Match: ist1 (increased sodium tolerance 1 homolog [Source:NCBI gene;Acc:100124797])

HSP 1 Score: 257.299 bits (656), Expect = 7.596e-82
Identity = 154/332 (46.39%), Postives = 208/332 (62.65%), Query Frame = 1
Query:   67 KLKTNLRIVINRLKLLEKKNTEIALKSRKEIADYLSSAKYDRARIKVEMIIRQDYLVEVYELVEMFCDLLLARFGMIECQKEIDPGLEEQIATLIWVTPRLQTDVLELKIIADQLLLKYGREYGLACQSNSLNNVNEKVMEKLSIKAPPKRLVEQYLVEIAKSFDVPYEPVEDIDPPATWNPNDFYAPVAPNLIDF-LPEKPPLVNPNAAYNPGVLPHPMYDPTMQPPYPVMNNGPFPYPHKKPMSDIDQPMSLPPKYEEFPNDG----SSSQESAPPLPPDRT---NDLFLPEIPT------DQNNTNQTPGSGSVDFDDLNRRFEELKRR 1020
            +L+ NLR+VINRLKLLEKK TE+A K+RKEIADYLS+ K +RARI+VE IIR+DYLVE  E++E++CDLLLARFG+I+  KE+DPGL E ++TLIW  PRLQT+V ELKI+ADQL  KY +EYG  C++N +  VNE++M KLS++APPK LVE+YL+EIAK+++VPYEP   +         +  A V  +LID    +               +P PM    MQ P P +   PF YP   P   +    ++   Y+ F N           + PP+   RT   ++  LPE+P+        +    T  S  +DFDDL+RRFEELK++
Sbjct:   10 RLRVNLRLVINRLKLLEKKKTELAQKARKEIADYLSTGKDERARIRVEHIIREDYLVEAMEILELYCDLLLARFGLIQSMKELDPGLGEAVSTLIWAAPRLQTEVTELKIVADQLCAKYSKEYGKLCRTNQIGTVNERLMHKLSVEAPPKILVERYLIEIAKNYNVPYEPDAVV-------MAEVPAGVEADLIDVGFTDDGRKGGSGGGGGGFGVPLPMVS-AMQMPTPTI---PFAYP--APGGQVFSGATV-GIYQPFGNLNPPPMGGPGNNVPPVAKPRTKTPDNFVLPELPSVPDTLPATSVGTSTSTSEDIDFDDLSRRFEELKKK 327          
BLAST of IST1 vs. Ensembl Xenopus
Match: ist1 (increased sodium tolerance 1 homolog [Source:NCBI gene;Acc:100124797])

HSP 1 Score: 257.684 bits (657), Expect = 1.038e-81
Identity = 157/349 (44.99%), Postives = 213/349 (61.03%), Query Frame = 1
Query:   67 KLKTNLRIVINRLKLLEKKNTEIALKSRKEIADYLSSAKYDRARIKVEMIIRQDYLVEVYELVEMFCDLLLARFGMIECQKEIDPGLEEQIATLIWVTPRLQTDVLELKIIADQLLLKYGREYGLACQSNSLNNVNEKVMEKLSIKAPPKRLVEQYLVEIAKSFDVPYEPVEDIDPPATWNPNDFYAPVAPNLIDF-LPEKPPLVNPNAAYNPGVLPHPMYDPTMQPPYPVMNNGPFPYPHKK---------------------PMSDIDQPMSLPPKYEEFPNDGSSSQESAPPLPPDRT---NDLFLPEIPT------DQNNTNQTPGSGSVDFDDLNRRFEELKRR 1020
            +L+ NLR+VINRLKLLEKK TE+A K+RKEIADYLS+ K +RARI+VE IIR+DYLVE  E++E++CDLLLARFG+I+  KE+DPGL E ++TLIW  PRLQT+V ELKI+ADQL  KY +EYG  C++N +  VNE++M KLS++APPK LVE+YL+EIAK+++VPYEP   +         +  A V  +LID    +               +P PM    MQ P P +   PF YP                        PM+D+  P+S P  +    + G+    + PP+   RT   ++  LPE+P+        +    T  S  +DFDDL+RRFEELK++
Sbjct:   10 RLRVNLRLVINRLKLLEKKKTELAQKARKEIADYLSTGKDERARIRVEHIIREDYLVEAMEILELYCDLLLARFGLIQSMKELDPGLGEAVSTLIWAAPRLQTEVTELKIVADQLCAKYSKEYGKLCRTNQIGTVNERLMHKLSVEAPPKILVERYLIEIAKNYNVPYEPDAVVM-------AEVPAGVEADLIDVGFTDDGRKGGSGGGGGGFGVPLPMVS-AMQMPTPTI---PFAYPAPGGQVFSGATVGIYQPFGNLNPPPMADL-HPISPPTGWAISGSPGN----NVPPVAKPRTKTPDNFVLPELPSVPDTLPATSVGTSTSTSEDIDFDDLSRRFEELKKK 342          
BLAST of IST1 vs. Ensembl Xenopus
Match: ist1 (increased sodium tolerance 1 homolog [Source:NCBI gene;Acc:100124797])

HSP 1 Score: 252.292 bits (643), Expect = 2.210e-79
Identity = 160/360 (44.44%), Postives = 215/360 (59.72%), Query Frame = 1
Query:   67 KLKTNLRIVINRLKLLEKKNTEIALKSRKEIADYLSSAKYDRARIKVEMIIRQDYLVEVYELVEMFCDLLLARFGMIECQKEIDPGLEEQIATLIWVTPRLQTDVLELKIIADQLLLKYGREYGLACQSNSLNNVNEKVMEKLSIKAPPKRLVEQYLVEIAKSFDVPYEPVEDIDPPATWNPNDFYAPVAPNLIDF-LPEKPPLVNPNAAYNPGVLPHPMYDPTMQPPYPVMNNGPFPYP---HKKPMS----DIDQPMS----------------LPPKYEEFPNDG---------SSSQESAPPLPPDRT---NDLFLPEIPT------DQNNTNQTPGSGSVDFDDLNRRFEELKRR 1020
            +L+ NLR+VINRLKLLEKK TE+A K+RKEIADYLS+ K +RARI+VE IIR+DYLVE  E++E++CDLLLARFG+I+  KE+DPGL E ++TLIW  PRLQT+V ELKI+ADQL  KY +EYG  C++N +  VNE++M KLS++APPK LVE+YL+EIAK+++VPYEP   +         +  A V  +LID    +               +P PM    MQ P P +   PF YP    + P+S     I QP                  +PP Y+   N G         +    + PP+   RT   ++  LPE+P+        +    T  S  +DFDDL+RRFEELK++
Sbjct:   10 RLRVNLRLVINRLKLLEKKKTELAQKARKEIADYLSTGKDERARIRVEHIIREDYLVEAMEILELYCDLLLARFGLIQSMKELDPGLGEAVSTLIWAAPRLQTEVTELKIVADQLCAKYSKEYGKLCRTNQIGTVNERLMHKLSVEAPPKILVERYLIEIAKNYNVPYEPDAVV-------MAEVPAGVEADLIDVGFTDDGRKGGSGGGGGGFGVPLPMVS-AMQMPTPTI---PFAYPAPGGQDPVSGATVGIYQPFGNLNPPPMGGMPPPVPSMPPTYDTIDNFGPQANNLPPTAGPGNNVPPVAKPRTKTPDNFVLPELPSVPDTLPATSVGTSTSTSEDIDFDDLSRRFEELKKK 358          
BLAST of IST1 vs. Ensembl Xenopus
Match: ENSXETT00000012180.1 (uncharacterized loc100216037 [Source:NCBI gene;Acc:100216037])

HSP 1 Score: 236.498 bits (602), Expect = 1.656e-73
Identity = 149/359 (41.50%), Postives = 208/359 (57.94%), Query Frame = 1
Query:   67 KLKTNLRIVINRLKLLEKKNTEIALKSRKEIADYLSSAKYDRARIKVEMIIRQDYLVEVYELVEMFCDLLLARFGMIECQKEIDPGLEEQIATLIWVTPRLQTDVLELKIIADQLLLKYGREYGLACQSNSLNNVNEKVMEKLSIKAPPKRLVEQYLVEIAKSFDVPYEPVEDIDPPATWNPNDFYAPVAPNLIDFLPEKPPLV-------------------NPNAAYNPGVLPHP---MYDPT--MQPPYPVMNNGPFPYPHKKPMSDIDQPMSLPPKYEEFPNDGSSSQESAPPL-------PPDRTNDLFLPEIPTDQNNTNQTPGSGS----------VDFDDLNRRFEELKRR 1020
            +L+ NLR+ INRLKLLEKK TE+ALK+RKEIADYLS  K +RARI+VE IIR+DYLVE  E++E++CDLLLARFG+I+  +E+DPGL E ++TLIW  PRLQ++V ELKI+A QL  KY +EYG  C++N +  V++K+M KL   APPK LVE+YL+EIAK++ VPYEP   I   A       ++ V P++I F+ +                        NPN   +P   P P   +Y+P   +QPP           P  K +  +     +PP      N G  S  S P +        P + N+L LP++P+       +P  GS          +DF+DL++R + LK++
Sbjct:   10 RLRVNLRLAINRLKLLEKKKTEMALKARKEIADYLSCRKDERARIRVEHIIREDYLVEAMEILELYCDLLLARFGLIQSMRELDPGLAEAVSTLIWAAPRLQSEVSELKIVASQLCHKYSKEYGNLCRTNQIGTVSDKLMNKLGTAAPPKILVEKYLIEIAKNYKVPYEPDAVIMGEAPT-----FSEVDPSIIGFVNDDKKGGPGNGGGFGGGDFRINQVYPNPN---DPKSFPDPSVGIYEPCAFLQPP-----------PRGKMIPHVPD---IPPSSNMMNNKGGDSGAS-PAMNSGQGENVPGKYNNLPLPKLPS----VPSSPAHGSPPSDPSPYEDIDFEDLSKRLDNLKKK 341          
BLAST of IST1 vs. Ensembl Xenopus
Match: ist1 (increased sodium tolerance 1 homolog [Source:NCBI gene;Acc:100124797])

HSP 1 Score: 203.756 bits (517), Expect = 4.780e-61
Identity = 146/360 (40.56%), Postives = 195/360 (54.17%), Query Frame = 1
Query:   67 KLKTNLRIVINRLKLLEKKNTEIALKSRKEIADYLSSAKYDRARIKVEMIIRQDYLVEVYELVEMFCDLLLARFGMIECQKEIDPGLEEQIATLIWVTPRLQTDVLELKIIADQLLLKYGREYGLACQSNSLNNVNEKVMEKLSIKAPPKRLVEQYLVEIAKSFDVPYEPVEDIDPPATWNPNDFYAPVAPNLIDF-LPEKPPLVNPNAAYNPGVLPHPMYDPTMQPPYPVMNNGPFPYP---HKKPMS----DIDQPMS----------------LPPKYEEFPNDG---------SSSQESAPPLPPDRT---NDLFLPEIPT------DQNNTNQTPGSGSVDFDDLNRRFEELKRR 1020
            +L+ NLR+VINRLKLLEKK TE+A K+RKEIADYLS+ K +RARI+VE IIR+DYLVE  E++E++CDLLLARFG+I+  KE+DPGL E ++TLIW  PRLQT+V ELKI+                            M KLS++APPK LVE+YL+EIAK+++VPYEP   +         +  A V  +LID    +               +P PM    MQ P P +   PF YP    + P+S     I QP                  +PP Y+   N G         +    + PP+   RT   ++  LPE+P+        +    T  S  +DFDDL+RRFEELK++
Sbjct:   10 RLRVNLRLVINRLKLLEKKKTELAQKARKEIADYLSTGKDERARIRVEHIIREDYLVEAMEILELYCDLLLARFGLIQSMKELDPGLGEAVSTLIWAAPRLQTEVTELKIL----------------------------MHKLSVEAPPKILVERYLIEIAKNYNVPYEPDAVV-------MAEVPAGVEADLIDVGFTDDGRKGGSGGGGGGFGVPLPMVS-AMQMPTPTI---PFAYPAPGGQDPVSGATVGIYQPFGNLNPPPMGGMPPPVPSMPPTYDTIDNFGPQANNLPPTAGPGNNVPPVAKPRTKTPDNFVLPELPSVPDTLPATSVGTSTSTSEDIDFDDLSRRFEELKKK 330          
BLAST of IST1 vs. Ensembl Mouse
Match: Ist1 (increased sodium tolerance 1 homolog (yeast) [Source:MGI Symbol;Acc:MGI:1919205])

HSP 1 Score: 247.284 bits (630), Expect = 1.214e-77
Identity = 154/359 (42.90%), Postives = 205/359 (57.10%), Query Frame = 1
Query:   67 KLKTNLRIVINRLKLLEKKNTEIALKSRKEIADYLSSAKYDRARIKVEMIIRQDYLVEVYELVEMFCDLLLARFGMIECQKEIDPGLEEQIATLIWVTPRLQTDVLELKIIADQLLLKYGREYGLACQSNSLNNVNEKVMEKLSIKAPPKRLVEQYLVEIAKSFDVPYEPVEDIDPPATWNPNDFYAPVAPNLIDFLPEKPPLVNPNAAYNPGVLPHPMYDP-----TMQPPYPVMNNGPFPYPHKKPMSDID----------------QPMSLPPKYEEFPN-DGSSSQESAPPL-------------PPDRTNDLFLPEIPT------DQNNTNQTPGSGSVDFDDLNRRFEELKRR 1020
            +L+ NLR+VINRLKLLEKK TE+A K+RKEIADYL++ K +RARI+VE IIR+DYLVE  E++E++CDLLLARFG+I+  KE+D GL E ++TLIW  PRLQ++V ELKI+ADQL  KY +EYG  C++N +  VN+++M KLS++APPK LVE+YL+EIAK+++VPYEP   +   A          V  +LID                 G    P+  P        P      N PF YP  K  SD                  Q  + PP YE   + +G  +  SA  +             P D  N   LPE+P+        +    T  S  +DFDDL+RRFEELK++
Sbjct:   10 RLRVNLRLVINRLKLLEKKKTELAQKARKEIADYLAAGKDERARIRVEHIIREDYLVEAMEILELYCDLLLARFGLIQSMKELDSGLAESVSTLIWAAPRLQSEVAELKIVADQLCAKYSKEYGKLCRTNQIGTVNDRLMHKLSVEAPPKILVERYLIEIAKNYNVPYEPDSVVMAEAPVG-------VETDLIDVGFTDDVKKGGPGRGGGGGFTAPVGGPDGIVPMPMPMPMPSPNAPFAYPLPKGPSDFSGLPVGTYQAFPNIHPPQIPATPPSYESVDDINGDKTVSSAQIVGPKPEAPAKPPSRPVDNYNTFVLPELPSVPDTLPTASAGASTSASEDIDFDDLSRRFEELKKK 361          
BLAST of IST1 vs. UniProt/SwissProt
Match: sp|Q9CX00|IST1_MOUSE (IST1 homolog OS=Mus musculus OX=10090 GN=Ist1 PE=1 SV=1)

HSP 1 Score: 247.284 bits (630), Expect = 8.488e-77
Identity = 154/359 (42.90%), Postives = 205/359 (57.10%), Query Frame = 1
Query:   67 KLKTNLRIVINRLKLLEKKNTEIALKSRKEIADYLSSAKYDRARIKVEMIIRQDYLVEVYELVEMFCDLLLARFGMIECQKEIDPGLEEQIATLIWVTPRLQTDVLELKIIADQLLLKYGREYGLACQSNSLNNVNEKVMEKLSIKAPPKRLVEQYLVEIAKSFDVPYEPVEDIDPPATWNPNDFYAPVAPNLIDFLPEKPPLVNPNAAYNPGVLPHPMYDP-----TMQPPYPVMNNGPFPYPHKKPMSDID----------------QPMSLPPKYEEFPN-DGSSSQESAPPL-------------PPDRTNDLFLPEIPT------DQNNTNQTPGSGSVDFDDLNRRFEELKRR 1020
            +L+ NLR+VINRLKLLEKK TE+A K+RKEIADYL++ K +RARI+VE IIR+DYLVE  E++E++CDLLLARFG+I+  KE+D GL E ++TLIW  PRLQ++V ELKI+ADQL  KY +EYG  C++N +  VN+++M KLS++APPK LVE+YL+EIAK+++VPYEP   +   A          V  +LID                 G    P+  P        P      N PF YP  K  SD                  Q  + PP YE   + +G  +  SA  +             P D  N   LPE+P+        +    T  S  +DFDDL+RRFEELK++
Sbjct:   10 RLRVNLRLVINRLKLLEKKKTELAQKARKEIADYLAAGKDERARIRVEHIIREDYLVEAMEILELYCDLLLARFGLIQSMKELDSGLAESVSTLIWAAPRLQSEVAELKIVADQLCAKYSKEYGKLCRTNQIGTVNDRLMHKLSVEAPPKILVERYLIEIAKNYNVPYEPDSVVMAEAPVG-------VETDLIDVGFTDDVKKGGPGRGGGGGFTAPVGGPDGIVPMPMPMPMPSPNAPFAYPLPKGPSDFSGLPVGTYQAFPNIHPPQIPATPPSYESVDDINGDKTVSSAQIVGPKPEAPAKPPSRPVDNYNTFVLPELPSVPDTLPTASAGASTSASEDIDFDDLSRRFEELKKK 361          
BLAST of IST1 vs. UniProt/SwissProt
Match: sp|P53990|IST1_HUMAN (IST1 homolog OS=Homo sapiens OX=9606 GN=IST1 PE=1 SV=1)

HSP 1 Score: 246.514 bits (628), Expect = 2.313e-76
Identity = 159/364 (43.68%), Postives = 213/364 (58.52%), Query Frame = 1
Query:   67 KLKTNLRIVINRLKLLEKKNTEIALKSRKEIADYLSSAKYDRARIKVEMIIRQDYLVEVYELVEMFCDLLLARFGMIECQKEIDPGLEEQIATLIWVTPRLQTDVLELKIIADQLLLKYGREYGLACQSNSLNNVNEKVMEKLSIKAPPKRLVEQYLVEIAKSFDVPYEP---VEDIDPPATWNPNDFYAPVAPNLID--FLPEKPPLVNPNAAYNPGVLPHPMYDPTMQPPYPVMN---NGPFPYPHKKPMSDIDQ-PM---------------SLPPKYEEFPN-----DGSSSQ-----------ESAPPLPPDRTNDLFLPEIPT------DQNNTNQTPGSGSVDFDDLNRRFEELKRR 1020
            +L+ NLR+VINRLKLLEKK TE+A K+RKEIADYL++ K +RARI+VE IIR+DYLVE  E++E++CDLLLARFG+I+  KE+D GL E ++TLIW  PRLQ++V ELKI+ADQL  KY +EYG  C++N +  VN+++M KLS++APPK LVE+YL+EIAK+++VPYEP   V    PP           V  +LID  F  +                P    D T+  P P+     N PF YP  K  SD +  PM               + PP YE   +     + SS+Q              P  P D  ++  LPE+P+        +    T  S  +DFDDL+RRFEELK++
Sbjct:   10 RLRVNLRLVINRLKLLEKKKTELAQKARKEIADYLAAGKDERARIRVEHIIREDYLVEAMEILELYCDLLLARFGLIQSMKELDSGLAESVSTLIWAAPRLQSEVAELKIVADQLCAKYSKEYGKLCRTNQIGTVNDRLMHKLSVEAPPKILVERYLIEIAKNYNVPYEPDSVVMAEAPPG----------VETDLIDVGFTDDVKKGGPGRGGSGGFTAPVGGPDGTVPMPMPMPMPSANTPFSYPLPKGPSDFNGLPMGTYQAFPNIHPPQIPATPPSYESVDDINADKNISSAQIVGPGPKPEASAKLPSRPADNYDNFVLPELPSVPDTLPTASAGASTSASEDIDFDDLSRRFEELKKK 363          
BLAST of IST1 vs. UniProt/SwissProt
Match: sp|Q3ZBV1|IST1_BOVIN (IST1 homolog OS=Bos taurus OX=9913 GN=IST1 PE=2 SV=1)

HSP 1 Score: 246.128 bits (627), Expect = 3.224e-76
Identity = 152/364 (41.76%), Postives = 210/364 (57.69%), Query Frame = 1
Query:   67 KLKTNLRIVINRLKLLEKKNTEIALKSRKEIADYLSSAKYDRARIKVEMIIRQDYLVEVYELVEMFCDLLLARFGMIECQKEIDPGLEEQIATLIWVTPRLQTDVLELKIIADQLLLKYGREYGLACQSNSLNNVNEKVMEKLSIKAPPKRLVEQYLVEIAKSFDVPYEP---VEDIDPPATWNPNDFYAPVAPNLID--FLPEKPPLVNPNAAYNPGVLPHPMYDPTM---QPPYPVMNNGPFPYPHKKPMSDID----------------QPMSLPPKYEEFPNDGSSSQESAPPLP----------------PDRTNDLFLPEIPTDQNNT-NQTPGSGS-----VDFDDLNRRFEELKRR 1020
            +L+ NLR+VINRLKLLEKK TE+A K+RKEIADYL++ K +RARI+VE IIR+DYLVE  E++E++CDLLLARFG+I+  KE+D GL E ++TLIW  PRLQ++V ELKI+ADQL  KY +EYG  C++N +  VN+++M KLS++APPK LVE+YL+EIAK+++VPYEP   V    PP           V  +LID  F  +                P    D T+    P      N PF YP  K  SD +                Q  + PP YE   +  +    S+  +                  +  ++  LPE+P+  +     +PG+ +     +DFDDL+RRFEELK++
Sbjct:   10 RLRVNLRLVINRLKLLEKKKTELAQKARKEIADYLAAGKDERARIRVEHIIREDYLVEAMEILELYCDLLLARFGLIQSMKELDSGLAESVSTLIWAAPRLQSEVAELKIVADQLCAKYSKEYGKLCRTNQIGTVNDRLMHKLSVEAPPKILVERYLIEIAKNYNVPYEPDSVVMAEAPPG----------VETDLIDVGFTDDVKKGGPGRGGGGGFTAPVGGPDGTVPMPMPMPMPSPNTPFSYPLPKGPSDFNGLPVGTYQAFPNIHPPQIPATPPSYESVDDINADKNVSSTQIVGPGPKPEPPAKPASRLTETYDNFVLPELPSVPDTLPTASPGANTSASEDIDFDDLSRRFEELKKK 363          
BLAST of IST1 vs. UniProt/SwissProt
Match: sp|Q568Z6|IST1_RAT (IST1 homolog OS=Rattus norvegicus OX=10116 GN=Ist1 PE=2 SV=1)

HSP 1 Score: 245.743 bits (626), Expect = 3.766e-76
Identity = 153/363 (42.15%), Postives = 204/363 (56.20%), Query Frame = 1
Query:   67 KLKTNLRIVINRLKLLEKKNTEIALKSRKEIADYLSSAKYDRARIKVEMIIRQDYLVEVYELVEMFCDLLLARFGMIECQKEIDPGLEEQIATLIWVTPRLQTDVLELKIIADQLLLKYGREYGLACQSNSLNNVNEKVMEKLSIKAPPKRLVEQYLVEIAKSFDVPYEPVEDIDPPATWNPNDFYAPVAPNLID--FLPEKPPLVNPNAAYNPGVLPHPMYDPT-------MQPPYPVMNNGPFPYPHKKPMSDID----------------QPMSLPPKYEEFPNDGSSSQESAPPL--------------PPDRTNDLFLPEIPT------DQNNTNQTPGSGSVDFDDLNRRFEELKRR 1020
            +L+ NLR+VINRLKLLEKK TE+A K+RKEIADYL++ K +RARI+VE IIR+DYLVE  E++E++CDLLLARFG+I+  KE+D GL E ++TLIW  PRLQ++V ELKI+ADQL  KY +EYG  C++N +  VN+++M KLS++APPK LVE+YL+EIAK+++VPYEP   +   A          V  +LID  F  +                P    D T         P      N PF YP  K  SD                  Q  + PP YE   +  +    S+  +              P D  N   LPE+P+        +    T  S  +DFDDL+RRFEELK++
Sbjct:   10 RLRVNLRLVINRLKLLEKKKTELAQKARKEIADYLAAGKDERARIRVEHIIREDYLVEAMEILELYCDLLLARFGLIQSMKELDSGLAESVSTLIWAAPRLQSEVAELKIVADQLCAKYSKEYGKLCRTNQIGTVNDRLMHKLSVEAPPKILVERYLIEIAKNYNVPYEPDSVVMAEAPVG-------VETDLIDVGFTDDVKKGGPGRGGGGGFTAPVGAPDGTMPMPMPMPMPMPSPSPNAPFAYPLPKGPSDFSGLPVGTYQAFPNIHPPQIPATPPSYESVDDINADKNVSSAQIVGPKPEAPAKPPSRPVDNYNTFVLPELPSVPDTLPTASAGASTSASEDIDFDDLSRRFEELKKK 365          
BLAST of IST1 vs. UniProt/SwissProt
Match: sp|Q5R6G8|IST1_PONAB (IST1 homolog OS=Pongo abelii OX=9601 GN=IST1 PE=2 SV=1)

HSP 1 Score: 242.276 bits (617), Expect = 8.280e-75
Identity = 156/364 (42.86%), Postives = 208/364 (57.14%), Query Frame = 1
Query:   67 KLKTNLRIVINRLKLLEKKNTEIALKSRKEIADYLSSAKYDRARIKVEMIIRQDYLVEVYELVEMFCDLLLARFGMIECQKEIDPGLEEQIATLIWVTPRLQTDVLELKIIADQLLLKYGREYGLACQSNSLNNVNEKVMEKLSIKAPPKRLVEQYLVEIAKSFDVPYEP---VEDIDPPATWNPNDFYAPVAPNLIDFLPEKPPLVNPNAAYNPGVLPHPMYDP-----TMQPPYPVMNNGPFPYPHKKPMSDIDQ-PM---------------SLPPKYEEFPN-----DGSSSQ-----------ESAPPLPPDRTNDLFLPEIPT------DQNNTNQTPGSGSVDFDDLNRRFEELKRR 1020
            +L+ NLR+VINRLKLLEKK TE+A K+RKEIADYL++ K +RARI+VE IIR+DYLVE  E++E++CDLLLARFG+I+  KE+D GL E ++TLIW  PRLQ++V ELKI+ADQL  KY + YG  C++N +  VN+++M KLS++APPK LVE+YL+EIAK+++VPYEP   V    PP           V  +LID                 G    P+  P        P      N PF YP  K  SD +  PM               + PP YE   +     + SS+Q              P  P D  ++  LPE+P+        +    T  S  +DFDDL+RRFEELK++
Sbjct:   10 RLRVNLRLVINRLKLLEKKKTELAQKARKEIADYLAAGKDERARIRVEHIIREDYLVEAMEILELYCDLLLARFGLIQSMKELDSGLAESVSTLIWAAPRLQSEVAELKIVADQLCAKYSKGYGKLCRTNQIGTVNDRLMHKLSVEAPPKILVERYLIEIAKNYNVPYEPDSVVMAEAPPG----------VETDLIDVGFTDDVKKGGPGRGGGGGFTAPVGGPEGTVPMPMPMPMPSANTPFSYPLPKGPSDFNGLPMGTYQAFPIIHPPQIPATPPSYESVDDINADKNISSAQIVGPGPKPEASAKLPSRPADNYDNFVLPELPSVPDTLPTASAGASTSASEDIDFDDLSRRFEELKKK 363          
BLAST of IST1 vs. TrEMBL
Match: A0A0B6ZH11 (Uncharacterized protein OS=Arion vulgaris OX=1028688 GN=ORF61596 PE=4 SV=1)

HSP 1 Score: 284.648 bits (727), Expect = 5.297e-89
Identity = 170/358 (47.49%), Postives = 218/358 (60.89%), Query Frame = 1
Query:   55 PNYNKLKTNLRIVINRLKLLEKKNTEIALKSRKEIADYLSSAKYDRARIKVEMIIRQDYLVEVYELVEMFCDLLLARFGMIECQKEIDPGLEEQIATLIWVTPRLQTDVLELKIIADQLLLKYGREYGLACQSNSLNNVNEKVMEKLSIKAPPKRLVEQYLVEIAKSFDVPYEPVEDIDPPATWNP---------NDFYAPV-------------APNLIDFLPEKPPLVNPNAAYNPGV---------LPHPMYDPTMQPPYPVMNNGPFPYPHKKPMSDIDQPMSLPPKYEEFPNDGSSSQESAPPLPPDRTNDLFLPEIPTDQNNT-----NQTPGSGSVDFDDLNRRFEELKRR 1020
            PNY KLKTN+R++INRLKLLEKK TE+ALKSRKEIADY+S+ K DRARI+VE IIR+DYLVE  EL+EM+CDLLLARFG+I+ QKE+DPGLEE IAT+IW TPRLQ DV EL+ + D+   KYG E+   C+ N  +NV+EKV+ KLS++APPK LVE Y+VEIAK+++VP+EP    +P AT++           DF A               AP    + P  P +  P+  Y P           +PH  Y+     PYP +  G     H  P       +  PPK          +  S P +P  +  D+F PE+PT  +NT     N   GS  V+FDDLNRRFEELK++
Sbjct:    6 PNYTKLKTNMRLIINRLKLLEKKKTEMALKSRKEIADYISAGKEDRARIRVEHIIREDYLVEAMELLEMYCDLLLARFGLIQTQKELDPGLEESIATIIWATPRLQADVQELRSVTDEFTKKYGPEFSQECRGNKRSNVSEKVIHKLSVQAPPKALVEHYMVEIAKTYNVPFEP----EPSATFDNELSANMNLLTDFDADTKNQGWGGPNGGIGAPQPHSYPP--PSVSVPHLTYTPASANVPSLSTDMPHGGYN-----PYPQIPPGYNTEAHSAPPGPQVNQLYGPPK------PARRTGPSNPAVPSSKGVDVF-PELPTVPSNTLPDLGNSVGGSDDVNFDDLNRRFEELKKK 345          
BLAST of IST1 vs. TrEMBL
Match: V4CNK7 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_177795 PE=4 SV=1)

HSP 1 Score: 282.337 bits (721), Expect = 6.280e-88
Identity = 170/358 (47.49%), Postives = 214/358 (59.78%), Query Frame = 1
Query:   58 NYNKLKTNLRIVINRLKLLEKKNTEIALKSRKEIADYLSSAKYDRARIKVEMIIRQDYLVEVYELVEMFCDLLLARFGMIECQKEIDPGLEEQIATLIWVTPRLQTDVLELKIIADQLLLKYGREYGLACQSNSLNNVNEKVMEKLSIKAPPKRLVEQYLVEIAKSFDVPYEPVEDIDPPATWNPNDFYAPVAPNLIDFLPEKPPLVNPNAAYNPGVLPHPMYD---PTMQPPYPVMNNGPFP-YPHKKP------------------MSDIDQPMSLPPKYEEF------PNDGSSSQESAPPLPPDRTNDLFLPEIPTDQNNT---------NQTPGSGSVDFDDLNRRFEELKRR 1020
            NYNKLKTNLR+ INRLKLLEKK TE+ALK+RKEIADY+S  K DRARI+VE I+R+DYLVE  EL+EM+CDLLLARFG+I+ QKEIDPGLEE IA+LIW TPRLQ DV E K IAD+   KYG+E+G AC++N+LNNV+EKVM K+S++APPK L+E+Y+VEIAK+++VP+EP       A+    D        LIDF   K    +         +  P  D    +  P  P   + P P YP +                       + Q  + PP Y +F      P +      SAPP  P    D F PE+PT  NNT           + G   V+FDDL RRFE LK++
Sbjct:    7 NYNKLKTNLRLTINRLKLLEKKKTELALKARKEIADYISGGKDDRARIRVEHIVREDYLVEAMELLEMYCDLLLARFGLIQTQKEIDPGLEEAIASLIWATPRLQADVQEFKPIADEFTAKYGKEFGQACRTNALNNVSEKVMHKMSVQAPPKTLIERYMVEIAKTYNVPFEP------DASVMAQDEIFAAENMLIDFGDGKKGNNSGGGPSGGMGVMQPGADNSACSAGPCGPAGASAPMPPYPQQNSNRAPPPLPNVPPANSENVYHTLYQDEAPPPDYNQFKQPNGMPPNNQVYDNSAPP--PGFKMDSF-PELPTVPNNTLPDVGNSVGGTSAGGDDVNFDDLTRRFEALKKK 355          
BLAST of IST1 vs. TrEMBL
Match: A0A0B7B5X8 (Uncharacterized protein OS=Arion vulgaris OX=1028688 GN=ORF165229 PE=4 SV=1)

HSP 1 Score: 282.722 bits (722), Expect = 7.404e-88
Identity = 175/371 (47.17%), Postives = 227/371 (61.19%), Query Frame = 1
Query:   55 PNYNKLKTNLRIVINRLKLLEKKNTEIALKSRKEIADYLSSAKYDRARIKVEMIIRQDYLVEVYELVEMFCDLLLARFGMIECQKEIDPGLEEQIATLIWVTPRLQTDVLELKIIADQLLLKYGREYGLACQSNSLNNVNEKVMEKLSIKAPPKRLVEQYLVEIAKSFDVPYEPVEDIDPPATWNPNDFYAPVAPNLIDFLPEKPPLVNPNAAYN--------------------PGVLPHPMY-DPTMQPPYPV----------MNNGPF--PYPHKKPM--SDIDQPMSLPPKYEEFPNDGSSSQ-----ESAPPLPPDRTNDLFLPEIPTDQNNT----NQTPGSGS-----VDFDDLNRRFEELKRR 1020
            PNY KLKTNLR++INRLKLLEKK TE+ALKSRKEIADY+S+AK DRARI+VE IIR+DYLVE  EL+EM+CDLLLARFG+I+ QKE+DPGLEE IAT+IW TPRLQ DV ELK + ++  +KY +E+  AC+ N L+NVNEKVM KLS++AP K LVE+Y+VEIAK+++VP+ P  D+    +   N+        LI+   +      PN   +                    P  L +P Y  P  Q PYP           M +G +   YP++ P   S I      PP +++  N    ++      SAPP P ++ ND   PE+PT  NNT      + G GS     VDFDDL RRFE+LK++
Sbjct:    6 PNYTKLKTNLRLIINRLKLLEKKKTEMALKSRKEIADYISAAKDDRARIRVEHIIREDYLVEAMELLEMYCDLLLARFGLIQTQKELDPGLEEAIATIIWATPRLQADVQELKAVTEEFTVKYSKEFAQACRGNQLSNVNEKVMHKLSVQAPAKELVERYMVEIAKTYNVPFVP--DV----SVMLNEELLSSENLLINLDADDKNKGRPNGGGSGHGGGSGHGGGGGHGGGIGAPQPLNYPPYPGPVQQAPYPTAGMPPPLPNHMPHGSYNGGYPNQPPAYNSGIHSAPPGPPNFDDLYNPQKPAKPPGPSVSAPPAPQNKGNDDMFPELPTVPNNTLPDLGNSVGGGSAGGDDVDFDDLTRRFEQLKKK 370          
BLAST of IST1 vs. TrEMBL
Match: A0A2T7P5X9 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_11413 PE=4 SV=1)

HSP 1 Score: 280.411 bits (716), Expect = 3.069e-87
Identity = 175/363 (48.21%), Postives = 218/363 (60.06%), Query Frame = 1
Query:   55 PNYNKLKTNLRIVINRLKLLEKKNTEIALKSRKEIADYLSSAKYDRARIKVEMIIRQDYLVEVYELVEMFCDLLLARFGMIECQKEIDPGLEEQIATLIWVTPRLQTDVLELKIIADQLLLKYGREYGLACQSNSLNNVNEKVMEKLSIKAPPKRLVEQYLVEIAKSFDVPYEPVEDIDPPATWNPNDFYAPVAPNLIDFLPEKPPLVNPNAAYNPGVLPHPM-----------------YDPTMQPPYPVMNNGPFPYPHKKPMS------DI-DQPMSL---PPKYE-----EFPNDGSSSQESAPPLPPDRTNDLFLPEIPTDQNNT---------NQTPGSGSVDFDDLNRRFEELKRR 1020
            PNY+KLKTNLR+ INRLKLLEKK TEIALKSRKEIADY+S  K DRARI+VE IIR+DYLVE  EL+EM+CDLLLARFG+I+ QKEIDPGLEE IATLIW TPRLQTDV ELK IAD+L  KYG+E+G  C+ N L+NV++KVM KLS++APPK LVE+Y++EIAK+F+VP+       P A+    D        LIDF  +K       +       P P+                   P    PYP   NG     H   MS      D+ D+P ++   P  Y+      F    +  +  A   PP ++ D+F PE+PT   N+           + G   VDFDDL RRFE LK++
Sbjct:    6 PNYSKLKTNLRLTINRLKLLEKKKTEIALKSRKEIADYISGGKDDRARIRVEHIIREDYLVEAMELLEMYCDLLLARFGLIQTQKEIDPGLEEAIATLIWATPRLQTDVQELKSIADELTAKYGKEFGQQCRCNGLSNVSDKVMHKLSVQAPPKALVEKYMMEIAKAFNVPFV------PDASVMAQDEVLLAENLLIDFDADKKGGGGGPSGGMRS--PQPLPSTAPYPAAAAAPPIPSVGPIGSSPYPPSYNG-----HASKMSPPPNFNDLYDKPGNVYDNPNVYDHVKAPHFQPPPAGFRPGAAAQPPPKSEDVF-PELPTVPTNSLPEISHTVGGTSAGGEDVDFDDLTRRFEALKKK 354          
BLAST of IST1 vs. TrEMBL
Match: A0A4Y2G6G6 (IST1 OS=Araneus ventricosus OX=182803 GN=IST1_1 PE=4 SV=1)

HSP 1 Score: 267.314 bits (682), Expect = 4.843e-82
Identity = 171/361 (47.37%), Postives = 219/361 (60.66%), Query Frame = 1
Query:   58 NYNKLKTNLRIVINRLKLLEKKNTEIALKSRKEIADYLSSAKYDRARIKVEMIIRQDYLVEVYELVEMFCDLLLARFGMIECQKEIDPGLEEQIATLIWVTPRLQTDVLELKIIADQLLLKYGREYGLACQSNSLNNVNEKVMEKLSIKAPPKRLVEQYLVEIAKSFDVPYEPVEDIDPPATWNPNDFYAPVAPNLIDFL-----PEKPPLVNPNAAYN---PGV------LPHPMYDPTMQ--------PPYP-VMNNGPFPYPHKKPMS---DIDQPMSLPPKYEEFPNDG------SSSQESAPPLPPDRTNDLF----LPEIPTDQNNT----NQTPGSGSVDFDDLNRRFEELKRR 1020
            NY+KLKTNLR+ INRLKLLEKK TE+A KSR+EIADYL++ K +R++I+VE IIR+DYLVE  ELVEM+CDL+LARFG+I+  K +D GL E +++LIW  PRLQTDV ELKIIADQL +KYG+ Y +A + NSLN+VNEK++ KLS++APPK LVE+YL+EIAKS +VPYEP  ++        +   A V+  LI+       PE   +  P+   N   PGV      LP P   P           PP P V  +GP+P     P S   +ID P    P YE    D       S   +S P +P       F    LPE+P+  N       +      VDFDDL +RFEELK+R
Sbjct:    7 NYSKLKTNLRLAINRLKLLEKKKTELAQKSRREIADYLANGKLERSKIRVEHIIREDYLVEAMELVEMYCDLMLARFGLIQQMKTLDEGLAEAVSSLIWAAPRLQTDVAELKIIADQLAVKYGKPYAIAARENSLNSVNEKLVHKLSVQAPPKVLVEKYLIEIAKSHNVPYEPDTEV---LAEEEHAREAIVSEPLINLGDDPRPPEPGFVTGPSPQENKMYPGVQYPQPDLPKPFNYPVPNVCAKGSDVPPVPSVAPSGPYPGAVTNPESIGFNIDAPA---PSYESVFGDNPPPLPQSFDAKSPPAMPTPAPRSKFPIDSLPELPSVPNTVLPELGEANSGDDVDFDDLAKRFEELKKR 361          
BLAST of IST1 vs. Ensembl Cavefish
Match: ist1 (IST1 factor associated with ESCRT-III [Source:ZFIN;Acc:ZDB-GENE-030131-179])

HSP 1 Score: 252.292 bits (643), Expect = 4.433e-80
Identity = 153/331 (46.22%), Postives = 205/331 (61.93%), Query Frame = 1
Query:   67 KLKTNLRIVINRLKLLEKKNTEIALKSRKEIADYLSSAKYDRARIKVEMIIRQDYLVEVYELVEMFCDLLLARFGMIECQKEIDPGLEEQIATLIWVTPRLQTDVLELKIIADQLLLKYGREYGLACQSNSLNNVNEKVMEKLSIKAPPKRLVEQYLVEIAKSFDVPYEPVEDIDPPATWNPNDFYAPVAPNLIDFLPE-KPPLVNPNAAYNPGVLPHPMYDPTMQPPYPVMNNGPFPYPHKKPMSD-----IDQPMSLPPKYEEFPNDGSSSQESAPPLPPDRTND-LFLPEIPT------DQNNTNQTPGSGSVDFDDLNRRFEELKRR 1020
            +L+ NLR+VINRLKLLEKK TE+A K+RKEIADYLS+ K +RARI+VE IIR+DYLVE  E++E++CDLLLARFG+I+  KE+DPGL+E ++TLIW  PRLQ++V ELKI++DQL  KY +EYG  C++N +  VN+++M KLS++APPK LVE+YL+EIAK+++VPYEP   + P               +LID   + K P             P       M  P P+     +P P K  +SD     ID    +      FP  GS    SA P P  +  D   LPE+P+        +    T  S  +DFDDL+RRFEELK++
Sbjct:   10 RLRVNLRLVINRLKLLEKKKTELAQKARKEIADYLSAGKDERARIRVEHIIREDYLVEAMEILELYCDLLLARFGLIQSMKELDPGLQEAVSTLIWAAPRLQSEVSELKIVSDQLCAKYSKEYGKLCRTNQIGTVNDRLMHKLSVEAPPKILVERYLIEIAKNYNVPYEPDAMVHPEVCQGEE-------ADLIDVDSDFKKPGGGGGGGGGFTAPPAAAMPMPMPMPMPMPTAFNYP-PPKGILSDILNIAIDNTDRISIHVVFFPT-GSVCFLSAGPGPSSQIYDNNALPELPSVPDTLPASSLGGNTAASDDIDFDDLSRRFEELKKK 331          
BLAST of IST1 vs. Ensembl Cavefish
Match: ist1 (IST1 factor associated with ESCRT-III [Source:ZFIN;Acc:ZDB-GENE-030131-179])

HSP 1 Score: 249.98 bits (637), Expect = 3.898e-78
Identity = 153/349 (43.84%), Postives = 208/349 (59.60%), Query Frame = 1
Query:   67 KLKTNLRIVINRLKLLEKKNTEIALKSRKEIADYLSSAKYDRARIKVEMIIRQDYLVEVYELVEMFCDLLLARFGMIECQKEIDPGLEEQIATLIWVTPRLQTDVLELKIIADQLLLKYGREYGLACQSNSLNNVNEKVMEKLSIKAPPKRLVEQYLVEIAKSFDVPYEPVEDIDPPATWNP--------NDFYAP----------VAPNLIDFLPEKPPLVNPNAAYN--PGVLPHPMYDPTMQPPYPVMNNGPFPYPHKKPMSDIDQPMSLPPKYEEFPNDGSSSQESAPPLP-PDRTNDLF----LPEIPT------DQNNTNQTPGSGSVDFDDLNRRFEELKRR 1020
            +L+ NLR+VINRLKLLEKK TE+A K+RKEIADYLS+ K +RARI+VE IIR+DYLVE  E++E++CDLLLARFG+I+  KE+DPGL+E ++TLIW  PRLQ++V ELKI++DQL  KY +EYG  C++N +  VN+++M KLS++APPK LVE+YL+EIAK+++VPYEP   + P              +DF  P           AP         P  +    A+N  P     P   P     Y   NN   P    +P     Q  S PP YE   +       S   +P P  ++ ++    LPE+P+        +    T  S  +DFDDL+RRFEELK++
Sbjct:   62 RLRVNLRLVINRLKLLEKKKTELAQKARKEIADYLSAGKDERARIRVEHIIREDYLVEAMEILELYCDLLLARFGLIQSMKELDPGLQEAVSTLIWAAPRLQSEVSELKIVSDQLCAKYSKEYGKLCRTNQIGTVNDRLMHKLSVEAPPKILVERYLIEIAKNYNVPYEPDAMVHPEVCQGEEADLIDVDSDFKKPGGGGGGGGGFTAPPAAAMPMPMPMPMPMPTAFNYPPPKGAEPFNGPVGT--YDAFNNFQPPVRGGQP----PQLPSCPPTYESIDDLAIHPSASPQVIPGPGPSSQIYDNNALPELPSVPDTLPASSLGGNTAASDDIDFDDLSRRFEELKKK 404          
BLAST of IST1 vs. Ensembl Sea Lamprey
Match: ist1 (IST1 factor associated with ESCRT-III [Source:ZFIN;Acc:ZDB-GENE-030131-179])

HSP 1 Score: 225.328 bits (573), Expect = 4.599e-70
Identity = 153/349 (43.84%), Postives = 202/349 (57.88%), Query Frame = 1
Query:   67 KLKTNLRIVINRLKLLEKKNTEIALKSRKEIADYLSSAKYDRARIKVEMIIRQDYLVEVYELVEMFCDLLLARFGMIECQKEIDPGLEEQIATLIWVTPRLQTDVLELKIIADQLLLKYGREYGLACQSNSLNNVNEKVMEKLSIKAPPKRLVEQYLVEIAKSFDVPYEP----------VEDIDPPATWNPNDFYAPVAPNLIDFLPEKPPLVNP----NAAYNP----GVLPHPMYDPTMQPPYPVMNNGPFPYPHKKPMSDIDQPMSLPPKYEEFPNDGSSSQESAPPLPPDRTNDLFLPEIPTDQNN-------------TNQTPGSGSVDFDDLNRRFEELKRR 1020
            +L+ NLR+VINRLKLL+KK TE+A K+RKEIADYL S K +RARI+VE IIR+DYLVE  E++E+ CDLLLARFG+I+  KE+DPGLEE I+TLIW  PRLQ +V ELK+++DQL  KY +EYG  C++N    VNE++M KL ++APPK LVE+YL+EIAK+++V +EP           ++ D    +   D Y     N           V P    NAA  P    G+ P+ M  PTM     V    PF YP             +P  +  FP    +     PP   +    L LP++PT  ++             +   P S  VDFDDL RRFEELK++
Sbjct:   10 RLRVNLRLVINRLKLLQKKKTELAQKARKEIADYLGSGKDERARIRVEHIIREDYLVEAMEILELLCDLLLARFGLIQSMKEMDPGLEEAISTLIWAAPRLQVEVQELKVVSDQLCAKYSKEYGKLCRTNQTGTVNERLMHKLGVEAPPKMLVERYLIEIAKNYNVAFEPDAIVLGEVPIADEADLIGVYGNVDDY-----NGGGGGGGGGGCVGPLPFGNAAMPPPLPSGMHPNMMPIPTMPTIPTVPPVTPFSYPPGNSQFLCVHTAPMPGGFPVFP---GAPVAQPPPAYDNLAPHLDLPDLPTVPDSLPQPAPRRRPPNSSGPPPPSDEVDFDDLTRRFEELKKK 350          
BLAST of IST1 vs. Ensembl Yeast
Match: IST1 (Protein with positive role in the multivesicular body sorting pathway; functions and forms a complex with Did2p; recruitment to endosomes is mediated by the Vps2p-Vps24p subcomplex of ESCRT-III; also interacts with Vps4p [Source:SGD;Acc:S000005209])

HSP 1 Score: 93.9745 bits (232), Expect = 5.162e-22
Identity = 61/176 (34.66%), Postives = 104/176 (59.09%), Query Frame = 1
Query:   67 KLKTNLRIVINRLKLLEKKNTEIALKSRKEIADYLSSAKYDRARIKVEMIIRQDYLVEVYELVEMFCDLLLARFGMIE--------CQKEIDPGLEEQIATLIWVTPRLQTDVLELKIIADQLLLKYGREYGLACQSNSLNNVNEKVMEKLSIKAPPKRLVEQYLVEIAKSFDVPY 570
            KLKT L++ I RL+  ++K   IA +SR+++A  L + K  +A  +VE +I  D  +E+ E++E++C+LLLAR  +I          ++ +D G+ E I +LI+    +  +V EL  + D +  K   E+     ++ + +V EK+++K S   P + LV+ YL EIAK++DVPY
Sbjct:   11 KLKTCLKMCIQRLRYAQEKQQAIAKQSRRQVAQLLLTNKEQKAHYRVETLIHDDIHIELLEILELYCELLLARVQVINDISTEEQLVKEHMDDGINEAIRSLIYAILFV-DEVKELSQLKDLMAWKINVEFVNGVIADHI-DVPEKIIKKCSPSVPKEELVDLYLKEIAKTYDVPY 184          
BLAST of IST1 vs. Ensembl Medaka
Match: ist1 (IST1 factor associated with ESCRT-III [Source:NCBI gene;Acc:101169772])

HSP 1 Score: 235.728 bits (600), Expect = 1.764e-73
Identity = 107/170 (62.94%), Postives = 145/170 (85.29%), Query Frame = 1
Query:   67 KLKTNLRIVINRLKLLEKKNTEIALKSRKEIADYLSSAKYDRARIKVEMIIRQDYLVEVYELVEMFCDLLLARFGMIECQKEIDPGLEEQIATLIWVTPRLQTDVLELKIIADQLLLKYGREYGLACQSNSLNNVNEKVMEKLSIKAPPKRLVEQYLVEIAKSFDVPYEP 576
            +L+ NLR+VINRLKLLEKK TE+A K+RKEIADYLSS K +RARI+VE IIR+DYLVE  E++E++CDLL+ RFG+I+  KE+DPGL+E ++TLIW  PRLQ++V ELKI+++QL  KY +EYG  C++N +  VN+++M KLS++APPK LVE+YL+EIAK+++VPYEP
Sbjct:   10 RLRVNLRLVINRLKLLEKKKTELAQKARKEIADYLSSGKDERARIRVEHIIREDYLVEAMEILELYCDLLITRFGLIQSMKELDPGLQEAVSTLIWAAPRLQSEVSELKIVSEQLCAKYSKEYGKLCRNNQIGTVNDRLMHKLSVEAPPKILVERYLIEIAKNYNVPYEP 179          
BLAST of IST1 vs. Planmine SMEST
Match: SMESG000078030.1 (SMESG000078030.1)

HSP 1 Score: 651.744 bits (1680), Expect = 0.000e+0
Identity = 322/324 (99.38%), Postives = 322/324 (99.38%), Query Frame = 1
Query:   52 KPNYNKLKTNLRIVINRLKLLEKKNTEIALKSRKEIADYLSSAKYDRARIKVEMIIRQDYLVEVYELVEMFCDLLLARFGMIECQKEIDPGLEEQIATLIWVTPRLQTDVLELKIIADQLLLKYGREYGLACQSNSLNNVNEKVMEKLSIKAPPKRLVEQYLVEIAKSFDVPYEPVEDIDPPATWNPNDFYAPVAPNLIDFLPEKPPLVNPNAAYNPGVLPHPMYDPTMQPPYPVMNNGPFPYPHKKPMSDIDQPMSLPPKYEEFPNDGSSSQESAPPLPPDRTNDLFLPEIPTDQNNTNQTPGSGSVDFDDLNRRFEELKRRP 1023
            KPNYNKLKTNLRIVINRLKLLEKKNTEIALKSRKEIADYLSSAKYDRARIKVEMIIRQDYLVEVYELVEMFCDLLLARFGMIECQKEIDPGLEEQIATLIWVTPRLQTDVLELKIIADQLLLKYGREYGLACQSNSLNNVNEKVMEKLSIKAPPKRLVEQYLVEIAKSFDVPYEPVEDIDPPA WNPNDFYAP APNLIDFLPEKPPLVNPNAAYNPGVLPHPMYDPTMQPPYPVMNNGPFPYPHKKPMSDIDQPMSLPPKYEEFPNDGSSSQESAPPLPPDRTNDLFLPEIPTDQNNTNQTPGSGSVDFDDLNRRFEELKRRP
Sbjct:    5 KPNYNKLKTNLRIVINRLKLLEKKNTEIALKSRKEIADYLSSAKYDRARIKVEMIIRQDYLVEVYELVEMFCDLLLARFGMIECQKEIDPGLEEQIATLIWVTPRLQTDVLELKIIADQLLLKYGREYGLACQSNSLNNVNEKVMEKLSIKAPPKRLVEQYLVEIAKSFDVPYEPVEDIDPPAAWNPNDFYAPAAPNLIDFLPEKPPLVNPNAAYNPGVLPHPMYDPTMQPPYPVMNNGPFPYPHKKPMSDIDQPMSLPPKYEEFPNDGSSSQESAPPLPPDRTNDLFLPEIPTDQNNTNQTPGSGSVDFDDLNRRFEELKRRP 328          
BLAST of IST1 vs. Planmine SMEST
Match: SMESG000007922.1 (SMESG000007922.1)

HSP 1 Score: 205.682 bits (522), Expect = 6.312e-63
Identity = 98/188 (52.13%), Postives = 140/188 (74.47%), Query Frame = 1
Query:   67 KLKTNLRIVINRLKLLEKKNTEIALKSRKEIADYLSSAKYDRARIKVEMIIRQDYLVEVYELVEMFCDLLLARFGMIECQKEIDPGLEEQIATLIWVTPRLQTDVLELKIIADQLLLKYGREYGLACQSNSLNNVNEKVMEKLSIKAPPKRLVEQYLVEIAKSFDVPYEPVEDIDPPATWNPNDFYAP 630
            KLKTNL I+INRLKLLE+K TE+ +K+RKEI+ Y+   KY++ARIKVE IIR+DYLVE YE++E+FCDL+LARFG++E QK+IDPGLEE +A+++W  PR++ D+ EL+II D L  KY ++Y + C  N  + VN+ ++ +++   P K+LVE YL+EIAK+F + Y     +D P    P+D+  P
Sbjct:   15 KLKTNLSIIINRLKLLERKKTEMGIKARKEISGYIKEKKYEKARIKVEHIIREDYLVEAYEMLELFCDLVLARFGLLEYQKDIDPGLEEALASIVWSVPRMKADLHELQIIEDMLARKYSKDYVVQCHQNINDKVNKDLIHRVTAYVPSKKLVEMYLLEIAKNFKLEYH----MDLP----PDDYGGP 194          
BLAST of IST1 vs. Planmine SMEST
Match: SMESG000007922.1 (SMESG000007922.1)

HSP 1 Score: 187.963 bits (476), Expect = 3.554e-56
Identity = 96/188 (51.06%), Postives = 134/188 (71.28%), Query Frame = 1
Query:   67 KLKTNLRIVINRLKLLEKKNTEIALKSRKEIADYLSSAKYDRARIKVEMIIRQDYLVEVYELVEMFCDLLLARFGMIECQKEIDPGLEEQIATLIWVTPRLQTDVLELKIIADQLLLKYGREYGLACQSNSLNNVNEKVMEKLSIKAPPKRLVEQYLVEIAKSFDVPYEPVEDIDPPATWNPNDFYAP 630
            KLKTNL I+INRLKLLE+K TE+ +K+RKEI+ Y+   KY++ARIKVE IIR+DYLVE YE++E+FCDL+LARFG++E QK+IDPGLEE +A+++W  PR++ D+ EL+II D L  KY ++Y + C+         K  + + I   P +LVE YL+EIAK+F + Y     +D P    P+D+  P
Sbjct:   15 KLKTNLSIIINRLKLLERKKTEMGIKARKEISGYIKEKKYEKARIKVEHIIREDYLVEAYEMLELFCDLVLARFGLLEYQKDIDPGLEEALASIVWSVPRMKADLHELQIIEDMLARKYSKDYVVQCR---------KFFKGILI---PGKLVEMYLLEIAKNFKLEYH----MDLP----PDDYGGP 182          
BLAST of IST1 vs. Planmine SMEST
Match: SMESG000007922.1 (SMESG000007922.1)

HSP 1 Score: 140.198 bits (352), Expect = 9.460e-39
Identity = 74/166 (44.58%), Postives = 106/166 (63.86%), Query Frame = 1
Query:  133 IALKSRKEIADYLSSAKYDRARIKVEMIIRQDYLVEVYELVEMFCDLLLARFGMIECQKEIDPGLEEQIATLIWVTPRLQTDVLELKIIADQLLLKYGREYGLACQSNSLNNVNEKVMEKLSIKAPPKRLVEQYLVEIAKSFDVPYEPVEDIDPPATWNPNDFYAP 630
            + +K+RKEI+ Y+   KY++ARIKVE IIR+DYLVE YE++E+FCDL+LARFG++E QK+IDPGLEE +A+++W  PR++ D+ EL+II D L                      K  + + I   P +LVE YL+EIAK+F + Y     +D P    P+D+  P
Sbjct:    1 MGIKARKEISGYIKEKKYEKARIKVEHIIREDYLVEAYEMLELFCDLVLARFGLLEYQKDIDPGLEEALASIVWSVPRMKADLHELQIIEDML-------------------ARRKFFKGILI---PGKLVEMYLLEIAKNFKLEYH----MDLP----PDDYGGP 136          
The following BLAST results are available for this feature:
BLAST of IST1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
IST11.498e-8045.37IST1 factor associated with ESCRT-III [Source:HGNC... [more]
IST11.014e-7643.44IST1 factor associated with ESCRT-III [Source:HGNC... [more]
IST11.014e-7643.44IST1 factor associated with ESCRT-III [Source:HGNC... [more]
IST11.014e-7643.44IST1 factor associated with ESCRT-III [Source:HGNC... [more]
IST11.030e-7643.44IST1 factor associated with ESCRT-III [Source:HGNC... [more]
back to top
BLAST of IST1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
istr-13.073e-6154.19Increased Sodium Tolerance Related [Source:UniPro... [more]
istr-13.073e-6154.19Increased Sodium Tolerance Related [Source:UniPro... [more]
istr-14.254e-6154.19Increased Sodium Tolerance Related [Source:UniPro... [more]
istr-14.254e-6154.19Increased Sodium Tolerance Related [Source:UniPro... [more]
back to top
BLAST of IST1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG101031.896e-6759.43gene:FBgn0035715 transcript:FBtr0330065[more]
CG101038.049e-6759.43gene:FBgn0035715 transcript:FBtr0330062[more]
CG101038.815e-6759.43gene:FBgn0035715 transcript:FBtr0330063[more]
CG101039.250e-6759.43gene:FBgn0035715 transcript:FBtr0330061[more]
CG101039.283e-6759.43gene:FBgn0035715 transcript:FBtr0330064[more]
back to top
BLAST of IST1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ist12.600e-7463.53IST1 factor associated with ESCRT-III [Source:ZFIN... [more]
ist14.630e-7463.53IST1 factor associated with ESCRT-III [Source:ZFIN... [more]
back to top
BLAST of IST1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ist17.596e-8246.39increased sodium tolerance 1 homolog [Source:NCBI ... [more]
ist11.038e-8144.99increased sodium tolerance 1 homolog [Source:NCBI ... [more]
ist12.210e-7944.44increased sodium tolerance 1 homolog [Source:NCBI ... [more]
ENSXETT00000012180.11.656e-7341.50uncharacterized loc100216037 [Source:NCBI gene;Acc... [more]
ist14.780e-6140.56increased sodium tolerance 1 homolog [Source:NCBI ... [more]
back to top
BLAST of IST1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Ist11.214e-7742.90increased sodium tolerance 1 homolog (yeast) [Sour... [more]
back to top
BLAST of IST1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9CX00|IST1_MOUSE8.488e-7742.90IST1 homolog OS=Mus musculus OX=10090 GN=Ist1 PE=1... [more]
sp|P53990|IST1_HUMAN2.313e-7643.68IST1 homolog OS=Homo sapiens OX=9606 GN=IST1 PE=1 ... [more]
sp|Q3ZBV1|IST1_BOVIN3.224e-7641.76IST1 homolog OS=Bos taurus OX=9913 GN=IST1 PE=2 SV... [more]
sp|Q568Z6|IST1_RAT3.766e-7642.15IST1 homolog OS=Rattus norvegicus OX=10116 GN=Ist1... [more]
sp|Q5R6G8|IST1_PONAB8.280e-7542.86IST1 homolog OS=Pongo abelii OX=9601 GN=IST1 PE=2 ... [more]
back to top
BLAST of IST1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0B6ZH115.297e-8947.49Uncharacterized protein OS=Arion vulgaris OX=10286... [more]
V4CNK76.280e-8847.49Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
A0A0B7B5X87.404e-8847.17Uncharacterized protein OS=Arion vulgaris OX=10286... [more]
A0A2T7P5X93.069e-8748.21Uncharacterized protein OS=Pomacea canaliculata OX... [more]
A0A4Y2G6G64.843e-8247.37IST1 OS=Araneus ventricosus OX=182803 GN=IST1_1 PE... [more]
back to top
BLAST of IST1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ist14.433e-8046.22IST1 factor associated with ESCRT-III [Source:ZFIN... [more]
ist13.898e-7843.84IST1 factor associated with ESCRT-III [Source:ZFIN... [more]
back to top
BLAST of IST1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ist14.599e-7043.84IST1 factor associated with ESCRT-III [Source:ZFIN... [more]
back to top
BLAST of IST1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
IST15.162e-2234.66Protein with positive role in the multivesicular b... [more]
back to top
BLAST of IST1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of IST1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ist11.764e-7362.94IST1 factor associated with ESCRT-III [Source:NCBI... [more]
back to top
BLAST of IST1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000078030.10.000e+099.38SMESG000078030.1[more]
SMESG000007922.16.312e-6352.13SMESG000007922.1[more]
SMESG000007922.13.554e-5651.06SMESG000007922.1[more]
SMESG000007922.19.460e-3944.58SMESG000007922.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30028398 ID=SMED30028398|Name=IST1|organism=Schmidtea mediterranea sexual|type=transcript|length=1395bp
AATAAATATAATTAAATTTTTATATTTTTTACTTCCACTATGTTTTCAAG
TAAACCGAATTACAACAAACTAAAAACTAATTTGAGAATAGTTATTAATC
GTCTTAAATTATTGGAAAAAAAGAACACTGAAATAGCTTTAAAATCACGA
AAAGAAATTGCTGATTATTTAAGTAGTGCTAAATATGATCGAGCTCGAAT
TAAAGTAGAAATGATCATAAGACAAGATTATCTTGTCGAGGTCTATGAAC
TAGTTGAAATGTTTTGTGATTTGTTGTTGGCTCGATTTGGTATGATTGAG
TGTCAAAAAGAAATTGATCCTGGATTAGAAGAACAAATTGCTACTCTTAT
TTGGGTAACGCCAAGGTTACAAACAGATGTACTAGAATTGAAAATTATAG
CAGATCAACTTCTTTTAAAATATGGCAGGGAATATGGACTAGCATGTCAA
TCTAATTCATTAAATAATGTCAATGAGAAAGTAATGGAAAAATTAAGTAT
CAAAGCACCACCTAAAAGACTTGTGGAACAATATTTGGTGGAAATCGCAA
AAAGCTTCGATGTTCCTTATGAACCTGTAGAAGATATTGATCCGCCTGCT
ACTTGGAATCCCAATGATTTCTATGCACCAGTTGCACCAAATTTGATAGA
CTTTTTGCCAGAAAAACCTCCATTAGTCAACCCGAATGCTGCATATAATC
CAGGTGTGTTACCTCATCCAATGTATGATCCCACAATGCAACCACCATAT
CCAGTGATGAATAATGGTCCATTTCCATATCCACATAAAAAACCAATGTC
GGACATTGATCAACCTATGAGCTTGCCGCCGAAATATGAAGAGTTTCCGA
ATGATGGTTCGTCATCGCAAGAAAGTGCTCCACCGTTGCCTCCTGATAGA
ACGAACGACTTATTTCTTCCAGAAATTCCAACTGATCAAAACAATACAAA
TCAAACTCCCGGTTCCGGTTCAGTGGATTTTGATGATTTGAATCGTCGTT
TTGAAGAGCTAAAACGAAGACCTTAATTTAGAGAGATTCATCGACTGATT
TATTTTTCAATATATTCAGAACTATTTGTTTTTTATTTTATTCAATTTGT
GGTGGATTTTAAATTTAATAATCATTTTATCGTGTAATATGCATTATGAT
GACGAAAACATATAAATGTTATGATTAGTTTTCCGAATTTTTATCAATCG
GCTTTGCAATTTCTTGAATGTATTATGTCATGCTTGATGAGCTTGTGGCT
CCGAGTGCATCAGTTCGGATGTGTGCATTGCATAACTGTGGTTGCGTGTG
GCTTTATATTTCAGTAGTGTAAAATCCCAACAAAAAATTTTTATTAATGT
ATAAGGTAAATAAAATAAAAGTGTTTTTAATGTGATGAAAAAAAA
back to top

protein sequence of SMED30028398-orf-1

>SMED30028398-orf-1 ID=SMED30028398-orf-1|Name=SMED30028398-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=329bp
MFSSKPNYNKLKTNLRIVINRLKLLEKKNTEIALKSRKEIADYLSSAKYD
RARIKVEMIIRQDYLVEVYELVEMFCDLLLARFGMIECQKEIDPGLEEQI
ATLIWVTPRLQTDVLELKIIADQLLLKYGREYGLACQSNSLNNVNEKVME
KLSIKAPPKRLVEQYLVEIAKSFDVPYEPVEDIDPPATWNPNDFYAPVAP
NLIDFLPEKPPLVNPNAAYNPGVLPHPMYDPTMQPPYPVMNNGPFPYPHK
KPMSDIDQPMSLPPKYEEFPNDGSSSQESAPPLPPDRTNDLFLPEIPTDQ
NNTNQTPGSGSVDFDDLNRRFEELKRRP*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR005061Ist1
Vocabulary: biological process
TermDefinition
GO:0015031protein transport