Ceramide kinase

Overview
NameCeramide kinase
Smed IDSMED30028389
Length (bp)1770
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ceramide kinase (SMED30028389) t-SNE clustered cells

Violin plots show distribution of expression levels for Ceramide kinase (SMED30028389) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ceramide kinase (SMED30028389) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ceramide kinase (SMED30028389) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30028389

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30028389h1SMcG0021172 dd_Smed_v4_9323_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30028389h1SMcG0021172 dd_Smed_v4_9323_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30028389h1SMcG0021172 dd_Smed_v4_9323_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
reproductive organSMED30028389h1SMcG0021173 Contig41855newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30028389h1SMcG0021173 Contig41855uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30028389h1SMcG0021172 Contig41855newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30028389h1SMcG0021172 Contig41855uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
epidermisSMED30028389h1SMcG0021172 dd_Smed_v4_9323_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ceramide kinase vs. Ensembl Human
Match: CERK (ceramide kinase [Source:HGNC Symbol;Acc:HGNC:19256])

HSP 1 Score: 331.643 bits (849), Expect = 3.391e-106
Identity = 176/455 (38.68%), Postives = 266/455 (58.46%), Query Frame = 2
Query:  290 QEAFKFIIYSVIPRLKRQHQLDILSTIISFDTEYSCDQWFILISKLLQKEETRPRSLTVFINPIGGLKKGVQLYKDKISPIFELCGIKSTVTITKHRGEAEAYILKQKSFDVDGFICVGGDGMLMELVQGLLLKARLDAGLSDDEHELYSKEFPAGLRVGIIPAGSTDTVAYSTIGTKDPITAALHVVLGRSIGLDALSVHCDNKFIRYNVSLMGYGFYGNLVAESESLRWIGPRRYDWLGFKNFMSLEAYFGELKYLPA-HSVKYGEPSDGIYCVGRCSRCL--------DDSNVIPSISHAED---WITVRDRFVAINSFLISCRCTKSPIGPAPFAHLGNGCTDLIIVRECSRFNFLQHLLRSASYEDHFDFDFVETVRVKEFSFRSLQ------DLQSSSETNIPKIQNYE---------LPWNCDGEPLYCPRVHCKVHKQIIKLFASGI 1573
            ++ + F ++ V  +  R+H+            E  C  W   + ++L+K  +RP+ L VFINP GG  +G ++Y+ K++P+F L  I + + +T+H  +A+  + +      DG +CVGGDGM  E++ GL+ + +  AG+  D++   +   P+ LR+GIIPAGSTD V YST+GT D  T+ALH+V+G S+ +D  SVH ++  +RY+VSL+GYGFYG+++ +SE  RW+G  RYD+ G K F+S   Y G + +LPA H+V  G P D   C   C  C         +    +  +  AED   W  V  +F+AIN+  +SC C +SP G +P AHLG+G +DLI++R+CSRFNFL+ L+R  + +D FDF FVE  RVK+F F S        DL+   +     I +             WNCDGE L+ P +  +VH Q+++LFA GI
Sbjct:   79 EKPYAFTVHCV--KRARRHRWKWAQVTFWCPEEQLCHLWLQTLREMLEKLTSRPKHLLVFINPFGGKGQGKRIYERKVAPLFTLASITTDIIVTEHANQAKETLYEINIDKYDGIVCVGGDGMFSEVLHGLIGRTQRSAGV--DQNHPRAVLVPSSLRIGIIPAGSTDCVCYSTVGTSDAETSALHIVVGDSLAMDVSSVHHNSTLLRYSVSLLGYGFYGDIIKDSEKKRWLGLARYDFSGLKTFLSHHCYEGTVSFLPAQHTV--GSPRDRKPCRAGCFVCRQSKQQLEEEQKKALYGLEAAEDVEEWQVVCGKFLAINATNMSCACRRSPRGLSPAAHLGDGSSDLILIRKCSRFNFLRFLIRHTNQQDQFDFTFVEVYRVKKFQFTSKHMEDEDSDLKEGGKKRFGHICSSHPSCCCTVSNSSWNCDGEVLHSPAIEVRVHCQLVRLFARGI 527          
BLAST of Ceramide kinase vs. Ensembl Human
Match: CERKL (ceramide kinase like [Source:HGNC Symbol;Acc:HGNC:21699])

HSP 1 Score: 211.075 bits (536), Expect = 1.766e-60
Identity = 131/401 (32.67%), Postives = 203/401 (50.62%), Query Frame = 2
Query:  383 TEYSCDQWFILISKLLQKEETRPRSLTVFINPIGGLKKGVQLYKDKISPIFELCGIKSTVTITKHRGEAEAYILKQKSFDVDGFICVGGDGMLMELVQGLLLKARLDAGLSDDEHELYSKEFPAGLRVGIIPAGSTDTVAYSTIGTKDPITAALHVVLGRSIGLDALSVHCDNKFIRYNVSLMGYGFYGNLVAESESLRWIGP-RRYDWLGFKNFMSLEAYFGELKYLPAHSVKYGEPSDGIYCVGRCSRCLDDSNVIPSISHAEDWITVRDRFVAINSFLISCRCTKSPIGPAPFAHLGNGCTDLIIVRECSRFNFLQHLLRSASYEDHFDFDFVETVRVKEFSFRSLQDLQSSSETNIPKIQNYE--LPWNCDGEPL-YCPRVHCKVHKQIIKLFASGI 1573
            +E  CD WF    K+L     RP+SL + +NP    K+  Q+Y +K+ P+ +L GIK+ VTI ++ G A + + + +    DG +CVGGDG   E+   LLL+A+ +AG+  D          A L +G+IPAGST+ +A+S  G    ITA LH+++G    +D  +     K +R+  S M +GF G  +A +E  RW+ P +R D+   K    L+A   E+ +LP +S      SD +       R    S   P     + W  ++ +F+ ++   I C C+ +P G AP   L NG   LII R  SR  F++HL R AS ++ F+F FVET  V+E       +    +          E   PWN DG+ +     VH ++H ++I L+   +
Sbjct:  144 SEDHCDIWFRQFKKILAGFPNRPKSLKILLNPQSHKKEATQVYYEKVEPLLKLAGIKTDVTIMEYEGHALSLLKECELQGFDGVVCVGGDGSASEVAHALLLRAQKNAGMETDR---ILTPVRAQLPLGLIPAGSTNVLAHSLHGVPHVITATLHIIMGHVQLVDVCTFSTAGKLLRFGFSAM-FGFGGRTLALAEKYRWMSPNQRRDFAVVKALAKLKAEDCEISFLPFNS------SDDVQ-----ERRAQGS---PKSDCNDQWQMIQGQFLNVSIMAIPCLCSVAPRGLAPNTRLNNGSMALIIARNTSRPEFIKHLKRYASVKNQFNFPFVETYTVEEVKVHPRNNTGGYNPEEEEDETASENCFPWNVDGDLMEVASEVHIRLHPRLISLYGGSM 526          
BLAST of Ceramide kinase vs. Ensembl Human
Match: CERKL (ceramide kinase like [Source:HGNC Symbol;Acc:HGNC:21699])

HSP 1 Score: 196.823 bits (499), Expect = 5.060e-55
Identity = 131/430 (30.47%), Postives = 203/430 (47.21%), Query Frame = 2
Query:  383 TEYSCDQWFILISKLLQKEETRPRSLTVFINPIGGLKKGVQLYKDKISPIFELCGIKSTVTITKHRGEAEAYILKQKSFDVDGF-----------------------------ICVGGDGMLMELVQGLLLKARLDAGLSDDEHELYSKEFPAGLRVGIIPAGSTDTVAYSTIGTKDPITAALHVVLGRSIGLDALSVHCDNKFIRYNVSLMGYGFYGNLVAESESLRWIGP-RRYDWLGFKNFMSLEAYFGELKYLPAHSVKYGEPSDGIYCVGRCSRCLDDSNVIPSISHAEDWITVRDRFVAINSFLISCRCTKSPIGPAPFAHLGNGCTDLIIVRECSRFNFLQHLLRSASYEDHFDFDFVETVRVKEFSFRSLQDLQSSSETNIPKIQNYE--LPWNCDGEPL-YCPRVHCKVHKQIIKLFASGI 1573
            +E  CD WF    K+L     RP+SL + +NP    K+  Q+Y +K+ P+ +L GIK+ VTI ++ G A + +   K  ++ GF                             +CVGGDG   E+   LLL+A+ +AG+  D          A L +G+IPAGST+ +A+S  G    ITA LH+++G    +D  +     K +R+  S M +GF G  +A +E  RW+ P +R D+   K    L+A   E+ +LP +S      SD +           D N        + W  ++ +F+ ++   I C C+ +P G AP   L NG   LII R  SR  F++HL R AS ++ F+F FVET  V+E       +    +          E   PWN DG+ +     VH ++H ++I L+   +
Sbjct:  144 SEDHCDIWFRQFKKILAGFPNRPKSLKILLNPQSHKKEATQVYYEKVEPLLKLAGIKTDVTIMEYEGHALSLL---KECELQGFDGGHRKPLFAIHWSVQRLFTGMQTLEPSVVCVGGDGSASEVAHALLLRAQKNAGMETDR---ILTPVRAQLPLGLIPAGSTNVLAHSLHGVPHVITATLHIIMGHVQLVDVCTFSTAGKLLRFGFSAM-FGFGGRTLALAEKYRWMSPNQRRDFAVVKALAKLKAEDCEISFLPFNS------SDDVQERRAQGSPKSDCN--------DQWQMIQGQFLNVSIMAIPCLCSVAPRGLAPNTRLNNGSMALIIARNTSRPEFIKHLKRYASVKNQFNFPFVETYTVEEVKVHPRNNTGGYNPEEEEDETASENCFPWNVDGDLMEVASEVHIRLHPRLISLYGGSM 552          
BLAST of Ceramide kinase vs. Ensembl Human
Match: CERKL (ceramide kinase like [Source:HGNC Symbol;Acc:HGNC:21699])

HSP 1 Score: 155.221 bits (391), Expect = 2.733e-40
Identity = 102/317 (32.18%), Postives = 156/317 (49.21%), Query Frame = 2
Query:  635 ICVGGDGMLMELVQGLLLKARLDAGLSDDEHELYSKEFPAGLRVGIIPAGSTDTVAYSTIGTKDPITAALHVVLGRSIGLDALSVHCDNKFIRYNVSLMGYGFYGNLVAESESLRWIGP-RRYDWLGFKNFMSLEAYFGELKYLPAHSVKYGEPSDGIYCVGRCSRCLDDSNVIPSISHAEDWITVRDRFVAINSFLISCRCTKSPIGPAPFAHLGNGCTDLIIVRECSRFNFLQHLLRSASYEDHFDFDFVETVRVKEFSFRSLQDLQSSSETNIPKIQNYE--LPWNCDGEPL-YCPRVHCKVHKQIIKLFASGI 1573
            +CVGGDG   E+   LLL+A+ +AG+  D          A L +G+IPAGST+ +A+S  G    ITA LH+++G    +D  +     K +R+  S M +GF G  +A +E  RW+ P +R D+   K    L+A   E+ +LP +S      SD +       R    S   P     + W  ++ +F+ ++   I C C+ +P G AP   L NG   LII R  SR  F++HL R AS ++ F+F FVET  V+E       +    +          E   PWN DG+ +     VH ++H ++I L+   +
Sbjct:  210 VCVGGDGSASEVAHALLLRAQKNAGMETDR---ILTPVRAQLPLGLIPAGSTNVLAHSLHGVPHVITATLHIIMGHVQLVDVCTFSTAGKLLRFGFSAM-FGFGGRTLALAEKYRWMSPNQRRDFAVVKALAKLKAEDCEISFLPFNS------SDDVQ-----ERRAQGS---PKSDCNDQWQMIQGQFLNVSIMAIPCLCSVAPRGLAPNTRLNNGSMALIIARNTSRPEFIKHLKRYASVKNQFNFPFVETYTVEEVKVHPRNNTGGYNPEEEEDETASENCFPWNVDGDLMEVASEVHIRLHPRLISLYGGSM 508          
BLAST of Ceramide kinase vs. Ensembl Human
Match: CERKL (ceramide kinase like [Source:HGNC Symbol;Acc:HGNC:21699])

HSP 1 Score: 127.102 bits (318), Expect = 4.644e-31
Identity = 95/319 (29.78%), Postives = 150/319 (47.02%), Query Frame = 2
Query:  632 FICVGGDGMLMELVQGLLLKARLD-AGLSDDEHELYSKEFPAGLRVGIIPAGSTDTVAYSTIGTKDPITAALHVVLGRSIGLDALSVHCDNKFIRYNVSLMGYGFYGNLVAESESLRWIGP-RRYDWLGFKNFMSLEAYFGELKYLPAHSVKYGEPSDGIYCVGRCSRCLDDSNVIPSISHAEDWITVRDRFVAINSFLISCRCTKSPIGPAPFAHLGNGCTDLIIVRECSRFNFLQHLLRSASYEDHFDFDFVETVRVKEFSFRSLQDLQSSSETNIPKIQNYE--LPWNCDGEPL-YCPRVHCKVHKQIIKLFASGI 1573
            FIC+  +       Q  L  + LD   LS+D  +++ ++F        I AGST+ +A+S  G    ITA LH+++G    +D  +     K +R+  S M +GF G  +A +E  RW+ P +R D+   K    L+A   E+ +LP +S      SD +       R    S   P     + W  ++ +F+ ++   I C C+ +P G AP   L NG   LII R  SR  F++HL R AS ++ F+F FVET  V+E       +    +          E   PWN DG+ +     VH ++H ++I L+   +
Sbjct:  123 FICLKKE-------QNKLKNSTLDLINLSEDHCDIWFRQFKK------ILAGSTNVLAHSLHGVPHVITATLHIIMGHVQLVDVCTFSTAGKLLRFGFSAM-FGFGGRTLALAEKYRWMSPNQRRDFAVVKALAKLKAEDCEISFLPFNS------SDDVQ-----ERRAQGS---PKSDCNDQWQMIQGQFLNVSIMAIPCLCSVAPRGLAPNTRLNNGSMALIIARNTSRPEFIKHLKRYASVKNQFNFPFVETYTVEEVKVHPRNNTGGYNPEEEEDETASENCFPWNVDGDLMEVASEVHIRLHPRLISLYGGSM 413          
BLAST of Ceramide kinase vs. Ensembl Celegans
Match: cerk-1 (Ceramide kinase 1 [Source:UniProtKB/Swiss-Prot;Acc:Q9TZI1])

HSP 1 Score: 178.718 bits (452), Expect = 8.453e-49
Identity = 118/408 (28.92%), Postives = 199/408 (48.77%), Query Frame = 2
Query:  371 ISFDTEYSCDQWFILISKLLQKEETRPRSLTVFINPIGGLKKGVQLYKDKISPIFELC-GIKSTVTITKHRGEAEAYILK---QKSFDVDGFICVGGDGMLMELVQGLLLKARLDAGLSDDEHELYSKEFPAGLRVGIIPAGSTDTVAYSTIGTKDPITAALHVVLGRSIGLDALSVHCDNKFIRYNVSLMGYGFYGNLVAESESLRWIGPRRYDWLGFKNFMSLEAYFGELKYLPAHSVKYGEPSDGIYCVGRCSRCLDDSNVIPSISHAEDWITVRDRFVAINSFLISCRCTKSPIGPAPFAHLGNGCTDLIIVRECSRFNFLQHLLRSASY--EDHFDFD-FVETVRVKEFSFRSLQDLQSSSETNIPKIQNYELPWNCDGEPLYCPR---VHCKVHKQIIKLFA 1564
            + F T    D W  LI   L++ + RP+++ +FINP GG  K  +++KD +   F L  G++  V +T+    A  YI++   ++   +DG + VGGDG+  EL+ G LL+ + DAG + D     S      +R GII AGS +++  +   T D  T+A+H+ +G    +D  +VH   K IR + + + YG+ G+++ +SE  R +GP RY W   +  +    Y G +++  +H            C+  C  C+      P  +   D+      F  +   +I      +P G APF  +G+G  DL +V   SRF+ +Q + + A Y  +  ++ D  +   RV ++S+      Q  ++   P +      WN DGE L  P+   +H K+H Q+I  F 
Sbjct:  138 VIFYTTSERDYWHSLIDTTLRRVKNRPKNIIIFINPFGGNGKAQKIFKDNVDAFFWLTPGLRYKVVLTERANHARDYIVEMPPEQWSAIDGLVSVGGDGLFNELLSGALLRTQTDAGRNIDNPS--SHLVTPHIRFGIIGAGSANSIVSTVHETNDHATSAVHIAIGSECNVDVCTVHQHQKLIRISANAISYGWLGDVLRDSEEYRCLGPIRYQWSALRTTIRHPIYRGMVQFSLSHKENVNPKDQLPPCLEPCPVCMK-----PQGNDKYDY-HWHAEFTHVICCVIPTVTPFTPYGLAPFTGIGDGTLDLALVPRISRFHNMQFMRKVAMYGGKQLYELDPSLNCYRVTKWSY------QPDADQEDPGV------WNLDGEILEQPKDEPLHFKLHPQLISFFG 525          
BLAST of Ceramide kinase vs. Ensembl Celegans
Match: sphk-1 (Sphingosine kinase 1 [Source:UniProtKB/Swiss-Prot;Acc:Q18425])

HSP 1 Score: 74.7146 bits (182), Expect = 5.651e-14
Identity = 90/386 (23.32%), Postives = 163/386 (42.23%), Query Frame = 2
Query:  410 ILISKLLQKEETRPRSLTVFINPIGGLKKGVQLYKDKISPIFELCGIKSTVTITKHRGEAEAYILKQKSF-DVDGFICVGGDGMLMELVQGLLLKARLDAGLSDDEHELYSKEFPAGLRVGIIPAGSTDTVAYSTI---GTK----DPITAALHVVLGRSIGLDAL---SVHCDNKFIRYNVSLMGYGFYGNLVAESESLR-WIGPRRYDWLGFKNFMSLEAYFGELKYLPAHSVKYGEPSDGIYCV--GRCSRCLDDSNVIP--SISHAED---------W-------------------ITVRDRFVAINSFLISCRCTKSPIGPAPFAHLGNGCTDLIIVREC-SRFNFLQHLLRSASYEDHFDFDFVETVRVKEFSFRSLQD 1432
            +++S+    +E    +L VFINP  G  K ++ + + + P  +   I+  V +T     A   ++ +      +G + + GDG++ E + G+L   R DA           + FP  L +GI+P+GS + +  S +   GTK      +  AL +    +   +++   SV  DN+     +S+ G+G   ++  +SE  R  +G  R+  +GF    +L +Y G L Y P +  K   PS  ++ V      + +DDS V    S+S +E+         W                   + + D FV I +  +S      P  P+            I+ ++  +R N  ++LL +  +E H D  FV+ V V       + +
Sbjct:   72 VILSRKPPPQEQCRGNLLVFINPNSGTGKSLETFANTVGPKLDKSLIRYEVVVTTGPNHARNVLMTKADLGKFNGVLILSGDGLVFEALNGIL--CREDA----------FRIFPT-LPIGIVPSGSGNGLLCSVLSKYGTKMNEKSVMERALEIATSPTAKAESVALYSVKTDNQSYASFLSI-GWGLMADIDIDSEKWRKSLGHHRFTVMGFIRSCNLRSYKGRLTYRP-YKPKGFHPSSNVFSVYEKTTQQRIDDSKVKTNGSVSDSEEETMETKFQNWTLPDSDETLAVGSSDLEETVVIEDNFVNIYAVTLSHIAADGPFAPSAKLEDNRIHLSYILWKDIGTRVNIAKYLL-AIEHETHLDLPFVKHVEVSSMKLEVISE 441          
BLAST of Ceramide kinase vs. Ensembl Celegans
Match: sphk-1 (Sphingosine kinase 1 [Source:UniProtKB/Swiss-Prot;Acc:Q18425])

HSP 1 Score: 74.3294 bits (181), Expect = 6.347e-14
Identity = 92/396 (23.23%), Postives = 166/396 (41.92%), Query Frame = 2
Query:  380 DTEYSCDQWFILISKLLQKEETRPRSLTVFINPIGGLKKGVQLYKDKISPIFELCGIKSTVTITKHRGEAEAYILKQKSF-DVDGFICVGGDGMLMELVQGLLLKARLDAGLSDDEHELYSKEFPAGLRVGIIPAGSTDTVAYSTI---GTK----DPITAALHVVLGRSIGLDAL---SVHCDNKFIRYNVSLMGYGFYGNLVAESESLR-WIGPRRYDWLGFKNFMSLEAYFGELKYLPAHSVKYGEPSDGIYCV--GRCSRCLDDSNVIP--SISHAED---------W-------------------ITVRDRFVAINSFLISCRCTKSPIGPAPFAHLGNGCTDLIIVREC-SRFNFLQHLLRSASYEDHFDFDFVETVRVKEFSFRSLQD 1432
            D E +     +++S+    +E    +L VFINP  G  K ++ + + + P  +   I+  V +T     A   ++ +      +G + + GDG++ E + G+L   R DA           + FP  L +GI+P+GS + +  S +   GTK      +  AL +    +   +++   SV  DN+     +S+ G+G   ++  +SE  R  +G  R+  +GF    +L +Y G L Y P +  K   PS  ++ V      + +DDS V    S+S +E+         W                   + + D FV I +  +S      P  P+            I+ ++  +R N  ++LL +  +E H D  FV+ V V       + +
Sbjct:   12 DAEENEQLTSVILSRKPPPQEQCRGNLLVFINPNSGTGKSLETFANTVGPKLDKSLIRYEVVVTTGPNHARNVLMTKADLGKFNGVLILSGDGLVFEALNGIL--CREDA----------FRIFPT-LPIGIVPSGSGNGLLCSVLSKYGTKMNEKSVMERALEIATSPTAKAESVALYSVKTDNQSYASFLSI-GWGLMADIDIDSEKWRKSLGHHRFTVMGFIRSCNLRSYKGRLTYRP-YKPKGFHPSSNVFSVYEKTTQQRIDDSKVKTNGSVSDSEEETMETKFQNWTLPDSDETLAVGSSDLEETVVIEDNFVNIYAVTLSHIAADGPFAPSAKLEDNRIHLSYILWKDIGTRVNIAKYLL-AIEHETHLDLPFVKHVEVSSMKLEVISE 391          
BLAST of Ceramide kinase vs. Ensembl Celegans
Match: sphk-1 (Sphingosine kinase 1 [Source:UniProtKB/Swiss-Prot;Acc:Q18425])

HSP 1 Score: 74.3294 bits (181), Expect = 6.347e-14
Identity = 92/396 (23.23%), Postives = 166/396 (41.92%), Query Frame = 2
Query:  380 DTEYSCDQWFILISKLLQKEETRPRSLTVFINPIGGLKKGVQLYKDKISPIFELCGIKSTVTITKHRGEAEAYILKQKSF-DVDGFICVGGDGMLMELVQGLLLKARLDAGLSDDEHELYSKEFPAGLRVGIIPAGSTDTVAYSTI---GTK----DPITAALHVVLGRSIGLDAL---SVHCDNKFIRYNVSLMGYGFYGNLVAESESLR-WIGPRRYDWLGFKNFMSLEAYFGELKYLPAHSVKYGEPSDGIYCV--GRCSRCLDDSNVIP--SISHAED---------W-------------------ITVRDRFVAINSFLISCRCTKSPIGPAPFAHLGNGCTDLIIVREC-SRFNFLQHLLRSASYEDHFDFDFVETVRVKEFSFRSLQD 1432
            D E +     +++S+    +E    +L VFINP  G  K ++ + + + P  +   I+  V +T     A   ++ +      +G + + GDG++ E + G+L   R DA           + FP  L +GI+P+GS + +  S +   GTK      +  AL +    +   +++   SV  DN+     +S+ G+G   ++  +SE  R  +G  R+  +GF    +L +Y G L Y P +  K   PS  ++ V      + +DDS V    S+S +E+         W                   + + D FV I +  +S      P  P+            I+ ++  +R N  ++LL +  +E H D  FV+ V V       + +
Sbjct:   12 DAEENEQLTSVILSRKPPPQEQCRGNLLVFINPNSGTGKSLETFANTVGPKLDKSLIRYEVVVTTGPNHARNVLMTKADLGKFNGVLILSGDGLVFEALNGIL--CREDA----------FRIFPT-LPIGIVPSGSGNGLLCSVLSKYGTKMNEKSVMERALEIATSPTAKAESVALYSVKTDNQSYASFLSI-GWGLMADIDIDSEKWRKSLGHHRFTVMGFIRSCNLRSYKGRLTYRP-YKPKGFHPSSNVFSVYEKTTQQRIDDSKVKTNGSVSDSEEETMETKFQNWTLPDSDETLAVGSSDLEETVVIEDNFVNIYAVTLSHIAADGPFAPSAKLEDNRIHLSYILWKDIGTRVNIAKYLL-AIEHETHLDLPFVKHVEVSSMKLEVISE 391          
BLAST of Ceramide kinase vs. Ensembl Celegans
Match: sphk-1 (Sphingosine kinase 1 [Source:UniProtKB/Swiss-Prot;Acc:Q18425])

HSP 1 Score: 74.3294 bits (181), Expect = 6.347e-14
Identity = 92/396 (23.23%), Postives = 166/396 (41.92%), Query Frame = 2
Query:  380 DTEYSCDQWFILISKLLQKEETRPRSLTVFINPIGGLKKGVQLYKDKISPIFELCGIKSTVTITKHRGEAEAYILKQKSF-DVDGFICVGGDGMLMELVQGLLLKARLDAGLSDDEHELYSKEFPAGLRVGIIPAGSTDTVAYSTI---GTK----DPITAALHVVLGRSIGLDAL---SVHCDNKFIRYNVSLMGYGFYGNLVAESESLR-WIGPRRYDWLGFKNFMSLEAYFGELKYLPAHSVKYGEPSDGIYCV--GRCSRCLDDSNVIP--SISHAED---------W-------------------ITVRDRFVAINSFLISCRCTKSPIGPAPFAHLGNGCTDLIIVREC-SRFNFLQHLLRSASYEDHFDFDFVETVRVKEFSFRSLQD 1432
            D E +     +++S+    +E    +L VFINP  G  K ++ + + + P  +   I+  V +T     A   ++ +      +G + + GDG++ E + G+L   R DA           + FP  L +GI+P+GS + +  S +   GTK      +  AL +    +   +++   SV  DN+     +S+ G+G   ++  +SE  R  +G  R+  +GF    +L +Y G L Y P +  K   PS  ++ V      + +DDS V    S+S +E+         W                   + + D FV I +  +S      P  P+            I+ ++  +R N  ++LL +  +E H D  FV+ V V       + +
Sbjct:   12 DAEENEQLTSVILSRKPPPQEQCRGNLLVFINPNSGTGKSLETFANTVGPKLDKSLIRYEVVVTTGPNHARNVLMTKADLGKFNGVLILSGDGLVFEALNGIL--CREDA----------FRIFPT-LPIGIVPSGSGNGLLCSVLSKYGTKMNEKSVMERALEIATSPTAKAESVALYSVKTDNQSYASFLSI-GWGLMADIDIDSEKWRKSLGHHRFTVMGFIRSCNLRSYKGRLTYRP-YKPKGFHPSSNVFSVYEKTTQQRIDDSKVKTNGSVSDSEEETMETKFQNWTLPDSDETLAVGSSDLEETVVIEDNFVNIYAVTLSHIAADGPFAPSAKLEDNRIHLSYILWKDIGTRVNIAKYLL-AIEHETHLDLPFVKHVEVSSMKLEVISE 391          
BLAST of Ceramide kinase vs. Ensembl Fly
Match: Cerk (gene:FBgn0037315 transcript:FBtr0078804)

HSP 1 Score: 215.698 bits (548), Expect = 2.917e-61
Identity = 149/465 (32.04%), Postives = 214/465 (46.02%), Query Frame = 2
Query:  446 RPRSLTVFINPIGGLKKGVQLYKDKISPIFELCGIKSTVTITKHRGEAEAYILKQKSFDVDGFICVGGDGMLMELVQGLLLKARLDAGLSDDEHELYSKEFPAGLRVGIIPAGSTDTVAYSTIGTKDPITAALHVVLGRSIGLDALSVHCDNKFIRYNVSLMGYGFYGNLVAESESLRWIGPRRYDWLGFKNFMSLEAYFGELKYLPAHSVKYGEPSDGI----------------YCVGRCSRC-----------------------------LDDSNVIP--------------------SISHAEDWITVRDRFVAINSFLI-----SCRCTKSPIGPAPFAHLGNGCTDLIIVRECSRFNFLQHLLRSASYE-DHFDFDFVETVRVKEFSFR-------------SLQDLQSSSETNIPKIQNYELPWNCDGEPLYCPRVHCKVHKQIIKLFASGIPHQAS 1588
            R R L VFINP GG K G Q Y+  + PIF+L G+ +T   T+   + +  +L       D   CVGGDG + E++ GL+ +   + GL  DE        PA L VG+IPAGSTDT+AYS  GT D  TAA+HV+LG+  GLD  SV      +R+  S++ YG+ G++ A+SE+ RW+GPRRY++ G K F++   Y  EL+ L    +    P + I                 C   C RC                              +DS++                      SIS   +    + + V  N F+I     +C C +SP G + ++HLG+GC DLI+V++ S  N ++ LL +A    D  +  FVE  R +EF FR             S Q +    E            WNCDGE +    +  + H Q+I++F  G PH  S
Sbjct:  202 RVRRLLVFINPYGGRKAGAQTYERHVRPIFQLAGVDATCITTQRANQVKDILLSHDLGVYDAVCCVGGDGTVAEVINGLIFRQMRELGL--DEQRPPYIPRPA-LPVGVIPAGSTDTIAYSMHGTADVRTAAIHVILGQHRGLDVCSVSNGQSLLRFCASVLSYGYLGDVAAQSENYRWMGPRRYEYSGVKAFLNNRGYDAELRMLEEPDLLLTTPLEDIPQSPDSVCSLGESVPSVCYANCQRCSFASSIQEQRSSLFIQEESKEAERNQQVETEDSHLAASEAALLRPRPRPGNLRLPTGSISSMRNLGNDQWKVVRGNFFMICGANITCACARSPNGISRYSHLGDGCLDLILVKKTSLLNNVRFLLNTAGRSGDIRNLPFVEVYRTREFRFRTFSASEEDYSLAGSCQPITPPEEMTAHSSSTEFSSWNCDGEVVTDLDITMRSHCQLIEVFMRG-PHSYS 662          
BLAST of Ceramide kinase vs. Ensembl Fly
Match: Cerk (gene:FBgn0037315 transcript:FBtr0078803)

HSP 1 Score: 215.698 bits (548), Expect = 2.917e-61
Identity = 149/465 (32.04%), Postives = 214/465 (46.02%), Query Frame = 2
Query:  446 RPRSLTVFINPIGGLKKGVQLYKDKISPIFELCGIKSTVTITKHRGEAEAYILKQKSFDVDGFICVGGDGMLMELVQGLLLKARLDAGLSDDEHELYSKEFPAGLRVGIIPAGSTDTVAYSTIGTKDPITAALHVVLGRSIGLDALSVHCDNKFIRYNVSLMGYGFYGNLVAESESLRWIGPRRYDWLGFKNFMSLEAYFGELKYLPAHSVKYGEPSDGI----------------YCVGRCSRC-----------------------------LDDSNVIP--------------------SISHAEDWITVRDRFVAINSFLI-----SCRCTKSPIGPAPFAHLGNGCTDLIIVRECSRFNFLQHLLRSASYE-DHFDFDFVETVRVKEFSFR-------------SLQDLQSSSETNIPKIQNYELPWNCDGEPLYCPRVHCKVHKQIIKLFASGIPHQAS 1588
            R R L VFINP GG K G Q Y+  + PIF+L G+ +T   T+   + +  +L       D   CVGGDG + E++ GL+ +   + GL  DE        PA L VG+IPAGSTDT+AYS  GT D  TAA+HV+LG+  GLD  SV      +R+  S++ YG+ G++ A+SE+ RW+GPRRY++ G K F++   Y  EL+ L    +    P + I                 C   C RC                              +DS++                      SIS   +    + + V  N F+I     +C C +SP G + ++HLG+GC DLI+V++ S  N ++ LL +A    D  +  FVE  R +EF FR             S Q +    E            WNCDGE +    +  + H Q+I++F  G PH  S
Sbjct:  202 RVRRLLVFINPYGGRKAGAQTYERHVRPIFQLAGVDATCITTQRANQVKDILLSHDLGVYDAVCCVGGDGTVAEVINGLIFRQMRELGL--DEQRPPYIPRPA-LPVGVIPAGSTDTIAYSMHGTADVRTAAIHVILGQHRGLDVCSVSNGQSLLRFCASVLSYGYLGDVAAQSENYRWMGPRRYEYSGVKAFLNNRGYDAELRMLEEPDLLLTTPLEDIPQSPDSVCSLGESVPSVCYANCQRCSFASSIQEQRSSLFIQEESKEAERNQQVETEDSHLAASEAALLRPRPRPGNLRLPTGSISSMRNLGNDQWKVVRGNFFMICGANITCACARSPNGISRYSHLGDGCLDLILVKKTSLLNNVRFLLNTAGRSGDIRNLPFVEVYRTREFRFRTFSASEEDYSLAGSCQPITPPEEMTAHSSSTEFSSWNCDGEVVTDLDITMRSHCQLIEVFMRG-PHSYS 662          
BLAST of Ceramide kinase vs. Ensembl Fly
Match: Sk1 (gene:FBgn0030300 transcript:FBtr0073497)

HSP 1 Score: 82.0333 bits (201), Expect = 5.368e-16
Identity = 57/216 (26.39%), Postives = 101/216 (46.76%), Query Frame = 2
Query:  452 RSLTVFINPIGGLKKGVQLYKDKISPIFELCGIKSTVTITKHRGEAEAYILKQKSF--DVDGFICVGGDGMLMELVQGLLLKARLDAGLSDDEHELYSKEFPAGLRVGIIPAGSTDTVAYSTI-------GTKDPITAALHVVLGRSIGLDALSVHC---DNKFIRYNVSLMGYGFYGNLVAESESLRWIGPRRYDWLGFKNFMSLEAYFGELKYL 1063
            + L + +NP  G  KG +L++ +++P+     ++  + IT H   A+ ++  ++       G +   GDG+  E++ GL+   R+D            +E P    +GIIP GS + +A S           K  + A L  + G+S  +D + V     D  F+ Y+   +G+G   ++  ESE LR IG +R+     K  + L +Y G + YL
Sbjct:  189 KQLLILLNPKSGSGKGRELFQKQVAPLLTEAEVQYDLQITTHPQYAKEFVRTRRDLLTRYSGIVVASGDGLFYEVLNGLM--ERMD-------WRRACRELP----LGIIPCGSGNGLAKSVAHHCNEPYEPKPILHATLTCMAGKSTPMDVVRVELATRDKHFVMYSFLSVGWGLIADIDIESERLRSIGAQRFTLWAIKRLIGLRSYKGRVSYL 391          
BLAST of Ceramide kinase vs. Ensembl Fly
Match: Sk1 (gene:FBgn0030300 transcript:FBtr0073498)

HSP 1 Score: 82.0333 bits (201), Expect = 5.368e-16
Identity = 57/216 (26.39%), Postives = 101/216 (46.76%), Query Frame = 2
Query:  452 RSLTVFINPIGGLKKGVQLYKDKISPIFELCGIKSTVTITKHRGEAEAYILKQKSF--DVDGFICVGGDGMLMELVQGLLLKARLDAGLSDDEHELYSKEFPAGLRVGIIPAGSTDTVAYSTI-------GTKDPITAALHVVLGRSIGLDALSVHC---DNKFIRYNVSLMGYGFYGNLVAESESLRWIGPRRYDWLGFKNFMSLEAYFGELKYL 1063
            + L + +NP  G  KG +L++ +++P+     ++  + IT H   A+ ++  ++       G +   GDG+  E++ GL+   R+D            +E P    +GIIP GS + +A S           K  + A L  + G+S  +D + V     D  F+ Y+   +G+G   ++  ESE LR IG +R+     K  + L +Y G + YL
Sbjct:  189 KQLLILLNPKSGSGKGRELFQKQVAPLLTEAEVQYDLQITTHPQYAKEFVRTRRDLLTRYSGIVVASGDGLFYEVLNGLM--ERMD-------WRRACRELP----LGIIPCGSGNGLAKSVAHHCNEPYEPKPILHATLTCMAGKSTPMDVVRVELATRDKHFVMYSFLSVGWGLIADIDIESERLRSIGAQRFTLWAIKRLIGLRSYKGRVSYL 391          
BLAST of Ceramide kinase vs. Ensembl Fly
Match: Sk2 (gene:FBgn0052484 transcript:FBtr0072984)

HSP 1 Score: 76.2554 bits (186), Expect = 3.662e-14
Identity = 71/285 (24.91%), Postives = 126/285 (44.21%), Query Frame = 2
Query:  296 AFKFIIYSVIPRLKRQHQLDILSTII-----SFDT----EYSCDQWFILISKLLQKE----------ETRPRSLTVFINPIGGLKKGVQLYKDKISPIFELCGIKSTVTITKHRGEAEAYILKQKSFDVDGFICV---GGDGMLMELVQGLLLKARLDAGLSDDEHELYSKEFPAGLRVGIIPAGSTDTVAYSTIG-------TKDPITAALHVVLGRSIGLDALSVHCDNKFIRYNVSLMGYGFYGNLVAESESLRWIGPRRYDWLGFKNFMSLEAYFGELKYL 1063
            AF ++   V+ +   + +L    T++     SFDT        D+W+  +   L +           + R R + V +NP  G     +++   ++P+     +   + +TKH   A  ++  +    +D + CV   GGDG+  E+V GLL +        D  H L        L +GIIP GS + +A S          +K  + AAL V+ GRS  +D + V   ++ + Y+   +G+G   ++  ESE +R +G +R+        ++L  Y G + YL
Sbjct:  144 AFLYVFAYVLKKRSLRSELHRERTVLTLRFRSFDTFEDNMREADRWYRSLRWQLHRTLEEIFVAPTVDERRRRVLVLLNPKSGSGDAREVFNMHVTPVLNEAEVPYDLYVTKHSNFAIEFLSTRC---LDAWCCVVAVGGDGLFHEIVNGLLQR-------QDWAHVL------PHLALGIIPCGSGNGLARSIAHCYNEPYFSKPVLGAALTVISGRSSPMDVVRVQLQSRSL-YSFLSIGWGLISDVDIESERIRMLGYQRFTVWTLYRLVNLRTYNGRISYL 411          
BLAST of Ceramide kinase vs. Ensembl Zebrafish
Match: zgc:158263 (zgc:158263 [Source:ZFIN;Acc:ZDB-GENE-070112-2262])

HSP 1 Score: 290.812 bits (743), Expect = 2.671e-90
Identity = 170/463 (36.72%), Postives = 239/463 (51.62%), Query Frame = 2
Query:  398 DQWFILISKLLQKEE-TRPRSLTVFINPIGGLKKGVQLYKDKISPIFELCGIKSTVTITKHRGEAEAYILKQKSFDVDGFICVGGDGMLMELVQGLLLKARLDAGLSDDEHELYSKEFPAGLRVGIIPAGSTDTVAYSTIGTKDPITAALHVVLGRSIGLDALSVHCDNKFIRYNVSLMGYGFYGNLVAESESLRWIGPRRYDWLGFKNFMSLEAYFGELKYLPAHSVKYGEPSDGIYCVGRCSRC----------------LDDSNVIPSISHAE-DWITVRDRFVAINSFLISCRCTKSPIGPAPFAHLGNGCTDLIIVRECSRFNFLQHLLRSASYEDHFDFDFVETVRVKEFSF----------------------RSLQDLQSSSETNIPKIQNYELP-------------------------------WNCDGEPLYCPRVHCKVHKQIIKLFASGI 1573
            DQW       L+    +RP  L VFINP GG K+G Q++   +SP+FEL GI S V +T+   +A  YILK+     DG ICVGGDGM  EL+ G++ + + +AG+S  E++L +   P  L +G+IPAGSTD V ++T+G  DP+T+ALH+++G S  LD  SVH  +  +RY+VSL+GYGFYG+++ ESE  RW+GP RYD+ G   +M   +Y G ++YLP+ S +   P D   C+  C  C                L  SNV    +  E +W+TV   F  I+   +S  C +SP G +P AHL +G  DLI+VR+ +  +FL +L R  + +D FD  FVE  RVK   F                      R L+D       NI       L                                WNCDGE L    + C++H Q+++LFA GI
Sbjct:  109 DQWITQHRTALKTHSPSRPHRLLVFINPFGGKKRGKQIFHSLVSPLFELAGISSHVVVTERANQARDYILKKDLTGFDGVICVGGDGMFSELLHGVIGRTQQEAGVS--ENDLTAMLQPCDLHIGVIPAGSTDCVCFTTVGINDPVTSALHIIIGDSQPLDVCSVHDQSTVVRYSVSLVGYGFYGDVLEESERHRWMGPLRYDYAGCMVYMCNRSYSGLVQYLPSDS-QISSPRDNTRCLSGCRVCSESKERLFPHFDSSTSLYSSNVSQYSTELEGEWVTVEGTFKCISLTCVSSSCPRSPKGLSPSAHLADGTADLILVRDTNPLSFLTYLHRHTNKQDQFDLPFVEVHRVKAVRFSLPPGEEEDFEEEEEKIQSSAERVLEDPGKLCSNNIAGHSQQHLTGQKEKATSTSRLKRPGFVCGPCCTKPRSVSVWNCDGEILPQTEISCRIHGQLVRLFARGI 568          
BLAST of Ceramide kinase vs. Ensembl Zebrafish
Match: cerk (ceramide kinase [Source:ZFIN;Acc:ZDB-GENE-041210-210])

HSP 1 Score: 290.812 bits (743), Expect = 1.604e-89
Identity = 153/369 (41.46%), Postives = 216/369 (58.54%), Query Frame = 2
Query:  566 ITKHRGEAEAYILKQKSFD-VDGFICVGGDGMLMELVQGLLLKARLDAGLSDDEHELYSKEFPAGLRVGIIPAGSTDTVAYSTIGTKDPITAALHVVLGRSIGLDALSVHCDNKFIRYNVSLMGYGFYGNLVAESESLRWIGPRRYDWLGFKNFMSLEAYFGELKYLPAHSVKYGEPSDGIYCVGRCSRCL----------DDSNVIPSISHAEDWITVRDRFVAINSFLISCRCTKSPIGPAPFAHLGNGCTDLIIVRECSRFNFLQHLLRSASYEDHFDFDFVETVRVKEFSFR-------SLQDLQSS------------SETNIPKIQNYELPWNCDGEPLYCPRVHCKVHKQIIKLFASGIPHQ 1582
            +T+H   A  ++  +      DG +CVGGDGM  E++ GL+ + + DAG+  DE+       P GLR+GIIPAGSTD + Y+T+G+ DP+T+ALH+V+G S  +D  SVH D++F+RY+VSL+GYGFYG+++ +SE  RW+GP RY+  G K F+S   Y G + +LPA     G P D + C   CS C           +D   +  +   + W  +R +F+AIN+  +SC C +SP G +P AHL +G TDLI+VR+CSR +FL+HLLR  + +D FD  FVE  RVK+F F        S  DL+ S             E       + +  WNCDGE L    +  +VH Q+IKLFA GI  Q
Sbjct:  264 VTEHANHARDHLKAEADLKKYDGVVCVGGDGMFSEIMHGLVSRTQQDAGV--DENSTEETLIPCGLRIGIIPAGSTDCICYATVGSNDPVTSALHMVVGDSQPMDVCSVHSDDRFLRYSVSLLGYGFYGDVLKDSERKRWMGPARYNISGVKTFLSHRYYEGTVSFLPAEE-NLGTPRDKVQCRSGCSICRRSSSDKLLSKEDEASVSDVDCRDTWTVIRGKFLAINAANMSCACPRSPKGLSPSAHLADGTTDLILVRKCSRVDFLRHLLRHTNKKDQFDHSFVEVYRVKQFRFTPRFQECGSEMDLRESRAGGKHFFCQICRENRACGCMSSQSNWNCDGEILPHTAIQVRVHCQLIKLFARGIEEQ 629          
BLAST of Ceramide kinase vs. Ensembl Zebrafish
Match: cerkl (ceramide kinase-like [Source:ZFIN;Acc:ZDB-GENE-070410-38])

HSP 1 Score: 221.476 bits (563), Expect = 4.146e-64
Identity = 144/412 (34.95%), Postives = 213/412 (51.70%), Query Frame = 2
Query:  395 CDQWFILISKLLQKEETRPRSLTVFINPIGGLKKGVQLYKDKISPIFELCGIKSTVTITKHRGEAEAYILKQKSF-DVDGFICVGGDGMLMELVQGLLLKARLDAGLSDDEHELYSKEFPAGLRVGIIPAGSTDTVAYSTIGTKDPITAALHVVLGRSIGLDALSVHCDNKFIRYNVSLMGYGFYGNLVAESESLRWIGP-RRYDWLGFKNFMSLEAYFGELKYLPAHSVKYGEPSD-----GIYCVGRCSRCLDDSNVIPSISHAEDWITVRDRFVAINSFLISCRCTKSPIGPAPFAHLGNGCTDLIIVRECSRFNFLQHLLRSASYEDHFDFDFVETVRVKEFSFRS----------LQDLQSSSETNIPKIQNY-ELPWNCDGEPLYCP-RVHCKVHKQIIKLFASGI 1573
            C+ WF  + +LL   + RP+SL VF+NPI   K+  Q+Y D+++P+F+L  I+  VTIT+ +G A + ILK  S  D DG +CVGGDG + E+  GLLL+A++DAG   D   +++    A L +G+IPAGSTD VA S  G +   TAALH+++G    +D  S  C  + +R+  S M +GF G  +A +E  RW+ P +R ++   K    L+    EL +L A   +  + ++     G  C G                   DW + +  F+ I+   I C C+ +P G AP   L NG   LI V   SR  F++HL R  S  + F F F+ET  VK    R            ++ + S   N P I +    PWN DG+ L  P  +  +VH Q++ LF S +
Sbjct:  177 CEIWFKTLKELLNGFKNRPKSLKVFVNPISHKKEAYQIYLDEVAPLFKLADIQVDVTITERKGHALS-ILKDCSLEDYDGVVCVGGDGSVSEVAHGLLLRAQMDAGRDTD--SIFTP-VQAALPLGVIPAGSTDVVACSVHGIRRAATAALHIIMGHHQPVDVCSFSCMGRLLRFGFSAM-FGFGGRTLALAERHRWMPPSQRREFALIKTLAKLKPEDCELSFLTAKGAEDQKKAELNGDGGDICEG-------------------DWQSRKGLFLNISIMAIPCLCSMAPRGLAPNTRLNNGSMALISVGNTSRSEFIKHLKRYNSTNNQFGFSFIETHSVKAVRLRPSSQSSWTDDVSEENEESDSKNTPIISSEGTYPWNIDGDLLDVPSELLIRVHPQLLTLFGSDV 564          
BLAST of Ceramide kinase vs. Ensembl Zebrafish
Match: SPHK1 (sphingosine kinase 1 [Source:HGNC Symbol;Acc:HGNC:11240])

HSP 1 Score: 76.2554 bits (186), Expect = 1.503e-14
Identity = 87/376 (23.14%), Postives = 146/376 (38.83%), Query Frame = 2
Query:  464 VFINPIGGLKKGVQLYKDKISPIFELCGIKSTVTITKHRGEAEAYILKQKSFDVDGFICVGGDGMLMELVQGLLLKARLDAGLSDDEHELYSKEFPAGLRVGIIPAGSTDTVAYST--------IGTKDPITA-ALHVVLGRSIGLDALSVHCDNKFIRYNVSLMGYGFYGNLVAESESLRWIGPRRYDWLGFKNFMSLEAYFGELKYLPAHSVKYGEPSDGIYCVGRCSRCLDDSNVIP-SISHAEDWITVRDRFVAINSFLISCRCTKSPIGPAPFAHLGNGCTDLIIVRECSRFNFLQHLLRSASYEDHFDFDFVETVRVKEFSFRSLQDLQSSSETNIPKIQNYELPWNCDGEPLYCPRVHCKVHKQIIKLF 1561
            V +NP  G  + +  Y   +  +     I  T+ IT+ +  A   +        D  I + GDG+L E+V GL+            E   + K     L  GI+P GS + +A S         +  +D +T+    +  G   GLD +SV   +    ++   + +GF  ++  ESE+ R IG  R+         SL  Y G+L YLPA     GE +D +   G     L+D  + P      ++W  V +R   +   +     ++  +  AP A   +G   L  +        L  L R+     H D      V V+  + R L+ L +     +            DGE ++   V  +VH+   ++ 
Sbjct:    2 VLVNPQSGRGQAMAQYNGHVQRMLTEADIPHTLVITERQNHARDLVRSTDLSQWDALIILSGDGLLFEVVNGLM------------ERPDWEKAIQTPL--GILPGGSGNALAASVHHYTRASPVWGEDLLTSCGFLLCKGLVSGLDLISVQLSSGARLFSFLSLAWGFVADVDIESETFRQIGALRFILGTLVRLASLRIYQGKLAYLPA-----GE-TDSVSSTGE--NLLNDHLMAPFGQPVPQNWTLVEEREFVLVLAMFQSHLSEDLMA-APGARADDGIIHLFYLTAGVSRATLLRLFRAMQSGTHLDCGCAHLVYVRAQAIR-LEPLSADGVLTV------------DGERVHYGPVQAQVHRAAARII 341          
BLAST of Ceramide kinase vs. Ensembl Zebrafish
Match: agk (acylglycerol kinase [Source:NCBI gene;Acc:334270])

HSP 1 Score: 67.0106 bits (162), Expect = 2.375e-11
Identity = 46/185 (24.86%), Postives = 87/185 (47.03%), Query Frame = 2
Query:  452 RSLTVFINPIGGLKKGVQLYKDKISPIFELCGIKSTVTITKHRGEAEAYILKQKSFDVDGFICVGGDGMLMELVQGLLLKARLDAGLSDDEHELYSKEFPAGLRVGIIPAGSTDTVAYSTIGTKDP-----ITAALHVVLGRSIGLDALSVHCDNKFIRYNVSLMGYGFYGNLVAESESLRWIGP 991
            +  TV +NP     K  QL++   +PI  L G++  +  T + G+A+   L +     D  I  GGDG L E++ GLL +A         + E++SK       +G IP GS+++++ S     D       +A L ++ G ++ LD L +  + +   + +  + +G + ++        ++GP
Sbjct:   64 KKATVILNPAACKGKANQLFEKNAAPILHLAGVEVKIVKTDYEGQAKK--LMELMEQTDMLIIAGGDGTLQEVITGLLRRA---------DEEIFSK-----TPIGFIPLGSSNSLSQSLHLVSDNKVQHITSATLSILKGETVPLDVLQIKGEKEQPVFALLGLRWGAFRDVATSISKYWYLGP 232          
BLAST of Ceramide kinase vs. Ensembl Xenopus
Match: CERK (ceramide kinase [Source:NCBI gene;Acc:100487080])

HSP 1 Score: 327.405 bits (838), Expect = 1.566e-104
Identity = 174/442 (39.37%), Postives = 250/442 (56.56%), Query Frame = 2
Query:  335 KRQHQLDILSTIISFDTEYSCDQWFILISKLLQKEETRPRSLTVFINPIGGLKKGVQLYKDKISPIFELCGIKSTVTITKHRGEAEAYILKQKSFDVDGFICVGGDGMLMELVQGLLLKARLDAGLSDDEHELYSKEFPAGLRVGIIPAGSTDTVAYSTIGTKDPITAALHVVLGRSIGLDALSVHCDNKFIRYNVSLMGYGFYGNLVAESESLRWIGPRRYDWLGFKNFMSLEAYFGELKYLPAHSVKYGEPSDGIYCVGRCSRCLDDSNVIPSISHAE-----------DWITVRDRFVAINSFLISCRCTKSPIGPAPFAHLGNGCTDLIIVRECSRFNFLQHLLRSASYEDHFDFDFVETVRVKEFSFRSLQ---------DLQSSSETNIPKI---------QNYELPWNCDGEPLYCPRVHCKVHKQIIKLFASGI 1573
            KR+H+            E    QW   +  +L+++  RP+ L V+INP GG K+G Q+Y++K++P+F   GI + V +T++   A   + +      DG +CVGGDGM  E++ GL+ + + D+ +  D +   ++     +R+GIIPAGSTD V Y+TIG  DP T+ALH++LG    LD  SVH    F++Y+VSL+GYGFYG+++  SE  RW+GP RYD  GFK F++   Y G + + PA  V  G P D I C  RC  C   S  +      +           DW T++ +F+AIN+  +SC C +SP G +P AHLG+G  DLI+VR+CSR +FL+HL+R  S +D FDF FVE  RVK F F             D+ S  + N P+I          +    WNCDGE +    +  +VH Q+IKLFA GI
Sbjct:   95 KRKHRWRCKEVTFWCSDEQLFYQWLQALHDILEQQTHRPKRLLVYINPYGGKKRGKQIYENKVAPLFSAAGICTDVIVTEYANHARDNLYEVNVEKYDGVVCVGGDGMFSEVLHGLIGRVQKDSDV--DHNNPNAQLSRCNIRIGIIPAGSTDCVCYATIGINDPETSALHIILGDCQPLDVCSVHHKRTFLKYSVSLLGYGFYGDVLKYSEKNRWLGPARYDVSGFKTFLTHHCYEGSVSFQPAKWV-LGSPRDQIICTSRCYICRQSSKQLEEQQKTQACGSEHRDQDDDWTTIKGKFMAINAVSMSCACPRSPKGLSPAAHLGDGSADLILVRKCSRLDFLRHLIRHTSNKDQFDFPFVEVYRVKNFQFTPKHFEDEDTESTDIGSIGKKNFPQICTDHPSCGCNHVNSIWNCDGETVDQTAIEMRVHCQLIKLFARGI 533          
BLAST of Ceramide kinase vs. Ensembl Xenopus
Match: CERK (ceramide kinase [Source:NCBI gene;Acc:100487080])

HSP 1 Score: 327.405 bits (838), Expect = 3.040e-104
Identity = 174/442 (39.37%), Postives = 250/442 (56.56%), Query Frame = 2
Query:  335 KRQHQLDILSTIISFDTEYSCDQWFILISKLLQKEETRPRSLTVFINPIGGLKKGVQLYKDKISPIFELCGIKSTVTITKHRGEAEAYILKQKSFDVDGFICVGGDGMLMELVQGLLLKARLDAGLSDDEHELYSKEFPAGLRVGIIPAGSTDTVAYSTIGTKDPITAALHVVLGRSIGLDALSVHCDNKFIRYNVSLMGYGFYGNLVAESESLRWIGPRRYDWLGFKNFMSLEAYFGELKYLPAHSVKYGEPSDGIYCVGRCSRCLDDSNVIPSISHAE-----------DWITVRDRFVAINSFLISCRCTKSPIGPAPFAHLGNGCTDLIIVRECSRFNFLQHLLRSASYEDHFDFDFVETVRVKEFSFRSLQ---------DLQSSSETNIPKI---------QNYELPWNCDGEPLYCPRVHCKVHKQIIKLFASGI 1573
            KR+H+            E    QW   +  +L+++  RP+ L V+INP GG K+G Q+Y++K++P+F   GI + V +T++   A   + +      DG +CVGGDGM  E++ GL+ + + D+ +  D +   ++     +R+GIIPAGSTD V Y+TIG  DP T+ALH++LG    LD  SVH    F++Y+VSL+GYGFYG+++  SE  RW+GP RYD  GFK F++   Y G + + PA  V  G P D I C  RC  C   S  +      +           DW T++ +F+AIN+  +SC C +SP G +P AHLG+G  DLI+VR+CSR +FL+HL+R  S +D FDF FVE  RVK F F             D+ S  + N P+I          +    WNCDGE +    +  +VH Q+IKLFA GI
Sbjct:  119 KRKHRWRCKEVTFWCSDEQLFYQWLQALHDILEQQTHRPKRLLVYINPYGGKKRGKQIYENKVAPLFSAAGICTDVIVTEYANHARDNLYEVNVEKYDGVVCVGGDGMFSEVLHGLIGRVQKDSDV--DHNNPNAQLSRCNIRIGIIPAGSTDCVCYATIGINDPETSALHIILGDCQPLDVCSVHHKRTFLKYSVSLLGYGFYGDVLKYSEKNRWLGPARYDVSGFKTFLTHHCYEGSVSFQPAKWV-LGSPRDQIICTSRCYICRQSSKQLEEQQKTQACGSEHRDQDDDWTTIKGKFMAINAVSMSCACPRSPKGLSPAAHLGDGSADLILVRKCSRLDFLRHLIRHTSNKDQFDFPFVEVYRVKNFQFTPKHFEDEDTESTDIGSIGKKNFPQICTDHPSCGCNHVNSIWNCDGETVDQTAIEMRVHCQLIKLFARGI 557          
BLAST of Ceramide kinase vs. Ensembl Xenopus
Match: CERK (ceramide kinase [Source:NCBI gene;Acc:100487080])

HSP 1 Score: 310.457 bits (794), Expect = 3.378e-99
Identity = 164/421 (38.95%), Postives = 237/421 (56.29%), Query Frame = 2
Query:  335 KRQHQLDILSTIISFDTEYSCDQWFILISKLLQKEETRPRSLTVFINPIGGLKKGVQLYKDKISPIFELCGIKSTVTITKHRGEAEAYILKQKSFDVDGFICVGGDGMLMELVQGLLLKARLDAGLSDDEHELYSKEFPAGLRVGIIPAGSTDTVAYSTIGTKDPITAALHVVLGRSIGLDALSVHCDNKFIRYNVSLMGYGFYGNLVAESESLRWIGPRRYDWLGFKNFMSLEAYFGELKYLPAHSVKYGEPSDGIYCVGRCSRCLDDSNVIPSISHAE-----------DWITVRDRFVAINSFLISCRCTKSPIGPAPFAHLGNGCTDLIIVRECSRFNFLQHLLRSASYEDHFDFDFVETVRVKEFSFRSLQ---------DLQSSSETNIPKI---------QNYELPWNCDGEPL 1510
            KR+H+            E    QW   +  +L+++  RP+ L V+INP GG K+G Q+Y++K++P+F   GI + V +T++   A   + +      DG +CVGGDGM  E++ GL+ + + D+ +  D +   ++     +R+GIIPAGSTD V Y+TIG  DP T+ALH++LG    LD  SVH    F++Y+VSL+GYGFYG+++  SE  RW+GP RYD  GFK F++   Y G + + PA  V  G P D I C  RC  C   S  +      +           DW T++ +F+AIN+  +SC C +SP G +P AHLG+G  DLI+VR+CSR +FL+HL+R  S +D FDF FVE  RVK F F             D+ S  + N P+I          +    WNCDGE +
Sbjct:   15 KRKHRWRCKEVTFWCSDEQLFYQWLQALHDILEQQTHRPKRLLVYINPYGGKKRGKQIYENKVAPLFSAAGICTDVIVTEYANHARDNLYEVNVEKYDGVVCVGGDGMFSEVLHGLIGRVQKDSDV--DHNNPNAQLSRCNIRIGIIPAGSTDCVCYATIGINDPETSALHIILGDCQPLDVCSVHHKRTFLKYSVSLLGYGFYGDVLKYSEKNRWLGPARYDVSGFKTFLTHHCYEGSVSFQPAKWV-LGSPRDQIICTSRCYICRQSSKQLEEQQKTQACGSEHRDQDDDWTTIKGKFMAINAVSMSCACPRSPKGLSPAAHLGDGSADLILVRKCSRLDFLRHLIRHTSNKDQFDFPFVEVYRVKNFQFTPKHFEDEDTESTDIGSIGKKNFPQICTDHPSCGCNHVNSIWNCDGETV 432          
BLAST of Ceramide kinase vs. Ensembl Xenopus
Match: CERK (ceramide kinase [Source:NCBI gene;Acc:100487080])

HSP 1 Score: 312.768 bits (800), Expect = 3.415e-99
Identity = 165/419 (39.38%), Postives = 238/419 (56.80%), Query Frame = 2
Query:  335 KRQHQLDILSTIISFDTEYSCDQWFILISKLLQKEETRPRSLTVFINPIGGLKKGVQLYKDKISPIFELCGIKSTVTITKHRGEAEAYILKQKSFDVDGFICVGGDGMLMELVQGLLLKARLDAGLSDDEHELYSKEFPAGLRVGIIPAGSTDTVAYSTIGTKDPITAALHVVLGRSIGLDALSVHCDNKFIRYNVSLMGYGFYGNLVAESESLRWIGPRRYDWLGFKNFMSLEAYFGELKYLPAHSVKYGEPSDGIYCVGRCSRCLDDSNVIP---------SISHAEDWITVRDRFVAINSFLISCRCTKSPIGPAPFAHLGNGCTDLIIVRECSRFNFLQHLLRSASYEDHFDFDFVETVRVKEFSFRSLQ---------DLQSSSETNIPKI---------QNYELPWNCDGEPL 1510
            KR+H+            E    QW   +  +L+++  RP+ L V+INP GG K+G Q+Y++K++P+F   GI + V +T++   A   + +      DG +CVGGDGM  E++ GL+ + + D+ +  D +   ++     +R+GIIPAGSTD V Y+TIG  DP T+ALH++LG    LD  SVH    F++Y+VSL+GYGFYG+++  SE  RW+GP RYD  GFK F++   Y G + + PA  V  G P D I C  RC  C   S  +          S    +DW T++ +F+AIN+  +SC C +SP G +P AHLG+G  DLI+VR+CSR +FL+HL+R  S +D FDF FVE  RVK F F             D+ S  + N P+I          +    WNCDGE +
Sbjct:   80 KRKHRWRCKEVTFWCSDEQLFYQWLQALHDILEQQTHRPKRLLVYINPYGGKKRGKQIYENKVAPLFSAAGICTDVIVTEYANHARDNLYEVNVEKYDGVVCVGGDGMFSEVLHGLIGRVQKDSDV--DHNNPNAQLSRCNIRIGIIPAGSTDCVCYATIGINDPETSALHIILGDCQPLDVCSVHHKRTFLKYSVSLLGYGFYGDVLKYSEKNRWLGPARYDVSGFKTFLTHHCYEGSVSFQPAKWV-LGSPRDQIICTSRCYICRQSSKQLEEQQKTQACGSEHRDDDWTTIKGKFMAINAVSMSCACPRSPKGLSPAAHLGDGSADLILVRKCSRLDFLRHLIRHTSNKDQFDFPFVEVYRVKNFQFTPKHFEDEDTESTDIGSIGKKNFPQICTDHPSCGCNHVNSIWNCDGETV 495          
BLAST of Ceramide kinase vs. Ensembl Xenopus
Match: CERK (ceramide kinase [Source:NCBI gene;Acc:100487080])

HSP 1 Score: 311.612 bits (797), Expect = 9.080e-99
Identity = 167/418 (39.95%), Postives = 237/418 (56.70%), Query Frame = 2
Query:  335 KRQHQLDILSTIISFDTEYSCDQWFILISKLLQKEETRPRSLTVFINPIGGLKKGVQLYKDKISPIFELCGIKSTVTITKHRGEAEAYILKQKSFDVDGFICVGGDGMLMELVQGLLLKARLDAGLSDDEHELYSKEFP-AGLRVGIIPAGSTDTVAYSTIGTKDPITAALHVVLGRSIGLDALSVHCDNKFIRYNVSLMGYGFYGNLVAESESLRWIGPRRYDWLGFKNFMSLEAYFGELKYLPAHSVKYGEPSDGIYCVGRCSRCLDDSNVIP---------SISHAEDWITVRDRFVAINSFLISCRCTKSPIGPAPFAHLGNGCTDLIIVRECSRFNFLQHLLRSASYEDHFDFDFVETVRVKEFSFRSLQ---------DLQSSSETNIPKI---------QNYELPWNCDGE 1504
            KR+H+            E    QW   +  +L+++  RP+ L V+INP GG K+G Q+Y++K++P+F   GI + V +T++   A   + +      DG +CVGGDGM  E++ GL+ + + D   SD +H   + +     +R+GIIPAGSTD V Y+TIG  DP T+ALH++LG    LD  SVH    F++Y+VSL+GYGFYG+++  SE  RW+GP RYD  GFK F++   Y G + + PA  V  G P D I C  RC  C   S  +          S    +DW T++ +F+AIN+  +SC C +SP G +P AHLG+G  DLI+VR+CSR +FL+HL+R  S +D FDF FVE  RVK F F             D+ S  + N P+I          +    WNCDGE
Sbjct:   87 KRKHRWRCKEVTFWCSDEQLFYQWLQALHDILEQQTHRPKRLLVYINPYGGKKRGKQIYENKVAPLFSAAGICTDVIVTEYANHARDNLYEVNVEKYDGVVCVGGDGMFSEVLHGLIGRVQKD---SDVDHNNPNAQLSRCNIRIGIIPAGSTDCVCYATIGINDPETSALHIILGDCQPLDVCSVHHKRTFLKYSVSLLGYGFYGDVLKYSEKNRWLGPARYDVSGFKTFLTHHCYEGSVSFQPAKWV-LGSPRDQIICTSRCYICRQSSKQLEEQQKTQACGSEHRDDDWTTIKGKFMAINAVSMSCACPRSPKGLSPAAHLGDGSADLILVRKCSRLDFLRHLIRHTSNKDQFDFPFVEVYRVKNFQFTPKHFEDEDTESTDIGSIGKKNFPQICTDHPSCGCNHVNSIWNCDGE 500          
BLAST of Ceramide kinase vs. Ensembl Mouse
Match: Cerk (ceramide kinase [Source:MGI Symbol;Acc:MGI:2386052])

HSP 1 Score: 333.954 bits (855), Expect = 1.855e-107
Identity = 183/497 (36.82%), Postives = 281/497 (56.54%), Query Frame = 2
Query:  182 RRILINDIINVTK--DCNFLLNNRLIQSPKILMKQLDNQEAFKFIIYSVIPRLKRQHQLDILSTIISFDTEYSCDQWFILISKLLQKEETRPRSLTVFINPIGGLKKGVQLYKDKISPIFELCGIKSTVTITKHRGEAEAYILKQKSFDVDGFICVGGDGMLMELVQGLLLKARLDAGLSDDEHELYSKEFPAGLRVGIIPAGSTDTVAYSTIGTKDPITAALHVVLGRSIGLDALSVHCDNKFIRYNVSLMGYGFYGNLVAESESLRWIGPRRYDWLGFKNFMSLEAYFGELKYLPA-HSVKYGEPSDGIYCVGRCSRCL--------DDSNVIPSISHA---EDWITVRDRFVAINSFLISCRCTKSPIGPAPFAHLGNGCTDLIIVRECSRFNFLQHLLRSASYEDHFDFDFVETVRVKEFSFRSLQDLQSSSETNIPKIQNY---------------ELPWNCDGEPLYCPRVHCKVHKQIIKLFASGIPHQA 1585
            R +L+++II V +  DC          +      +++N   F F ++ V  +  R H+            E  C  W   +  LL+   +RP+ L VFINP GG  +G ++Y+  ++P+F L  I + + IT+H  +A+  + +  +   DG +CVGGDGM  E++ G++ + +  AG+  D +   +   P+ LR+GIIPAGSTD V YST+GT D  T+ALH+++G S+ +D  SVH  N  +RY+VSL+GYGFYG+L+ +SE  RW+G  RYD+ G K F+S + Y G L +LPA H+V  G P D   C   C  C         ++   +  + +A   E+W     +F+AIN+  +SC C +SP G +PFAHLG+G +DLI++R+CSRFNFL+ L+R  + ED FDF FVE  RVK+F F S       +++   + Q +                  WNCDGE ++ P +  +VH Q+++LFA GI  ++
Sbjct:   50 RSVLVSEIIAVEEKDDCE-------KHASSGRWHKMEN--PFAFTVHRV--KRVRHHRWKWARVTFWSADEQLCHLWLQTLRGLLESLTSRPKHLLVFINPFGGKGQGKRIYEKTVAPLFTLASITTEIIITEHANQAKETLYEINTDSYDGIVCVGGDGMFSEVLHGVIGRTQQSAGI--DPNHPRAVLVPSTLRIGIIPAGSTDCVCYSTVGTNDAETSALHIIIGDSLAIDVSSVHYHNTLLRYSVSLLGYGFYGDLIKDSEKKRWMGLVRYDFSGLKTFLSHQYYEGTLSFLPAQHTV--GSPRDNKPCRAGCFVCRQSKQQLEEEEKKALYGLENAEEMEEWQVTCGKFLAINATNMSCACPRSPGGLSPFAHLGDGSSDLILIRKCSRFNFLRFLIRHTNQEDQFDFTFVEVYRVKKFHFTSKHVEDEDNDSKEQEKQKFGKICKDRPSCTCSASRSSWNCDGEVMHSPAIEVRVHCQLVRLFARGIEEES 531          
BLAST of Ceramide kinase vs. Ensembl Mouse
Match: Cerkl (ceramide kinase-like [Source:MGI Symbol;Acc:MGI:3037816])

HSP 1 Score: 194.897 bits (494), Expect = 1.217e-54
Identity = 126/425 (29.65%), Postives = 209/425 (49.18%), Query Frame = 2
Query:  335 KRQHQLDILSTIISFDTEYSCDQWFILISKLLQKEETRPRSLTVFINPIGGLKKGVQLYKDKISPIFELCGIKSTVTITKHRGEAEAYILKQKSFDVDGFICVGGDGMLMELVQGLLLKARLDAGLSDD-EHELYSKEFPAGLRVGIIPAGSTDTVAYSTIGTKDPITAALHVVLGRSIGLDALSVHCDNKFIRYNVSLMGYGFYGNLVAESESLRWIGP-RRYDWLGFKNFMSLEAYFGELKYLPAHSVKYGEPSDGIYCVGRCSRCLDDSNVIPSISHAED-----WITVRDRFVAINSFLISCRCTKSPIGPAPFAHLGNGCTDLIIVRECSRFNFLQHLLRSASYEDHFDFDFVETVRVKEFSFRSLQDLQSSSET----NIPKIQNYELPWNCDGEPL-YCPRVHCKVHKQIIKLFASGI 1573
            +R    D    +I+F  ++ CD WF    K+L    +RP++L + +NP    K+ V +Y +K+ P+ +L GI++ VTIT++ G A + + + +    DG +CVGGDG   E  + LLL+A+ +AG+  D    L   E P    +G IPAGST+ +A+S  GT   +TA +H++LG    +D  +     K + +  S M +GF G  +A +E  RW+ P +R D+   K    L+    ++ +L A                    C  +     S   AE      W T++ +F+ I+   + C C+ +P G  P   L NG   L +VR  +R  F++HL R +S ++ F+F FVET  ++E       +    S      N      +  PWN DG+ +     VH ++H ++I+L+   +
Sbjct:  113 QRNKLKDSTLDLINFSEDH-CDIWFRQFKKILDGFTSRPKALKILLNPQSHRKESVHVYYEKVEPLLKLAGIETDVTITEYEGHALSLLDECELRGFDGVVCVGGDGSASEAARALLLRAQKNAGVEMDCIPTLVGAELP----LGFIPAGSTNALAHSLFGTPHVVTATMHIILGHIRSVDVCTFSSAGKLLCFGFSAM-FGFGGRTLALAEKYRWMSPSQRRDFAIIKALAKLKPEDCKISFLLAG-------------------CSQNKQERKSQRSAESDCGGHWQTIQGQFLNISIMAMPCPCSMAPRGFTPDTRLHNGSMALRVVRNTTRSEFVKHLKRHSSVKNQFNFPFVETYIIEEVKIHPKSNSNGYSPQEEGGNHTTASEHGFPWNVDGDLMEAASEVHIRLHPRLIRLYGGSL 512          
BLAST of Ceramide kinase vs. Ensembl Mouse
Match: Cerk (ceramide kinase [Source:MGI Symbol;Acc:MGI:2386052])

HSP 1 Score: 152.14 bits (383), Expect = 4.825e-42
Identity = 84/228 (36.84%), Postives = 122/228 (53.51%), Query Frame = 2
Query:  983 IGPRRYDWLGFKNFMSLEAYFGELKYLPA-HSVKYGEPSDGIYCVGRCSRCLDDSNVIP-----------SISHAEDWITVRDRFVAINSFLISCRCTKSPIGPAPFAHLGNGCTDLIIVRECSRFNFLQHLLRSASYEDHFDFDFVETVRVKEFSFRSLQDLQSSSETNIPKIQNY---------------ELPWNCDGEPLYCPRVHCKVHKQIIKLFASGIPHQA 1585
            +G  RYD+ G K F+S + Y G L +LPA H+V  G P D   C   C  C      +            +    E+W     +F+AIN+  +SC C +SP G +PFAHLG+G +DLI++R+CSRFNFL+ L+R  + ED FDF FVE  RVK+F F S       +++   + Q +                  WNCDGE ++ P +  +VH Q+++LFA GI  ++
Sbjct:    1 MGLVRYDFSGLKTFLSHQYYEGTLSFLPAQHTV--GSPRDNKPCRAGCFVCRQSKQQLEEEEKKALYGLENAEEMEEWQVTCGKFLAINATNMSCACPRSPGGLSPFAHLGDGSSDLILIRKCSRFNFLRFLIRHTNQEDQFDFTFVEVYRVKKFHFTSKHVEDEDNDSKEQEKQKFGKICKDRPSCTCSASRSSWNCDGEVMHSPAIEVRVHCQLVRLFARGIEEES 226          
BLAST of Ceramide kinase vs. Ensembl Mouse
Match: Sphk1 (sphingosine kinase 1 [Source:MGI Symbol;Acc:MGI:1316649])

HSP 1 Score: 88.1965 bits (217), Expect = 2.458e-18
Identity = 86/367 (23.43%), Postives = 147/367 (40.05%), Query Frame = 2
Query:  446 RPRSLTVFINPIGGLKKGVQLYKDKISPIFELCGIKSTVTITKHRGEAEAYILKQKSFDVDGFICVGGDGMLMELVQGLLLKARLDAGLSDDEHELYSKEFPAGLRVGIIPAGSTDTVAYSTIGTKD-PITAALHVVLGRSIGLDALSVHCDNKFIRYNVSLMGYGFYGNLVAESESLRWIGPRRYDWLGFKNFMSLEAYFGELKYLPAHSVKYGEPSDGIYCVGRCSRCLDDSNVIP-SISHAEDWITVRDRFVAINSFLISCRCTKSPIGPAPFAHLGNGCTDLIIVRECSRFNFLQHLLRSASYEDHFDFDFVETVRVKEFSFRSLQDLQSSSETNIPKIQNYELPWNCDGEPLYCPRVHCKVH 1540
            RP  + V +NP GG  K +QL++ ++ P  E   I   + +T+ +  A   +  ++    D    + GDG++ E+V GL+ +   +  +      L     P G     + A       Y  +  +D  I   L +   R   ++ LS+H  +    Y+V  + +GF  ++  ESE  R +G  R+    F    SL  Y G+L YLP  +V    P+  +   G       D++++P        W  V ++   +   L+    + S +  AP      G   L  VR       L  L  +     H + D    V V   +FR    L+  S+  +         ++ DGE + C  V  +VH
Sbjct:   19 RPCRVLVLLNPQGGKGKALQLFQSRVQPFLEEAEITFKLILTERKNHARELVCAEELGHWDALAVMSGDGLMHEVVNGLMERPDWETAIQKPLCSL-----PGG-SGNALAASVNHYAGYEQVTNEDLLINCTLLLCRRRLSPMNLLSLHTASGLRLYSVLSLSWGFVADVDLESEKYRRLGEIRFTVGTFFRLASLRIYQGQLAYLPVGTVASKRPASTLVQKGPV-----DTHLVPLEEPVPSHWTVVPEQDFVLVLVLLHTHLS-SELFAAPMGRCEAGVMHLFYVRAGVSRAALLRLFLAMQKGKHMELDCPYLVHVPVVAFR----LEPRSQRGV---------FSVDGELMVCEAVQGQVH 360          
BLAST of Ceramide kinase vs. Ensembl Mouse
Match: Sphk1 (sphingosine kinase 1 [Source:MGI Symbol;Acc:MGI:1316649])

HSP 1 Score: 88.1965 bits (217), Expect = 2.789e-18
Identity = 86/375 (22.93%), Postives = 150/375 (40.00%), Query Frame = 2
Query:  446 RPRSLTVFINPIGGLKKGVQLYKDKISPIFELCGIKSTVTITKHRGEAEAYILKQKSFDVDGFICVGGDGMLMELVQGLLLKARLDAGLSDDEHELYSKEFPAGLRVGIIPAGSTDTVA--------YSTIGTKD-PITAALHVVLGRSIGLDALSVHCDNKFIRYNVSLMGYGFYGNLVAESESLRWIGPRRYDWLGFKNFMSLEAYFGELKYLPAHSVKYGEPSDGIYCVGRCSRCLDDSNVIP-SISHAEDWITVRDRFVAINSFLISCRCTKSPIGPAPFAHLGNGCTDLIIVRECSRFNFLQHLLRSASYEDHFDFDFVETVRVKEFSFRSLQDLQSSSETNIPKIQNYELPWNCDGEPLYCPRVHCKVH 1540
            RP  + V +NP GG  K +QL++ ++ P  E   I   + +T+ +  A   +  ++    D    + GDG++ E+V GL+ +   +  +                 +  +P GS + +A        Y  +  +D  I   L +   R   ++ LS+H  +    Y+V  + +GF  ++  ESE  R +G  R+    F    SL  Y G+L YLP  +V    P+  +   G       D++++P        W  V ++   +   L+    + S +  AP      G   L  VR       L  L  +     H + D    V V   +FR    L+  S+  +         ++ DGE + C  V  +VH
Sbjct:   12 RPCRVLVLLNPQGGKGKALQLFQSRVQPFLEEAEITFKLILTERKNHARELVCAEELGHWDALAVMSGDGLMHEVVNGLMERPDWETAIQKP--------------LCSLPGGSGNALAASVNHYAGYEQVTNEDLLINCTLLLCRRRLSPMNLLSLHTASGLRLYSVLSLSWGFVADVDLESEKYRRLGEIRFTVGTFFRLASLRIYQGQLAYLPVGTVASKRPASTLVQKGPV-----DTHLVPLEEPVPSHWTVVPEQDFVLVLVLLHTHLS-SELFAAPMGRCEAGVMHLFYVRAGVSRAALLRLFLAMQKGKHMELDCPYLVHVPVVAFR----LEPRSQRGV---------FSVDGELMVCEAVQGQVH 353          
BLAST of Ceramide kinase vs. UniProt/SwissProt
Match: sp|Q8K4Q7|CERK1_MOUSE (Ceramide kinase OS=Mus musculus OX=10090 GN=Cerk PE=1 SV=2)

HSP 1 Score: 333.954 bits (855), Expect = 1.297e-106
Identity = 183/497 (36.82%), Postives = 281/497 (56.54%), Query Frame = 2
Query:  182 RRILINDIINVTK--DCNFLLNNRLIQSPKILMKQLDNQEAFKFIIYSVIPRLKRQHQLDILSTIISFDTEYSCDQWFILISKLLQKEETRPRSLTVFINPIGGLKKGVQLYKDKISPIFELCGIKSTVTITKHRGEAEAYILKQKSFDVDGFICVGGDGMLMELVQGLLLKARLDAGLSDDEHELYSKEFPAGLRVGIIPAGSTDTVAYSTIGTKDPITAALHVVLGRSIGLDALSVHCDNKFIRYNVSLMGYGFYGNLVAESESLRWIGPRRYDWLGFKNFMSLEAYFGELKYLPA-HSVKYGEPSDGIYCVGRCSRCL--------DDSNVIPSISHA---EDWITVRDRFVAINSFLISCRCTKSPIGPAPFAHLGNGCTDLIIVRECSRFNFLQHLLRSASYEDHFDFDFVETVRVKEFSFRSLQDLQSSSETNIPKIQNY---------------ELPWNCDGEPLYCPRVHCKVHKQIIKLFASGIPHQA 1585
            R +L+++II V +  DC          +      +++N   F F ++ V  +  R H+            E  C  W   +  LL+   +RP+ L VFINP GG  +G ++Y+  ++P+F L  I + + IT+H  +A+  + +  +   DG +CVGGDGM  E++ G++ + +  AG+  D +   +   P+ LR+GIIPAGSTD V YST+GT D  T+ALH+++G S+ +D  SVH  N  +RY+VSL+GYGFYG+L+ +SE  RW+G  RYD+ G K F+S + Y G L +LPA H+V  G P D   C   C  C         ++   +  + +A   E+W     +F+AIN+  +SC C +SP G +PFAHLG+G +DLI++R+CSRFNFL+ L+R  + ED FDF FVE  RVK+F F S       +++   + Q +                  WNCDGE ++ P +  +VH Q+++LFA GI  ++
Sbjct:   50 RSVLVSEIIAVEEKDDCE-------KHASSGRWHKMEN--PFAFTVHRV--KRVRHHRWKWARVTFWSADEQLCHLWLQTLRGLLESLTSRPKHLLVFINPFGGKGQGKRIYEKTVAPLFTLASITTEIIITEHANQAKETLYEINTDSYDGIVCVGGDGMFSEVLHGVIGRTQQSAGI--DPNHPRAVLVPSTLRIGIIPAGSTDCVCYSTVGTNDAETSALHIIIGDSLAIDVSSVHYHNTLLRYSVSLLGYGFYGDLIKDSEKKRWMGLVRYDFSGLKTFLSHQYYEGTLSFLPAQHTV--GSPRDNKPCRAGCFVCRQSKQQLEEEEKKALYGLENAEEMEEWQVTCGKFLAINATNMSCACPRSPGGLSPFAHLGDGSSDLILIRKCSRFNFLRFLIRHTNQEDQFDFTFVEVYRVKKFHFTSKHVEDEDNDSKEQEKQKFGKICKDRPSCTCSASRSSWNCDGEVMHSPAIEVRVHCQLVRLFARGIEEES 531          
BLAST of Ceramide kinase vs. UniProt/SwissProt
Match: sp|Q8TCT0|CERK1_HUMAN (Ceramide kinase OS=Homo sapiens OX=9606 GN=CERK PE=1 SV=1)

HSP 1 Score: 331.643 bits (849), Expect = 1.628e-105
Identity = 176/455 (38.68%), Postives = 266/455 (58.46%), Query Frame = 2
Query:  290 QEAFKFIIYSVIPRLKRQHQLDILSTIISFDTEYSCDQWFILISKLLQKEETRPRSLTVFINPIGGLKKGVQLYKDKISPIFELCGIKSTVTITKHRGEAEAYILKQKSFDVDGFICVGGDGMLMELVQGLLLKARLDAGLSDDEHELYSKEFPAGLRVGIIPAGSTDTVAYSTIGTKDPITAALHVVLGRSIGLDALSVHCDNKFIRYNVSLMGYGFYGNLVAESESLRWIGPRRYDWLGFKNFMSLEAYFGELKYLPA-HSVKYGEPSDGIYCVGRCSRCL--------DDSNVIPSISHAED---WITVRDRFVAINSFLISCRCTKSPIGPAPFAHLGNGCTDLIIVRECSRFNFLQHLLRSASYEDHFDFDFVETVRVKEFSFRSLQ------DLQSSSETNIPKIQNYE---------LPWNCDGEPLYCPRVHCKVHKQIIKLFASGI 1573
            ++ + F ++ V  +  R+H+            E  C  W   + ++L+K  +RP+ L VFINP GG  +G ++Y+ K++P+F L  I + + +T+H  +A+  + +      DG +CVGGDGM  E++ GL+ + +  AG+  D++   +   P+ LR+GIIPAGSTD V YST+GT D  T+ALH+V+G S+ +D  SVH ++  +RY+VSL+GYGFYG+++ +SE  RW+G  RYD+ G K F+S   Y G + +LPA H+V  G P D   C   C  C         +    +  +  AED   W  V  +F+AIN+  +SC C +SP G +P AHLG+G +DLI++R+CSRFNFL+ L+R  + +D FDF FVE  RVK+F F S        DL+   +     I +             WNCDGE L+ P +  +VH Q+++LFA GI
Sbjct:   79 EKPYAFTVHCV--KRARRHRWKWAQVTFWCPEEQLCHLWLQTLREMLEKLTSRPKHLLVFINPFGGKGQGKRIYERKVAPLFTLASITTDIIVTEHANQAKETLYEINIDKYDGIVCVGGDGMFSEVLHGLIGRTQRSAGV--DQNHPRAVLVPSSLRIGIIPAGSTDCVCYSTVGTSDAETSALHIVVGDSLAMDVSSVHHNSTLLRYSVSLLGYGFYGDIIKDSEKKRWLGLARYDFSGLKTFLSHHCYEGTVSFLPAQHTV--GSPRDRKPCRAGCFVCRQSKQQLEEEQKKALYGLEAAEDVEEWQVVCGKFLAINATNMSCACRRSPRGLSPAAHLGDGSSDLILIRKCSRFNFLRFLIRHTNQQDQFDFTFVEVYRVKKFQFTSKHMEDEDSDLKEGGKKRFGHICSSHPSCCCTVSNSSWNCDGEVLHSPAIEVRVHCQLVRLFARGI 527          
BLAST of Ceramide kinase vs. UniProt/SwissProt
Match: sp|Q6USK2|CERK_ARATH (Ceramide kinase OS=Arabidopsis thaliana OX=3702 GN=CERK PE=1 SV=1)

HSP 1 Score: 204.527 bits (519), Expect = 1.145e-56
Identity = 151/537 (28.12%), Postives = 236/537 (43.95%), Query Frame = 2
Query:  248 LIQSPKILMKQ---------LDNQEAFKFIIYSVIPRLKRQHQLDILSTIISFDTEYSCDQWFILISKLLQKEETRPRSLTVFINPIGGLKKGVQLYKDKISPIFELCGIKSTVTITKHRGEA---EAYILKQKSFDVDGFICVGGDGMLMELVQGLLLKARLDAGL----------------------SDDEHELYSKE----FPAGL----------------------------RVGIIPAGSTDTVAYSTIGTKDPITAALHVVLGRSIGLDAL--------SVHCDNKFIRYNVSLMGYGFYGNLVAESESLRWIGPRRYDWLGFKNFMSLEAYFGELKYLPAHS---------------VKYGEPSDGIYCVGRCSRCLDD------SNVIPSISHAEDWITVRDRFVAINSFLISCRCTKSPIGPAPFAHLGNGCTDLIIVRECSRFNFLQHLLRSASY-EDHFDFDFVETVRVKEFSFRSLQDLQSSSETNIPKIQNYELPWNCDGEPLYCPRVHCKVHKQIIKLFASG 1570
            L+ SPK+ ++          L+ QE ++F ++      K     ++ +         +C  W   ++  L KE  RPR+L VF++P  G   G +++ + +S IF    + + V +T+  G A    A I  ++    DG I VGGDG   E++ G LL +RL   L                       D+ HE   KE     P  +                            R G+IPAGSTD +   T G +DP+T+ALH++LGR + LDA+        S      +IRY  S  GYGFYG++++ESE  RW+GP+RYD++G K F+   +Y  E+ +  A S                +    S+ I C   C  C         S  +        W   + RF++I + ++S R  ++P G    AHL +G   LI++++CSR  +L HL   A    +  +F+FVE  + + F+F S  +               E  WN DGE     ++  +V + +I LFASG
Sbjct:   86 LVHSPKLGLRHAKECFRERLLNTQEMYRFTVHGFQSSPKEPCLWNLAAFTFGHMDLQTCQSWMDQLNYSLIKEVERPRNLLVFVHPKSGKGNGSKVW-ETVSKIFIRAKVNTKVIVTERAGHAFDVMASIQNKELHTYDGIIAVGGDGFFNEILNGYLL-SRLKVPLPPSPSDSFNSVQSRGSSSVPEPGDEVHETDQKEHYPLLPDSVQEVMNFRTVNGSCEGIEDPDHPFSSERPRFGLIPAGSTDAIVMCTTGARDPVTSALHIILGRKLFLDAMQVVRWKTASTSTIEPYIRYAASFAGYGFYGDVISESEKYRWMGPKRYDYVGTKIFLKHRSYEAEVMFEEAESENSKASLHTRSKTWPFRNTTRSEKILCRANCKICNSKVGWNSASTTLNPCPEKTRWCRTKGRFLSIGAAVMSNRNERAPDGLVVDAHLSDGFLHLILIKDCSRPKYLWHLTELAKRGGEPLNFEFVEYHKTRAFTFTSFGE---------------ESVWNLDGEIFEAHQLSAQVLRGLIPLFASG 605          
BLAST of Ceramide kinase vs. UniProt/SwissProt
Match: sp|Q49MI3|CERKL_HUMAN (Ceramide kinase-like protein OS=Homo sapiens OX=9606 GN=CERKL PE=1 SV=1)

HSP 1 Score: 196.823 bits (499), Expect = 2.430e-54
Identity = 131/430 (30.47%), Postives = 203/430 (47.21%), Query Frame = 2
Query:  383 TEYSCDQWFILISKLLQKEETRPRSLTVFINPIGGLKKGVQLYKDKISPIFELCGIKSTVTITKHRGEAEAYILKQKSFDVDGF-----------------------------ICVGGDGMLMELVQGLLLKARLDAGLSDDEHELYSKEFPAGLRVGIIPAGSTDTVAYSTIGTKDPITAALHVVLGRSIGLDALSVHCDNKFIRYNVSLMGYGFYGNLVAESESLRWIGP-RRYDWLGFKNFMSLEAYFGELKYLPAHSVKYGEPSDGIYCVGRCSRCLDDSNVIPSISHAEDWITVRDRFVAINSFLISCRCTKSPIGPAPFAHLGNGCTDLIIVRECSRFNFLQHLLRSASYEDHFDFDFVETVRVKEFSFRSLQDLQSSSETNIPKIQNYE--LPWNCDGEPL-YCPRVHCKVHKQIIKLFASGI 1573
            +E  CD WF    K+L     RP+SL + +NP    K+  Q+Y +K+ P+ +L GIK+ VTI ++ G A + +   K  ++ GF                             +CVGGDG   E+   LLL+A+ +AG+  D          A L +G+IPAGST+ +A+S  G    ITA LH+++G    +D  +     K +R+  S M +GF G  +A +E  RW+ P +R D+   K    L+A   E+ +LP +S      SD +           D N        + W  ++ +F+ ++   I C C+ +P G AP   L NG   LII R  SR  F++HL R AS ++ F+F FVET  V+E       +    +          E   PWN DG+ +     VH ++H ++I L+   +
Sbjct:  144 SEDHCDIWFRQFKKILAGFPNRPKSLKILLNPQSHKKEATQVYYEKVEPLLKLAGIKTDVTIMEYEGHALSLL---KECELQGFDGGHRKPLFAIHWSVQRLFTGMQTLEPSVVCVGGDGSASEVAHALLLRAQKNAGMETDR---ILTPVRAQLPLGLIPAGSTNVLAHSLHGVPHVITATLHIIMGHVQLVDVCTFSTAGKLLRFGFSAM-FGFGGRTLALAEKYRWMSPNQRRDFAVVKALAKLKAEDCEISFLPFNS------SDDVQERRAQGSPKSDCN--------DQWQMIQGQFLNVSIMAIPCLCSVAPRGLAPNTRLNNGSMALIIARNTSRPEFIKHLKRYASVKNQFNFPFVETYTVEEVKVHPRNNTGGYNPEEEEDETASENCFPWNVDGDLMEVASEVHIRLHPRLISLYGGSM 552          
BLAST of Ceramide kinase vs. UniProt/SwissProt
Match: sp|Q9TZI1|CERK_CAEEL (Ceramide kinase 1 OS=Caenorhabditis elegans OX=6239 GN=cerk-1 PE=3 SV=1)

HSP 1 Score: 178.718 bits (452), Expect = 1.075e-47
Identity = 118/408 (28.92%), Postives = 199/408 (48.77%), Query Frame = 2
Query:  371 ISFDTEYSCDQWFILISKLLQKEETRPRSLTVFINPIGGLKKGVQLYKDKISPIFELC-GIKSTVTITKHRGEAEAYILK---QKSFDVDGFICVGGDGMLMELVQGLLLKARLDAGLSDDEHELYSKEFPAGLRVGIIPAGSTDTVAYSTIGTKDPITAALHVVLGRSIGLDALSVHCDNKFIRYNVSLMGYGFYGNLVAESESLRWIGPRRYDWLGFKNFMSLEAYFGELKYLPAHSVKYGEPSDGIYCVGRCSRCLDDSNVIPSISHAEDWITVRDRFVAINSFLISCRCTKSPIGPAPFAHLGNGCTDLIIVRECSRFNFLQHLLRSASY--EDHFDFD-FVETVRVKEFSFRSLQDLQSSSETNIPKIQNYELPWNCDGEPLYCPR---VHCKVHKQIIKLFA 1564
            + F T    D W  LI   L++ + RP+++ +FINP GG  K  +++KD +   F L  G++  V +T+    A  YI++   ++   +DG + VGGDG+  EL+ G LL+ + DAG + D     S      +R GII AGS +++  +   T D  T+A+H+ +G    +D  +VH   K IR + + + YG+ G+++ +SE  R +GP RY W   +  +    Y G +++  +H            C+  C  C+      P  +   D+      F  +   +I      +P G APF  +G+G  DL +V   SRF+ +Q + + A Y  +  ++ D  +   RV ++S+      Q  ++   P +      WN DGE L  P+   +H K+H Q+I  F 
Sbjct:  138 VIFYTTSERDYWHSLIDTTLRRVKNRPKNIIIFINPFGGNGKAQKIFKDNVDAFFWLTPGLRYKVVLTERANHARDYIVEMPPEQWSAIDGLVSVGGDGLFNELLSGALLRTQTDAGRNIDNPS--SHLVTPHIRFGIIGAGSANSIVSTVHETNDHATSAVHIAIGSECNVDVCTVHQHQKLIRISANAISYGWLGDVLRDSEEYRCLGPIRYQWSALRTTIRHPIYRGMVQFSLSHKENVNPKDQLPPCLEPCPVCMK-----PQGNDKYDY-HWHAEFTHVICCVIPTVTPFTPYGLAPFTGIGDGTLDLALVPRISRFHNMQFMRKVAMYGGKQLYELDPSLNCYRVTKWSY------QPDADQEDPGV------WNLDGEILEQPKDEPLHFKLHPQLISFFG 525          
BLAST of Ceramide kinase vs. TrEMBL
Match: A0A3L8SQP0 (DAGKc domain-containing protein OS=Chloebia gouldiae OX=44316 GN=DV515_00004342 PE=4 SV=1)

HSP 1 Score: 351.673 bits (901), Expect = 4.121e-111
Identity = 180/464 (38.79%), Postives = 274/464 (59.05%), Query Frame = 2
Query:  305 FIIYSVIPRLKRQHQLDILSTIISFDTEYSCDQWFILISKLLQKEETRPRSLTVFINPIGGLKKGVQLYKDKISPIFELCGIKSTVTITKHRGEAEAYILKQKSFDVDGFICVGGDGMLMELVQGLLLKARLDAGLSDDEHELYSKEFPAGLRVGIIPAGSTDTVAYSTIGTKDPITAALHVVLGRSIGLDALSVHCDNKFIRYNVSLMGYGFYGNLVAESESLRWIGPRRYDWLGFKNFMSLEAYFGELKYLPAHSVKYGEPSDGIYCVGRCSRC------LDDSNVIPSISH---AEDWITVRDRFVAINSFLISCRCTKSPIGPAPFAHLGNGCTDLIIVRECSRFNFLQHLLRSASYEDHFDFDFVETVRVKEFSFRSLQDLQSSSETNIPKIQNYEL-----------------PWNCDGEPLYCPRVHCKVHKQIIKLFASGIPHQASNSSSHIKSTI 1618
            F +Y V  +  R H+          + E+ C+QW   + +LL+ +++RP+ L V+INP GG ++G ++Y+ K++P+F L  I + V IT+H   A+  + +   +  DG +CVGGDGM  E++ GL+ + + D+G+  D++   +      +R+GIIPAGSTD + YST+G  DP+T+ALH++LG    LD  SVH +N F++Y+VSL+GYGFYG+++ +SE  RW+GP RYD+ GFK F+S   Y G + Y PA    +G P D   C   C  C      L + +    + H   AE+W  ++ +F+AIN+  +SC C +SP G +P AHL +G  DLI+VR+CSRF+FL++L+R  + +D FDF FV+  RVK F F S   L   +E+N+  I                       WNCDGE L    V  +VH Q++KLFA GI     + ++H +S+I
Sbjct:   62 FTVYYV--KKARNHRWRCSGATFWCEDEHLCNQWTQALKELLEMQKSRPKQLLVYINPYGGKRQGKRIYEQKVAPLFSLASISTDVVITEHANHAKDNLFEVNIYKYDGVVCVGGDGMFSEVMHGLIGRMQKDSGI--DQNNPKASLVQCNIRIGIIPAGSTDCICYSTVGISDPVTSALHIILGDCQPLDVSSVHHNNTFLKYSVSLLGYGFYGDILKDSEKKRWMGPMRYDYSGFKTFLSHHYYEGTIAYQPAKHT-HGSPRDKERCRTGCYICKQSEKQLSEQSKERGLKHEEGAEEWKVIKGKFLAINAVSMSCACPRSPKGLSPAAHLADGSADLILVRKCSRFDFLRYLVRHTNQDDQFDFPFVDVYRVKCFQFTS--KLSEDNESNVMDIGKKRFGQFCRDHPACCCNIVNSTWNCDGETLDSSAVEVRVHCQLMKLFARGIEEDCKDEAAHSQSSI 518          
BLAST of Ceramide kinase vs. TrEMBL
Match: H0Z008 (Ceramide kinase OS=Taeniopygia guttata OX=59729 GN=CERK PE=4 SV=1)

HSP 1 Score: 349.362 bits (895), Expect = 2.088e-110
Identity = 178/464 (38.36%), Postives = 270/464 (58.19%), Query Frame = 2
Query:  305 FIIYSVIPRLKRQHQLDILSTIISFDTEYSCDQWFILISKLLQKEETRPRSLTVFINPIGGLKKGVQLYKDKISPIFELCGIKSTVTITKHRGEAEAYILKQKSFDVDGFICVGGDGMLMELVQGLLLKARLDAGLSDDEHELYSKEFPAGLRVGIIPAGSTDTVAYSTIGTKDPITAALHVVLGRSIGLDALSVHCDNKFIRYNVSLMGYGFYGNLVAESESLRWIGPRRYDWLGFKNFMSLEAYFGELKYLPAHSVKYGEPSDGIYCVGRCSRCLDDSNVIPSISH---------AEDWITVRDRFVAINSFLISCRCTKSPIGPAPFAHLGNGCTDLIIVRECSRFNFLQHLLRSASYEDHFDFDFVETVRVKEFSFRSLQDLQSSSETNIPKIQNYEL-----------------PWNCDGEPLYCPRVHCKVHKQIIKLFASGIPHQASNSSSHIKSTI 1618
            F +Y V  +  R H+          + E+ C+QW   + +LL+ +++RP+ L V+INP GG ++G ++Y+ K++P+F L  I + V IT+H   A+  + +   +  DG +CVGGDGM  E++ GL+ + + D+G+  D++   +      +R+GIIPAGSTD + YST+G  DP+T+ALH++LG    LD  SVH +N F++Y+VSL+GYGFYG+++ +SE  RW+GP RYD+ GFK F+S   Y G + Y PA    +G P D   C   C  C      +   S           E+W  ++ +F+AIN+  +SC C +SP G +P AHL +G  DLI+VR+CSRF+FL++L+R  + +D FDF FV+  RVK F F S   L   +E+N+  I                       WNCDGE L    V  +VH Q++KLFA GI     + ++H +S+I
Sbjct:   47 FTVYYV--KKARNHRWRCSDATFWCEDEHLCNQWTQALKELLEMQKSRPKQLLVYINPYGGKRQGKRIYEQKVAPLFSLASISTDVVITEHANHAKDNLFEVNIYKYDGVVCVGGDGMFSEVMHGLIGRMQKDSGI--DQNNPKASLVQCNIRIGIIPAGSTDCICYSTVGISDPVTSALHIILGDCQPLDVSSVHHNNTFLKYSVSLLGYGFYGDILKDSEKKRWMGPMRYDYSGFKTFLSHHYYEGTIAYQPAKHT-HGSPRDKERCRTGCYICKQSEKQLAEQSKERGLKHEEGEEEWKVIKGKFLAINAVSMSCACPRSPKGLSPAAHLADGSADLILVRKCSRFDFLRYLVRHTNQDDQFDFPFVDVYRVKCFQFTS--KLSEDNESNVMDIGKKRFGQFCRDHPTCCCSIVNSTWNCDGETLDSSAVEVRVHCQLMKLFARGIEEDCKDEAAHSQSSI 503          
BLAST of Ceramide kinase vs. TrEMBL
Match: A0A218UUF9 (Ceramide kinase OS=Lonchura striata domestica OX=299123 GN=CERK PE=4 SV=1)

HSP 1 Score: 348.977 bits (894), Expect = 9.689e-110
Identity = 178/464 (38.36%), Postives = 270/464 (58.19%), Query Frame = 2
Query:  305 FIIYSVIPRLKRQHQLDILSTIISFDTEYSCDQWFILISKLLQKEETRPRSLTVFINPIGGLKKGVQLYKDKISPIFELCGIKSTVTITKHRGEAEAYILKQKSFDVDGFICVGGDGMLMELVQGLLLKARLDAGLSDDEHELYSKEFPAGLRVGIIPAGSTDTVAYSTIGTKDPITAALHVVLGRSIGLDALSVHCDNKFIRYNVSLMGYGFYGNLVAESESLRWIGPRRYDWLGFKNFMSLEAYFGELKYLPAHSVKYGEPSDGIYCVGRCSRCLDDSNVIPSISH---------AEDWITVRDRFVAINSFLISCRCTKSPIGPAPFAHLGNGCTDLIIVRECSRFNFLQHLLRSASYEDHFDFDFVETVRVKEFSFRSLQDLQSSSETNIPKIQNYEL-----------------PWNCDGEPLYCPRVHCKVHKQIIKLFASGIPHQASNSSSHIKSTI 1618
            F +Y V  +  R H+          + E+ C+QW   + +LL+ +++RP+ L V+INP GG ++G ++Y+ K++P+F L  I + V IT+H   A+  + +   +  DG +CVGGDGM  E++ GL+ + + D+G+  D++   +      +R+GIIPAGSTD + YST+G  DP+T+ALH++LG    LD  SVH +N F++Y+VSL+GYGFYG+++ +SE  RW+GP RYD+ GFK F+S   Y G + Y PA    +G P D   C   C  C      +   S           E+W  ++ +F+AIN+  +SC C +SP G +P AHL +G  DLI+VR+CSRF+FL++L+R  + +D FDF FV+  RVK F F S   L   +E+N+  I                       WNCDGE L    V  +VH Q++KLFA GI     + ++H +S+I
Sbjct:   83 FTVYYV--KKARNHRWRCSDATFWCEDEHLCNQWTQALKELLEMQKSRPKQLLVYINPYGGKRQGKRIYEQKVAPLFSLASISTDVVITEHANHAKDNLFEVNIYKYDGVVCVGGDGMFSEVMHGLIGRMQKDSGI--DQNNPKASLVQCNIRIGIIPAGSTDCICYSTVGISDPVTSALHIILGDCQPLDVSSVHHNNTFLKYSVSLLGYGFYGDILKDSEKKRWMGPMRYDYSGFKTFLSHHYYEGTIAYQPAKHT-HGSPRDKERCRTGCYICKQSEKQLAEQSKERGLKHEEGEEEWKVIKGKFLAINAVSMSCACPRSPKGLSPAAHLADGSADLILVRKCSRFDFLRYLVRHTNQDDQFDFPFVDVYRVKCFQFTS--KLSEDNESNVMDIGKKRFGQFCRDHPACCCNIVNSTWNCDGETLDSSAVEVRVHCQLMKLFARGIEEDCKDEAAHSQSSI 539          
BLAST of Ceramide kinase vs. TrEMBL
Match: V9KQK9 (Ceramide kinase (Fragment) OS=Callorhinchus milii OX=7868 PE=2 SV=1)

HSP 1 Score: 348.206 bits (892), Expect = 1.952e-109
Identity = 186/455 (40.88%), Postives = 268/455 (58.90%), Query Frame = 2
Query:  305 FIIYSVIPRLKRQHQLDILSTIISFDTEYSCDQWFILISKLLQKEETRPRSLTVFINPIGGLKKGVQLYKDKISPIFELCGIKSTVTITKHRGEAEAYILKQKSFDVDGFICVGGDGMLMELVQGLLLKARLDAGLSDDEHELYSKEFPAGLRVGIIPAGSTDTVAYSTIGTKDPITAALHVVLGRSIGLDALSVHCDNKFIRYNVSLMGYGFYGNLVAESESLRWIGPRRYDWLGFKNFMSLEAYFGELKYLPAHSVKYGEPSDGIYCVGRCSRC------LDDSNVIPSISHA---EDWITVRDRFVAINSFLISCRCTKSPIGPAPFAHLGNGCTDLIIVRECSRFNFLQHLLRSASYEDHFDFDFVETVRVKEFSFR---------SLQDL------QSSSETNIPKIQNYELPWNCDGEPLYCPRVHCKVHKQIIKLFASGIPHQASNSS 1597
            F +Y V  R K  H      T    D +  C+QW   + + L  +  RP++L VFINP GG + G  +Y  K++P+F+L  I + V +T+H  +A  ++ +      DG +CVGGDGM  E++ GL+ + +  AG+  D+++  SK     LR+GIIPAGSTD + Y+T+G  DP+T+ALH+++G S  +D  SVH +N F++Y+VSL+GYGFYG+++ +SE+ RW+GP RYD+ GFK F+S + Y G + YLPA +   G P D   C   C  C      LD SN    + H    EDW  V+ +F+AIN+  +SC C+KSP+G +P AHL +G  DLI+VR+CSRFNFL+HL+R  + +D FD  FVE  RVK+F F           ++D+      Q  S+            WNCDGE +    V  +VH Q+IKLF  GI H    +S
Sbjct:   93 FTVYYV-QRSKEHHWCCAEVTFYCSD-QLLCNQWVQALQRRLDLQGVRPKNLLVFINPFGGKQLGKHIYDKKVAPLFQLASITTEVIVTEHANQARDHLAEVDLRIYDGIVCVGGDGMFSEVIHGLICQTQKIAGI--DQNDPNSKLVACSLRIGIIPAGSTDCICYATVGVNDPVTSALHIIVGDSQPMDVSSVHHNNTFLKYSVSLLGYGFYGDVLKDSENNRWMGPSRYDFSGFKTFLSHQCYEGTVLYLPA-TETLGNPRDESRCTAGCYVCQYSGKLLDLSNNKQELKHVAEEEDWKVVKGKFLAINAANMSCACSKSPMGLSPAAHLADGTIDLILVRKCSRFNFLRHLIRHTNKDDQFDLAFVEVYRVKQFIFTPKYSEEDNIDIRDVGKNLFGQFCSDHPACGCSQVNSNWNCDGEIIEHAAVEVRVHCQLIKLFVRGIEHSTQKTS 542          
BLAST of Ceramide kinase vs. TrEMBL
Match: A0A4W3J5F6 (DAGKc domain-containing protein OS=Callorhinchus milii OX=7868 GN=cerk PE=4 SV=1)

HSP 1 Score: 347.436 bits (890), Expect = 3.796e-109
Identity = 186/455 (40.88%), Postives = 267/455 (58.68%), Query Frame = 2
Query:  305 FIIYSVIPRLKRQHQLDILSTIISFDTEYSCDQWFILISKLLQKEETRPRSLTVFINPIGGLKKGVQLYKDKISPIFELCGIKSTVTITKHRGEAEAYILKQKSFDVDGFICVGGDGMLMELVQGLLLKARLDAGLSDDEHELYSKEFPAGLRVGIIPAGSTDTVAYSTIGTKDPITAALHVVLGRSIGLDALSVHCDNKFIRYNVSLMGYGFYGNLVAESESLRWIGPRRYDWLGFKNFMSLEAYFGELKYLPAHSVKYGEPSDGIYCVGRCSRC------LDDSNVIPSISHA---EDWITVRDRFVAINSFLISCRCTKSPIGPAPFAHLGNGCTDLIIVRECSRFNFLQHLLRSASYEDHFDFDFVETVRVKEFSFR---------SLQDL------QSSSETNIPKIQNYELPWNCDGEPLYCPRVHCKVHKQIIKLFASGIPHQASNSS 1597
            F +Y V  R K  H      T    D +  C+QW   + + L  +  RP++L VFINP GG + G  +Y  K++P+F+L  I + V +T+H   A  ++ +      DG +CVGGDGM  E++ GL+ + +  AG+  D+++  SK     LR+GIIPAGSTD + Y+T+G  DP+T+ALH+++G S  +D  SVH +N F++Y+VSL+GYGFYG+++ +SE+ RW+GP RYD+ GFK F+S + Y G + YLPA +   G P D   C   C  C      LD SN    + H    EDW  V+ +F+AIN+  +SC C+KSP+G +P AHL +G  DLI+VR+CSRFNFL+HL+R  + +D FD  FVE  RVK+F F           ++D+      Q  S+            WNCDGE +    V  +VH Q+IKLF  GI H    +S
Sbjct:   93 FTVYYV-QRSKEHHWCCAEVTFYCSD-QLLCNQWVQALQRRLDLQGVRPKNLLVFINPFGGKQLGKHIYDKKVAPLFQLASITTEVIVTEHANHARDHLAEVDLRIYDGIVCVGGDGMFSEVIHGLICQTQKIAGI--DQNDPNSKLVACSLRIGIIPAGSTDCICYATVGVNDPVTSALHIIVGDSQPMDVSSVHHNNTFLKYSVSLLGYGFYGDVLKDSENNRWMGPSRYDFSGFKTFLSHQCYEGTVLYLPA-TETLGNPRDESRCTAGCYVCQYSGKLLDLSNNKQELKHVAEEEDWKVVKGKFLAINAANMSCACSKSPMGLSPAAHLADGTIDLILVRKCSRFNFLRHLIRHTNKDDQFDLAFVEVYRVKQFIFTPKYSEEDNIDIRDIGKNLFGQFCSDHPACGCSQVNSNWNCDGEIIEHAAVEVRVHCQLIKLFVRGIEHSTQKTS 542          
BLAST of Ceramide kinase vs. Ensembl Cavefish
Match: cerk (ceramide kinase [Source:ZFIN;Acc:ZDB-GENE-041210-210])

HSP 1 Score: 300.442 bits (768), Expect = 1.331e-94
Identity = 162/402 (40.30%), Postives = 233/402 (57.96%), Query Frame = 2
Query:  395 CDQWFILISKLLQKEETRPRSLTVFINPIGGLKKGVQLYKDKISPIFELCGIKSTVTITKHRGEAEAYILKQKSFD-VDGFICVGGDGMLMELVQGLLLKARLDAGLSDDEHELYSKEFPAGLRVGIIPAGSTDTVAYSTIGTKDPITAALHVVLGRSIGLDALSVHCDNKFIRYNVSLMGYGFYGNLVAESESLRWIGPRRYDWLGFKNFMSLEAYFGELKYLPAHSVKYGEPSDGIYCVGRCSRCLDDSNVIP------SISHAE---DWITVRDRFVAINSFLISCRCTKSPIGPAPFAHLGNGCTDLIIVRECSRFNFLQHLLRSASYEDHFDFDFVETVRVKEFSFR----------SLQDLQSSSETNIPKIQNYELP----------WNCDGEPL 1510
            C QW   I + L     RP+ L V+INP GG ++G ++Y+ K++PIF    I + V +T+    A  ++  +      DG +CVGGDGM  E++ GL+ + + DAG+  D++    +    GLR+GIIPAGSTD + Y+T+G+ DP+T+ALH+++G S  +D  SVH  + F+RY+VSL+GYGFYG+++ +SE  RW+GP RYD  G K F+S   Y G + +LPA       P D I C   C+ C   S V        SIS AE    W  +R +F+AIN+  +SC C +SP G +P AHL +G  DLI+VR+CSR +FL+HLLR  + +D FD  FVE  RV++F F            L+++ + S  +       E P          WNCDGE L
Sbjct:  123 CLQWVQAIREQLALLTIRPKRLLVYINPYGGKQRGKRIYEQKVAPIFSRASISTDVIVTERANHARDHLKTEADLKKYDGVVCVGGDGMFSEIMHGLISRTQCDAGV--DQNRPDEELISCGLRIGIIPAGSTDCICYATVGSNDPVTSALHIIVGDSQPMDVCSVHHHDTFLRYSVSLLGYGFYGDMLTDSERKRWMGPARYDISGVKTFLSHRYYEGTISFLPADGT-VSTPRDKIQCRSGCNICQMPSLVESTYKAEDSISEAETKDTWQVIRGKFLAINAACMSCACPRSPKGLSPSAHLADGTADLILVRKCSRIDFLRHLLRHTNKDDQFDHPFVEVYRVRQFRFTPRYQETDSELELREVGAGSSKHFFTQICREHPACGCTPTQSSWNCDGEIL 521          
BLAST of Ceramide kinase vs. Ensembl Cavefish
Match: zgc:158263 (ceramide kinase-like [Source:NCBI gene;Acc:103040162])

HSP 1 Score: 273.092 bits (697), Expect = 2.222e-83
Identity = 165/483 (34.16%), Postives = 242/483 (50.10%), Query Frame = 2
Query:  398 DQWFILISKLLQKE-ETRPRSLTVFINPIGGLKKGVQLYKDKISPIFELCGIKSTVTITKHRGEAEAYILKQKSFDVDGFICVGGDGMLMELVQGLLLKARLDAGLSDDEHELYSKEFPAGLRVGIIPAGSTDTVAYSTIGTKDPITAALHVVLGRSIGLDALSVHCDNKFIRYNVSLMGYGFYGNLVAESESLRWIGPRRYDWLGFKNFMSLEAYFGELKYLPAHSVKYGEPSDGIYCVGRCSRC----------LDDSNVIPSISHAE-------DWITVRDRFVAINSFLISCRCTKSPIGPAPFAHLGNGCTDLIIVRECSRFNFLQHLLRSASYEDHFDFDFVETVRVKEFSF------------------RSLQDLQSSSETNIPKIQN-------------YELPWN-----------------------------CDGEPLYCPRVHCKVHKQIIKLFASGIPHQASNSSSHIKS 1612
            DQW   +   L+    +RP  L VFINP GG K+  ++Y    +P+FEL GI S V +T+   +A  +ILK+     DG ICVGGDGM  EL+ G++ + + +AG+S  EH+      P  L +GIIPAGSTD V ++T+G  DP+T+ LH+++G S  LD  SVH  +  +RY+VSL+GYGFYG+++AESE  RW+GP RYD+ G   ++   +Y G ++YLPA   +   P D   C+  C  C           D S+ I S   ++       +W++V  RF  ++   +S  C +SP G +P AHL +G  DLI+VR+     FL +L R  + +D FD  FVE  RVK   F                  R+ + L    +  + +I++              + PWN                             CDGE L    + C+V  Q+++LFA GI  +      H  S
Sbjct:  112 DQWVAQLKTALKTHCPSRPHRLLVFINPYGGKKRAKEIYHSIAAPLFELAGISSHVVVTERANQARDHILKKDLTGFDGVICVGGDGMFSELLHGVIGRTQQEAGIS--EHDPTVMLQPCDLHIGIIPAGSTDCVCFATVGVNDPVTSTLHIIIGDSQPLDVCSVHHQSTLVRYSVSLVGYGFYGDVLAESERHRWMGPLRYDYSGCLVYLCNRSYQGIVQYLPADP-QISSPRDNTRCLSGCRVCSESTERLFPHFDSSSSIYSRQISQYSNESNGEWMSVEGRFKCVSLTCMSSSCPRSPDGLSPSAHLADGTADLILVRDTHPLGFLTYLHRHTTTQDQFDLPFVEVHRVKAVRFTLPLEDEEVCEYEESEAQRTEEVLGDPEKPPVDEIESCRDGSQHDLAGKRQDEPWNKKKGRKRKKKQDFLCGLCCRKPPTVSVWNCDGEILPYTEISCRVRGQLVRLFARGIEEKGGTWKCHKGS 591          
BLAST of Ceramide kinase vs. Ensembl Cavefish
Match: zgc:158263 (ceramide kinase-like [Source:NCBI gene;Acc:103040162])

HSP 1 Score: 273.092 bits (697), Expect = 2.419e-83
Identity = 165/483 (34.16%), Postives = 242/483 (50.10%), Query Frame = 2
Query:  398 DQWFILISKLLQKE-ETRPRSLTVFINPIGGLKKGVQLYKDKISPIFELCGIKSTVTITKHRGEAEAYILKQKSFDVDGFICVGGDGMLMELVQGLLLKARLDAGLSDDEHELYSKEFPAGLRVGIIPAGSTDTVAYSTIGTKDPITAALHVVLGRSIGLDALSVHCDNKFIRYNVSLMGYGFYGNLVAESESLRWIGPRRYDWLGFKNFMSLEAYFGELKYLPAHSVKYGEPSDGIYCVGRCSRC----------LDDSNVIPSISHAE-------DWITVRDRFVAINSFLISCRCTKSPIGPAPFAHLGNGCTDLIIVRECSRFNFLQHLLRSASYEDHFDFDFVETVRVKEFSF------------------RSLQDLQSSSETNIPKIQN-------------YELPWN-----------------------------CDGEPLYCPRVHCKVHKQIIKLFASGIPHQASNSSSHIKS 1612
            DQW   +   L+    +RP  L VFINP GG K+  ++Y    +P+FEL GI S V +T+   +A  +ILK+     DG ICVGGDGM  EL+ G++ + + +AG+S  EH+      P  L +GIIPAGSTD V ++T+G  DP+T+ LH+++G S  LD  SVH  +  +RY+VSL+GYGFYG+++AESE  RW+GP RYD+ G   ++   +Y G ++YLPA   +   P D   C+  C  C           D S+ I S   ++       +W++V  RF  ++   +S  C +SP G +P AHL +G  DLI+VR+     FL +L R  + +D FD  FVE  RVK   F                  R+ + L    +  + +I++              + PWN                             CDGE L    + C+V  Q+++LFA GI  +      H  S
Sbjct:  105 DQWVAQLKTALKTHCPSRPHRLLVFINPYGGKKRAKEIYHSIAAPLFELAGISSHVVVTERANQARDHILKKDLTGFDGVICVGGDGMFSELLHGVIGRTQQEAGIS--EHDPTVMLQPCDLHIGIIPAGSTDCVCFATVGVNDPVTSTLHIIIGDSQPLDVCSVHHQSTLVRYSVSLVGYGFYGDVLAESERHRWMGPLRYDYSGCLVYLCNRSYQGIVQYLPADP-QISSPRDNTRCLSGCRVCSESTERLFPHFDSSSSIYSRQISQYSNESNGEWMSVEGRFKCVSLTCMSSSCPRSPDGLSPSAHLADGTADLILVRDTHPLGFLTYLHRHTTTQDQFDLPFVEVHRVKAVRFTLPLEDEEVCEYEESEAQRTEEVLGDPEKPPVDEIESCRDGSQHDLAGKRQDEPWNKKKGRKRKKKQDFLCGLCCRKPPTVSVWNCDGEILPYTEISCRVRGQLVRLFARGIEEKGGTWKCHKGS 584          
BLAST of Ceramide kinase vs. Ensembl Cavefish
Match: cerkl (ceramide kinase like [Source:NCBI gene;Acc:103022441])

HSP 1 Score: 219.164 bits (557), Expect = 2.875e-63
Identity = 140/406 (34.48%), Postives = 213/406 (52.46%), Query Frame = 2
Query:  395 CDQWFILISKLLQKEETRPRSLTVFINPIGGLKKGVQLYKDKISPIFELCGIKSTVTITKHRGEAEAYILKQKSFDVDGFICVGGDGMLMELVQGLLLKARLDAGLSDDEHELYSKEFPAGLRVGIIPAGSTDTVAYSTIGTKDPITAALHVVLGRSIGLDALSVHCDNKFIRYNVSLMGYGFYGNLVAESESLRWIGPRRYDWLGF-KNFMSLEAYFGELKYLPAHSVKYGEPSDGIYCVGRCSRCLDDSNVIPSISHAEDWITVRDRFVAINSFLISCRCTKSPIGPAPFAHLGNGCTDLIIVRECSRFNFLQHLLRSASYEDHFDFDFVET-----VRVKEFSFRSLQDLQS-----SSETNIPKIQNYEL-PWNCDGEPLYCP-RVHCKVHKQIIKLFASGI 1573
            C+ WF  + ++L   ++RP+SL VFINP    K+  Q+Y+D+++P+F+L  IK+ VTIT+ +G A + +   +  + DG +CVGGDG + E+  GLLL+A++DAG   D   +  +   A L +G+IPAGSTD VA S  G + P+TAALH+++G    +D  SV    + +R+  S+M +GF    +A +E L WI   +   + F     +L+    EL ++P+        S G+          + S+V         W   R  F+ I+   I C C+ +P G APF  L N    L+ V   SR  F++HL R +S  + F F FVET     VR++  S     D  S     S   N P I +    PWN DGE L  P  +  +VH +I+ LF + +
Sbjct:  172 CEIWFKQLKEILNGFQSRPKSLKVFINPCSHKKEANQIYEDQVAPLFKLADIKTDVTITERKGHALSILKDCRLDEYDGVVCVGGDGSVAEVAHGLLLRAQMDAGRDTDSIFMPVQ---AALPLGVIPAGSTDAVACSVHGIRHPVTAALHIIMGHRQAVDVCSVSSMGRLLRFCFSVM-FGFGSRTLAAAEKLTWIPNTQRREVAFITTLTNLKPEECELSFIPS--------SGGVVDQSDSESESELSDV----GEGGPWQRRRGLFLNISIMSIPCLCSIAPRGLAPFTRLNNSSMALVAVGNASRSEFIKHLKRYSSTNNQFSFSFVETQCVYAVRLRPRSHSGWTDETSEENEESDSKNTPIISSEGTHPWNIDGELLEVPGELLIRVHSRILTLFGADV 561          
BLAST of Ceramide kinase vs. Ensembl Cavefish
Match: SPHK1 (sphingosine kinase 1 [Source:NCBI gene;Acc:103023393])

HSP 1 Score: 66.2402 bits (160), Expect = 4.252e-11
Identity = 54/220 (24.55%), Postives = 89/220 (40.45%), Query Frame = 2
Query:  437 EETRPRSLTVFINPIGGLKKGVQLYKDKISPIFELCGIKSTVTITKHRGEAEAYILKQKSFDVDGFICVGGDGMLMELVQGLLLKARLDAGLSDDEHELYSKEFPAGLRVGIIPAGSTDTVAYS---------TIGTKDPITAALHVVLGRSIGLDALSVHCDNKFIRYNVSLMGYGFYGNLVAESESLRWIGPRRYDWLGFKNFMSLEAYFGELKYLPA 1069
            E   P  + + +NP+ G  +   L+   +  + +   I  T+TIT+ +  A   + +      D    + GDG+L E+V GL+ +        DD  E            G++P GS + VA S           G +  +     +  G    LD  SV   +    ++   + +GF  ++  ESE  R +G  R+         SL  Y G+L YLPA
Sbjct:  143 EVKSPCRVLLLLNPLSGKGQAHTLFTSHVQRMLQEASIPYTLTITERQNHARELVREADLSQWDALAIMSGDGLLFEVVNGLMER--------DDWEEAIKTPL------GVLPGGSGNAVAASMHHYCGLQPVSGEELLVNCGFMLCKGLVSRLDLTSVCMASSQRLFSFLSLAWGFVADVDIESEKYRHVGAARFTLGTLVRLASLRIYQGKLSYLPA 348          
BLAST of Ceramide kinase vs. Ensembl Sea Lamprey
Match: cerkl (ceramide kinase-like [Source:ZFIN;Acc:ZDB-GENE-070410-38])

HSP 1 Score: 184.882 bits (468), Expect = 5.384e-52
Identity = 133/445 (29.89%), Postives = 204/445 (45.84%), Query Frame = 2
Query:  383 TEYSCDQWFILISKLLQKEETRPRSLTVFINPIGGLKKGVQLYKDKISPIFELCGIKSTVTITKHRGEAEAYILKQKSFDVDGF------------------------------ICVGGDGMLMELVQGLLLKARLDAGLSDDEHELYSKEFPAGLRVGIIPAGSTDTVAYSTIGTKDPITAALHVVLGRSIGLDALSVHCDNKFIRYNVSLMGYGFYGNLVAESESLRWIGP-RRYDWLGFKNFMSLEAYFGELKYLPAHSVKYGEPSDGIYCVGRCSRCLDDSNVIPSISHAEDWITVRDRFVAINSFLISCRCTKSPIGPAPFAHLGNGCTDLIIVRECSRFNFLQHLLRSASYEDHFDFDFVET-----VRVKEFSFRSLQDLQS---SSETNIPKIQNYELPWNCDGEPL-YCPRVHCKVHKQIIKLFASGIPHQASNSS 1597
            +E  C  WF  I  +L     RPR L VF+NP    K+  +L+  ++ P+F+L  I + +T+T+  G A A +   ++ D+ GF                              +CVGGDG + E+V GLLL+A+ D G   D         P  L +GIIPAGSTD VAYS  GT    TA+LH++LG  + +D  S+    + +R+  S M  GF G  +A +E  RW+ P +R D+   K   SL     E+ +LPA     G+ ++G           D + ++        W+     F+ +    + CRC  +P G AP   L +G   LI VR  SR +F+++L R  S +   +  FV++     VRV      S +D  S     E       +    WN DG  L     VH +VH +++ L+   + H   +++
Sbjct:   70 SEDHCQTWFYRIRAVLSGFPERPRRLLVFVNPQSHRKEAPELFASRVEPLFKLADIGTHLTVTEREGHALAEL---QTCDLTGFDGAWKKKRTRSLHSSSQRVFAALHASVHSVVCVGGDGTVAEVVNGLLLRAQRDVGTDPDG---AFTPAPTHLPIGIIPAGSTDVVAYSMHGTSHAATASLHIILGHLLPVDVCSLAVRGRLLRFGFSAM-LGFGGRSLAIAERHRWMPPNQRRDFAVLKALASLRPVDCEIGFLPASEGASGQTAEGAR--------EDAAGLL--------WLHTSGDFLNVTVAAVPCRCAVAPRGLAPDTLLDDGSMSLIAVRSTSRAHFVKYLKRFGSSKSQPNPPFVDSMAVQAVRVTPRGHLSGEDGSSRWGDGEGETAGATDGRCFWNVDGVLLEETGEVHIRVHTRLVTLYGCSLGHDDEDAA 491          
BLAST of Ceramide kinase vs. Ensembl Sea Lamprey
Match: agk (acylglycerol kinase [Source:NCBI gene;Acc:334270])

HSP 1 Score: 74.7146 bits (182), Expect = 1.487e-14
Identity = 79/325 (24.31%), Postives = 135/325 (41.54%), Query Frame = 2
Query:  449 PRSLTVFINPIGGLKKGVQLYKDKISPIFELCGIKSTVTITKHRGEAEAYILKQKSFD-VDGFICVGGDGMLMELVQGLLLKARLDAGLSDDEHELYSKEFPAGLRVGIIPAGSTDTV-AYSTIGTKDPI----TAALHVVLGRSIGLDALSVHCDNKFIRYNVSLMGYGFYGNLVAESESLRWIGPRRYDWLGFKNFMSLEAYFGELKYLPAHSVKYGEPSDGIYCVGRCSRCLDDSNVIPSISHAEDWITVRDRFVAINSFLISCRCTKSPIGPAPFAHLGNGCTDLIIVRECSRFNFLQHLLRSASYEDHFDFDFVETVRVK 1405
            P+ +TVF+NP     K   L+    +PI  L G + TV  T H G+A+  +      D  D  +  GG+G L+E+V G+L +        DDE + +SK     + +GIIP G  +TV     +  +D +    +AAL +V G ++ +D L V        Y +S + +G Y +  A +    ++GP +      K    L + F E        + Y EP++      R     +    +P  S    W  + +RF+ +       +  + P+   P   +     +++I    S  N +  L  S    D  D   + +   K
Sbjct:   60 PKRITVFLNPAASNGKAKNLFDLNAAPILHLAGFEVTVVKTDHEGQAQDLL---GVLDRTDAIVVAGGNGTLLEVVTGMLRR--------DDEAD-FSK-----IPIGIIPLGKVNTVGGIVNLQEEDQVRRITSAALAIVRGSTVPVDVLQVVGVKGKPVYALSELRWGNYRDAEASTPRYWYLGPLK------KVASYLLSTFQEWPPSRHALLSYAEPAE------RPEYVEESPGPVPRPSL---WRRIYNRFLRLQ----ESKVPEKPVEETPQTEMEISSMEVVI----SSLNAVLDLKTSQQKPDAVDIVLMPSAITK 344          
BLAST of Ceramide kinase vs. Ensembl Yeast
Match: LCB4 (Sphingoid long-chain base kinase; responsible for synthesis of long-chain base phosphates, which function as signaling molecules, regulates synthesis of ceramide from exogenous long-chain bases, localizes to the Golgi and late endosomes; LCB4 has a paralog, LCB5, that arose from the whole genome duplication [Source:SGD;Acc:S000005697])

HSP 1 Score: 62.003 bits (149), Expect = 1.592e-10
Identity = 58/206 (28.16%), Postives = 90/206 (43.69%), Query Frame = 2
Query:  416 ISKLLQK---EETRPRSLTVFINPIGGLKKGVQLYKDKISPIFELCGIKSTVTITKHRGEAEAYILKQKSFDV---DGFICVGGDGMLMELVQGLLLKA-RLDAGLSDDEHELYSKEFPAGLRVGIIPAGSTDTVAYSTIGTKDPITAALHVVLGRSIGLDALSVHCD---NKFIRYNVSLMGYGFYGNLVAESESLRWIGPRRYD 1003
            + ++L+K      R RS+ V INP GG      L+  K  PI    G K  +  TK+   A   I   K  D+   D   C  GDG+  E++ GL  +  R+DA         ++K     L V  +P GS + ++ S   T +P  AAL +V      +D +        N++ R +     YG        +E +RW+GP R++
Sbjct:  212 VEEILEKSYENSKRNRSILVIINPHGGKGTAKNLFLTKARPILVESGCKIEIAYTKY---ARHAIDIAKDLDISKYDTIACASGDGIPYEVINGLYRRPDRVDA---------FNK-----LAVTQLPCGSGNAMSISCHWTNNPSYAALCLVKSIETRIDLMCCSQPSYMNEWPRLSFLSQTYGVIAESDINTEFIRWMGPVRFN 400          
BLAST of Ceramide kinase vs. Ensembl Yeast
Match: LCB5 (Minor sphingoid long-chain base kinase; possibly involved in synthesis of long-chain base phosphates, which function as signaling molecules; LCB5 has a paralog, LCB4, that arose from the whole genome duplication [Source:SGD;Acc:S000004250])

HSP 1 Score: 56.9954 bits (136), Expect = 5.594e-9
Identity = 54/224 (24.11%), Postives = 93/224 (41.52%), Query Frame = 2
Query:  413 LISKLLQ---KEETRPRSLTVFINPIGGLKKGVQLYKDKISPIFELCGIKSTVTITKHRGEAEAYILKQKSFDVDGF---ICVGGDGMLMELVQGLLLKARLDAGLSDDEHELYSKEFPAGLRVGIIPAGSTDTVAYSTIGTKDPITAALHVVLGRSIGLDALSVHCDNKFIRYNVSL----MGYGFYGNLVAESESLRWIGPRRYDWLGFKNFMSLEAYFGEL 1054
            L+ ++L+   K   R +S+ V INP GG  K  +L+  K  P+         V  TK+ G A   I   +  D+D +    C  GDG+  E++ GL  +              + K F   + +  IP GS + ++ S   T +P  + L ++      +D +       + R +  L      YG        +E +RW+GP R++     N +  + Y  E+
Sbjct:  253 LVEEILKRSYKNTRRNKSIFVIINPFGGKGKAKKLFMTKAKPLLLASRCSIEVVYTKYPGHA---IEIAREMDIDKYDTIACASGDGIPHEVINGLYQRPD------------HVKAF-NNIAITEIPCGSGNAMSVSCHWTNNPSYSTLCLIKSIETRIDLMCC-SQPSYAREHPKLSFLSQTYGLIAETDINTEFIRWMGPARFELGVAFNIIQKKKYPCEI 459          
BLAST of Ceramide kinase vs. Ensembl Nematostella
Match: EDO48195 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RK69])

HSP 1 Score: 299.671 bits (766), Expect = 1.149e-95
Identity = 160/431 (37.12%), Postives = 243/431 (56.38%), Query Frame = 2
Query:  371 ISFDTE--YSCDQWFILISKLLQKEETRPRSLTVFINPIGGLKKGVQLYKDKISPIFELCGIKSTVTITKHRGEAEAYILKQKSFDVDGFICVGGDGMLMELVQGLLLKARLDAGLSDDEHELYSKEFPAGLRVGIIPAGSTDTVAYSTIGTKDPITAALHVVLGRSIGLDALSVHCDNKFIRYNVSLMGYGFYGNLVAESESLRWIGPRRYDWLGFKNFMSLEAYFGELKYLPAHSVKYGEPSDGIYCVGRCSRC--------LDDSNV-----IPSISHAEDWITVRDRFVAINSFLISCRCTKSPIGPAPFAHLGNGCTDLIIVRECSRFNFLQHLLRSASYEDHFDFDFVETVRVKEFSFRSLQD---LQSSSETNIPKIQNYELP------------WNCDGEPLYCPRVHCKVHKQIIKLFASGI 1573
            I+FD +    C +W   +  +L +   RP  L VF+NP+GG K+  ++Y+DKI P+FEL GI++ V +T+    A+ Y+ ++    VDG ICVGGDGM  E++ GL+++ + D  + D  +  +    P  + +G+IPAGSTD +AY T G  DP+T+ALH+++G    LD  SV    + +RY+VS+M YGF+G+++ +SE  RW+GP+RYD  GFK FM    Y G +K+L   S     P D   C   C  C        L D+ V      P  +    W +V+ +F+++    +SC C KSP G +P AHL +GC DLI+V+  SR  +L+H+LR A   DHF+F+FVE  RV+EF F    +    +  ++  +    +Y               W C GE L+   V   VH+Q++++FA GI
Sbjct:   19 ITFDCKDVALCREWIKAMQAILNENYERPNRLLVFVNPVGGKKQAAKIYRDKIQPLFELAGIQAEVIVTQRANHAKDYLEEEALEKVDGVICVGGDGMFHEILNGLIIRTQQDYDV-DTTNPDFQAVCPK-ISIGVIPAGSTDAIAYCTTGINDPVTSALHIIIGDIHPLDVCSVSNGQEVLRYSVSMMAYGFFGDVLQDSEKFRWMGPKRYDCSGFKKFMGNRGYEGTIKFLSDDS-SVASPQDRSRCRTGCFVCNETKDIQLLQDTAVGEVSQKPLQADGSQWRSVKGKFISVIGANMSCACAKSPEGLSPSAHLADGCLDLILVKHTSRVQYLRHMLRLAGTSDHFNFNFVEVFRVREFQFTPFHNDDPPEGHTDATVFLCGHYSRSHIFYHLSLQTHSW-CSGEHLFSLEVSVLVHRQLVRIFARGI 445          
BLAST of Ceramide kinase vs. Ensembl Nematostella
Match: EDO43299 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYW8])

HSP 1 Score: 166.777 bits (421), Expect = 1.578e-46
Identity = 93/262 (35.50%), Postives = 139/262 (53.05%), Query Frame = 2
Query:  338 RQHQLDILSTIISFDTEYSCDQWFILISKLLQKEETRPRSLTVFINPIGGLKKGVQLYKDKISPIFELCGIKSTVTITKHRGEAEAYILKQKSFD-VDGFICVGGDGMLMELVQGLLLKARLDAGLSDDEHELYSKEFPA---GLRVGIIPAGSTDTVAYSTIGTKDPITAALHVVLGRSIGLDALSVHCDNKFIRYNVSLMGYGFYGNLVAESESLRWIGPRRYDWLGFKNFMSLEAYFGELKYLPAHSVKYGEPSDGIYC 1111
            +   L   + ++    E SC  W   I+  L+    RP+ L V INP     K   +Y + +S +F   GI++ + +T+  G A  Y+         DG +CVGGDG++ E+V G+L       GL D   E   ++F A    +R+GIIPAGSTD +A+S +GT DP TAA+++ LG S  LD  S+   N+ +R+  SL  YGF G+++  SE  RW+GP+RY W   K    L++Y  E+ YL +   +   P D   C
Sbjct:   86 KDRTLSETNMVLECTDEDSCQHWVTAINDKLKSFPHRPKMLKVIINPYSKKGKAPHVYYNSVSKLFHRAGIRTDIMLTERAGHAWDYLRSATDLSSYDGVVCVGGDGIVHEVVNGILENTHAMEGL-DVTCEALPEDFKAITPDMRIGIIPAGSTDVIAFSGLGTNDPTTAAINIALGPSQSLDICSLESANRLVRFAFSL-AYGFLGDVLKSSEQSRWLGPKRYKWAAVKRMCRLKSYEVEINYLVSTDTE-SHPRDEQRC 344          
BLAST of Ceramide kinase vs. Ensembl Nematostella
Match: EDO40058 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S881])

HSP 1 Score: 97.0561 bits (240), Expect = 5.927e-22
Identity = 91/381 (23.88%), Postives = 171/381 (44.88%), Query Frame = 2
Query:  452 RSLTVFINPIGGLKKGVQLYKDKISPIFELCGIKSTVTITKHRGEAEAYILKQKSFDVDGFICVGGDGMLMELVQGLLLKARLDAGLSDDEHELYSKEFPAGLRVGIIPAGSTDTVAYSTI-GTKDP---ITAALHVVLGRSIGLDALS-VHCDNKFIRYNVSLMGYGFYGNLVAESESLRWIGPRRYDWLGFKNFMSLEAYFGELKYLPAHSVKYGEPSDGIYCVGRCSRCLDDSNVIPSISH--AEDWITVRDRFVAINSFLISCRCTKSPIGP----APFAHLGNGCTDLIIVRECSRFNFLQHLLRSASYEDHFDFDFVETVRVKEFSFRSLQDLQSSSETNIPKIQNYELPWNCDGEPLYCPRVHCKVHKQIIKLF 1561
            R + VF+NP  G  K ++++++K++P+FE   I   + IT++ G A+AY  +    + DG +   GDG++ E++ G + +   +  +               + +G+IP GS + + +S++  + +P   + A   V+ G    +D  S V   ++F  Y+   M +G   ++  ESE  R++G  R+        ++L  Y G + YLP     Y E  DG +     ++   + N++P++       W +V  +F+  +S ++      S +GP    AP +  G+G   L +    +  + +Q L      ED    D  E V V+  +FR   DL       I            DGE +    V  +VH+ + ++ 
Sbjct:    5 RKMLVFVNPFSGKGKSLKIFRNKVAPMFENADIDYKLVITEYAGHAKAYASQLCIPEWDGVVICSGDGLVFEVLNGFMNRQDWEVAIK--------------MPIGVIPTGSGNALCFSSLHASGEPMEVVCAIYAVIRGNIHEMDIASIVTPTSRF--YSFLSMTWGIMSDVDIESEKYRYLGNARFTVGAVVRILNLRLYQGRISYLP-----YEE--DGQFTRSSGNQFGPELNLLPALEENLPSSWKSVEGKFILCSSVMM------SHLGPDICAAPQSKFGDGI--LYVAYAEAGISKMQLLDMFMKMEDGSHIDCEEIVCVRACAFRLEPDLTQLGTIAI------------DGELIPYSAVQGQVHRGLGRVM 342          
BLAST of Ceramide kinase vs. Ensembl Nematostella
Match: EDO44393 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RW54])

HSP 1 Score: 72.4034 bits (176), Expect = 3.166e-15
Identity = 37/115 (32.17%), Postives = 58/115 (50.43%), Query Frame = 2
Query: 1178 WITVRDRFVAINSFLISCRCTKSPIGPAPFAHLGNGCTDLIIVRECSRFNFLQHLLRSASYEDHFDFDFVETVRVKEFSFRSLQDLQSSSETNIPKIQNYELPWNCDGEPLYCPR 1522
            W T R   V ++   +   C  SP G +P  HLG+G TD+IIVR C+      H+ R+ + +D FDFDFV   R+K+   R++ D + +++       +       DG  +  PR
Sbjct:    2 WQTFRGPVVGVSLITLPSPCDISPDGASPCCHLGDGYTDMIIVRACTTAEMYAHVQRNFNRKDQFDFDFVNVHRIKQCYIRAISDPEQATQNESNNQSDSARSRLVDGRAIPLPR 116          
BLAST of Ceramide kinase vs. Ensembl Nematostella
Match: EDO41738 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3K0])

HSP 1 Score: 65.0846 bits (157), Expect = 2.707e-11
Identity = 48/191 (25.13%), Postives = 89/191 (46.60%), Query Frame = 2
Query:  446 RPRSLTVFINPIGGLKKGVQLYKDKISPIFELCGIKSTVTITKHRGEAEAYILKQKSFDVDGFICVGGDGMLMELVQGLLLKARLDAGLSDDEHELYSKEFPAGLRVGIIPAGSTDTVAYSTIGTKDPI------TAALHVVLGRSIGLDALSVHCDNKFIRYNVSLMGYGFYGNLVAESESLRWI-GPRR 997
            +PR L VF N   G  +  +L++    PI  L G+  T+  T + G+ +  +++     +DG +  GGDG L+E V GLL +         D+ ++      + + +GIIP G+ +T      G+ +         AA+ +V G++     + +  +     + ++ + +G + +  AES    WI GP R
Sbjct:   62 KPRRLMVFFNATAGKGEAEKLFQRNAEPILHLAGLDVTIVKTDYEGQIKK-LMQYIDPSLDGIVVAGGDGTLLEAVTGLLRRP--------DQADV------SKIPIGIIPVGTNNTFFNRVFGSGNASQSRQIGNAAMTIVKGQTTSAGVMEIKGEEGRPTFALNGVHWGAFRD-TAESYDKYWITGPLR 236          
BLAST of Ceramide kinase vs. Ensembl Medaka
Match: cerk (ceramide kinase [Source:NCBI gene;Acc:101167008])

HSP 1 Score: 325.094 bits (832), Expect = 8.398e-104
Identity = 169/455 (37.14%), Postives = 261/455 (57.36%), Query Frame = 2
Query:  305 FIIYSVIPRLKRQHQLDILSTIISFDTEYSCDQWFILISKLLQKEETRPRSLTVFINPIGGLKKGVQLYKDKISPIFELCGIKSTVTITKHRGEAEAYILKQKSFD-VDGFICVGGDGMLMELVQGLLLKARLDAGLSDDEHELYSKEFPAGLRVGIIPAGSTDTVAYSTIGTKDPITAALHVVLGRSIGLDALSVHCDNKFIRYNVSLMGYGFYGNLVAESESLRWIGPRRYDWLGFKNFMSLEAYFGELKYLPAHSVKYGEPSDGIYCVGRCSRCLDDSNVIPSISHAED-----------WITVRDRFVAINSFLISCRCTKSPIGPAPFAHLGNGCTDLIIVRECSRFNFLQHLLRSASYEDHFDFDFVETVRVKEFSFRSL--QDLQSSSETNIPK---------IQNYELP------WNCDGEPLYCPRVHCKVHKQIIKLFASGIPHQ 1582
            F ++ V  +  + H+        S  +   C+QW  +  + L     RP+ L V+INP GG ++G ++Y++K++P+F+  GI + V +T+    A  ++  + +    DG +CVGGDGM  E++ GL+ + + D  +  D++   ++  P  LR+GIIPAGSTD + ++T+GT DP+T+ALH+++G S  +D  SVH ++ F+RY+VSL+GYGFYG+++A+SE  RW+GP RYD  G K F+    Y G + +LPA     G P D + C   CS C    +    +    D           W  +  +F+AIN+  +SC C +SP G +P AHL +G  DLI+VR+CSR +F +HLLR  + +D FD  FVE  RV++F F  L  Q L   +++ +PK          Q   +P      WNCDGE L+   +   VH+Q+I+LFA GI  Q
Sbjct:   97 FTVFYV--KRTKNHRWRCNEATFSCSSAELCEQWIQVTREQLSLLTNRPKRLLVYINPFGGKRRGKRIYEEKVAPVFQQAGISADVIVTERANHARDHLTTEANLQQYDGVVCVGGDGMFSEILHGLVARTQNDNKV--DQNRPDAELKPCMLRIGIIPAGSTDCICFATVGTNDPVTSALHIIIGDSQPMDVCSVHHNDVFLRYSVSLLGYGFYGDVLADSEKKRWLGPARYDLSGVKAFLCHNYYKGTVSFLPAED-NLGHPRDKLQCRFGCSICQHKQSSKDKLRETADEETAAEVSSSSWKVICGKFIAINAANMSCACPRSPKGLSPSAHLADGTADLILVRKCSRLDFFRHLLRHTNTDDQFDHSFVEVHRVRKFHFEPLDPQPLLLENQSELPKKPGFCPLGSAQTTCIPSAAHSSWNCDGEILHHAAIQVSVHRQLIRLFARGIEEQ 546          
BLAST of Ceramide kinase vs. Ensembl Medaka
Match: zgc:158263 (ceramide kinase [Source:NCBI gene;Acc:101165056])

HSP 1 Score: 274.248 bits (700), Expect = 6.905e-84
Identity = 161/477 (33.75%), Postives = 248/477 (51.99%), Query Frame = 2
Query:  383 TEYSC------DQWFILISKLLQKEET-RPRSLTVFINPIGGLKKGVQLYKDKISPIFELCGIKSTVTITKHRGEAEAYILKQKSFDVDGFICVGGDGMLMELVQGLLLKARLDAGLSDDEHELYSKEFPAGLRVGIIPAGSTDTVAYSTIGTKDPITAALHVVLGRSIGLDALSVHCDNKFIRYNVSLMGYGFYGNLVAESESLRWIGPRRYDWLGFKNFMSLEAYFGELKYLPAHSVKYGEPSDGIYCVGRCSRCLDDSN-VIPSISHAE----------------DWITVRDRFVAINSFLISCRCTKSPIGPAPFAHLGNGCTDLIIVRECSRFNFLQHLLRSASYEDHFDFDFVETVRVKEFSFRSLQDL--------------------------------QSSSETNIPKIQNYE----LPWNC---------------DGEPLYCPRVHCKVHKQIIKLFASGIPHQAS 1588
            T++SC      DQW   +   +Q     RP  L VFINP GG K   Q++   ++P+FEL GI S V +T+   +A  ++LK+     DG +CVGGDGM  E++ G++ + + +AG  +++  +  +  P  L +GIIPAGSTD V Y+T+G  DP+T+ALH+++G S  LD  SVH     +RY+VSL+GYGFYG+++ ESE  RW+GP RYD+ G   ++S  +Y G ++YLPA  +    P D   C+  C+ C   +  + P+ S +                 +W+TV+ RF  ++   +S  CT+SP+G +P AHL +G  DL++V + +  +FL+ L R  S +D FD  FVE  RVK   F    D+                                Q  +E    ++   E    +P+ C               DGE L    + CK+H Q+++L+A GI  +A+
Sbjct:   95 TQFSCPSRVLRDQWIKNLRTAVQTHTPLRPHRLLVFINPFGGKKMARQIFHSLVAPLFELAGISSHVIVTERANQARDHLLKKDLMGFDGVVCVGGDGMFSEILHGVIGRTQQEAGTCENDPGVTLQ--PCPLHIGIIPAGSTDCVCYATVGVIDPVTSALHIIIGDSQPLDVCSVHHGFALVRYSVSLLGYGFYGDVLVESEKHRWMGPLRYDYSGSMVYLSNRSYTGTVQYLPADPL-LSSPRDNTRCLSGCTVCSRSTERLFPNSSDSGSLYSSYSGHFHNDLEGEWVTVQGRFKCVSLTCMSSSCTRSPMGLSPSAHLADGTGDLVLVWDTNPLSFLRFLYRHTSTDDQFDLPFVEVHRVKAVRFSLAGDIKEEGHEEIREPSDEMDIEAGGQVRSGSRNGSQQHLAEKATGRVTTSEKKTVIPFTCCLCCKKPPAVSVWNCDGEILPFTNISCKIHGQLVRLYARGIEDKAA 568          
BLAST of Ceramide kinase vs. Ensembl Medaka
Match: cerkl (ceramide kinase like [Source:NCBI gene;Acc:101165852])

HSP 1 Score: 193.741 bits (491), Expect = 3.411e-54
Identity = 129/410 (31.46%), Postives = 200/410 (48.78%), Query Frame = 2
Query:  404 WFILISKLLQKEETRPRSLTVFINPIGGLKKGVQLYKDKISPIFELCGIKSTVTITKHRGEAEAYILKQKSFDVDGFICVGGDGMLMELVQGLLLKARLDAGLSDDEHELYSKEFPAGLRVGIIPAGSTDTVAYSTIGTKDPITAALHVVLGRSIGLDALSVHCDNKFIRYNVSLMGYGFYGNLVAESESLRWIG-PRRYDWLGFKNFMSLEAYFGELKYLPAHSVKYGEPSDGIYCVGRCSRCLDDSNVIPSISHAEDWITVRDRFVAINSFLISCRCTKSPIGPAPFAHLGNGCTDLIIVRECSRFNFLQHLLRSASYEDHFDFDFVET-----VRVKEFSFRSLQDLQSSSE-----TNIPKIQNYELPWNCDGEPL-YCPRVHCKVHKQIIKLFASGIPHQASNSS 1597
            W+  + + +    +RPR L VFINP    K+ V +Y++ ++P+F++  I++ +T+T+ +G   + I + K  + +G +CVGGDG + EL   L+ +A+LDA L +       K   A L +GIIPAGSTD V+ S  G +DP+TAALH++LG    +D  S     + + +  S M +GF G  +A +E  RW+   RR ++   K    L     EL +LPA   + GE S                           W T + ++++I+   I C  + +P G AP   L +G   LI V   SR  F++HL R  S    F F FVET     V+++  S       +S  E     T I + +    PWN DGE +     V  +VH ++I L+   +    S  S
Sbjct:  172 WYNALKEQIAGISSRPRYLKVFINPSSHKKEAVHIYRESVAPLFKMADIRTDITVTEKKGHTLSVIKECKLDEYNGVVCVGGDGSVAELCHALVFRAQLDANLPE-------KPVKAVLPLGIIPAGSTDVVSCSVHGVRDPVTAALHIILGHLQQVDMCSFSPVGQSVHFGFSAM-FGFGGRSLARAEKKRWMASSRRREYALVKTLAKLRPEECELSFLPAKKSREGEAS---------------------------WTTKQGQYLSISVMSIPCLSSHAPRGLAPNTSLTSGSASLIAVENTSRSEFIKHLKRFGSSSGEFSFSFVETHAVSAVKIRPLSMSGFSKEESEEEGDSKSTPIIQPEGAAFPWNIDGELVEIANEVLIRVHPRLISLYGEEVEEAESTVS 546          
BLAST of Ceramide kinase vs. Ensembl Medaka
Match: ENSORLT00000015689.2 (sphingosine kinase 1-like [Source:NCBI gene;Acc:101160322])

HSP 1 Score: 75.485 bits (184), Expect = 6.263e-14
Identity = 57/245 (23.27%), Postives = 101/245 (41.22%), Query Frame = 2
Query:  437 EETRPRSLTVFINPIGGLKKGVQLYKDKISPIFELCGIKSTVTITKHRGEAEAYILKQKSFDVDGFICVGGDGMLMELVQGLLLKARLDAGLSDDEHELYSKEFPAGLRVGIIPAGSTDTVA-----YSTI----GTKDPITAALHVVLGRSIGLDALSVHCDNKFIRYNVSLMGYGFYGNLVAESESLRWIGPRRYDWLGFKNFMSLEAYFGELKYLPAHSVKYGE-----------PSDGIYC 1111
            E  RP    + +NP  G  + +QL+   +  +     +  T+ IT+H+  A   + K      D  + + GDG+L E++ GL+            E E + +     L  GI+P GS + +A     YS +      +  ++    +  G    LD +S+H  ++   ++   + +GF  ++  ESE  R +G  R+         +L  Y G L YLPA      +           P  G++C
Sbjct:  148 ELQRPCRTMILVNPHSGRGQALQLFTGHVQGMLTEASVPYTLVITEHQNHARELVKKADLSQWDALVIMSGDGLLYEVINGLM------------EREDWQEAIQTPL--GILPGGSGNALAASVHHYSQLPPAWNEELLLSCGFMLCKGLVCSLDLVSIHLTSRQRLFSFLSLAWGFVADVDIESEKYRHVGAIRFLMGTLVRLAALRVYQGRLAYLPAKDAPKKDKASTKVNCSNTPQQGLFC 378          
BLAST of Ceramide kinase vs. Ensembl Medaka
Match: cerkl (ceramide kinase like [Source:NCBI gene;Acc:101165852])

HSP 1 Score: 74.3294 bits (181), Expect = 9.126e-14
Identity = 84/365 (23.01%), Postives = 140/365 (38.36%), Query Frame = 2
Query:  545 GIKSTVTITKHRGEAEAYILKQKSFDVDGFICVGGDGMLMELVQGLLLKARLDAGLSDDEHELYSKEFPAGLRVGIIPAGSTDTVAYSTIGTKDPITAALHVVLGRSIGLDALSVHCDNKFIRYNVSLMGYGFYGNLVAESESLRWIGPRRYDWLGFKNFMSLEAYFGELKYLPAHSVKYGEPSDGIYCVGRCSRCLDDSNVIPSISHAE---DWITVRDRFVAINSFLISCRCTKSPIGPAPFAHLGNGCTDLIIVRECSRFNFLQHLLRSASYEDHFDFDFVET-----VRVKEFSFRSLQDLQSSSE-----TNIPKIQNYELPWNCDGEPL-YCPRVHCKVHKQIIKLFASGIPHQASNSS 1597
             +K  + +T+ +G   + I + K  + +G +CVGGDG + EL   L+ +A+LDA L +       K   A L +GIIPAG+ +         +     ++ +  G    +D  S     + + +  S M +GF G  +A +E  RW+   R         ++LE                            C  C    N+    +  E    W T + ++++I+                            +I+   SR  F++HL R  S    F F FVET     V+++  S       +S  E     T I + +    PWN DGE +     V  +VH ++I L+   +    S  S
Sbjct:  119 ALKEQIAVTEKKGHTLSVIKECKLDEYNGVVCVGGDGSVAELCHALVFRAQLDANLPE-------KPVKAVLPLGIIPAGTKNNFFRKNQHIEVLCKKSISLFAGHLQQVDMCSFSPVGQSVHFGFSAM-FGFGGRSLARAEKKRWMASSRRREYALVKTLTLEQM-------------------------SCPVC----NLWLFFAEGEGEASWTTKQGQYLSIS----------------------------VIMENTSRSEFIKHLKRFGSSSGEFSFSFVETHAVSAVKIRPLSMSGFSKEESEEEGDSKSTPIIQPEGAAFPWNIDGELVEIANEVLIRVHPRLISLYGEEVEEAESTVS 418          
BLAST of Ceramide kinase vs. Planmine SMEST
Match: SMESG000062920.1 (SMESG000062920.1)

HSP 1 Score: 584.719 bits (1506), Expect = 0.000e+0
Identity = 279/280 (99.64%), Postives = 279/280 (99.64%), Query Frame = 2
Query:  782 GSTDTVAYSTIGTKDPITAALHVVLGRSIGLDALSVHCDNKFIRYNVSLMGYGFYGNLVAESESLRWIGPRRYDWLGFKNFMSLEAYFGELKYLPAHSVKYGEPSDGIYCVGRCSRCLDDSNVIPSISHAEDWITVRDRFVAINSFLISCRCTKSPIGPAPFAHLGNGCTDLIIVRECSRFNFLQHLLRSASYEDHFDFDFVETVRVKEFSFRSLQDLQSSSETNIPKIQNYELPWNCDGEPLYCPRVHCKVHKQIIKLFASGIPHQASNSSSHIKSTII 1621
            GSTDTVAYSTIGTKDPITAALHVVLGRSIGLDALSVHCDNKFIRYNVSLMGYGFYGNLVAESESLRWIGPRRYDWLGFKNFMSLEAYFGELKYLPA SVKYGEPSDGIYCVGRCSRCLDDSNVIPSISHAEDWITVRDRFVAINSFLISCRCTKSPIGPAPFAHLGNGCTDLIIVRECSRFNFLQHLLRSASYEDHFDFDFVETVRVKEFSFRSLQDLQSSSETNIPKIQNYELPWNCDGEPLYCPRVHCKVHKQIIKLFASGIPHQASNSSSHIKSTII
Sbjct:   52 GSTDTVAYSTIGTKDPITAALHVVLGRSIGLDALSVHCDNKFIRYNVSLMGYGFYGNLVAESESLRWIGPRRYDWLGFKNFMSLEAYFGELKYLPAPSVKYGEPSDGIYCVGRCSRCLDDSNVIPSISHAEDWITVRDRFVAINSFLISCRCTKSPIGPAPFAHLGNGCTDLIIVRECSRFNFLQHLLRSASYEDHFDFDFVETVRVKEFSFRSLQDLQSSSETNIPKIQNYELPWNCDGEPLYCPRVHCKVHKQIIKLFASGIPHQASNSSSHIKSTII 331          
BLAST of Ceramide kinase vs. Planmine SMEST
Match: SMESG000062918.1 (SMESG000062918.1)

HSP 1 Score: 496.893 bits (1278), Expect = 1.606e-175
Identity = 244/244 (100.00%), Postives = 244/244 (100.00%), Query Frame = 2
Query:   53 MLEYITENPVLPCPVSINGNKGRLSLIKETLILNYHYQSCDVNRRILINDIINVTKDCNFLLNNRLIQSPKILMKQLDNQEAFKFIIYSVIPRLKRQHQLDILSTIISFDTEYSCDQWFILISKLLQKEETRPRSLTVFINPIGGLKKGVQLYKDKISPIFELCGIKSTVTITKHRGEAEAYILKQKSFDVDGFICVGGDGMLMELVQGLLLKARLDAGLSDDEHELYSKEFPAGLRVGIIPAG 784
            MLEYITENPVLPCPVSINGNKGRLSLIKETLILNYHYQSCDVNRRILINDIINVTKDCNFLLNNRLIQSPKILMKQLDNQEAFKFIIYSVIPRLKRQHQLDILSTIISFDTEYSCDQWFILISKLLQKEETRPRSLTVFINPIGGLKKGVQLYKDKISPIFELCGIKSTVTITKHRGEAEAYILKQKSFDVDGFICVGGDGMLMELVQGLLLKARLDAGLSDDEHELYSKEFPAGLRVGIIPAG
Sbjct:    1 MLEYITENPVLPCPVSINGNKGRLSLIKETLILNYHYQSCDVNRRILINDIINVTKDCNFLLNNRLIQSPKILMKQLDNQEAFKFIIYSVIPRLKRQHQLDILSTIISFDTEYSCDQWFILISKLLQKEETRPRSLTVFINPIGGLKKGVQLYKDKISPIFELCGIKSTVTITKHRGEAEAYILKQKSFDVDGFICVGGDGMLMELVQGLLLKARLDAGLSDDEHELYSKEFPAGLRVGIIPAG 244          
BLAST of Ceramide kinase vs. Planmine SMEST
Match: SMESG000062322.1 (SMESG000062322.1)

HSP 1 Score: 65.855 bits (159), Expect = 3.326e-11
Identity = 72/336 (21.43%), Postives = 138/336 (41.07%), Query Frame = 2
Query:  464 VFINPIGGLKKGVQLYKDKISPIFELCGIKSTVTITKHRGEAEAYILKQKSF-DVDGFICVGGDGMLMELVQGLLLKARLDAGLSDDEHELYSKEFPAGLRVGIIPAGSTDTVAYSTIGTKDPITAALHVVLGRSI----------GLDALSVHCDNKFIRYNVSLMGYGFYGNLVAESESLRWIGPRRYDWLGFKNFMSLEAYFGELKYLPAHSV---------KYGEPSDGIYCVGRCSRCLDDSNVIPSISHAEDWITVRDRFVAINSFLISCRCTKSPIGPAPFAHLGNGCTDLIIVRECSRFNFLQHLLRSASYEDHFDFDFVETVRVKEF 1411
            + +NP  G +KG ++Y++ I  IFE   I   + +T+    A   +   ++  D  G I V GDG++ E+  G+  +      L               + +G+I AGS + +A ++I +   I  + +++L  ++           L  L      +F+ + +SL  +G   N+   S+ LRW+G  R++     +   L  +  +L YLP ++           Y    +       C + L D N    I   E WI + ++F+ I   L+    + + +  AP A + +G   L+I+      + L   +    Y  H    ++  +    F
Sbjct:   42 LIVNPKSGTQKGQKIYQNCIKEIFESHNIAYVLLMTEKPSHALGVVKNCENLTDYRGIITVSGDGLVYEVFCGIFERMSWKDDLQ-------------SIPIGVIAAGSGNGLA-ASISSFAGIHPSGNLILQNTLIFKDPQIQKKDLMILQTTERKEFLAF-LSLT-WGLIANVDVGSDKLRWMGTARFNISAAIHIAKLTKFKAKLWYLPVNTTFPKNNSYQYSYKSSIEQASYSKYCFKYLKDIN--EPIPEDEGWILLDEKFIGIVVTLLPYLASNAYV--APQAEIDDGKIHLLIINSNISRSELLSFISKIEYGTHLLSRYITLIECNAF 357          
BLAST of Ceramide kinase vs. Planmine SMEST
Match: SMESG000062322.1 (SMESG000062322.1)

HSP 1 Score: 65.855 bits (159), Expect = 3.782e-11
Identity = 72/336 (21.43%), Postives = 138/336 (41.07%), Query Frame = 2
Query:  464 VFINPIGGLKKGVQLYKDKISPIFELCGIKSTVTITKHRGEAEAYILKQKSF-DVDGFICVGGDGMLMELVQGLLLKARLDAGLSDDEHELYSKEFPAGLRVGIIPAGSTDTVAYSTIGTKDPITAALHVVLGRSI----------GLDALSVHCDNKFIRYNVSLMGYGFYGNLVAESESLRWIGPRRYDWLGFKNFMSLEAYFGELKYLPAHSV---------KYGEPSDGIYCVGRCSRCLDDSNVIPSISHAEDWITVRDRFVAINSFLISCRCTKSPIGPAPFAHLGNGCTDLIIVRECSRFNFLQHLLRSASYEDHFDFDFVETVRVKEF 1411
            + +NP  G +KG ++Y++ I  IFE   I   + +T+    A   +   ++  D  G I V GDG++ E+  G+  +      L               + +G+I AGS + +A ++I +   I  + +++L  ++           L  L      +F+ + +SL  +G   N+   S+ LRW+G  R++     +   L  +  +L YLP ++           Y    +       C + L D N    I   E WI + ++F+ I   L+    + + +  AP A + +G   L+I+      + L   +    Y  H    ++  +    F
Sbjct:   52 LIVNPKSGTQKGQKIYQNCIKEIFESHNIAYVLLMTEKPSHALGVVKNCENLTDYRGIITVSGDGLVYEVFCGIFERMSWKDDLQ-------------SIPIGVIAAGSGNGLA-ASISSFAGIHPSGNLILQNTLIFKDPQIQKKDLMILQTTERKEFLAF-LSLT-WGLIANVDVGSDKLRWMGTARFNISAAIHIAKLTKFKAKLWYLPVNTTFPKNNSYQYSYKSSIEQASYSKYCFKYLKDIN--EPIPEDEGWILLDEKFIGIVVTLLPYLASNAYV--APQAEIDDGKIHLLIINSNISRSELLSFISKIEYGTHLLSRYITLIECNAF 367          
BLAST of Ceramide kinase vs. Planmine SMEST
Match: SMESG000018881.1 (SMESG000018881.1)

HSP 1 Score: 50.0618 bits (118), Expect = 3.671e-6
Identity = 41/109 (37.61%), Postives = 52/109 (47.71%), Query Frame = 2
Query:  434 KEETRPRSLTVFINPIGGLKKGVQLYKDKISPIFELCGIKSTVTITKHRGEAEAYILKQKSFDVDGFICVGGDGMLMELVQGLLLKARLDAGLSDDEHELYSKEFPAGL 760
            KE TR   +TV  NP    +K    +   I P+  L G K TV  T    EA+  +   KS D D     GGDG LME+V GLL   R+D  L D  H++     P G+
Sbjct:   55 KELTR---VTVIHNPYANNRKCKDNFHKNIFPLLNLSGYKVTVVETDKAEEAKEMMSVLKSDDQDCIYIAGGDGTLMEIVTGLL--RRVD--LRDQIHKIPLALAPLGI 156          
The following BLAST results are available for this feature:
BLAST of Ceramide kinase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CERK3.391e-10638.68ceramide kinase [Source:HGNC Symbol;Acc:HGNC:19256... [more]
CERKL1.766e-6032.67ceramide kinase like [Source:HGNC Symbol;Acc:HGNC:... [more]
CERKL5.060e-5530.47ceramide kinase like [Source:HGNC Symbol;Acc:HGNC:... [more]
CERKL2.733e-4032.18ceramide kinase like [Source:HGNC Symbol;Acc:HGNC:... [more]
CERKL4.644e-3129.78ceramide kinase like [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of Ceramide kinase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cerk-18.453e-4928.92Ceramide kinase 1 [Source:UniProtKB/Swiss-Prot;Ac... [more]
sphk-15.651e-1423.32Sphingosine kinase 1 [Source:UniProtKB/Swiss-Prot... [more]
sphk-16.347e-1423.23Sphingosine kinase 1 [Source:UniProtKB/Swiss-Prot... [more]
sphk-16.347e-1423.23Sphingosine kinase 1 [Source:UniProtKB/Swiss-Prot... [more]
sphk-16.347e-1423.23Sphingosine kinase 1 [Source:UniProtKB/Swiss-Prot... [more]
back to top
BLAST of Ceramide kinase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cerk2.917e-6132.04gene:FBgn0037315 transcript:FBtr0078804[more]
Cerk2.917e-6132.04gene:FBgn0037315 transcript:FBtr0078803[more]
Sk15.368e-1626.39gene:FBgn0030300 transcript:FBtr0073497[more]
Sk15.368e-1626.39gene:FBgn0030300 transcript:FBtr0073498[more]
Sk23.662e-1424.91gene:FBgn0052484 transcript:FBtr0072984[more]
back to top
BLAST of Ceramide kinase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zgc:1582632.671e-9036.72zgc:158263 [Source:ZFIN;Acc:ZDB-GENE-070112-2262][more]
cerk1.604e-8941.46ceramide kinase [Source:ZFIN;Acc:ZDB-GENE-041210-2... [more]
cerkl4.146e-6434.95ceramide kinase-like [Source:ZFIN;Acc:ZDB-GENE-070... [more]
SPHK11.503e-1423.14sphingosine kinase 1 [Source:HGNC Symbol;Acc:HGNC:... [more]
agk2.375e-1124.86acylglycerol kinase [Source:NCBI gene;Acc:334270][more]
back to top
BLAST of Ceramide kinase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CERK1.566e-10439.37ceramide kinase [Source:NCBI gene;Acc:100487080][more]
CERK3.040e-10439.37ceramide kinase [Source:NCBI gene;Acc:100487080][more]
CERK3.378e-9938.95ceramide kinase [Source:NCBI gene;Acc:100487080][more]
CERK3.415e-9939.38ceramide kinase [Source:NCBI gene;Acc:100487080][more]
CERK9.080e-9939.95ceramide kinase [Source:NCBI gene;Acc:100487080][more]
back to top
BLAST of Ceramide kinase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cerk1.855e-10736.82ceramide kinase [Source:MGI Symbol;Acc:MGI:2386052... [more]
Cerkl1.217e-5429.65ceramide kinase-like [Source:MGI Symbol;Acc:MGI:30... [more]
Cerk4.825e-4236.84ceramide kinase [Source:MGI Symbol;Acc:MGI:2386052... [more]
Sphk12.458e-1823.43sphingosine kinase 1 [Source:MGI Symbol;Acc:MGI:13... [more]
Sphk12.789e-1822.93sphingosine kinase 1 [Source:MGI Symbol;Acc:MGI:13... [more]
back to top
BLAST of Ceramide kinase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8K4Q7|CERK1_MOUSE1.297e-10636.82Ceramide kinase OS=Mus musculus OX=10090 GN=Cerk P... [more]
sp|Q8TCT0|CERK1_HUMAN1.628e-10538.68Ceramide kinase OS=Homo sapiens OX=9606 GN=CERK PE... [more]
sp|Q6USK2|CERK_ARATH1.145e-5628.12Ceramide kinase OS=Arabidopsis thaliana OX=3702 GN... [more]
sp|Q49MI3|CERKL_HUMAN2.430e-5430.47Ceramide kinase-like protein OS=Homo sapiens OX=96... [more]
sp|Q9TZI1|CERK_CAEEL1.075e-4728.92Ceramide kinase 1 OS=Caenorhabditis elegans OX=623... [more]
back to top
BLAST of Ceramide kinase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3L8SQP04.121e-11138.79DAGKc domain-containing protein OS=Chloebia gouldi... [more]
H0Z0082.088e-11038.36Ceramide kinase OS=Taeniopygia guttata OX=59729 GN... [more]
A0A218UUF99.689e-11038.36Ceramide kinase OS=Lonchura striata domestica OX=2... [more]
V9KQK91.952e-10940.88Ceramide kinase (Fragment) OS=Callorhinchus milii ... [more]
A0A4W3J5F63.796e-10940.88DAGKc domain-containing protein OS=Callorhinchus m... [more]
back to top
BLAST of Ceramide kinase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cerk1.331e-9440.30ceramide kinase [Source:ZFIN;Acc:ZDB-GENE-041210-2... [more]
zgc:1582632.222e-8334.16ceramide kinase-like [Source:NCBI gene;Acc:1030401... [more]
zgc:1582632.419e-8334.16ceramide kinase-like [Source:NCBI gene;Acc:1030401... [more]
cerkl2.875e-6334.48ceramide kinase like [Source:NCBI gene;Acc:1030224... [more]
SPHK14.252e-1124.55sphingosine kinase 1 [Source:NCBI gene;Acc:1030233... [more]
back to top
BLAST of Ceramide kinase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
cerkl5.384e-5229.89ceramide kinase-like [Source:ZFIN;Acc:ZDB-GENE-070... [more]
agk1.487e-1424.31acylglycerol kinase [Source:NCBI gene;Acc:334270][more]
back to top
BLAST of Ceramide kinase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
LCB41.592e-1028.16Sphingoid long-chain base kinase; responsible for ... [more]
LCB55.594e-924.11Minor sphingoid long-chain base kinase; possibly i... [more]
back to top
BLAST of Ceramide kinase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO481951.149e-9537.12Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO432991.578e-4635.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO400585.927e-2223.88Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO443933.166e-1532.17Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO417382.707e-1125.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Ceramide kinase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cerk8.398e-10437.14ceramide kinase [Source:NCBI gene;Acc:101167008][more]
zgc:1582636.905e-8433.75ceramide kinase [Source:NCBI gene;Acc:101165056][more]
cerkl3.411e-5431.46ceramide kinase like [Source:NCBI gene;Acc:1011658... [more]
ENSORLT00000015689.26.263e-1423.27sphingosine kinase 1-like [Source:NCBI gene;Acc:10... [more]
cerkl9.126e-1423.01ceramide kinase like [Source:NCBI gene;Acc:1011658... [more]
back to top
BLAST of Ceramide kinase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000062920.10.000e+099.64SMESG000062920.1[more]
SMESG000062918.11.606e-175100.00SMESG000062918.1[more]
SMESG000062322.13.326e-1121.43SMESG000062322.1[more]
SMESG000062322.13.782e-1121.43SMESG000062322.1[more]
SMESG000018881.13.671e-637.61SMESG000018881.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30028389 ID=SMED30028389|Name=Ceramide kinase|organism=Schmidtea mediterranea sexual|type=transcript|length=1770bp
TATTCATTTGAAAGCGATATTTTGAGATTAAATTACAAATTTAAGTGGAG
CTATGCTTGAATATATCACAGAAAATCCTGTACTACCATGCCCAGTCTCA
ATAAATGGAAATAAAGGGCGATTATCATTAATAAAGGAAACCTTAATTTT
GAATTACCATTATCAATCATGTGATGTTAATAGAAGAATTTTAATAAATG
ACATTATTAATGTTACAAAAGATTGCAATTTCTTATTAAACAATCGTTTG
ATTCAATCCCCTAAAATTTTGATGAAACAACTAGATAACCAGGAAGCTTT
CAAATTTATAATTTATTCAGTTATTCCTCGTCTGAAAAGACAGCACCAAC
TTGATATCCTATCTACAATTATCAGTTTTGATACTGAATATAGTTGTGAT
CAGTGGTTCATATTAATTAGTAAATTACTTCAAAAAGAGGAAACCCGCCC
TCGATCTCTGACAGTGTTCATCAATCCTATTGGTGGTTTAAAGAAAGGAG
TACAGCTATATAAAGATAAAATTAGCCCTATTTTTGAATTATGCGGAATA
AAGTCGACTGTGACAATAACAAAACATCGAGGCGAAGCTGAAGCTTACAT
TCTTAAACAGAAATCCTTTGACGTTGACGGTTTTATTTGTGTTGGTGGTG
ATGGGATGCTGATGGAGCTGGTGCAAGGATTATTATTAAAAGCCAGGTTA
GATGCGGGTCTTTCAGATGACGAGCATGAGCTGTATAGCAAAGAATTTCC
AGCTGGATTAAGAGTCGGAATTATTCCGGCAGGTTCCACAGACACTGTAG
CTTATTCGACGATTGGTACCAAAGATCCGATCACCGCGGCTCTCCATGTA
GTGCTAGGGAGGAGTATAGGACTTGATGCTCTCTCGGTTCATTGTGACAA
TAAGTTCATTAGATATAATGTTTCACTGATGGGATATGGGTTTTATGGCA
ATTTAGTTGCAGAAAGTGAATCATTGCGTTGGATAGGCCCAAGACGGTAT
GATTGGCTAGGTTTTAAAAATTTTATGTCTCTTGAAGCTTATTTTGGTGA
ATTGAAATATTTGCCAGCTCATTCTGTTAAATACGGTGAACCATCTGATG
GGATTTATTGTGTCGGGAGGTGCTCAAGGTGCTTAGACGATTCCAATGTC
ATTCCAAGCATCAGTCACGCAGAAGATTGGATCACAGTTCGCGATCGTTT
TGTCGCTATAAATTCATTTCTTATCAGCTGTCGGTGTACGAAGTCTCCAA
TCGGTCCAGCTCCTTTTGCTCACCTTGGAAATGGATGTACTGACCTCATA
ATTGTCCGAGAATGTTCCCGGTTTAATTTTTTACAGCATTTATTACGAAG
TGCATCTTACGAAGATCATTTCGATTTCGACTTTGTTGAAACGGTTCGGG
TAAAGGAATTTTCCTTTAGATCTCTACAAGATCTCCAATCATCGAGCGAA
ACTAACATTCCTAAAATTCAAAACTATGAACTGCCGTGGAATTGTGATGG
TGAACCCCTTTACTGTCCGCGAGTTCATTGCAAAGTCCACAAACAGATTA
TCAAATTATTTGCCAGTGGGATTCCTCACCAGGCATCGAACAGTAGTTCC
CATATCAAGTCAACAATAATTTAAGATTACTTTAATTTTTAGAAAATATA
TTTTCTTGTATTATTATCTAATAAAATTTCTTTTATTTCGTCGTGCCGAG
TTGTGTCCATCATTAACCAGAAAATTTAAATAATTTATATCAGTTGGCGC
ATAATTTTTTTGATTTTGCA
back to top

protein sequence of SMED30028389-orf-1

>SMED30028389-orf-1 ID=SMED30028389-orf-1|Name=SMED30028389-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=524bp
MLEYITENPVLPCPVSINGNKGRLSLIKETLILNYHYQSCDVNRRILIND
IINVTKDCNFLLNNRLIQSPKILMKQLDNQEAFKFIIYSVIPRLKRQHQL
DILSTIISFDTEYSCDQWFILISKLLQKEETRPRSLTVFINPIGGLKKGV
QLYKDKISPIFELCGIKSTVTITKHRGEAEAYILKQKSFDVDGFICVGGD
GMLMELVQGLLLKARLDAGLSDDEHELYSKEFPAGLRVGIIPAGSTDTVA
YSTIGTKDPITAALHVVLGRSIGLDALSVHCDNKFIRYNVSLMGYGFYGN
LVAESESLRWIGPRRYDWLGFKNFMSLEAYFGELKYLPAHSVKYGEPSDG
IYCVGRCSRCLDDSNVIPSISHAEDWITVRDRFVAINSFLISCRCTKSPI
GPAPFAHLGNGCTDLIIVRECSRFNFLQHLLRSASYEDHFDFDFVETVRV
KEFSFRSLQDLQSSSETNIPKIQNYELPWNCDGEPLYCPRVHCKVHKQII
KLFASGIPHQASNSSSHIKSTII*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003951NAD+ kinase activity
GO:0016301kinase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR017438ATP-NAD_kinase_N
IPR001206Diacylglycerol_kinase_cat_dom
IPR016064NAD/diacylglycerol_kinase_sf
Vocabulary: biological process
TermDefinition
GO:0016310phosphorylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001206Diacylglycerol kinase, catalytic domainPFAMPF00781DAGK_catcoord: 136..278
e-value: 4.7E-19
score: 68.3
IPR001206Diacylglycerol kinase, catalytic domainPROSITEPS50146DAGKcoord: 131..283
score: 28.674
NoneNo IPR availableGENE3DG3DSA:2.60.200.40coord: 276..504
e-value: 2.4E-46
score: 160.0
NoneNo IPR availablePANTHERPTHR12358SPHINGOSINE KINASEcoord: 82..511
NoneNo IPR availablePANTHERPTHR12358:SF25CERAMIDE KINASEcoord: 82..511
IPR017438Inorganic polyphosphate/ATP-NAD kinase, N-terminalGENE3DG3DSA:3.40.50.10330coord: 120..271
e-value: 9.8E-29
score: 101.4
IPR016064NAD kinase/diacylglycerol kinase-like domain superfamilySUPERFAMILYSSF111331NAD kinase/diacylglycerol kinase-likecoord: 132..504