BTB domain-containing protein

Overview
NameBTB domain-containing protein
Smed IDSMED30028384
Length (bp)3011
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of BTB domain-containing protein (SMED30028384) t-SNE clustered cells

Violin plots show distribution of expression levels for BTB domain-containing protein (SMED30028384) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of BTB domain-containing protein (SMED30028384) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for BTB domain-containing protein (SMED30028384) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30028384

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30028384SMESG000045114.1 dd_Smed_v4_5109_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
zeta neoblastSMED30028384SMESG000045114.1 dd_Smed_v4_5109_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of BTB domain-containing protein vs. Ensembl Human
Match: IVNS1ABP (influenza virus NS1A binding protein [Source:HGNC Symbol;Acc:HGNC:16951])

HSP 1 Score: 173.326 bits (438), Expect = 1.402e-44
Identity = 96/305 (31.48%), Postives = 156/305 (51.15%), Query Frame = 1
Query: 1579 LSTSRCAAGLVNVNDQLIVIGGFNRGECLNSVEIYQPLINKWSPSLSMKLCRAR--LVALVGQSDKENPYVYAIGGSDGYKE-LHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGNLAIVGGC--FGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPEPSYSRRGASLVPYNGKLYLFGGSDSNSSLRTLEIFDSVANQWSLSVQQMKQSRANLCGGVLLNKLMAIGGFTGKHFLDTMECVDFDESCEISSEWSMYVPI 2478
            +  +R   G   +N +LI  GG+NR ECL +VE Y P  + WS    M+  RAR  +  L+GQ       +Y +GGS+G+ + L   E +D N   W  V  +   R   G   +       G L IVGG   +G   L++C+++D     W+    ++  R Q+AV  +   L+++GG +SW CL++ E  +     W  +   + +RRGA +   NGKL++ GG D + ++  +E++D   N+W + +  M   R+N     + N + A+GGF G  FL+T+E  + +     S+EWS Y  I
Sbjct:  354 MQYARSGLGTAEMNGKLIAAGGYNREECLRTVECYNPHTDHWSFLAPMRTPRARFQMAVLMGQ-------LYVVGGSNGHSDDLSCGEMYDSNIDDWIPVPELRTNRCNAGVCAL------NGKLYIVGGSDPYGQKGLKNCDVFDPVTKLWTSCAPLNIRRHQSAVCELGGYLYIIGGAESWNCLNTVERYNPENNTWTLIAPMNVARRGAGVAVLNGKLFVCGGFDGSHAISCVEMYDPTRNEWKM-MGNMTSPRSNAGIATVGNTIYAVGGFDGNEFLNTVEVYNLE-----SNEWSPYTKI 639          

HSP 2 Score: 96.6709 bits (239), Expect = 7.693e-20
Identity = 62/229 (27.07%), Postives = 114/229 (49.78%), Query Frame = 1
Query:   37 NKLSLIDDRSRHSELLNRLNKLRISKAFCDVTVFAENKEFVAHKVILASSSDYFLSKFTEDPKCDRLSI----NMNKDIFNLLLDYFYTSNLIVSKEKVPQLFSAAKYLKVRRVVKVCAQFLTKILSLDNIIDVRESVALNDSEDLCQAANAFIKENMDKIISN---VKIQKLNMDIMVDTVPKKENDSRLAELVIDWLEYSIVEDNMKLSDFVNENLVFFLTPSNSLV 702
            N   + +D +     + +LN LR S  FCDV +     E +AH+ +LA  S Y    F  D     +S     ++N +   +LL+Y YT+ L   KE V  ++SAAK LK+ RV +VC  +L   + + + I  R   +      L    +A+I+E++ +I      +K+ +L +++M++      ++ +L   VI+W++ SI E+   L + + E    + +  + L+
Sbjct:    4 NGYLMFEDENFIESSVAKLNALRKSGQFCDVRLQVCGHEMLAHRAVLACCSPYLFEIFNSDSDPHGISHVKFDDLNPEAVEVLLNYAYTAQLKADKELVKDVYSAAKKLKMDRVKQVCGDYLLSRMDVTSCISYRNFASCMGDSRLLNKVDAYIQEHLLQISEEEEFLKLPRLKLEVMLEDNVCLPSNGKLYTKVINWVQRSIWENGDSLEELMEEVQTLYYSADHKLL 232          

HSP 3 Score: 60.077 bits (144), Expect = 1.854e-8
Identity = 35/119 (29.41%), Postives = 64/119 (53.78%), Query Frame = 1
Query: 1531 LKKVNTKVSTLERFDCLSTSRCAAGLVNVNDQLIVIGGFNRGECLNSVEIYQPLINKWSPSLSMKLCRARL-VALVGQSDKENPYVYAIGGSDGYKELHTVERFDVNNQRWTRVANINQ 1884
            +++ N + +T      ++ +R  AG+  +N +L V GGF+    ++ VE+Y P  N+W    +M   R+   +A VG +      +YA+GG DG + L+TVE +++ +  W+    I Q
Sbjct:  529 VERYNPENNTWTLIAPMNVARRGAGVAVLNGKLFVCGGFDGSHAISCVEMYDPTRNEWKMMGNMTSPRSNAGIATVGNT------IYAVGGFDGNEFLNTVEVYNLESNEWSPYTKIFQ 641          

HSP 4 Score: 51.6026 bits (122), Expect = 7.029e-6
Identity = 32/121 (26.45%), Postives = 56/121 (46.28%), Query Frame = 1
Query: 2026 LKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPEPSYSRRGASLVPYNGKLYLFGGSDSNS-SLRTLEIFDSVANQWSLSVQQMKQSRANLCGGVLLNKLMAIGG 2385
            +  M  +RS    A ++ +L   GG +  +CL + E  +     W  +      R    +    G+LY+ GGS+ +S  L   E++DS  + W + V +++ +R N     L  KL  +GG
Sbjct:  351 MSPMQYARSGLGTAEMNGKLIAAGGYNREECLRTVECYNPHTDHWSFLAPMRTPRARFQMAVLMGQLYVVGGSNGHSDDLSCGEMYDSNIDDW-IPVPELRTNRCNAGVCALNGKLYIVGG 470          
BLAST of BTB domain-containing protein vs. Ensembl Human
Match: KLHL18 (kelch like family member 18 [Source:HGNC Symbol;Acc:HGNC:29120])

HSP 1 Score: 144.436 bits (363), Expect = 2.477e-35
Identity = 97/308 (31.49%), Postives = 148/308 (48.05%), Query Frame = 1
Query: 1591 RCAAGLVNVNDQLIVIGGFNR-GECLNSVEIYQPLINKWSPSLSMKLCRARL-VALVGQSDKENPYVYAIGGSDGYKELHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGNLAIVGGCFGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPEPSYSRRGASLVPYNGKLYLFGGSDSNSSLRTLEIFDSVANQWSLSV-QQMKQSRANL---CGGVLLNKLMAIGGFTGKHFLDTMECVDFDESCEISSEWSMYVPIGWSVNG 2496
            RC   +  +   +  +GG N  G+ LN VE++ P+ N W     M   R+R+ VA+V      N  +YAIGG DG   L TVE ++     WTRV ++N +RS  G  V+       G + + GG  G ++L S E Y    DKW+ + SMS++RS A V   + +++V GG D  +  SS E  +     W         R          K+++ GG D +  L   E++ SVA+QW L V    ++SR +L   CG     +L A+GG+ G+  L ++E  D +  C     W+   P+     G
Sbjct:  281 RCCTSIAGL---IYAVGGLNSAGDSLNVVEVFDPIANCWERCRPMTTARSRVGVAVV------NGLLYAIGGYDGQLRLSTVEAYNPETDTWTRVGSMNSKRSAMGTVVLD------GQIYVCGGYDGNSSLSSVETYSPETDKWTVVTSMSSNRSAAGVTVFEGRIYVSGGHDGLQIFSSVEHYNHHTATWHPAAGMLNKRCRHGAASLGSKMFVCGGYDGSGFLSIAEMYSSVADQWCLIVPMHTRRSRVSLVASCG-----RLYAVGGYDGQSNLSSVEMYDPETDC-----WTFMAPMACHEGG 563          

HSP 2 Score: 94.3597 bits (233), Expect = 3.380e-19
Identity = 61/213 (28.64%), Postives = 98/213 (46.01%), Query Frame = 1
Query: 1531 LKKVNTKVSTLERFDCLSTSRCAAGLVNVNDQLIVIGGFNRGECLNSVEIYQPLINKWSPSLSMKLCRARLVALVGQSDKENPYVYAIGGSDGYKELHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGNLAIVGGCFGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTM 2169
            ++  N +  T  R   +++ R A G V ++ Q+ V GG++    L+SVE Y P  +KW+   SM   R+     V +       +Y  GG DG +   +VE ++ +   W   A +  +R  HG A      S    + + GG  G   L   E+Y +  D+W  +  M T RS+ ++ +   +L+ VGG D    LSS E+ D     W  M
Sbjct:  353 VEAYNPETDTWTRVGSMNSKRSAMGTVVLDGQIYVCGGYDGNSSLSSVETYSPETDKWTVVTSMSSNRSAAGVTVFEGR-----IYVSGGHDGLQIFSSVEHYNHHTATWHPAAGMLNKRCRHGAA------SLGSKMFVCGGYDGSGFLSIAEMYSSVADQWCLIVPMHTRRSRVSLVASCGRLYAVGGYDGQSNLSSVEMYDPETDCWTFM 554          

HSP 3 Score: 78.1814 bits (191), Expect = 3.881e-14
Identity = 50/194 (25.77%), Postives = 98/194 (50.52%), Query Frame = 1
Query:   73 SELLNR----LNKLRISKAFCDVTVFAENKEFVAHKVILASSSDYFLSKFTED-PKCDRLSI---NMNKDIFNLLLDYFYTSNLIVSKEKVPQLFSAAKYLKVRRVVKVCAQFLTKILSLDNIIDVRESVALNDSEDLCQAANAFIKENMDKIISNVKIQKLNMDIMVDTVPKKE----NDSRLAELVIDWLEY 618
            SEL +R    + ++R     CDVT+   + +F AH+++LA+S  YF + FT D  +C +  I    M+      L+++ Y  NL + ++ V  L   A +L+++ +   C  FL + L   N + VR+         L  AAN+FI ++  ++  + +   L ++ +++ V + E    ++ ++ E  + W+ Y
Sbjct:   18 SELPSRGYGVMEEIRRQGKLCDVTLKIGDHKFSAHRIVLAASIPYFHAMFTNDMMECKQDEIVMQGMDPSALEALINFAYNGNLAIDQQNVQSLLMGASFLQLQSIKDACCTFLRERLHPKNCLGVRQFAETMMCAVLYDAANSFIHQHFVEVSMSEEFLALPLEDVLELVSRDELNVKSEEQVFEAALAWVRY 211          
BLAST of BTB domain-containing protein vs. Ensembl Human
Match: KLHL20 (kelch like family member 20 [Source:HGNC Symbol;Acc:HGNC:25056])

HSP 1 Score: 142.51 bits (358), Expect = 1.478e-34
Identity = 90/264 (34.09%), Postives = 134/264 (50.76%), Query Frame = 1
Query: 1552 VSTLERFD----------CLSTSRCAAGLVNVNDQLIVIGGFNRGECLNSVEIYQPLINKWSPSLS-MKLCRARL-VALVGQSDKENPYVYAIGGSDGYKELHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGNLAIVGGCFGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPEPSYSRRGASLVPYNGKLYLFGGSDSNSSLRTLEIFDSVANQWSL 2307
            +S++ER+D           +S  RC  G+  ++D L  +GG +    LNSVE Y P  N+WS  ++    CR  + VA++G       ++YA+GG DG   L+ VER+D    +WTRVA+++  R   G AV  +G    G L  VGG  G + L + E Y+   ++W  +  M T R     A   + ++ VGG D    LSS E  + R  +W  +   +  R G  L   NG+L   GG D  + L+T+E+FD  AN W L
Sbjct:  332 ISSVERYDPQTNEWRMVASMSKRRCGVGVSVLDDLLYAVGGHDGSSYLNSVERYDPKTNQWSSDVAPTSTCRTSVGVAVLGG------FLYAVGGQDGVSCLNIVERYDPKENKWTRVASMSTRRL--GVAVAVLG----GFLYAVGGSDGTSPLNTVERYNPQENRWHTIAPMGTRRKHLGCAVYQDMIYAVGGRDDTTELSSAERYNPRTNQWSPVVAMTSRRSGVGLAVVNGQLMAVGGFDGTTYLKTIEVFDPDANTWRL 583          

HSP 2 Score: 140.584 bits (353), Expect = 5.931e-34
Identity = 93/290 (32.07%), Postives = 144/290 (49.66%), Query Frame = 1
Query: 1609 VNVNDQLIVIGGFNRGECLNSVEIYQPLINKWS--PSLSMKLCRARLVALVGQSDKENPYVYAIGGSDGYKELHTVERFDVNNQRWTR-VANINQERSYHGGAVMPVGASSAGNLAIVGGCFGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPEPSYSRRGASLVPYNGKLYLFGGSDSNSSLRTLEIFDSVANQWSLSVQQMKQSRANLCGGVLLNKLMAIGGFTGKHFLDTMECVDFDESCEISSEWSMY 2469
            +   + L  +GG+  G+ ++SVE Y P  N+W    S+S + C   +  L       +  +YA+GG DG   L++VER+D    +W+  VA  +  R+  G AV+       G L  VGG  G + L   E YD   +KW+ + SMST R   AVA +   L+ VGG+D    L++ E  + +E +W T+      R+      Y   +Y  GG D  + L + E ++   NQWS  V  M   R+ +   V+  +LMA+GGF G  +L T+E  D D     ++ W +Y
Sbjct:  314 IRCGEVLFAVGGWCSGDAISSVERYDPQTNEWRMVASMSKRRCGVGVSVL-------DDLLYAVGGHDGSSYLNSVERYDPKTNQWSSDVAPTSTCRTSVGVAVL------GGFLYAVGGQDGVSCLNIVERYDPKENKWTRVASMSTRRLGVAVAVLGGFLYAVGGSDGTSPLNTVERYNPQENRWHTIAPMGTRRKHLGCAVYQDMIYAVGGRDDTTELSSAERYNPRTNQWS-PVVAMTSRRSGVGLAVVNGQLMAVGGFDGTTYLKTIEVFDPD-----ANTWRLY 584          

HSP 3 Score: 107.457 bits (267), Expect = 2.442e-23
Identity = 70/209 (33.49%), Postives = 102/209 (48.80%), Query Frame = 1
Query: 1582 STSRCAAGLVNVNDQLIVIGGFNRGECLNSVEIYQPLINKWSPSLSMKLCRARL-VALVGQSDKENPYVYAIGGSDGYKELHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGNLAIVGGCFGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPEPSYSRRGASL 2205
            ST R + G+  +   L  +GG +   CLN VE Y P  NKW+   SM   R  + VA++G       ++YA+GGSDG   L+TVER++    RW  +A +   R + G AV          +  VGG      L S E Y+   ++WS + +M++ RS   +A ++ QL  VGG D    L + EV D     WR     +Y R G  +
Sbjct:  400 STCRTSVGVAVLGGFLYAVGGQDGVSCLNIVERYDPKENKWTRVASMSTRRLGVAVAVLGG------FLYAVGGSDGTSPLNTVERYNPQENRWHTIAPMGTRRKHLGCAVY------QDMIYAVGGRDDTTELSSAERYNPRTNQWSPVVAMTSRRSGVGLAVVNGQLMAVGGFDGTTYLKTIEVFDPDANTWRLYGGMNYRRLGGGV 596          

HSP 4 Score: 98.2117 bits (243), Expect = 2.511e-20
Identity = 69/280 (24.64%), Postives = 131/280 (46.79%), Query Frame = 1
Query:   25 IPKSNKLSLIDDRSRHSELLNRLNKLRISKAFCDVTVFAENKEFVAHKVILASSSDYFLSKFTEDPKCDRLSINMNKDI----FNLLLDYFYTSNLIVSKEKVPQLFSAAKYLKVRRVVKVCAQFLTKILSLDNIIDVRESVALNDSEDLCQAANAFIKENMDKIISNVKIQKLNMDIMVDTVPKKENDSRLAE----LVIDWLEYSIVEDNMKLSDFVNENLVFFLTPS--NSLVQCSEMASSNKFSSTFINDYFNGFLSYQ-KNISKRVKCRPRSKER 831
            +P+  ++  I D+    + L  +N LR  +  CDV +    K+  AH+VIL++ S YF + FT +    R +  + +DI      LL+D+ YTS + V +  V  L  AA  L++  + + C +FL + L   N + +R     +   +L + A+ F + N  +++ + +   L  + ++D +   E + R  E     V+ W++YSI E   +L   +    +  L+P      V    +  S++     +++  N  L  Q + + +  + RPR   R
Sbjct:   37 VPQPARMPYISDK-HPRQTLEVINLLRKHRELCDVVLVVGAKKIYAHRVILSACSPYFRAMFTGELAESRQTEVVIRDIDERAMELLIDFAYTSQITVEEGNVQTLLPAACLLQLAEIQEACCEFLKRQLDPSNCLGIRAFADTHSCRELLRIADKFTQHNFQEVMESEEFMLLPANQLIDIISSDELNVRSEEQVFNAVMAWVKYSIQERRPQLPQVLQHVRLPLLSPKFLVGTVGSDPLIKSDEECRDLVDEAKNYLLLPQERPLMQGPRTRPRKPIR 315          

HSP 5 Score: 80.4925 bits (197), Expect = 9.285e-15
Identity = 57/181 (31.49%), Postives = 83/181 (45.86%), Query Frame = 1
Query: 1942 LAIVGGCFGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPEP-SYSRRGASLVPYNGKLYLFGGSDSNSSLRTLEIFDSVANQWSLSVQQMKQSRANLCGGVLLNKLMAIGGFTGKHFLDTMECVDFDESCEISSEWSMYVPIG 2481
             A+ G C G + + S E YD   ++W  + SMS  R    V+ +D+ L+ VGG D    L+S E  D +  +W +   P S  R    +    G LY  GG D  S L  +E +D   N+W+  V  M   R  +   VL   L A+GG  G   L+T+E  +  E     + W    P+G
Sbjct:  321 FAVGGWCSG-DAISSVERYDPQTNEWRMVASMSKRRCGVGVSVLDDLLYAVGGHDGSSYLNSVERYDPKTNQWSSDVAPTSTCRTSVGVAVLGGFLYAVGGQDGVSCLNIVERYDPKENKWT-RVASMSTRRLGVAVAVLGGFLYAVGGSDGTSPLNTVERYNPQE-----NRWHTIAPMG 494          

HSP 6 Score: 74.3294 bits (181), Expect = 6.204e-13
Identity = 51/182 (28.02%), Postives = 79/182 (43.41%), Query Frame = 1
Query: 1528 LLKKVNTKVSTLERFDCLSTSRCAAGLVNVNDQLIVIGGFNRGECLNSVEIYQPLINKWSPSLSMKLCRARLVALVGQSDKENPYVYAIGGSDGYKELHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGNLAIVGGCFGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASI 2073
            ++++ + K +   R   +ST R    +  +   L  +GG +    LN+VE Y P  N+W     M   R  L   V Q       +YA+GG D   EL + ER++    +W+ V  +   RS  G AV+       G L  VGG  G   L++ E++D   + W     M+  R    V  I
Sbjct:  429 IVERYDPKENKWTRVASMSTRRLGVAVAVLGGFLYAVGGSDGTSPLNTVERYNPQENRWHTIAPMGTRRKHLGCAVYQD-----MIYAVGGRDDTTELSSAERYNPRTNQWSPVVAMTSRRSGVGLAVV------NGQLMAVGGFDGTTYLKTIEVFDPDANTWRLYGGMNYRRLGGGVGVI 599          
BLAST of BTB domain-containing protein vs. Ensembl Human
Match: KLHL8 (kelch like family member 8 [Source:HGNC Symbol;Acc:HGNC:18644])

HSP 1 Score: 135.961 bits (341), Expect = 2.566e-33
Identity = 86/253 (33.99%), Postives = 128/253 (50.59%), Query Frame = 1
Query: 1579 LSTSRCAAGLVNVNDQLIVIGGFNRGECLNSVEIYQPLINKWSPSLSMKLCRARLVALVGQSDKENPYVYAIGGSDGYKELHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGNLAIVGGCFGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPEPSYSRRGASLVPYNGKLYLFGGSDSNSSLRTLEIFDSVANQWSLSVQQMKQSRA 2337
            +++ R   G+++V  ++  +GG +  E L S+E++ PL NKW    SM   R R +AL          +YAIGG D     + VER+D+ + +W+ VA +N  R   G   +        ++  VGG  G  +L S E YD  LDKW ++K M   R+   V+ +   L+VVGG D    LSS E  D R  KW  +   +  R G  +    GK++  GG + N+ L T+E FD V N+W L V  +   RA
Sbjct:  169 MNSRRRHVGVISVEGKVYAVGGHDGNEHLGSMEMFDPLTNKWMMKASMNTKR-RGIALASLGGP----IYAIGGLDDNTCFNDVERYDIESDQWSTVAPMNTPRGGVGSVAL------VNHVYAVGGNDGMASLSSVERYDPHLDKWIEVKEMGQRRAGNGVSKLHGCLYVVGGFDDNSPLSSVERYDPRSNKWDYVAALTTPRGGVGIATVMGKIFAVGGHNGNAYLNTVEAFDPVLNRWEL-VGSVSHCRA 409          

HSP 2 Score: 100.138 bits (248), Expect = 2.059e-21
Identity = 68/234 (29.06%), Postives = 110/234 (47.01%), Query Frame = 1
Query: 1543 NTKVSTLERFDCLS----------TSRCAAGLVNVNDQLIVIGGFNRGECLNSVEIYQPLINKWSPSLSMKLCRARL--VALVGQSDKENPYVYAIGGSDGYKELHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGNLAIVGGCFGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPEPSYSRRGASLV 2208
            N  + ++E FD L+          T R    L ++   +  IGG +   C N VE Y    ++WS    M   R  +  VALV        +VYA+GG+DG   L +VER+D +  +W  V  + Q R+ +G + +       G L +VGG    + L S E YD   +KW  + +++T R    +A++  ++F VGG +    L++ E  D    +W  +   S+ R GA + 
Sbjct:  194 NEHLGSMEMFDPLTNKWMMKASMNTKRRGIALASLGGPIYAIGGLDDNTCFNDVERYDIESDQWSTVAPMNTPRGGVGSVALVN-------HVYAVGGNDGMASLSSVERYDPHLDKWIEVKEMGQRRAGNGVSKL------HGCLYVVGGFDDNSPLSSVERYDPRSNKWDYVAALTTPRGGVGIATVMGKIFAVGGHNGNAYLNTVEAFDPVLNRWELVGSVSHCRAGAGVA 414          

HSP 3 Score: 83.5741 bits (205), Expect = 4.323e-16
Identity = 53/167 (31.74%), Postives = 80/167 (47.90%), Query Frame = 1
Query: 1930 SAGNLAIVGGCFGPNN-LRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPEPSYSRRGASLVPYNGKLYLFGGSDSNSSLRTLEIFDSVANQWSLSVQQMKQSRANLCGGVLLNKLMAIGGFTGKHFLDTMECVD 2427
            +AG L  VGG  G  +  RS E Y    + W     M++ R    V S++ +++ VGG D  + L S E+ D    KW      +  RRG +L    G +Y  GG D N+    +E +D  ++QWS +V  M   R  +    L+N + A+GG  G   L ++E  D
Sbjct:  133 TAGVLFCVGGRGGSGDPFRSIECYSINKNSWFFGPEMNSRRRHVGVISVEGKVYAVGGHDGNEHLGSMEMFDPLTNKWMMKASMNTKRRGIALASLGGPIYAIGGLDDNTCFNDVERYDIESDQWS-TVAPMNTPRGGVGSVALVNHVYAVGGNDGMASLSSVERYD 298          

HSP 4 Score: 56.9954 bits (136), Expect = 1.250e-7
Identity = 39/132 (29.55%), Postives = 65/132 (49.24%), Query Frame = 1
Query: 1552 VSTLERFDC----------LSTSRCAAGLVNVNDQLIVIGGFNRGECLNSVEIYQPLINKWSPSLSMKLCRAR--LVALVGQSDKENPYVYAIGGSDGYKELHTVERFDVNNQRWTRVANINQERSYHGGAV 1911
            +S++ER+D           +   R   G+  ++  L V+GGF+    L+SVE Y P  NKW    ++   R    +  ++G+       ++A+GG +G   L+TVE FD    RW  V +++  R+  G AV
Sbjct:  291 LSSVERYDPHLDKWIEVKEMGQRRAGNGVSKLHGCLYVVGGFDDNSPLSSVERYDPRSNKWDYVAALTTPRGGVGIATVMGK-------IFAVGGHNGNAYLNTVEAFDPVLNRWELVGSVSHCRAGAGVAV 415          
BLAST of BTB domain-containing protein vs. Ensembl Human
Match: KLHL8 (kelch like family member 8 [Source:HGNC Symbol;Acc:HGNC:18644])

HSP 1 Score: 138.272 bits (347), Expect = 3.954e-33
Identity = 86/254 (33.86%), Postives = 128/254 (50.39%), Query Frame = 1
Query: 1579 LSTSRCAAGLVNVNDQLIVIGGFNRGECLNSVEIYQPLINKWSPSLSMKLCRARLVALVGQSDKENPYVYAIGGSDGYKELHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGNLAIVGGCFGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPEPSYSRRGASLVPYNGKLYLFGGSDSNSSLRTLEIFDSVANQWSLSVQQMKQSRAN 2340
            +++ R   G+++V  ++  +GG +  E L S+E++ PL NKW    SM   R R +AL          +YAIGG D     + VER+D+ + +W+ VA +N  R   G   +        ++  VGG  G  +L S E YD  LDKW ++K M   R+   V+ +   L+VVGG D    LSS E  D R  KW  +   +  R G  +    GK++  GG + N+ L T+E FD V N+W L V  +   RA 
Sbjct:  352 MNSRRRHVGVISVEGKVYAVGGHDGNEHLGSMEMFDPLTNKWMMKASMNTKR-RGIALASLGGP----IYAIGGLDDNTCFNDVERYDIESDQWSTVAPMNTPRGGVGSVAL------VNHVYAVGGNDGMASLSSVERYDPHLDKWIEVKEMGQRRAGNGVSKLHGCLYVVGGFDDNSPLSSVERYDPRSNKWDYVAALTTPRGGVGIATVMGKIFAVGGHNGNAYLNTVEAFDPVLNRWEL-VGSVSHCRAG 593          

HSP 2 Score: 101.679 bits (252), Expect = 1.935e-21
Identity = 68/234 (29.06%), Postives = 110/234 (47.01%), Query Frame = 1
Query: 1543 NTKVSTLERFDCLS----------TSRCAAGLVNVNDQLIVIGGFNRGECLNSVEIYQPLINKWSPSLSMKLCRARL--VALVGQSDKENPYVYAIGGSDGYKELHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGNLAIVGGCFGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPEPSYSRRGASLV 2208
            N  + ++E FD L+          T R    L ++   +  IGG +   C N VE Y    ++WS    M   R  +  VALV        +VYA+GG+DG   L +VER+D +  +W  V  + Q R+ +G + +       G L +VGG    + L S E YD   +KW  + +++T R    +A++  ++F VGG +    L++ E  D    +W  +   S+ R GA + 
Sbjct:  377 NEHLGSMEMFDPLTNKWMMKASMNTKRRGIALASLGGPIYAIGGLDDNTCFNDVERYDIESDQWSTVAPMNTPRGGVGSVALVN-------HVYAVGGNDGMASLSSVERYDPHLDKWIEVKEMGQRRAGNGVSKL------HGCLYVVGGFDDNSPLSSVERYDPRSNKWDYVAALTTPRGGVGIATVMGKIFAVGGHNGNAYLNTVEAFDPVLNRWELVGSVSHCRAGAGVA 597          

HSP 3 Score: 85.1149 bits (209), Expect = 2.841e-16
Identity = 53/167 (31.74%), Postives = 80/167 (47.90%), Query Frame = 1
Query: 1930 SAGNLAIVGGCFGPNN-LRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPEPSYSRRGASLVPYNGKLYLFGGSDSNSSLRTLEIFDSVANQWSLSVQQMKQSRANLCGGVLLNKLMAIGGFTGKHFLDTMECVD 2427
            +AG L  VGG  G  +  RS E Y    + W     M++ R    V S++ +++ VGG D  + L S E+ D    KW      +  RRG +L    G +Y  GG D N+    +E +D  ++QWS +V  M   R  +    L+N + A+GG  G   L ++E  D
Sbjct:  316 TAGVLFCVGGRGGSGDPFRSIECYSINKNSWFFGPEMNSRRRHVGVISVEGKVYAVGGHDGNEHLGSMEMFDPLTNKWMMKASMNTKRRGIALASLGGPIYAIGGLDDNTCFNDVERYDIESDQWS-TVAPMNTPRGGVGSVALVNHVYAVGGNDGMASLSSVERYD 481          

HSP 4 Score: 58.151 bits (139), Expect = 7.030e-8
Identity = 45/158 (28.48%), Postives = 75/158 (47.47%), Query Frame = 1
Query: 1552 VSTLERFDC----------LSTSRCAAGLVNVNDQLIVIGGFNRGECLNSVEIYQPLINKWSPSLSMKLCRAR--LVALVGQSDKENPYVYAIGGSDGYKELHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGNLAIVGGCFGPNNLRSC 1989
            +S++ER+D           +   R   G+  ++  L V+GGF+    L+SVE Y P  NKW    ++   R    +  ++G+       ++A+GG +G   L+TVE FD    RW  V +++  R+   GA + V +     +  VG   G NN+  C
Sbjct:  474 LSSVERYDPHLDKWIEVKEMGQRRAGNGVSKLHGCLYVVGGFDDNSPLSSVERYDPRSNKWDYVAALTTPRGGVGIATVMGK-------IFAVGGHNGNAYLNTVEAFDPVLNRWELVGSVSHCRA---GAGVAVCSCLTSQIRDVG--HGSNNVVDC 619          
BLAST of BTB domain-containing protein vs. Ensembl Celegans
Match: ivns-1 (Influenza Virus NS1a (A) binding protein homolog [Source:UniProtKB/TrEMBL;Acc:Q21854])

HSP 1 Score: 169.088 bits (427), Expect = 7.398e-43
Identity = 105/327 (32.11%), Postives = 156/327 (47.71%), Query Frame = 1
Query: 1465 TKHEGPFTDSKSDDQSTVLQQLLKKVNTKVSTLERFDCLSTSRCAAGLVNVNDQLIVIGGFNRGECLNSVEIYQPLINKWSPSLSMKLCRARLVALVGQSDKENPYVYAIGGSDGYKELHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGNLAIVGGCFGPNNLRSCEIYDTTL-----DKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPEPSYSRRGASLVPYNGKLYLFGGSDSNSSLRTLEIFDSVANQWSLSVQQMKQSRANLCGGVLL-NKLMAIGGFTGKHFLDTMECVD 2427
            TK E    DS+   ++ +L +L+     +   LE   C+S  RC+ G   +N ++ V GG++RGECL SVE Y  +  KW     MK  R R    +         V+A+ GS+G  +L + E +D     W  + N+   R ++G A +         +  +GG F    L+ CE  DTT       +W  + SM   R QA V +    +   GG D W C+ S E  D +   WR +P+   +RRG ++      LY+ GG D   SL T+EI DS ++QW +    +   RAN    V   N +  IGGF G  FLDT+E ++
Sbjct:  469 TKREPCPVDSQ---KAALLSRLISCTGKQQKPLE---CMSAPRCSIGASFLNGKIFVCGGYDRGECLRSVEEYDVVNGKWRNVAKMKAERGRFDCTI-----HGGKVFAVAGSNGNNDLKSCEIYDPKADVWAPLPNLATARCHNGCATI------DNYVYCIGGSFDQKVLKDCERLDTTKLGTEEAEWEPMASMEHPRYQAGVCTWKGLVVAAGGCDRWTCMDSVEAFDPKTNAWRQLPKLRQARRGGAVAVVRDTLYVIGGHDGTQSLDTVEILDSPSSQWRVG-PTLTTPRANTHAVVTAGNVIFCIGGFNGVKFLDTIELLE 777          

HSP 2 Score: 126.716 bits (317), Expect = 1.676e-29
Identity = 76/241 (31.54%), Postives = 118/241 (48.96%), Query Frame = 1
Query: 1774 NPYVYAIGGSDGYKELHTVERFDVNNQRWTRVANINQER-----SYHGGAVMPVGASSAGNLAIVGGCFGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDL-----REGKWRTMPEPSYSRRGASLVPYNGKLYLFGGSDSNSSLRTLEIFDSVANQWSLSVQQMKQSRANLCGGVLLNKLMAIGGFTGKHFLDTMECVDFDESCEISSEWSM 2466
            N  ++  GG D  + L +VE +DV N +W  VA +  ER     + HGG V  V  S+           G N+L+SCEIYD   D W+ L +++T+R     A+IDN ++ +GG+   K L  CE +D       E +W  M    + R  A +  + G +   GG D  + + ++E FD   N W   + +++Q+R      V+ + L  IGG  G   LDT+E +D       SS+W +
Sbjct:  514 NGKIFVCGGYDRGECLRSVEEYDVVNGKWRNVAKMKAERGRFDCTIHGGKVFAVAGSN-----------GNNDLKSCEIYDPKADVWAPLPNLATARCHNGCATIDNYVYCIGGSFDQKVLKDCERLDTTKLGTEEAEWEPMASMEHPRYQAGVCTWKGLVVAAGGCDRWTCMDSVEAFDPKTNAWR-QLPKLRQARRGGAVAVVRDTLYVIGGHDGTQSLDTVEILD-----SPSSQWRV 737          

HSP 3 Score: 75.8702 bits (185), Expect = 1.203e-13
Identity = 54/204 (26.47%), Postives = 89/204 (43.63%), Query Frame = 1
Query:   49 LIDDRSRHSELLNRLNKLRISKAFCDVTVFAENKEFVAHKVILASSSDYFLSKFTE------DPKCDRLS----------INMNKDI------------------------------FNLLLDYFYTSNLIVSKEKVPQLFSAAKYLKVRRVVKVCAQFLTKILSLDNIIDVRESVALNDSEDLCQAANAFIKENMDKIISNVK 522
            ++ D S  ++LL+RLN  R ++  CD  +F + +E   HKV+LA+ S   L  F E      D K    S           N N ++                              F  L+++ YT+NL +S  KV +L+  A  L++  V++ CA +L + L L N I +R     ++   L    + FI +N D I+++ K
Sbjct:   70 MLRDPSIKNDLLDRLNTFRRNRELCDAVLFVKEREIFVHKVVLAAVSPALLDMFNEENESSQDEKSPTSSSPTNGHTNGITNGNGEVAHENGAPVSAQKPQKSSTTFYEFSQTDFECFEALVNFAYTANLEISSRKVAELYKTAYALQMIPVIRACAAYLAENLQLSNCIGIRRQANFHNDTFLMGKVDQFIVDNFDSIVNDSK 273          

HSP 4 Score: 70.0922 bits (170), Expect = 6.273e-12
Identity = 54/201 (26.87%), Postives = 91/201 (45.27%), Query Frame = 1
Query: 1579 LSTSRCAAGLVNVNDQLIVIGGFNRGECLNSVEIYQPLI-----NKWSPSLSMKLCRARLVALVGQSDKENPYVYAIGGSDGYKELHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGNLAIVGGCFGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQA-AVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWR 2163
            L+T+RC  G   +++ +  IGG    + L   E            +W P  SM+  R +      +       V A GG D +  + +VE FD     W ++  + Q R   GGAV  V  +    L ++GG  G  +L + EI D+   +W    +++T R+   AV +  N +F +GG +  K L + E+++  +  WR
Sbjct:  595 LATARCHNGCATIDNYVYCIGGSFDQKVLKDCERLDTTKLGTEEAEWEPMASMEHPRYQAGVCTWKG-----LVVAAGGCDRWTCMDSVEAFDPKTNAWRQLPKLRQAR--RGGAVAVVRDT----LYVIGGHDGTQSLDTVEILDSPSSQWRVGPTLTTPRANTHAVVTAGNVIFCIGGFNGVKFLDTIELLENEQIGWR 784          
BLAST of BTB domain-containing protein vs. Ensembl Celegans
Match: ivns-1 (Influenza Virus NS1a (A) binding protein homolog [Source:UniProtKB/TrEMBL;Acc:Q21854])

HSP 1 Score: 169.088 bits (427), Expect = 7.398e-43
Identity = 105/327 (32.11%), Postives = 156/327 (47.71%), Query Frame = 1
Query: 1465 TKHEGPFTDSKSDDQSTVLQQLLKKVNTKVSTLERFDCLSTSRCAAGLVNVNDQLIVIGGFNRGECLNSVEIYQPLINKWSPSLSMKLCRARLVALVGQSDKENPYVYAIGGSDGYKELHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGNLAIVGGCFGPNNLRSCEIYDTTL-----DKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPEPSYSRRGASLVPYNGKLYLFGGSDSNSSLRTLEIFDSVANQWSLSVQQMKQSRANLCGGVLL-NKLMAIGGFTGKHFLDTMECVD 2427
            TK E    DS+   ++ +L +L+     +   LE   C+S  RC+ G   +N ++ V GG++RGECL SVE Y  +  KW     MK  R R    +         V+A+ GS+G  +L + E +D     W  + N+   R ++G A +         +  +GG F    L+ CE  DTT       +W  + SM   R QA V +    +   GG D W C+ S E  D +   WR +P+   +RRG ++      LY+ GG D   SL T+EI DS ++QW +    +   RAN    V   N +  IGGF G  FLDT+E ++
Sbjct:  469 TKREPCPVDSQ---KAALLSRLISCTGKQQKPLE---CMSAPRCSIGASFLNGKIFVCGGYDRGECLRSVEEYDVVNGKWRNVAKMKAERGRFDCTI-----HGGKVFAVAGSNGNNDLKSCEIYDPKADVWAPLPNLATARCHNGCATI------DNYVYCIGGSFDQKVLKDCERLDTTKLGTEEAEWEPMASMEHPRYQAGVCTWKGLVVAAGGCDRWTCMDSVEAFDPKTNAWRQLPKLRQARRGGAVAVVRDTLYVIGGHDGTQSLDTVEILDSPSSQWRVG-PTLTTPRANTHAVVTAGNVIFCIGGFNGVKFLDTIELLE 777          

HSP 2 Score: 126.716 bits (317), Expect = 1.676e-29
Identity = 76/241 (31.54%), Postives = 118/241 (48.96%), Query Frame = 1
Query: 1774 NPYVYAIGGSDGYKELHTVERFDVNNQRWTRVANINQER-----SYHGGAVMPVGASSAGNLAIVGGCFGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDL-----REGKWRTMPEPSYSRRGASLVPYNGKLYLFGGSDSNSSLRTLEIFDSVANQWSLSVQQMKQSRANLCGGVLLNKLMAIGGFTGKHFLDTMECVDFDESCEISSEWSM 2466
            N  ++  GG D  + L +VE +DV N +W  VA +  ER     + HGG V  V  S+           G N+L+SCEIYD   D W+ L +++T+R     A+IDN ++ +GG+   K L  CE +D       E +W  M    + R  A +  + G +   GG D  + + ++E FD   N W   + +++Q+R      V+ + L  IGG  G   LDT+E +D       SS+W +
Sbjct:  514 NGKIFVCGGYDRGECLRSVEEYDVVNGKWRNVAKMKAERGRFDCTIHGGKVFAVAGSN-----------GNNDLKSCEIYDPKADVWAPLPNLATARCHNGCATIDNYVYCIGGSFDQKVLKDCERLDTTKLGTEEAEWEPMASMEHPRYQAGVCTWKGLVVAAGGCDRWTCMDSVEAFDPKTNAWR-QLPKLRQARRGGAVAVVRDTLYVIGGHDGTQSLDTVEILD-----SPSSQWRV 737          

HSP 3 Score: 75.8702 bits (185), Expect = 1.203e-13
Identity = 54/204 (26.47%), Postives = 89/204 (43.63%), Query Frame = 1
Query:   49 LIDDRSRHSELLNRLNKLRISKAFCDVTVFAENKEFVAHKVILASSSDYFLSKFTE------DPKCDRLS----------INMNKDI------------------------------FNLLLDYFYTSNLIVSKEKVPQLFSAAKYLKVRRVVKVCAQFLTKILSLDNIIDVRESVALNDSEDLCQAANAFIKENMDKIISNVK 522
            ++ D S  ++LL+RLN  R ++  CD  +F + +E   HKV+LA+ S   L  F E      D K    S           N N ++                              F  L+++ YT+NL +S  KV +L+  A  L++  V++ CA +L + L L N I +R     ++   L    + FI +N D I+++ K
Sbjct:   70 MLRDPSIKNDLLDRLNTFRRNRELCDAVLFVKEREIFVHKVVLAAVSPALLDMFNEENESSQDEKSPTSSSPTNGHTNGITNGNGEVAHENGAPVSAQKPQKSSTTFYEFSQTDFECFEALVNFAYTANLEISSRKVAELYKTAYALQMIPVIRACAAYLAENLQLSNCIGIRRQANFHNDTFLMGKVDQFIVDNFDSIVNDSK 273          

HSP 4 Score: 70.0922 bits (170), Expect = 6.273e-12
Identity = 54/201 (26.87%), Postives = 91/201 (45.27%), Query Frame = 1
Query: 1579 LSTSRCAAGLVNVNDQLIVIGGFNRGECLNSVEIYQPLI-----NKWSPSLSMKLCRARLVALVGQSDKENPYVYAIGGSDGYKELHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGNLAIVGGCFGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQA-AVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWR 2163
            L+T+RC  G   +++ +  IGG    + L   E            +W P  SM+  R +      +       V A GG D +  + +VE FD     W ++  + Q R   GGAV  V  +    L ++GG  G  +L + EI D+   +W    +++T R+   AV +  N +F +GG +  K L + E+++  +  WR
Sbjct:  595 LATARCHNGCATIDNYVYCIGGSFDQKVLKDCERLDTTKLGTEEAEWEPMASMEHPRYQAGVCTWKG-----LVVAAGGCDRWTCMDSVEAFDPKTNAWRQLPKLRQAR--RGGAVAVVRDT----LYVIGGHDGTQSLDTVEILDSPSSQWRVGPTLTTPRANTHAVVTAGNVIFCIGGFNGVKFLDTIELLENEQIGWR 784          
BLAST of BTB domain-containing protein vs. Ensembl Celegans
Match: ivns-1 (Influenza Virus NS1a (A) binding protein homolog [Source:UniProtKB/TrEMBL;Acc:Q21854])

HSP 1 Score: 169.088 bits (427), Expect = 7.398e-43
Identity = 105/327 (32.11%), Postives = 156/327 (47.71%), Query Frame = 1
Query: 1465 TKHEGPFTDSKSDDQSTVLQQLLKKVNTKVSTLERFDCLSTSRCAAGLVNVNDQLIVIGGFNRGECLNSVEIYQPLINKWSPSLSMKLCRARLVALVGQSDKENPYVYAIGGSDGYKELHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGNLAIVGGCFGPNNLRSCEIYDTTL-----DKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPEPSYSRRGASLVPYNGKLYLFGGSDSNSSLRTLEIFDSVANQWSLSVQQMKQSRANLCGGVLL-NKLMAIGGFTGKHFLDTMECVD 2427
            TK E    DS+   ++ +L +L+     +   LE   C+S  RC+ G   +N ++ V GG++RGECL SVE Y  +  KW     MK  R R    +         V+A+ GS+G  +L + E +D     W  + N+   R ++G A +         +  +GG F    L+ CE  DTT       +W  + SM   R QA V +    +   GG D W C+ S E  D +   WR +P+   +RRG ++      LY+ GG D   SL T+EI DS ++QW +    +   RAN    V   N +  IGGF G  FLDT+E ++
Sbjct:  469 TKREPCPVDSQ---KAALLSRLISCTGKQQKPLE---CMSAPRCSIGASFLNGKIFVCGGYDRGECLRSVEEYDVVNGKWRNVAKMKAERGRFDCTI-----HGGKVFAVAGSNGNNDLKSCEIYDPKADVWAPLPNLATARCHNGCATI------DNYVYCIGGSFDQKVLKDCERLDTTKLGTEEAEWEPMASMEHPRYQAGVCTWKGLVVAAGGCDRWTCMDSVEAFDPKTNAWRQLPKLRQARRGGAVAVVRDTLYVIGGHDGTQSLDTVEILDSPSSQWRVG-PTLTTPRANTHAVVTAGNVIFCIGGFNGVKFLDTIELLE 777          

HSP 2 Score: 126.716 bits (317), Expect = 1.676e-29
Identity = 76/241 (31.54%), Postives = 118/241 (48.96%), Query Frame = 1
Query: 1774 NPYVYAIGGSDGYKELHTVERFDVNNQRWTRVANINQER-----SYHGGAVMPVGASSAGNLAIVGGCFGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDL-----REGKWRTMPEPSYSRRGASLVPYNGKLYLFGGSDSNSSLRTLEIFDSVANQWSLSVQQMKQSRANLCGGVLLNKLMAIGGFTGKHFLDTMECVDFDESCEISSEWSM 2466
            N  ++  GG D  + L +VE +DV N +W  VA +  ER     + HGG V  V  S+           G N+L+SCEIYD   D W+ L +++T+R     A+IDN ++ +GG+   K L  CE +D       E +W  M    + R  A +  + G +   GG D  + + ++E FD   N W   + +++Q+R      V+ + L  IGG  G   LDT+E +D       SS+W +
Sbjct:  514 NGKIFVCGGYDRGECLRSVEEYDVVNGKWRNVAKMKAERGRFDCTIHGGKVFAVAGSN-----------GNNDLKSCEIYDPKADVWAPLPNLATARCHNGCATIDNYVYCIGGSFDQKVLKDCERLDTTKLGTEEAEWEPMASMEHPRYQAGVCTWKGLVVAAGGCDRWTCMDSVEAFDPKTNAWR-QLPKLRQARRGGAVAVVRDTLYVIGGHDGTQSLDTVEILD-----SPSSQWRV 737          

HSP 3 Score: 75.8702 bits (185), Expect = 1.203e-13
Identity = 54/204 (26.47%), Postives = 89/204 (43.63%), Query Frame = 1
Query:   49 LIDDRSRHSELLNRLNKLRISKAFCDVTVFAENKEFVAHKVILASSSDYFLSKFTE------DPKCDRLS----------INMNKDI------------------------------FNLLLDYFYTSNLIVSKEKVPQLFSAAKYLKVRRVVKVCAQFLTKILSLDNIIDVRESVALNDSEDLCQAANAFIKENMDKIISNVK 522
            ++ D S  ++LL+RLN  R ++  CD  +F + +E   HKV+LA+ S   L  F E      D K    S           N N ++                              F  L+++ YT+NL +S  KV +L+  A  L++  V++ CA +L + L L N I +R     ++   L    + FI +N D I+++ K
Sbjct:   70 MLRDPSIKNDLLDRLNTFRRNRELCDAVLFVKEREIFVHKVVLAAVSPALLDMFNEENESSQDEKSPTSSSPTNGHTNGITNGNGEVAHENGAPVSAQKPQKSSTTFYEFSQTDFECFEALVNFAYTANLEISSRKVAELYKTAYALQMIPVIRACAAYLAENLQLSNCIGIRRQANFHNDTFLMGKVDQFIVDNFDSIVNDSK 273          

HSP 4 Score: 70.0922 bits (170), Expect = 6.273e-12
Identity = 54/201 (26.87%), Postives = 91/201 (45.27%), Query Frame = 1
Query: 1579 LSTSRCAAGLVNVNDQLIVIGGFNRGECLNSVEIYQPLI-----NKWSPSLSMKLCRARLVALVGQSDKENPYVYAIGGSDGYKELHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGNLAIVGGCFGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQA-AVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWR 2163
            L+T+RC  G   +++ +  IGG    + L   E            +W P  SM+  R +      +       V A GG D +  + +VE FD     W ++  + Q R   GGAV  V  +    L ++GG  G  +L + EI D+   +W    +++T R+   AV +  N +F +GG +  K L + E+++  +  WR
Sbjct:  595 LATARCHNGCATIDNYVYCIGGSFDQKVLKDCERLDTTKLGTEEAEWEPMASMEHPRYQAGVCTWKG-----LVVAAGGCDRWTCMDSVEAFDPKTNAWRQLPKLRQAR--RGGAVAVVRDT----LYVIGGHDGTQSLDTVEILDSPSSQWRVGPTLTTPRANTHAVVTAGNVIFCIGGFNGVKFLDTIELLENEQIGWR 784          
BLAST of BTB domain-containing protein vs. Ensembl Celegans
Match: kel-3 (KELch-repeat containing protein [Source:UniProtKB/TrEMBL;Acc:O18147])

HSP 1 Score: 150.984 bits (380), Expect = 6.831e-38
Identity = 98/305 (32.13%), Postives = 153/305 (50.16%), Query Frame = 1
Query: 1564 ERFDCLSTSRCAAGLVNVNDQLIV-IGGF-NRGECLNSVEIYQPLINKWSPSLSMKLCRARLVALVGQSDKENPYVYAIGGSDGYKELHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGNLAIVGGCFGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPEPSYSRRGASLVPYNGKLYLFGGSDSNSSLRTLEIFDSVANQWS-LSVQQMKQSRANLCGGVLLNK-LMAIGGFTGKHFLDTMECVDFDESCEISSEWSM 2466
            +R   + + +C   L  +   LIV IGG  ++ +  +SVEIY P   KWSP   M   R R+   V Q       VYAIGG +G   L  VE+FD +  +WT ++ + ++RS    A +         L + GG  G ++L S EIYD   + W     M   RS A V  ID  +++ GG D  +  +S E +D    +W  +P     R       + GK+Y+ GG D  S L+++E++D V  +WS +S   M++SR +L   V  N+ L A+ GF G++ L +ME  D     +++  W++
Sbjct:  283 DRRSLIKSFKCTPRLCQIVPGLIVAIGGLMHQSQSKSSVEIYDPTSKKWSPIDGMVTLRTRVGVAVNQRQ-----VYAIGGFNGQDRLDLVEKFDYDTLKWTTLSPLTRKRSALAAAFV------TNRLYVCGGYDGLHSLSSIEIYDINRNVWEAGPPMENMRSAAGVTVIDKHIYICGGHDGMQIFASVERLDTENQQWERIPSMIQQRCRFGAATFKGKIYVAGGYDGTSFLKSVEVYDPVEKKWSPVSPMNMRRSRVSL---VSTNEGLFAVAGFDGENNLCSMEQYD-----DVTDSWTI 568          

HSP 2 Score: 68.5514 bits (166), Expect = 1.590e-11
Identity = 65/278 (23.38%), Postives = 132/278 (47.48%), Query Frame = 1
Query:   40 KLSLIDDRSRHSELLNRLNKLRISKAFCDVTVFAENKEFVAHKVILASSSDYFLSKFTED-PKCDRLSIN-----MNKDIFNLLLDYFYTSNLIVSKEKVPQLFSAAKYLKVRRVVKVCAQFLTKILSLDNIIDVRESVALNDSED-LCQAANAFIKENMDKIISNVKIQKLNMDIMVDTVPKK----ENDSRLAELVIDWLEYSIV--EDNMKLSDFVNENLVFFLTPS--NSLVQCSEMASSNKFSSTFIN---DYFNGFLSYQKNISKRVKCRPR 819
            K+ ++D+  + S  +   N+LR     CDV +  EN++  AHKVILA++  YF   FT D  + +   IN     MN +  + LL + YT  L ++   V  +   A + ++  VV+ C  FL   L   N + +RE   +   E+ + +  + +I+++   +  +   ++L+++  ++ +       +++ ++    ++WL   ++  E   K+   V   L   L+P+  +S+V  + +   +      I+   DY    L  ++++ K  KC PR
Sbjct:   26 KVDILDEMYKKSYSI--FNELRSKCQLCDVALLVENRKLSAHKVILAATIPYFRGMFTLDLMEANMKEINIEDSDMNYETVDALLSFAYTGELRITTSNVQSIMLGANFFQMLEVVQHCGNFLLTRLHPSNALSIREFCKMMCVEEKITEMTDDYIQKHFMAVSKDEDFKRLSLEDAIELLRNDHLYVDSEEQVYVAAMEWLNCDVIRHEQAAKILPCVRLPL---LSPTYLSSIVASNPIIKKDIPCRDLIDEAKDYH--LLPDRRSLIKSFKCTPR 296          

HSP 3 Score: 66.6254 bits (161), Expect = 6.808e-11
Identity = 56/206 (27.18%), Postives = 79/206 (38.35%), Query Frame = 1
Query: 1579 LSTSRCAAGLVNVNDQLIVIGGFNRGECLNSVEIYQPLINKWSPSLSMKLCRARLVALVGQSDKENPYVYAIGGSDGYKELHTVERFDVNNQRWTRVANINQERSYHGGAVM------------------------------PVG-----------ASSAGNLAIVGGCFGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASI 2073
            L+  R A     V ++L V GG++    L+S+EIY    N W     M+  R+   A V   DK   ++Y  GG DG +   +VER D  NQ+W R+ ++ Q+R   G A                                PV             S+   L  V G  G NNL S E YD   D W+   +++       V  I
Sbjct:  384 LTRKRSALAAAFVTNRLYVCGGYDGLHSLSSIEIYDINRNVWEAGPPMENMRS--AAGVTVIDK---HIYICGGHDGMQIFASVERLDTENQQWERIPSMIQQRCRFGAATFKGKIYVAGGYDGTSFLKSVEVYDPVEKKWSPVSPMNMRRSRVSLVSTNEGLFAVAGFDGENNLCSMEQYDDVTDSWTIATALTCHEGGVGVGVI 584          

HSP 4 Score: 65.0846 bits (157), Expect = 1.637e-10
Identity = 38/130 (29.23%), Postives = 64/130 (49.23%), Query Frame = 1
Query: 1531 LKKVNTKVSTLERFDCLSTSRCAAGLVNVNDQLIVIGGFNRGECLNSVEIYQPLINKWSPSLSMKLCRARLVALVGQSDKENPYVYAIGGSDGYKELHTVERFDVNNQRWTRVANINQERSYHGGAVMPV 1920
            +++++T+    ER   +   RC  G      ++ V GG++    L SVE+Y P+  KWSP   M + R+R V+LV      N  ++A+ G DG   L ++E++D     WT    +       G  V+P+
Sbjct:  462 VERLDTENQQWERIPSMIQQRCRFGAATFKGKIYVAGGYDGTSFLKSVEVYDPVEKKWSPVSPMNMRRSR-VSLVST----NEGLFAVAGFDGENNLCSMEQYDDVTDSWTIATALTCHEGGVGVGVIPM 586          
BLAST of BTB domain-containing protein vs. Ensembl Celegans
Match: kel-3 (KELch-repeat containing protein [Source:UniProtKB/TrEMBL;Acc:O18147])

HSP 1 Score: 150.984 bits (380), Expect = 7.115e-38
Identity = 98/305 (32.13%), Postives = 153/305 (50.16%), Query Frame = 1
Query: 1564 ERFDCLSTSRCAAGLVNVNDQLIV-IGGF-NRGECLNSVEIYQPLINKWSPSLSMKLCRARLVALVGQSDKENPYVYAIGGSDGYKELHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGNLAIVGGCFGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPEPSYSRRGASLVPYNGKLYLFGGSDSNSSLRTLEIFDSVANQWS-LSVQQMKQSRANLCGGVLLNK-LMAIGGFTGKHFLDTMECVDFDESCEISSEWSM 2466
            +R   + + +C   L  +   LIV IGG  ++ +  +SVEIY P   KWSP   M   R R+   V Q       VYAIGG +G   L  VE+FD +  +WT ++ + ++RS    A +         L + GG  G ++L S EIYD   + W     M   RS A V  ID  +++ GG D  +  +S E +D    +W  +P     R       + GK+Y+ GG D  S L+++E++D V  +WS +S   M++SR +L   V  N+ L A+ GF G++ L +ME  D     +++  W++
Sbjct:  281 DRRSLIKSFKCTPRLCQIVPGLIVAIGGLMHQSQSKSSVEIYDPTSKKWSPIDGMVTLRTRVGVAVNQRQ-----VYAIGGFNGQDRLDLVEKFDYDTLKWTTLSPLTRKRSALAAAFV------TNRLYVCGGYDGLHSLSSIEIYDINRNVWEAGPPMENMRSAAGVTVIDKHIYICGGHDGMQIFASVERLDTENQQWERIPSMIQQRCRFGAATFKGKIYVAGGYDGTSFLKSVEVYDPVEKKWSPVSPMNMRRSRVSL---VSTNEGLFAVAGFDGENNLCSMEQYD-----DVTDSWTI 566          

HSP 2 Score: 69.3218 bits (168), Expect = 9.293e-12
Identity = 65/276 (23.55%), Postives = 132/276 (47.83%), Query Frame = 1
Query:   40 KLSLIDDRSRHSELLNRLNKLRISKAFCDVTVFAENKEFVAHKVILASSSDYFLSKFTED-PKCDRLSIN---MNKDIFNLLLDYFYTSNLIVSKEKVPQLFSAAKYLKVRRVVKVCAQFLTKILSLDNIIDVRESVALNDSED-LCQAANAFIKENMDKIISNVKIQKLNMDIMVDTVPKK----ENDSRLAELVIDWLEYSIV--EDNMKLSDFVNENLVFFLTPS--NSLVQCSEMASSNKFSSTFIN---DYFNGFLSYQKNISKRVKCRPR 819
            K+ ++D+  + S  +   N+LR     CDV +  EN++  AHKVILA++  YF   FT D  + +   IN   MN +  + LL + YT  L ++   V  +   A + ++  VV+ C  FL   L   N + +RE   +   E+ + +  + +I+++   +  +   ++L+++  ++ +       +++ ++    ++WL   ++  E   K+   V   L   L+P+  +S+V  + +   +      I+   DY    L  ++++ K  KC PR
Sbjct:   26 KVDILDEMYKKSYSI--FNELRSKCQLCDVALLVENRKLSAHKVILAATIPYFRGMFTLDLMEANMKEINIEDMNYETVDALLSFAYTGELRITTSNVQSIMLGANFFQMLEVVQHCGNFLLTRLHPSNALSIREFCKMMCVEEKITEMTDDYIQKHFMAVSKDEDFKRLSLEDAIELLRNDHLYVDSEEQVYVAAMEWLNCDVIRHEQAAKILPCVRLPL---LSPTYLSSIVASNPIIKKDIPCRDLIDEAKDYH--LLPDRRSLIKSFKCTPR 294          

HSP 3 Score: 66.2402 bits (160), Expect = 7.148e-11
Identity = 56/206 (27.18%), Postives = 79/206 (38.35%), Query Frame = 1
Query: 1579 LSTSRCAAGLVNVNDQLIVIGGFNRGECLNSVEIYQPLINKWSPSLSMKLCRARLVALVGQSDKENPYVYAIGGSDGYKELHTVERFDVNNQRWTRVANINQERSYHGGAVM------------------------------PVG-----------ASSAGNLAIVGGCFGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASI 2073
            L+  R A     V ++L V GG++    L+S+EIY    N W     M+  R+   A V   DK   ++Y  GG DG +   +VER D  NQ+W R+ ++ Q+R   G A                                PV             S+   L  V G  G NNL S E YD   D W+   +++       V  I
Sbjct:  382 LTRKRSALAAAFVTNRLYVCGGYDGLHSLSSIEIYDINRNVWEAGPPMENMRS--AAGVTVIDK---HIYICGGHDGMQIFASVERLDTENQQWERIPSMIQQRCRFGAATFKGKIYVAGGYDGTSFLKSVEVYDPVEKKWSPVSPMNMRRSRVSLVSTNEGLFAVAGFDGENNLCSMEQYDDVTDSWTIATALTCHEGGVGVGVI 582          

HSP 4 Score: 65.0846 bits (157), Expect = 1.810e-10
Identity = 38/130 (29.23%), Postives = 64/130 (49.23%), Query Frame = 1
Query: 1531 LKKVNTKVSTLERFDCLSTSRCAAGLVNVNDQLIVIGGFNRGECLNSVEIYQPLINKWSPSLSMKLCRARLVALVGQSDKENPYVYAIGGSDGYKELHTVERFDVNNQRWTRVANINQERSYHGGAVMPV 1920
            +++++T+    ER   +   RC  G      ++ V GG++    L SVE+Y P+  KWSP   M + R+R V+LV      N  ++A+ G DG   L ++E++D     WT    +       G  V+P+
Sbjct:  460 VERLDTENQQWERIPSMIQQRCRFGAATFKGKIYVAGGYDGTSFLKSVEVYDPVEKKWSPVSPMNMRRSR-VSLVST----NEGLFAVAGFDGENNLCSMEQYDDVTDSWTIATALTCHEGGVGVGVIPM 584          
BLAST of BTB domain-containing protein vs. Ensembl Fly
Match: dbo (gene:FBgn0040230 transcript:FBtr0332133)

HSP 1 Score: 139.813 bits (351), Expect = 5.382e-34
Identity = 91/267 (34.08%), Postives = 135/267 (50.56%), Query Frame = 1
Query: 1552 VSTLERFDC----------LSTSRCAAGLVNVNDQLIVIGGFNRGECLNSVEIYQPLINKWS----PSLSMKLCRARL-VALVGQSDKENPYVYAIGGSDGYKELHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGNLAIVGGCFGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPEPSYSRRGASLVPYNGKLYLFGGSDSNSSLRTLEIFDSVANQWSL 2307
            ++++ERFD           +S  RC  G+  +ND L  +GG +    LNS+E Y P  N+WS    P+ S   CR  + VA++      + ++YA+GG DG + L+ VER+D    +W++VA +   R   G AV  +G    G L  +GG  G   L + E YD   +KW  +  MST R     A  +N ++ VGG D    LSS E  +     W  +   +  R G  L   NG+LY  GG D ++ L+T+E++D   NQW L
Sbjct:  336 IASVERFDPQTNDWKMVAPMSKRRCGVGVAVLNDLLYAVGGHDGQSYLNSIERYDPQTNQWSCDVAPTTS---CRTSVGVAVL------DGFLYAVGGQDGVQCLNHVERYDPKENKWSKVAPMTTRRL--GVAVAVLG----GFLYAIGGSDGQCPLNTVERYDPRHNKWVAVSPMSTRRKHLGCAVFNNYIYAVGGRDDCMELSSAERYNPLTNTWSPIVAMTSRRSGVGLAVVNGQLYAVGGFDGSAYLKTIEVYDPETNQWRL 587          

HSP 2 Score: 126.331 bits (316), Expect = 1.487e-29
Identity = 85/270 (31.48%), Postives = 128/270 (47.41%), Query Frame = 1
Query: 1627 LIVIGGFNRGECLNSVEIYQPLINKWS--PSLSMKLCRARLVALVGQSDKENPYVYAIGGSDGYKELHTVERFDVNNQRWT-RVANINQERSYHGGAVMPVGASSAGNLAIVGGCFGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPEPSYSRRGASLVPYNGKLYLFGGSDSNSSLRTLEIFDSVANQWSLSVQQMKQSRANLCGGVLLNKLMAIGGFTGKHFLDTMECVD 2427
            L  +GG+  G+ + SVE + P  N W     +S + C   +  L       N  +YA+GG DG   L+++ER+D    +W+  VA     R+  G AV+       G L  VGG  G   L   E YD   +KWS +  M+T R   AVA +   L+ +GG+D    L++ E  D R  KW  +   S  R+      +N  +Y  GG D    L + E ++ + N WS  +  M   R+ +   V+  +L A+GGF G  +L T+E  D
Sbjct:  324 LFAVGGWCSGDAIASVERFDPQTNDWKMVAPMSKRRCGVGVAVL-------NDLLYAVGGHDGQSYLNSIERYDPQTNQWSCDVAPTTSCRTSVGVAVL------DGFLYAVGGQDGVQCLNHVERYDPKENKWSKVAPMTTRRLGVAVAVLGGFLYAIGGSDGQCPLNTVERYDPRHNKWVAVSPMSTRRKHLGCAVFNNYIYAVGGRDDCMELSSAERYNPLTNTWS-PIVAMTSRRSGVGLAVVNGQLYAVGGFDGSAYLKTIEVYD 579          

HSP 3 Score: 107.457 bits (267), Expect = 1.206e-23
Identity = 74/233 (31.76%), Postives = 112/233 (48.07%), Query Frame = 1
Query: 1783 VYAIGGSDGYKELHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGNLAIVGGCFGPNNLRSCEIYDTTLDKWS-DLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPEPSYSRRGASLVPYNGKLYLFGGSDSNSSLRTLEIFDSVANQWSLSVQQMKQSRANLCGGVLLNKLMAIGGFTGKHFLDTMECVDFDESCEISSEWSMYVPI 2478
            ++A+GG      + +VERFD     W  VA +++ R   G AV+         L  VGG  G + L S E YD   ++WS D+   ++ R+   VA +D  L+ VGG D  +CL+  E  D +E KW  +   +  R G ++    G LY  GGSD    L T+E +D   N+W ++V  M   R +L   V  N + A+GG       D ME    +    +++ WS  V +
Sbjct:  324 LFAVGGWCSGDAIASVERFDPQTNDWKMVAPMSKRRCGVGVAVL------NDLLYAVGGHDGQSYLNSIERYDPQTNQWSCDVAPTTSCRTSVGVAVLDGFLYAVGGQDGVQCLNHVERYDPKENKWSKVAPMTTRRLGVAVAVLGGFLYAIGGSDGQCPLNTVERYDPRHNKW-VAVSPMSTRRKHLGCAVFNNYIYAVGGRD-----DCMELSSAERYNPLTNTWSPIVAM 544          

HSP 4 Score: 107.457 bits (267), Expect = 1.388e-23
Identity = 80/263 (30.42%), Postives = 125/263 (47.53%), Query Frame = 1
Query: 1468 KHEGPFTDSKSDDQSTVLQQLLKKVN-----TKVSTLERFD-------C----LSTSRCAAGLVNVNDQLIVIGGFNRGECLNSVEIYQPLINKWSPSLSMKLCRARL-VALVGQSDKENPYVYAIGGSDGYKELHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGNLAIVGGCFGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPEPSYSRRGASL 2205
            K   P +  +      VL  LL  V      + ++++ER+D       C     ++ R + G+  ++  L  +GG +  +CLN VE Y P  NKWS    M   R  + VA++G       ++YAIGGSDG   L+TVER+D  + +W  V+ ++  R + G AV          +  VGG      L S E Y+   + WS + +M++ RS   +A ++ QL+ VGG D    L + EV D    +WR     +Y R G  +
Sbjct:  350 KMVAPMSKRRCGVGVAVLNDLLYAVGGHDGQSYLNSIERYDPQTNQWSCDVAPTTSCRTSVGVAVLDGFLYAVGGQDGVQCLNHVERYDPKENKWSKVAPMTTRRLGVAVAVLGG------FLYAIGGSDGQCPLNTVERYDPRHNKWVAVSPMSTRRKHLGCAVF------NNYIYAVGGRDDCMELSSAERYNPLTNTWSPIVAMTSRRSGVGLAVVNGQLYAVGGFDGSAYLKTIEVYDPETNQWRLCGCMNYRRLGGGV 600          

HSP 5 Score: 97.4413 bits (241), Expect = 1.896e-20
Identity = 60/229 (26.20%), Postives = 118/229 (51.53%), Query Frame = 1
Query:   28 PKSNKLSLIDDRSRHSEL-LNRLNKLRISKAFCDVTVFAENKEFVAHKVILASSSDYFLSKFT---EDPKCDRLSI-NMNKDIFNLLLDYFYTSNLIVSKEKVPQLFSAAKYLKVRRVVKVCAQFLTKILSLDNIIDVRESVALNDSEDLCQAANAFIKENMDKIISNVKIQKLNMDIMVDTVPKKENDSRLAE----LVIDWLEYSIVEDNMKLSDFVNENLVFFLTP 687
            P   +LS   ++  H ++ L  LN LR  +  CDV +    ++  AH+VIL++ S YF + FT   E+ +   ++I +++++   LL+D+ YT+++IV +  V  L  AA  L++  +  +C +FL + L   N + +R     +   +L + A+ F + N  +++ + +   L +  +VD +   E + R  E     V+ WL+Y++ E    L+  +    +  L+P
Sbjct:   42 PSPARLSHTSEK--HPKVTLTELNMLRRHRELCDVVLNVGGRKIFAHRVILSACSSYFCAMFTGELEESRQTEVTIRDIDENAMELLIDFCYTAHIIVEESNVQTLLPAACLLQLVEIQDICCEFLKRQLDPTNCLGIRAFADTHSCRELLRIADKFTQHNFQEVMESEEFLLLPVGQLVDIICSDELNVRSEEQVFNAVMSWLKYNVAERRQHLAQVLQHVRLPLLSP 268          

HSP 6 Score: 59.3066 bits (142), Expect = 1.544e-8
Identity = 49/163 (30.06%), Postives = 73/163 (44.79%), Query Frame = 1
Query: 1480 PFTDSKSDDQSTVLQQLLKKVN-----TKVSTLERFDC----------LSTSRCAAGLVNVNDQLIVIGGFNRGEC--LNSVEIYQPLINKWSPSLSMKLCRARL-VALVGQSDKENPYVYAIGGSDGYKELHTVERFDVNNQRWTRVANINQERSYHGGAVM 1914
            P T  +      VL   L  +        ++T+ER+D           +ST R   G    N+ +  +GG  R +C  L+S E Y PL N WSP ++M   R+ + +A+V      N  +YA+GG DG   L T+E +D    +W     +N  R   G  VM
Sbjct:  449 PMTTRRLGVAVAVLGGFLYAIGGSDGQCPLNTVERYDPRHNKWVAVSPMSTRRKHLGCAVFNNYIYAVGG--RDDCMELSSAERYNPLTNTWSPIVAMTSRRSGVGLAVV------NGQLYAVGGFDGSAYLKTIEVYDPETNQWRLCGCMNYRRLGGGVGVM 603          
BLAST of BTB domain-containing protein vs. Ensembl Fly
Match: dbo (gene:FBgn0040230 transcript:FBtr0075505)

HSP 1 Score: 139.813 bits (351), Expect = 6.263e-34
Identity = 91/267 (34.08%), Postives = 135/267 (50.56%), Query Frame = 1
Query: 1552 VSTLERFDC----------LSTSRCAAGLVNVNDQLIVIGGFNRGECLNSVEIYQPLINKWS----PSLSMKLCRARL-VALVGQSDKENPYVYAIGGSDGYKELHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGNLAIVGGCFGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPEPSYSRRGASLVPYNGKLYLFGGSDSNSSLRTLEIFDSVANQWSL 2307
            ++++ERFD           +S  RC  G+  +ND L  +GG +    LNS+E Y P  N+WS    P+ S   CR  + VA++      + ++YA+GG DG + L+ VER+D    +W++VA +   R   G AV  +G    G L  +GG  G   L + E YD   +KW  +  MST R     A  +N ++ VGG D    LSS E  +     W  +   +  R G  L   NG+LY  GG D ++ L+T+E++D   NQW L
Sbjct:  336 IASVERFDPQTNDWKMVAPMSKRRCGVGVAVLNDLLYAVGGHDGQSYLNSIERYDPQTNQWSCDVAPTTS---CRTSVGVAVL------DGFLYAVGGQDGVQCLNHVERYDPKENKWSKVAPMTTRRL--GVAVAVLG----GFLYAIGGSDGQCPLNTVERYDPRHNKWVAVSPMSTRRKHLGCAVFNNYIYAVGGRDDCMELSSAERYNPLTNTWSPIVAMTSRRSGVGLAVVNGQLYAVGGFDGSAYLKTIEVYDPETNQWRL 587          

HSP 2 Score: 126.331 bits (316), Expect = 1.531e-29
Identity = 85/270 (31.48%), Postives = 128/270 (47.41%), Query Frame = 1
Query: 1627 LIVIGGFNRGECLNSVEIYQPLINKWS--PSLSMKLCRARLVALVGQSDKENPYVYAIGGSDGYKELHTVERFDVNNQRWT-RVANINQERSYHGGAVMPVGASSAGNLAIVGGCFGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPEPSYSRRGASLVPYNGKLYLFGGSDSNSSLRTLEIFDSVANQWSLSVQQMKQSRANLCGGVLLNKLMAIGGFTGKHFLDTMECVD 2427
            L  +GG+  G+ + SVE + P  N W     +S + C   +  L       N  +YA+GG DG   L+++ER+D    +W+  VA     R+  G AV+       G L  VGG  G   L   E YD   +KWS +  M+T R   AVA +   L+ +GG+D    L++ E  D R  KW  +   S  R+      +N  +Y  GG D    L + E ++ + N WS  +  M   R+ +   V+  +L A+GGF G  +L T+E  D
Sbjct:  324 LFAVGGWCSGDAIASVERFDPQTNDWKMVAPMSKRRCGVGVAVL-------NDLLYAVGGHDGQSYLNSIERYDPQTNQWSCDVAPTTSCRTSVGVAVL------DGFLYAVGGQDGVQCLNHVERYDPKENKWSKVAPMTTRRLGVAVAVLGGFLYAIGGSDGQCPLNTVERYDPRHNKWVAVSPMSTRRKHLGCAVFNNYIYAVGGRDDCMELSSAERYNPLTNTWS-PIVAMTSRRSGVGLAVVNGQLYAVGGFDGSAYLKTIEVYD 579          

HSP 3 Score: 107.457 bits (267), Expect = 1.254e-23
Identity = 74/233 (31.76%), Postives = 112/233 (48.07%), Query Frame = 1
Query: 1783 VYAIGGSDGYKELHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGNLAIVGGCFGPNNLRSCEIYDTTLDKWS-DLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPEPSYSRRGASLVPYNGKLYLFGGSDSNSSLRTLEIFDSVANQWSLSVQQMKQSRANLCGGVLLNKLMAIGGFTGKHFLDTMECVDFDESCEISSEWSMYVPI 2478
            ++A+GG      + +VERFD     W  VA +++ R   G AV+         L  VGG  G + L S E YD   ++WS D+   ++ R+   VA +D  L+ VGG D  +CL+  E  D +E KW  +   +  R G ++    G LY  GGSD    L T+E +D   N+W ++V  M   R +L   V  N + A+GG       D ME    +    +++ WS  V +
Sbjct:  324 LFAVGGWCSGDAIASVERFDPQTNDWKMVAPMSKRRCGVGVAVL------NDLLYAVGGHDGQSYLNSIERYDPQTNQWSCDVAPTTSCRTSVGVAVLDGFLYAVGGQDGVQCLNHVERYDPKENKWSKVAPMTTRRLGVAVAVLGGFLYAIGGSDGQCPLNTVERYDPRHNKW-VAVSPMSTRRKHLGCAVFNNYIYAVGGRD-----DCMELSSAERYNPLTNTWSPIVAM 544          

HSP 4 Score: 107.457 bits (267), Expect = 1.369e-23
Identity = 80/263 (30.42%), Postives = 125/263 (47.53%), Query Frame = 1
Query: 1468 KHEGPFTDSKSDDQSTVLQQLLKKVN-----TKVSTLERFD-------C----LSTSRCAAGLVNVNDQLIVIGGFNRGECLNSVEIYQPLINKWSPSLSMKLCRARL-VALVGQSDKENPYVYAIGGSDGYKELHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGNLAIVGGCFGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPEPSYSRRGASL 2205
            K   P +  +      VL  LL  V      + ++++ER+D       C     ++ R + G+  ++  L  +GG +  +CLN VE Y P  NKWS    M   R  + VA++G       ++YAIGGSDG   L+TVER+D  + +W  V+ ++  R + G AV          +  VGG      L S E Y+   + WS + +M++ RS   +A ++ QL+ VGG D    L + EV D    +WR     +Y R G  +
Sbjct:  350 KMVAPMSKRRCGVGVAVLNDLLYAVGGHDGQSYLNSIERYDPQTNQWSCDVAPTTSCRTSVGVAVLDGFLYAVGGQDGVQCLNHVERYDPKENKWSKVAPMTTRRLGVAVAVLGG------FLYAIGGSDGQCPLNTVERYDPRHNKWVAVSPMSTRRKHLGCAVF------NNYIYAVGGRDDCMELSSAERYNPLTNTWSPIVAMTSRRSGVGLAVVNGQLYAVGGFDGSAYLKTIEVYDPETNQWRLCGCMNYRRLGGGV 600          

HSP 5 Score: 97.8265 bits (242), Expect = 1.650e-20
Identity = 60/229 (26.20%), Postives = 118/229 (51.53%), Query Frame = 1
Query:   28 PKSNKLSLIDDRSRHSEL-LNRLNKLRISKAFCDVTVFAENKEFVAHKVILASSSDYFLSKFT---EDPKCDRLSI-NMNKDIFNLLLDYFYTSNLIVSKEKVPQLFSAAKYLKVRRVVKVCAQFLTKILSLDNIIDVRESVALNDSEDLCQAANAFIKENMDKIISNVKIQKLNMDIMVDTVPKKENDSRLAE----LVIDWLEYSIVEDNMKLSDFVNENLVFFLTP 687
            P   +LS   ++  H ++ L  LN LR  +  CDV +    ++  AH+VIL++ S YF + FT   E+ +   ++I +++++   LL+D+ YT+++IV +  V  L  AA  L++  +  +C +FL + L   N + +R     +   +L + A+ F + N  +++ + +   L +  +VD +   E + R  E     V+ WL+Y++ E    L+  +    +  L+P
Sbjct:   42 PSPARLSHTSEK--HPKVTLTELNMLRRHRELCDVVLNVGGRKIFAHRVILSACSSYFCAMFTGELEESRQTEVTIRDIDENAMELLIDFCYTAHIIVEESNVQTLLPAACLLQLVEIQDICCEFLKRQLDPTNCLGIRAFADTHSCRELLRIADKFTQHNFQEVMESEEFLLLPVGQLVDIICSDELNVRSEEQVFNAVMSWLKYNVAERRQHLAQVLQHVRLPLLSP 268          

HSP 6 Score: 59.3066 bits (142), Expect = 1.497e-8
Identity = 49/163 (30.06%), Postives = 73/163 (44.79%), Query Frame = 1
Query: 1480 PFTDSKSDDQSTVLQQLLKKVN-----TKVSTLERFDC----------LSTSRCAAGLVNVNDQLIVIGGFNRGEC--LNSVEIYQPLINKWSPSLSMKLCRARL-VALVGQSDKENPYVYAIGGSDGYKELHTVERFDVNNQRWTRVANINQERSYHGGAVM 1914
            P T  +      VL   L  +        ++T+ER+D           +ST R   G    N+ +  +GG  R +C  L+S E Y PL N WSP ++M   R+ + +A+V      N  +YA+GG DG   L T+E +D    +W     +N  R   G  VM
Sbjct:  449 PMTTRRLGVAVAVLGGFLYAIGGSDGQCPLNTVERYDPRHNKWVAVSPMSTRRKHLGCAVFNNYIYAVGG--RDDCMELSSAERYNPLTNTWSPIVAMTSRRSGVGLAVV------NGQLYAVGGFDGSAYLKTIEVYDPETNQWRLCGCMNYRRLGGGVGVM 603          
BLAST of BTB domain-containing protein vs. Ensembl Fly
Match: kel (gene:FBgn0001301 transcript:FBtr0081042)

HSP 1 Score: 132.88 bits (333), Expect = 1.450e-31
Identity = 82/261 (31.42%), Postives = 136/261 (52.11%), Query Frame = 1
Query: 1579 LSTSRCAAGLVNVNDQLIVIGGFNRGECLNSVEIYQPLINKWSPSLSMKLCRARL-VALVGQSDKENPYVYAIGGSDGYKELHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGNLAIVGG--CFGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPEPSYSRRGASLVPYNGKLYLFGGSDSNSSLRTLEIFDSVANQWSL--SVQQMKQSRANLC 2346
            +   RC +GL  + D++  +GGFN    + +V++Y P  ++W+   +M+  R+ L VA++      N  +YA+GG DG   L + E +D     W  +A+++  RS  G  V+       G L  VGG   F    L S E Y+   D W ++  MS+ RS A V  ++N L+ VGG D      S E  D     WR++ + SY RR A +V ++G LY+ GG D  S+L ++E++   ++ W +  ++  + +S A +C
Sbjct:  435 MPNRRCRSGLSVLGDKVYAVGGFNGSLRVRTVDVYDPATDQWANCSNMEARRSTLGVAVL------NGCIYAVGGFDGTTGLSSAEMYDPKTDIWRFIASMSTRRSSVGVGVV------HGLLYAVGGYDGFTRQCLSSVERYNPDTDTWVNVAEMSSRRSGAGVGVLNNILYAVGGHDGPMVRRSVEAYDCETNSWRSVADMSYCRRNAGVVAHDGLLYVVGGDDGTSNLASVEVYCPDSDSWRILPALMTIGRSYAGVC 683          

HSP 2 Score: 97.8265 bits (242), Expect = 2.068e-20
Identity = 72/264 (27.27%), Postives = 119/264 (45.08%), Query Frame = 1
Query: 1777 PYVYAIGGSDGYKELHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGNLAIVGGCFGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPEPSYSRRGASLVPYNGKLYLFGGSD--SNSSLRTLEIFDSVANQWSLSVQQMKQSRANLCGGVLLNKLMAIGGFTGKHFLDTMECVDFDESCEISSEWSMYVPIGWSVNGHSFIENDAGDFNLDSQNTITSG 2562
            P +  + G    K + +VE +D+  ++W + A +   R   G +V+         +  VGG  G   +R+ ++YD   D+W++  +M   RS   VA ++  ++ VGG D    LSS E+ D +   WR +   S  R    +   +G LY  GG D  +   L ++E ++   + W ++V +M   R+    GVL N L A+GG  G     ++E  D    CE +S W        SV   S+   +AG    D    +  G
Sbjct:  402 PKILLVIGGQAPKAIRSVEWYDLREEKWYQAAEMPNRRCRSGLSVL------GDKVYAVGGFNGSLRVRTVDVYDPATDQWANCSNMEARRSTLGVAVLNGCIYAVGGFDGTTGLSSAEMYDPKTDIWRFIASMSTRRSSVGVGVVHGLLYAVGGYDGFTRQCLSSVERYNPDTDTW-VNVAEMSSRRSGAGVGVLNNILYAVGGHDGPMVRRSVEAYD----CETNS-WR-------SVADMSYCRRNAGVVAHDGLLYVVGG 646          

HSP 3 Score: 92.0485 bits (227), Expect = 1.035e-18
Identity = 53/188 (28.19%), Postives = 102/188 (54.26%), Query Frame = 1
Query:   82 LNRLNKLRISKAFCDVTVFAENKEFVAHKVILASSSDYFLSKFT--EDPKCDRLSI-NMNKDIFNLLLDYFYTSNLIVSKEKVPQLFSAAKYLKVRRVVKVCAQFLTKILSLDNIIDVRESVALNDSEDLCQAANAFIKENMDKIISNVKIQKLNMDIMVDTVPKKE----NDSRLAELVIDWLEYSI 624
             + +N++R  K  CDV + A++ E  AH+++LAS S YF + FT  E+ +  R+++ +++     LL+DY YT+ + V+++ V  L +AA  L++  V   C  FL   L   N + +RE   ++   +L   A  +I+++ +++I   +   L+ + ++  +        N+ R+ E VI WL Y +
Sbjct:  144 FDAMNEMRKQKQLCDVILVADDVEIHAHRMVLASCSPYFYAMFTSFEESRQARITLQSVDARALELLIDYVYTATVEVNEDNVQVLLTAANLLQLTDVRDACCDFLQTQLDASNCLGIREFADIHACVELLNYAETYIEQHFNEVIQFDEFLNLSHEQVISLIGNDRISVPNEERVYECVIAWLRYDV 331          

HSP 4 Score: 68.9366 bits (167), Expect = 1.470e-11
Identity = 42/160 (26.25%), Postives = 74/160 (46.25%), Query Frame = 1
Query: 1915 PVGASSAGNLAIVGGCFGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPEPSYSRRGASLVPYNGKLYLFGGSDSNSSLRTLEIFDSVANQWSLSVQQMKQSRANLCGGVLLNKLMAIGGFTG 2394
            PVG      L ++GG   P  +RS E YD   +KW     M   R ++ ++ + ++++ VGG +    + + +V D    +W         R    +   NG +Y  GG D  + L + E++D   + W   +  M   R+++  GV+   L A+GG+ G
Sbjct:  398 PVGMPKI--LLVIGG-QAPKAIRSVEWYDLREEKWYQAAEMPNRRCRSGLSVLGDKVYAVGGFNGSLRVRTVDVYDPATDQWANCSNMEARRSTLGVAVLNGCIYAVGGFDGTTGLSSAEMYDPKTDIWRF-IASMSTRRSSVGVGVVHGLLYAVGGYDG 553          
BLAST of BTB domain-containing protein vs. Ensembl Fly
Match: kel (gene:FBgn0001301 transcript:FBtr0081043)

HSP 1 Score: 132.109 bits (331), Expect = 1.016e-30
Identity = 84/272 (30.88%), Postives = 142/272 (52.21%), Query Frame = 1
Query: 1579 LSTSRCAAGLVNVNDQLIVIGGFNRGECLNSVEIYQPLINKWSPSLSMKLCRARL-VALVGQSDKENPYVYAIGGSDGYKELHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGNLAIVGG--CFGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPEPSYSRRGASLVPYNGKLYLFGGSDSNSSLRTLEIFDSVANQWSL--SVQQMKQSRANLCGGVLLNKLMAI 2379
            +   RC +GL  + D++  +GGFN    + +V++Y P  ++W+   +M+  R+ L VA++      N  +YA+GG DG   L + E +D     W  +A+++  RS  G  V+       G L  VGG   F    L S E Y+   D W ++  MS+ RS A V  ++N L+ VGG D      S E  D     WR++ + SY RR A +V ++G LY+ GG D  S+L ++E++   ++ W +  ++  + +S A +C   +++K M +
Sbjct:  435 MPNRRCRSGLSVLGDKVYAVGGFNGSLRVRTVDVYDPATDQWANCSNMEARRSTLGVAVL------NGCIYAVGGFDGTTGLSSAEMYDPKTDIWRFIASMSTRRSSVGVGVV------HGLLYAVGGYDGFTRQCLSSVERYNPDTDTWVNVAEMSSRRSGAGVGVLNNILYAVGGHDGPMVRRSVEAYDCETNSWRSVADMSYCRRNAGVVAHDGLLYVVGGDDGTSNLASVEVYCPDSDSWRILPALMTIGRSYAGVC---MIDKPMXM 691          

HSP 2 Score: 96.2857 bits (238), Expect = 1.083e-19
Identity = 64/228 (28.07%), Postives = 108/228 (47.37%), Query Frame = 1
Query: 1777 PYVYAIGGSDGYKELHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGNLAIVGGCFGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPEPSYSRRGASLVPYNGKLYLFGGSD--SNSSLRTLEIFDSVANQWSLSVQQMKQSRANLCGGVLLNKLMAIGGFTGKHFLDTMECVDFDESCEISS 2454
            P +  + G    K + +VE +D+  ++W + A +   R   G +V+         +  VGG  G   +R+ ++YD   D+W++  +M   RS   VA ++  ++ VGG D    LSS E+ D +   WR +   S  R    +   +G LY  GG D  +   L ++E ++   + W ++V +M   R+    GVL N L A+GG  G     ++E  D    CE +S
Sbjct:  402 PKILLVIGGQAPKAIRSVEWYDLREEKWYQAAEMPNRRCRSGLSVL------GDKVYAVGGFNGSLRVRTVDVYDPATDQWANCSNMEARRSTLGVAVLNGCIYAVGGFDGTTGLSSAEMYDPKTDIWRFIASMSTRRSSVGVGVVHGLLYAVGGYDGFTRQCLSSVERYNPDTDTW-VNVAEMSSRRSGAGVGVLNNILYAVGGHDGPMVRRSVEAYD----CETNS 618          

HSP 3 Score: 92.4337 bits (228), Expect = 1.327e-18
Identity = 53/185 (28.65%), Postives = 101/185 (54.59%), Query Frame = 1
Query:   91 LNKLRISKAFCDVTVFAENKEFVAHKVILASSSDYFLSKFT--EDPKCDRLSI-NMNKDIFNLLLDYFYTSNLIVSKEKVPQLFSAAKYLKVRRVVKVCAQFLTKILSLDNIIDVRESVALNDSEDLCQAANAFIKENMDKIISNVKIQKLNMDIMVDTVPKKE----NDSRLAELVIDWLEYSI 624
            +N++R  K  CDV + A++ E  AH+++LAS S YF + FT  E+ +  R+++ +++     LL+DY YT+ + V+++ V  L +AA  L++  V   C  FL   L   N + +RE   ++   +L   A  +I+++ +++I   +   L+ + ++  +        N+ R+ E VI WL Y +
Sbjct:  147 MNEMRKQKQLCDVILVADDVEIHAHRMVLASCSPYFYAMFTSFEESRQARITLQSVDARALELLIDYVYTATVEVNEDNVQVLLTAANLLQLTDVRDACCDFLQTQLDASNCLGIREFADIHACVELLNYAETYIEQHFNEVIQFDEFLNLSHEQVISLIGNDRISVPNEERVYECVIAWLRYDV 331          

HSP 4 Score: 67.781 bits (164), Expect = 5.296e-11
Identity = 42/160 (26.25%), Postives = 74/160 (46.25%), Query Frame = 1
Query: 1915 PVGASSAGNLAIVGGCFGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPEPSYSRRGASLVPYNGKLYLFGGSDSNSSLRTLEIFDSVANQWSLSVQQMKQSRANLCGGVLLNKLMAIGGFTG 2394
            PVG      L ++GG   P  +RS E YD   +KW     M   R ++ ++ + ++++ VGG +    + + +V D    +W         R    +   NG +Y  GG D  + L + E++D   + W   +  M   R+++  GV+   L A+GG+ G
Sbjct:  398 PVGMPKI--LLVIGG-QAPKAIRSVEWYDLREEKWYQAAEMPNRRCRSGLSVLGDKVYAVGGFNGSLRVRTVDVYDPATDQWANCSNMEARRSTLGVAVLNGCIYAVGGFDGTTGLSSAEMYDPKTDIWRF-IASMSTRRSSVGVGVVHGLLYAVGGYDG 553          
BLAST of BTB domain-containing protein vs. Ensembl Fly
Match: CG17754 (gene:FBgn0030114 transcript:FBtr0340121)

HSP 1 Score: 124.79 bits (312), Expect = 2.297e-29
Identity = 97/335 (28.96%), Postives = 154/335 (45.97%), Query Frame = 1
Query: 1522 QQLLKKVNTKVSTLERFDCLSTSRCAAGLVNVNDQLIVIGGFNRGECLNSVEIYQPLINKWSPSLSMKLCRARLVALVGQSDKENPYVYAIGGSDGYKELHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGNLAIVGGCFGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPEPSYSRRGASLVPYNGKLYLFGGSDSNSS------LRTLEIFDSVANQWSLSVQQMKQSRANLCGGVLLNKLMAIGGFTGKHFLDTMECVDFDESCEISSEWSMYVPIGWSVNGHSFI 2508
            QQL+ +        ER   ++T R       V  +L+ +GG +  +   S+E Y P ++KW+P   M   R +  A V   DK    +  +GG DG K L+TVE  D+N   W  +  +   R   G AV+       G L  VGG  G + L + E +D     WS +  MS+ RS A VA +  +L+ VGG D   C  S E  D    KW  +   +  R G  +   NG LY  GG D  +S        T+E +D   + W+L +  +   R  +   +L ++L+ +GG+ G H L ++E  ++D    + + W+   P+ ++  G   +
Sbjct:  186 QQLVMEAFKWHLMPERRSRIATERTTPRKSTVG-RLLAVGGMDAHKGAISIESYCPRLDKWTPWKHMTGRRLQFGAAV-MEDK----LILVGGRDGLKTLNTVESLDLNTMAWAPLNAMATPRHGLGVAVL------EGPLYAVGGHDGWSYLNTVERWDPIARTWSYVAPMSSMRSTAGVAVLGGRLYAVGGRDGSVCHRSIECYDPHTNKWSLLAPMNRRRGGVGVTVANGFLYALGGHDCPASNPMVCRTETVERYDPATDTWTL-ICSLALGRDAIGCALLGDRLIVVGGYDGNHALKSVE--EYD---PVRNGWNELAPMAFARAGACVV 502          

HSP 2 Score: 77.411 bits (189), Expect = 2.802e-14
Identity = 59/208 (28.37%), Postives = 92/208 (44.23%), Query Frame = 1
Query: 1474 EGPFTDSKSDDQSTVLQQLLKKVNTKVSTLERFDCLSTSRCAAGLVNVNDQLIVIGGFNRGECLNSVEIYQPLINKWSPSLSMKLCRARLVALVGQSDKENPYVYAIGGSDGYK------ELHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGNLAIVGGCFGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDN 2079
            EGP       D  + L  + ++ +    T      +S+ R  AG+  +  +L  +GG +   C  S+E Y P  NKWS    M   R  +   V      N ++YA+GG D            TVER+D     WT + ++   R   G A++         L +VGG  G + L+S E YD   + W++L  M+ +R+ A V +I N
Sbjct:  311 EGPLYAVGGHDGWSYLNTV-ERWDPIARTWSYVAPMSSMRSTAGVAVLGGRLYAVGGRDGSVCHRSIECYDPHTNKWSLLAPMNRRRGGVGVTVA-----NGFLYALGGHDCPASNPMVCRTETVERYDPATDTWTLICSLALGRDAIGCALL------GDRLIVVGGYDGNHALKSVEEYDPVRNGWNELAPMAFARAGACVVAIPN 506          
BLAST of BTB domain-containing protein vs. Ensembl Zebrafish
Match: ivns1abpa (influenza virus NS1A binding protein a [Source:NCBI gene;Acc:387591])

HSP 1 Score: 177.563 bits (449), Expect = 4.022e-46
Identity = 102/301 (33.89%), Postives = 160/301 (53.16%), Query Frame = 1
Query: 1579 LSTSRCAAGLVNVNDQLIVIGGFNRGECLNSVEIYQPLINKWSPSLSMKLCRAR--LVALVGQSDKENPYVYAIGGSDGYK-ELHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGN-LAIVGGC--FGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPEPSYSRRGASLVPYNGKLYLFGGSDSNSSLRTLEIFDSVANQWSLSVQQMKQSRANLCGGVLLNKLMAIGGFTGKHFLDTMECVDFDESCEISSEWS 2463
            +  +R   G+ ++NDQLI  GG+NR ECL +VE Y    N W+    M+  RAR  +  L+GQ       +Y +GGS+G+  EL   E ++ N   WT+V  +   R          G  S  N L +VGG    G   L++C+++D     W++   ++  R QAAV  +D  ++V+GG +SW CL+S E  +     W  +   + +RRGA +  Y GKL++ GG D + +LR +E++D V N+W + +  M   R+N    VL + + AIGGF G  FL+++E  +       + EWS
Sbjct:  354 MHYARSGLGIASLNDQLIAAGGYNREECLRTVECYNIKTNSWTFIAPMRTPRARFQMAVLMGQ-------LYVMGGSNGHSDELSCGETYNPNADEWTQVPELRTNRCN-------AGVCSLNNKLYVVGGSDPCGQKGLKNCDVFDPISKAWTNCAPLNIRRHQAAVCELDGFMYVIGGAESWNCLNSVERYNPENNTWTLIASMNIARRGAGVAVYEGKLFVVGGFDGSHALRCVEMYDPVRNEWRM-LGSMNSPRSNAGAAVLNDVIYAIGGFDGNDFLNSVEAYN-----PKTEEWS 634          

HSP 2 Score: 103.219 bits (256), Expect = 4.283e-22
Identity = 62/198 (31.31%), Postives = 110/198 (55.56%), Query Frame = 1
Query: 1579 LSTSRCAAGLVNVNDQLIVIGGFNR--GECLNSVEIYQPLINKWSPSLSMKLCRARLVALVGQSDKENPYVYAIGGSDGYKELHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGNLAIVGGCFGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRT 2166
            L T+RC AG+ ++N++L V+GG +    + L + +++ P+   W+    + + R +  A V + D    ++Y IGG++ +  L++VER++  N  WT +A++N  R   G AV        G L +VGG  G + LR  E+YD   ++W  L SM++ RS A  A +++ ++ +GG D    L+S E  + +  +W T
Sbjct:  449 LRTNRCNAGVCSLNNKLYVVGGSDPCGQKGLKNCDVFDPISKAWTNCAPLNIRRHQ--AAVCELDG---FMYVIGGAESWNCLNSVERYNPENNTWTLIASMNIARRGAGVAVY------EGKLFVVGGFDGSHALRCVEMYDPVRNEWRMLGSMNSPRSNAGAAVLNDVIYAIGGFDGNDFLNSVEAYNPKTEEWST 635          

HSP 3 Score: 90.1225 bits (222), Expect = 5.201e-18
Identity = 57/232 (24.57%), Postives = 114/232 (49.14%), Query Frame = 1
Query:   37 NKLSLIDDRSRHSELLNRLNKLRISKAFCDVTVFAENKEFVAHKVILASSSDYFLSKFTEDPKCDRLSI----NMNKDIFNLLLDYFYTSNLIVSKEKVPQLFSAAKYLKVRRVVKVCAQFLTKILSLDNIIDVRESVALNDSEDLCQAANAFIKENMDKIISN---VKIQKLNMDIMVDTVPKKENDSRLAELVIDWLEYSIVEDNMKLSDFVNENLVFFLTPSNSLVQCS 711
            N   + +D S     + ++N LR +  FCDV +     E +AH+ +LA  S Y    F  D +   +S     +++ +   +LL+Y YT+ L   KE V +++SAAK LK+ RV ++C  +L   +   + I  R   +      L    +++I+E++ ++      +K+ +L +++M++      ++ +L   VI W++ S+ E+   L   + E    + +  + L+  S
Sbjct:    4 NGYLIFEDESFLDSTVAKMNALRKNGQFCDVRLQVCGHELMAHRAVLACCSPYLFEIFNSDLEPHGISHVKFEDLDPEAVEILLNYAYTAQLKADKELVKEVYSAAKRLKMDRVKQICGDYLLSKMDSQSAISYRNFASCMGDGRLLGKIDSYIQEHLLEVSEQEDFLKLPRLKLEVMLEDNLTLPSNGKLYSKVIGWVQRSLWENGEPLERLMEEVQTLYYSADHKLLDGS 235          

HSP 4 Score: 61.6178 bits (148), Expect = 4.013e-9
Identity = 42/152 (27.63%), Postives = 71/152 (46.71%), Query Frame = 1
Query: 2026 LKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPEPSYSRRGASLVPYNGKLYLFGGSDSNS-SLRTLEIFDSVANQWSLSVQQMKQSRANLCGGVLLNKLMAIGGFTGKHFLDTMECVDFDESCEISSEWSMYVPI 2478
            L  M  +RS   +AS+++QL   GG +  +CL + E  +++   W  +      R    +    G+LY+ GGS+ +S  L   E ++  A++W+  V +++ +R N     L NKL  +GG           C  FD    IS  W+   P+
Sbjct:  351 LSPMHYARSGLGIASLNDQLIAAGGYNREECLRTVECYNIKTNSWTFIAPMRTPRARFQMAVLMGQLYVMGGSNGHSDELSCGETYNPNADEWT-QVPELRTNRCNAGVCSLNNKLYVVGGSDPCGQKGLKNCDVFD---PISKAWTNCAPL 498          

HSP 5 Score: 58.5362 bits (140), Expect = 3.081e-8
Identity = 35/115 (30.43%), Postives = 59/115 (51.30%), Query Frame = 1
Query: 1531 LKKVNTKVSTLERFDCLSTSRCAAGLVNVNDQLIVIGGFNRGECLNSVEIYQPLINKWSPSLSMKLCRARLVALVGQSDKENPYVYAIGGSDGYKELHTVERFDVNNQRWTRVAN 1875
            +++ N + +T      ++ +R  AG+     +L V+GGF+    L  VE+Y P+ N+W    SM   R+   A V      N  +YAIGG DG   L++VE ++   + W+  A+
Sbjct:  529 VERYNPENNTWTLIASMNIARRGAGVAVYEGKLFVVGGFDGSHALRCVEMYDPVRNEWRMLGSMNSPRSNAGAAV-----LNDVIYAIGGFDGNDFLNSVEAYNPKTEEWSTCAD 638          
BLAST of BTB domain-containing protein vs. Ensembl Zebrafish
Match: ivns1abpb (influenza virus NS1A binding protein b [Source:NCBI gene;Acc:334334])

HSP 1 Score: 167.548 bits (423), Expect = 9.174e-43
Identity = 96/303 (31.68%), Postives = 156/303 (51.49%), Query Frame = 1
Query: 1579 LSTSRCAAGLVNVNDQLIVIGGFNRGECLNSVEIYQPLINKWSPSLSMKLCRAR--LVALVGQSDKENPYVYAIGGSDGYK-ELHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGNLAIVGGC--FGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPEPSYSRRGASLVPYNGKLYLFGGSDSNSSLRTLEIFDSVANQWSLSVQQMKQSRANLCGGVLLNKLMAIGGFTGKHFLDTMECVDFDESCEISSEWSMYV 2472
            +  +R   G   ++ +LI  GG+NR ECL +VE Y P  + W+    M+  RAR  +  L+G+       VY +GGS+G+  EL   E ++     W +V  +   R   G        S    L +VGG    G   L++C+ +D     W+    ++  R QAAV  +   ++V+GG +SW CL+S E  +     W  +   + +RRGA +  Y GKL++ GG D + +LR +E++D   N+W + +  M  +R+N    VL N L A+GGF G  FL++ME  + ++     +EWS ++
Sbjct:  351 MHYARSGLGTAELDCKLIAAGGYNREECLRTVECYDPKKDCWTFIAPMRTPRARFQMAVLMGE-------VYVMGGSNGHSDELSCGEMYNPRADEWIQVPELRTNRCNAGVC------SLQNKLFVVGGSDPCGQKGLKNCDSFDPVTKMWTSCAPLNIKRHQAAVCELSGYMYVIGGAESWNCLNSVERYNPENNTWTLVASMNVARRGAGVAVYEGKLFVVGGFDGSHALRCVEVYDPATNEWRM-LGSMTSARSNAGLAVLNNVLCAVGGFDGNEFLNSMEVYNLEK-----NEWSPFI 634          

HSP 2 Score: 90.8929 bits (224), Expect = 3.351e-18
Identity = 61/244 (25.00%), Postives = 114/244 (46.72%), Query Frame = 1
Query:   37 NKLSLIDDRSRHSELLNRLNKLRISKAFCDVTVFAENKEFVAHKVILASSSDYFLSKFTED--PKCDRLSI---NMNKDIFNLLLDYFYTSNLIVSKEKVPQLFSAAKYLKVRRVVKVCAQFLTKILSLDNIIDVRESVALNDSEDLCQAANAFIKENMDKIISN---VKIQKLNMDIMVDTVPKKENDSRLAELVIDWLEYSIVEDNMKLSDFVNENLVFFLTPSNSLVQCSEMASSNKFSST 744
            N   + +D S     + ++N LR S  FCDV +     E +AHK +LA  S Y    F  D  P+     +   ++N D   +LL+Y YT+ L   K  V  ++SAAK LK+ RV ++C ++L   +   + I  R   +      L    + +I++++ +I      +K+ +L +++M++       + +L   VI W++ S+ ++   L   + E    + +  + L   S +    +  ST
Sbjct:    4 NGYLIFEDESFLDSTVAKMNALRKSGQFCDVRLLVCGHELMAHKAVLACCSPYLFEIFNADTEPQGGVSLVKFDDLNPDAVEVLLNYAYTAQLKADKSLVSDVYSAAKKLKLERVKQICGEYLLSKMDSQSAISYRNFASSMADGRLLGKIDGYIQDHLHEISEQDDFLKLPRLKLEVMLEDNLNLPGNGKLYSKVISWVQRSLWKNGDPLEKLMEEVQTLYYSADHKLHDGSLLEGQAEVCST 247          

HSP 3 Score: 58.9214 bits (141), Expect = 2.316e-8
Identity = 40/152 (26.32%), Postives = 70/152 (46.05%), Query Frame = 1
Query: 2026 LKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPEPSYSRRGASLVPYNGKLYLFGGSDSNS-SLRTLEIFDSVANQWSLSVQQMKQSRANLCGGVLLNKLMAIGGFTGKHFLDTMECVDFDESCEISSEWSMYVPI 2478
            LK M  +RS    A +D +L   GG +  +CL + E  D ++  W  +      R    +    G++Y+ GGS+ +S  L   E+++  A++W + V +++ +R N     L NKL  +GG           C  FD    ++  W+   P+
Sbjct:  348 LKPMHYARSGLGTAELDCKLIAAGGYNREECLRTVECYDPKKDCWTFIAPMRTPRARFQMAVLMGEVYVMGGSNGHSDELSCGEMYNPRADEW-IQVPELRTNRCNAGVCSLQNKLFVVGGSDPCGQKGLKNCDSFD---PVTKMWTSCAPL 495          

HSP 4 Score: 50.8322 bits (120), Expect = 7.985e-6
Identity = 32/113 (28.32%), Postives = 56/113 (49.56%), Query Frame = 1
Query: 1531 LKKVNTKVSTLERFDCLSTSRCAAGLVNVNDQLIVIGGFNRGECLNSVEIYQPLINKWSPSLSMKLCR--ARLVALVGQSDKENPYVYAIGGSDGYKELHTVERFDVNNQRWT 1863
            +++ N + +T      ++ +R  AG+     +L V+GGF+    L  VE+Y P  N+W    SM   R  A L  L       N  + A+GG DG + L+++E +++    W+
Sbjct:  526 VERYNPENNTWTLVASMNVARRGAGVAVYEGKLFVVGGFDGSHALRCVEVYDPATNEWRMLGSMTSARSNAGLAVL-------NNVLCAVGGFDGNEFLNSMEVYNLEKNEWS 631          
BLAST of BTB domain-containing protein vs. Ensembl Zebrafish
Match: klhl18 (kelch-like family member 18 [Source:ZFIN;Acc:ZDB-GENE-030131-5785])

HSP 1 Score: 143.28 bits (360), Expect = 3.931e-35
Identity = 97/308 (31.49%), Postives = 159/308 (51.62%), Query Frame = 1
Query: 1582 STSRCAAGLVNVNDQLIVIGGFNR-GECLNSVEIYQPLINKWSPSLSMKLCRARL-VALVGQSDKENPYVYAIGGSDGYKELHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGNLAIVGGCFGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPEPSYSRR---GASLVPYNGKLYLFGGSDSNSSLRTLEIFDSVANQWS-LSVQQMKQSRANL---CGGVLLNKLMAIGGFTGKHFLDTMECVDFDESCEISSEWSMYVPI 2478
            +  RC   +  +   +  +GG N  G+ LN VE++ P+ N W     M   R+R+ VA+V      N  +YAIGG DG   L TVE ++ +   WT+VA++N +RS  G  V+       G++ + GG  G ++L S E Y    D+W+ +  MS SRS A V   + +++V GG D  +  ++ E  +     W  +  P  ++R   GA+ +  N  LY+ GG D ++ L   E++ SVA+QWS L     ++SR +L   CG     +L A+GG+ G+  L ++E  D     + ++ W+   P+
Sbjct:  280 TRQRCCTSIAGL---IYAVGGLNSAGDSLNVVEVFDPIGNCWERCQPMSTARSRVGVAVV------NGLLYAIGGYDGQSRLRTVEVYNPDTDTWTKVASMNTQRSAMGTVVVD------GHIYVCGGYDGKSSLNSVECYAPETDRWTIVTEMSASRSAAGVTVFEGRIYVSGGHDGLQIFNTMEYYNQHTASWHPVA-PMINKRCRHGAAALGSN--LYVAGGYDGSAFLSGAEVYSSVADQWSHLVAMNTRRSRISLVANCG-----RLYAVGGYDGQSNLSSLEMYD-----QETNRWTFMAPM 559          

HSP 2 Score: 118.627 bits (296), Expect = 4.453e-27
Identity = 75/248 (30.24%), Postives = 115/248 (46.37%), Query Frame = 1
Query: 1564 ERFDCLSTSRCAAGLVNVNDQLIVIGGFNRGECLNSVEIYQPLINKWSPSLSMKLCRARLVALVGQSDKENPYVYAIGGSDGYKELHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGNLAIVGGCFGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPEPSYSRRGASLVPYNGKLYLFGGSDSNSSLRTLEIFDSVANQWSL 2307
            ER   +ST+R   G+  VN  L  IGG++    L +VE+Y P  + W+   SM   R+ +  +V      + ++Y  GG DG   L++VE +     RWT V  ++  RS  G  V        G + + GG  G     + E Y+     W  +  M   R +   A++ + L+V GG D    LS  EV      +W  +   +  R   SLV   G+LY  GG D  S+L +LE++D   N+W+ 
Sbjct:  319 ERCQPMSTARSRVGVAVVNGLLYAIGGYDGQSRLRTVEVYNPDTDTWTKVASMNTQRSAMGTVV-----VDGHIYVCGGYDGKSSLNSVECYAPETDRWTIVTEMSASRSAAGVTVF------EGRIYVSGGHDGLQIFNTMEYYNQHTASWHPVAPMINKRCRHGAAALGSNLYVAGGYDGSAFLSGAEVYSSVADQWSHLVAMNTRRSRISLVANCGRLYAVGGYDGQSNLSSLEMYDQETNRWTF 555          

HSP 3 Score: 105.145 bits (261), Expect = 8.725e-23
Identity = 64/209 (30.62%), Postives = 100/209 (47.85%), Query Frame = 1
Query: 1543 NTKVSTLERFDCLSTSRCAAGLVNVNDQLIVIGGFNRGECLNSVEIYQPLINKWSPSLSMKLCRARLVALVGQSDKENPYVYAIGGSDGYKELHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGNLAIVGGCFGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTM 2169
            N    T  +   ++T R A G V V+  + V GG++    LNSVE Y P  ++W+    M   R+     V +       +Y  GG DG +  +T+E ++ +   W  VA +  +R  HG A +        NL + GG  G   L   E+Y +  D+WS L +M+T RS+ ++ +   +L+ VGG D    LSS E+ D    +W  M
Sbjct:  359 NPDTDTWTKVASMNTQRSAMGTVVVDGHIYVCGGYDGKSSLNSVECYAPETDRWTIVTEMSASRSAAGVTVFEGR-----IYVSGGHDGLQIFNTMEYYNQHTASWHPVAPMINKRCRHGAAAL------GSNLYVAGGYDGSAFLSGAEVYSSVADQWSHLVAMNTRRSRISLVANCGRLYAVGGYDGQSNLSSLEMYDQETNRWTFM 556          

HSP 4 Score: 71.2478 bits (173), Expect = 3.891e-12
Identity = 45/199 (22.61%), Postives = 97/199 (48.74%), Query Frame = 1
Query:   91 LNKLRISKAFCDVTVFAENKEFVAHKVILASSSDYFLSKFTED-PKCDRLSI---NMNKDIFNLLLDYFYTSNLIVSKEKVPQLFSAAKYLKVRRVVKVCAQFLTKILSLDNIIDVRESVALNDSEDLCQAANAFIKENMDKIISNVKIQKLNMDIMVDTVPKKE----NDSRLAELVIDWLEYSIVEDNMKLSDFVNE 663
            + ++R     CDVT+     +F AH+++LA+S  YF + FT D  +C +  I    M+      L+++ Y  ++ + ++ V  L   A +L+++ V   C  FL + L   N + VR+         L  AAN+F+ ++  ++  + +   L  + +++ V   E     + ++ E V+ W+ +   +   +L + +++
Sbjct:   30 MEEIRRQGKLCDVTLKVGEHKFSAHRIVLAASIPYFHAMFTNDMVECKQDEIVMQGMDPSALEALINFAYNGHIAIDQQNVQALLIGASFLQLQNVKDACCSFLQQRLHPKNCLGVRQFAETMMCTTLYDAANSFVHQHFVEVSVSEEFLALRPEEVLELVGCDELNVQAEEQVFEAVLAWVRHERDDRESRLPELLSK 228          
BLAST of BTB domain-containing protein vs. Ensembl Zebrafish
Match: ivns1abpb (influenza virus NS1A binding protein b [Source:NCBI gene;Acc:334334])

HSP 1 Score: 142.51 bits (358), Expect = 9.331e-35
Identity = 83/268 (30.97%), Postives = 135/268 (50.37%), Query Frame = 1
Query: 1579 LSTSRCAAGLVNVNDQLIVIGGFNRGECLNSVEIYQPLINKWSPSLSMKLCRAR--LVALVGQSDKENPYVYAIGGSDGYK-ELHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGNLAIVGGC--FGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPEPSYSRRGASLVPYNGKLYLFGGSDSNSSLRTLEIFDSVANQWSLSVQQMKQSRANLCGGVLLNK 2367
            +  +R   G   ++ +LI  GG+NR ECL +VE Y P  + W+    M+  RAR  +  L+G+       VY +GGS+G+  EL   E ++     W +V  +   R   G        S    L +VGG    G   L++C+ +D     W+    ++  R QAAV  +   ++V+GG +SW CL+S E  +     W  +   + +RRGA +  Y GKL++ GG D + +LR +E++D   N+W + +  M  +R+N   G+L  K
Sbjct:  351 MHYARSGLGTAELDCKLIAAGGYNREECLRTVECYDPKKDCWTFIAPMRTPRARFQMAVLMGE-------VYVMGGSNGHSDELSCGEMYNPRADEWIQVPELRTNRCNAGVC------SLQNKLFVVGGSDPCGQKGLKNCDSFDPVTKMWTSCAPLNIKRHQAAVCELSGYMYVIGGAESWNCLNSVERYNPENNTWTLVASMNVARRGAGVAVYEGKLFVVGGFDGSHALRCVEVYDPATNEWRM-LGSMTSARSN--AGLLYAK 602          

HSP 2 Score: 105.916 bits (263), Expect = 5.240e-23
Identity = 71/229 (31.00%), Postives = 114/229 (49.78%), Query Frame = 1
Query: 1789 AIGGSDGYKELHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGNLAIVGGCFGPNNLRSC-EIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTD--SWKCLSSCEVMDLREGKWRTMPEPSYSRRGASLVPYNGKLYLFGGSDSNSSLRTLEIFDSVANQWSLSVQQMKQSRANLCGGVLLNKLMAIGGFTGKHFLDTMECVDFDESCEISSEWSM 2466
            A GG +  + L TVE +D     WT +A +   R+    AV+       G + ++GG  G ++  SC E+Y+   D+W  +  + T+R  A V S+ N+LFVVGG+D    K L +C+  D     W +    +  R  A++   +G +Y+ GG++S + L ++E ++   N W+L V  M  +R      V   KL  +GGF G H L  +E  D       ++EW M
Sbjct:  369 AAGGYNREECLRTVECYDPKKDCWTFIAPMRTPRARFQMAVL------MGEVYVMGGSNGHSDELSCGEMYNPRADEWIQVPELRTNRCNAGVCSLQNKLFVVGGSDPCGQKGLKNCDSFDPVTKMWTSCAPLNIKRHQAAVCELSGYMYVIGGAESWNCLNSVERYNPENNTWTL-VASMNVARRGAGVAVYEGKLFVVGGFDGSHALRCVEVYD-----PATNEWRM 585          

HSP 3 Score: 90.5077 bits (223), Expect = 3.546e-18
Identity = 61/244 (25.00%), Postives = 114/244 (46.72%), Query Frame = 1
Query:   37 NKLSLIDDRSRHSELLNRLNKLRISKAFCDVTVFAENKEFVAHKVILASSSDYFLSKFTED--PKCDRLSI---NMNKDIFNLLLDYFYTSNLIVSKEKVPQLFSAAKYLKVRRVVKVCAQFLTKILSLDNIIDVRESVALNDSEDLCQAANAFIKENMDKIISN---VKIQKLNMDIMVDTVPKKENDSRLAELVIDWLEYSIVEDNMKLSDFVNENLVFFLTPSNSLVQCSEMASSNKFSST 744
            N   + +D S     + ++N LR S  FCDV +     E +AHK +LA  S Y    F  D  P+     +   ++N D   +LL+Y YT+ L   K  V  ++SAAK LK+ RV ++C ++L   +   + I  R   +      L    + +I++++ +I      +K+ +L +++M++       + +L   VI W++ S+ ++   L   + E    + +  + L   S +    +  ST
Sbjct:    4 NGYLIFEDESFLDSTVAKMNALRKSGQFCDVRLLVCGHELMAHKAVLACCSPYLFEIFNADTEPQGGVSLVKFDDLNPDAVEVLLNYAYTAQLKADKSLVSDVYSAAKKLKLERVKQICGEYLLSKMDSQSAISYRNFASSMADGRLLGKIDGYIQDHLHEISEQDDFLKLPRLKLEVMLEDNLNLPGNGKLYSKVISWVQRSLWKNGDPLEKLMEEVQTLYYSADHKLHDGSLLEGQAEVCST 247          

HSP 4 Score: 59.3066 bits (142), Expect = 2.127e-8
Identity = 40/152 (26.32%), Postives = 70/152 (46.05%), Query Frame = 1
Query: 2026 LKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPEPSYSRRGASLVPYNGKLYLFGGSDSNS-SLRTLEIFDSVANQWSLSVQQMKQSRANLCGGVLLNKLMAIGGFTGKHFLDTMECVDFDESCEISSEWSMYVPI 2478
            LK M  +RS    A +D +L   GG +  +CL + E  D ++  W  +      R    +    G++Y+ GGS+ +S  L   E+++  A++W + V +++ +R N     L NKL  +GG           C  FD    ++  W+   P+
Sbjct:  348 LKPMHYARSGLGTAELDCKLIAAGGYNREECLRTVECYDPKKDCWTFIAPMRTPRARFQMAVLMGEVYVMGGSNGHSDELSCGEMYNPRADEW-IQVPELRTNRCNAGVCSLQNKLFVVGGSDPCGQKGLKNCDSFD---PVTKMWTSCAPL 495          
BLAST of BTB domain-containing protein vs. Ensembl Zebrafish
Match: klhl20 (kelch-like family member 20 [Source:ZFIN;Acc:ZDB-GENE-040426-1935])

HSP 1 Score: 142.124 bits (357), Expect = 1.101e-34
Identity = 90/264 (34.09%), Postives = 134/264 (50.76%), Query Frame = 1
Query: 1552 VSTLERFD----------CLSTSRCAAGLVNVNDQLIVIGGFNRGECLNSVEIYQPLINKWSPSLS-MKLCRARL-VALVGQSDKENPYVYAIGGSDGYKELHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGNLAIVGGCFGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPEPSYSRRGASLVPYNGKLYLFGGSDSNSSLRTLEIFDSVANQWSL 2307
            +S++ER+D           +S  RC  G+  ++D L  +GG +    LNSVE Y P  N+WS  ++    CR  + VA++G       Y+YA+GG DG   L+ VER+D    +WTRVA+++  R   G AV  +G    G L  VGG  G + L + E Y+   ++W  +  M T R     A   + ++ VGG D    LSS E  + R  +W  +   +  R G  L   NG+L   GG D  + L+T+E++D  AN W L
Sbjct:  314 ISSVERYDPQTNEWRMVASMSKRRCGVGVSVLDDLLYAVGGHDGSSYLNSVERYDPKTNQWSSDVAPTSTCRTSVGVAVLGG------YLYAVGGQDGVSCLNIVERYDPKENKWTRVASMSTRRL--GVAVAVLG----GFLYAVGGSDGTSPLNTVERYNPQENRWHTVAPMGTRRKHLGCAVYQDMIYSVGGRDDTTELSSAERYNPRTNQWSPVVAMTSRRSGVGLAVVNGQLMAVGGFDGTTYLKTIEVYDPDANTWRL 565          

HSP 2 Score: 140.584 bits (353), Expect = 3.773e-34
Identity = 93/290 (32.07%), Postives = 144/290 (49.66%), Query Frame = 1
Query: 1609 VNVNDQLIVIGGFNRGECLNSVEIYQPLINKWS--PSLSMKLCRARLVALVGQSDKENPYVYAIGGSDGYKELHTVERFDVNNQRWTR-VANINQERSYHGGAVMPVGASSAGNLAIVGGCFGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPEPSYSRRGASLVPYNGKLYLFGGSDSNSSLRTLEIFDSVANQWSLSVQQMKQSRANLCGGVLLNKLMAIGGFTGKHFLDTMECVDFDESCEISSEWSMY 2469
            +   + L  +GG+  G+ ++SVE Y P  N+W    S+S + C   +  L       +  +YA+GG DG   L++VER+D    +W+  VA  +  R+  G AV+       G L  VGG  G + L   E YD   +KW+ + SMST R   AVA +   L+ VGG+D    L++ E  + +E +W T+      R+      Y   +Y  GG D  + L + E ++   NQWS  V  M   R+ +   V+  +LMA+GGF G  +L T+E  D D     ++ W +Y
Sbjct:  296 IRCGEVLFAVGGWCSGDAISSVERYDPQTNEWRMVASMSKRRCGVGVSVL-------DDLLYAVGGHDGSSYLNSVERYDPKTNQWSSDVAPTSTCRTSVGVAVL------GGYLYAVGGQDGVSCLNIVERYDPKENKWTRVASMSTRRLGVAVAVLGGFLYAVGGSDGTSPLNTVERYNPQENRWHTVAPMGTRRKHLGCAVYQDMIYSVGGRDDTTELSSAERYNPRTNQWS-PVVAMTSRRSGVGLAVVNGQLMAVGGFDGTTYLKTIEVYDPD-----ANTWRLY 566          

HSP 3 Score: 108.227 bits (269), Expect = 9.506e-24
Identity = 71/209 (33.97%), Postives = 102/209 (48.80%), Query Frame = 1
Query: 1582 STSRCAAGLVNVNDQLIVIGGFNRGECLNSVEIYQPLINKWSPSLSMKLCRARL-VALVGQSDKENPYVYAIGGSDGYKELHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGNLAIVGGCFGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPEPSYSRRGASL 2205
            ST R + G+  +   L  +GG +   CLN VE Y P  NKW+   SM   R  + VA++G       ++YA+GGSDG   L+TVER++    RW  VA +   R + G AV          +  VGG      L S E Y+   ++WS + +M++ RS   +A ++ QL  VGG D    L + EV D     WR     +Y R G  +
Sbjct:  382 STCRTSVGVAVLGGYLYAVGGQDGVSCLNIVERYDPKENKWTRVASMSTRRLGVAVAVLGG------FLYAVGGSDGTSPLNTVERYNPQENRWHTVAPMGTRRKHLGCAVY------QDMIYSVGGRDDTTELSSAERYNPRTNQWSPVVAMTSRRSGVGLAVVNGQLMAVGGFDGTTYLKTIEVYDPDANTWRLYGGMNYRRLGGGV 578          

HSP 4 Score: 97.4413 bits (241), Expect = 2.142e-20
Identity = 69/280 (24.64%), Postives = 131/280 (46.79%), Query Frame = 1
Query:   25 IPKSNKLSLIDDRSRHSELLNRLNKLRISKAFCDVTVFAENKEFVAHKVILASSSDYFLSKFTEDPKCDRLSINMNKDI----FNLLLDYFYTSNLIVSKEKVPQLFSAAKYLKVRRVVKVCAQFLTKILSLDNIIDVRESVALNDSEDLCQAANAFIKENMDKIISNVKIQKLNMDIMVDTVPKKENDSRLAE----LVIDWLEYSIVEDNMKLSDFVNENLVFFLTPS--NSLVQCSEMASSNKFSSTFINDYFNGFLSYQ-KNISKRVKCRPRSKER 831
            +P+  ++  I D+    + L  +N LR  +  CDV +    K+  AH+VIL++ S YF + FT +    R +  + +DI      LL+D+ YTS + V +  V  L  AA  L++  + + C +FL + L   N + +R     +   +L + A+ F + N  +++ + +   L  + ++D +   E + R  E     V+ W++YSI E   +L   +    +  L+P      V    +  S++     +++  N  L  Q + + +  + RPR   R
Sbjct:   19 VPQPARMPYISDKHPR-QTLEVINLLRKHRELCDVVLVVGAKKIYAHRVILSACSPYFRAMFTGELAESRQTEVVIRDIDERAMELLIDFAYTSQVTVEEGNVQTLLPAACLLQLAEIQEACCEFLKRQLDPSNCLGIRAFADTHSCRELLRIADKFTQHNFQEVMESEEFMLLPANQLIDIISSDELNVRSEEQVFNAVMAWVKYSIQERRPQLPQVLQHVRLPLLSPKFLVGTVGSDPLIKSDEECRDLVDEAKNYLLLPQERPLMQGPRTRPRKPIR 297          

HSP 5 Score: 81.2629 bits (199), Expect = 3.023e-15
Identity = 57/181 (31.49%), Postives = 83/181 (45.86%), Query Frame = 1
Query: 1942 LAIVGGCFGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPEP-SYSRRGASLVPYNGKLYLFGGSDSNSSLRTLEIFDSVANQWSLSVQQMKQSRANLCGGVLLNKLMAIGGFTGKHFLDTMECVDFDESCEISSEWSMYVPIG 2481
             A+ G C G + + S E YD   ++W  + SMS  R    V+ +D+ L+ VGG D    L+S E  D +  +W +   P S  R    +    G LY  GG D  S L  +E +D   N+W+  V  M   R  +   VL   L A+GG  G   L+T+E  +  E     + W    P+G
Sbjct:  303 FAVGGWCSG-DAISSVERYDPQTNEWRMVASMSKRRCGVGVSVLDDLLYAVGGHDGSSYLNSVERYDPKTNQWSSDVAPTSTCRTSVGVAVLGGYLYAVGGQDGVSCLNIVERYDPKENKWT-RVASMSTRRLGVAVAVLGGFLYAVGGSDGTSPLNTVERYNPQE-----NRWHTVAPMG 476          

HSP 6 Score: 75.0998 bits (183), Expect = 2.571e-13
Identity = 51/182 (28.02%), Postives = 79/182 (43.41%), Query Frame = 1
Query: 1528 LLKKVNTKVSTLERFDCLSTSRCAAGLVNVNDQLIVIGGFNRGECLNSVEIYQPLINKWSPSLSMKLCRARLVALVGQSDKENPYVYAIGGSDGYKELHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGNLAIVGGCFGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASI 2073
            ++++ + K +   R   +ST R    +  +   L  +GG +    LN+VE Y P  N+W     M   R  L   V Q       +Y++GG D   EL + ER++    +W+ V  +   RS  G AV+       G L  VGG  G   L++ E+YD   + W     M+  R    V  I
Sbjct:  411 IVERYDPKENKWTRVASMSTRRLGVAVAVLGGFLYAVGGSDGTSPLNTVERYNPQENRWHTVAPMGTRRKHLGCAVYQD-----MIYSVGGRDDTTELSSAERYNPRTNQWSPVVAMTSRRSGVGLAVV------NGQLMAVGGFDGTTYLKTIEVYDPDANTWRLYGGMNYRRLGGGVGVI 581          
BLAST of BTB domain-containing protein vs. Ensembl Xenopus
Match: IVNS1ABP (influenza virus NS1A binding protein [Source:NCBI gene;Acc:100145550])

HSP 1 Score: 163.31 bits (412), Expect = 1.428e-41
Identity = 93/309 (30.10%), Postives = 156/309 (50.49%), Query Frame = 1
Query: 1558 TLER-FDCLSTSRCAAGLVNVNDQLIVIGGFNRGECLNSVEIYQPLINKWSPSLSMKLCRARLVALVGQSDKENPYVYAIGGSDGYKE-LHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGNLAIVGGC--FGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPEPSYSRRGASLVPYNGKLYLFGGSDSNSSLRTLEIFDSVANQWSLSVQQMKQSRANLCGGVLLNKLMAIGGFTGKHFLDTMECVDFDESCEISSEWSMYV 2472
            +LER    +  +R   G   +N +LI  GG+NR ECL +VE Y P  + W+    MK  RAR    V        ++Y +GGS+G+ + L   E++D  +  W  V  +   R   G   +       G L +VGG   +G   L++C+++D     W+    ++  R Q+AV  + N+++++GG +SW CL+S E  +     W  +   + +RRGA +  Y GKL++ GG D   +L  +E +D   N+W + +  M  +R+N     + +++ A GGF G  FL+T+E  +       + EWS + 
Sbjct:  298 SLERVMSPMHYARSGLGTAELNGKLIAAGGYNREECLRTVECYDPETDIWTFIAPMKTPRARFQMAVLMD-----HLYVVGGSNGHSDDLSCGEKYDPKSNVWISVPELRSNRCNAGVCAL------NGKLYVVGGSDPYGQKGLKNCDVFDPITRMWTCCAQLNIRRHQSAVCELGNKMYIIGGAESWNCLNSVECYNPENDTWTLVAPMNVARRGAGVAVYEGKLFVVGGFDGTHALSCVESYDPERNEWKM-MGSMTSARSNAGMVAVGDQIYAAGGFDGNEFLNTIEVYN-----PQTEEWSPFT 589          

HSP 2 Score: 80.1073 bits (196), Expect = 9.532e-15
Identity = 55/175 (31.43%), Postives = 91/175 (52.00%), Query Frame = 1
Query:   88 RLNKLRISKAFCDVTVFAENKEFVAHKVILASSSDYFLSKFTEDPKCDRLSI----NMNKDIFNLLLDYFYTSNLIVSKEKVPQLFSAAKYLKVRRVVKVCAQFLTKILSLDNIIDVRESV-ALNDSEDLCQAANAFIKENMDKIISN---VKIQKLNMDIMVDTVPKKENDSRL 588
            +LN LR S  FCDV +     E +AH+ +LA  S +    F  D +   +S+    ++N D   +LL+Y YTS L    + V  ++SAAK LK+ RV +VC  +L   + + + I  R  V A+ D   L +  N +I+E++ +I      +K+ +LN+  +  +   K  D+ L
Sbjct:   21 KLNALRKSGQFCDVKLQVCGHEMLAHRAVLACCSPFLFEIFNSDGESHGISLVRFDDLNPDAVEVLLNYAYTSQLKAETDLVKDVYSAAKKLKIDRVKQVCGDYLLSKIDVQSCISYRNFVNAMGDWRLLSKIDN-YIQEHLLEISEQEDFLKLPRLNVQTLYYSADHKLLDASL 194          

HSP 3 Score: 60.077 bits (144), Expect = 1.431e-8
Identity = 40/156 (25.64%), Postives = 68/156 (43.59%), Query Frame = 1
Query: 1579 LSTSRCAAGLVNVNDQLIVIGGFNRGECLNSVEIYQPLINKWSPSLSMKLCRARLVALVGQSDKENPYVYAIGGSDGYKELHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGNLAIVGGCFGPNNLRSCEIYDTTLDKWSDLKSMSTS 2046
            L+  R  + +  + +++ +IGG     CLNSVE Y P  + W+    M + R      V +       ++ +GG DG   L  VE +D     W  + ++   RS  G  ++ VG      +   GG  G   L + E+Y+   ++WS    +  S
Sbjct:  450 LNIRRHQSAVCELGNKMYIIGGAESWNCLNSVECYNPENDTWTLVAPMNVARRGAGVAVYEGK-----LFVVGGFDGTHALSCVESYDPERNEWKMMGSMTSARSNAG--MVAVG----DQIYAAGGFDGNEFLNTIEVYNPQTEEWSPFTHLCKS 594          
BLAST of BTB domain-containing protein vs. Ensembl Xenopus
Match: IVNS1ABP (influenza virus NS1A binding protein [Source:NCBI gene;Acc:100145550])

HSP 1 Score: 163.696 bits (413), Expect = 1.962e-41
Identity = 93/309 (30.10%), Postives = 156/309 (50.49%), Query Frame = 1
Query: 1558 TLER-FDCLSTSRCAAGLVNVNDQLIVIGGFNRGECLNSVEIYQPLINKWSPSLSMKLCRARLVALVGQSDKENPYVYAIGGSDGYKE-LHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGNLAIVGGC--FGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPEPSYSRRGASLVPYNGKLYLFGGSDSNSSLRTLEIFDSVANQWSLSVQQMKQSRANLCGGVLLNKLMAIGGFTGKHFLDTMECVDFDESCEISSEWSMYV 2472
            +LER    +  +R   G   +N +LI  GG+NR ECL +VE Y P  + W+    MK  RAR    V        ++Y +GGS+G+ + L   E++D  +  W  V  +   R   G   +       G L +VGG   +G   L++C+++D     W+    ++  R Q+AV  + N+++++GG +SW CL+S E  +     W  +   + +RRGA +  Y GKL++ GG D   +L  +E +D   N+W + +  M  +R+N     + +++ A GGF G  FL+T+E  +       + EWS + 
Sbjct:  342 SLERVMSPMHYARSGLGTAELNGKLIAAGGYNREECLRTVECYDPETDIWTFIAPMKTPRARFQMAVLMD-----HLYVVGGSNGHSDDLSCGEKYDPKSNVWISVPELRSNRCNAGVCAL------NGKLYVVGGSDPYGQKGLKNCDVFDPITRMWTCCAQLNIRRHQSAVCELGNKMYIIGGAESWNCLNSVECYNPENDTWTLVAPMNVARRGAGVAVYEGKLFVVGGFDGTHALSCVESYDPERNEWKM-MGSMTSARSNAGMVAVGDQIYAAGGFDGNEFLNTIEVYNPQ-----TEEWSPFT 633          

HSP 2 Score: 98.2117 bits (243), Expect = 2.078e-20
Identity = 65/216 (30.09%), Postives = 113/216 (52.31%), Query Frame = 1
Query:   88 RLNKLRISKAFCDVTVFAENKEFVAHKVILASSSDYFLSKFTEDPKCDRLSI----NMNKDIFNLLLDYFYTSNLIVSKEKVPQLFSAAKYLKVRRVVKVCAQFLTKILSLDNIIDVRESV-ALNDSEDLCQAANAFIKENMDKIISN---VKIQKLNMDIMVDTVPKKENDSRLAELVIDWLEYSIVEDNMKLSDFVNENLVFFLTPSNSLVQCS 711
            +LN LR S  FCDV +     E +AH+ +LA  S +    F  D +   +S+    ++N D   +LL+Y YTS L    + V  ++SAAK LK+ RV +VC  +L   + + + I  R  V A+ D   L +  N +I+E++ +I      +K+ +LN++IM++      ++ +L   VI+W++ SI E+   L   + E    + +  + L+  S
Sbjct:   21 KLNALRKSGQFCDVKLQVCGHEMLAHRAVLACCSPFLFEIFNSDGESHGISLVRFDDLNPDAVEVLLNYAYTSQLKAETDLVKDVYSAAKKLKIDRVKQVCGDYLLSKIDVQSCISYRNFVNAMGDWRLLSKIDN-YIQEHLLEISEQEDFLKLPRLNLEIMLEENVSLPSNGKLYTKVINWVQRSIWENGENLDALLEEVQTLYYSADHKLLDAS 235          

HSP 3 Score: 61.2326 bits (147), Expect = 6.639e-9
Identity = 40/155 (25.81%), Postives = 69/155 (44.52%), Query Frame = 1
Query: 1579 LSTSRCAAGLVNVNDQLIVIGGFNRGECLNSVEIYQPLINKWSPSLSMKLCRARLVALVGQSDKENPYVYAIGGSDGYKELHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGNLAIVGGCFGPNNLRSCEIYDTTLDKWSDLKSMST 2043
            L+  R  + +  + +++ +IGG     CLNSVE Y P  + W+    M + R      V +       ++ +GG DG   L  VE +D     W  + ++   RS  G  ++ VG      +   GG  G   L + E+Y+   ++WS    +S+
Sbjct:  494 LNIRRHQSAVCELGNKMYIIGGAESWNCLNSVECYNPENDTWTLVAPMNVARRGAGVAVYEGK-----LFVVGGFDGTHALSCVESYDPERNEWKMMGSMTSARSNAG--MVAVG----DQIYAAGGFDGNEFLNTIEVYNPQTEEWSPFTHLSS 637          
BLAST of BTB domain-containing protein vs. Ensembl Xenopus
Match: IVNS1ABP (influenza virus NS1A binding protein [Source:NCBI gene;Acc:100145550])

HSP 1 Score: 163.696 bits (413), Expect = 1.984e-41
Identity = 93/309 (30.10%), Postives = 156/309 (50.49%), Query Frame = 1
Query: 1558 TLER-FDCLSTSRCAAGLVNVNDQLIVIGGFNRGECLNSVEIYQPLINKWSPSLSMKLCRARLVALVGQSDKENPYVYAIGGSDGYKE-LHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGNLAIVGGC--FGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPEPSYSRRGASLVPYNGKLYLFGGSDSNSSLRTLEIFDSVANQWSLSVQQMKQSRANLCGGVLLNKLMAIGGFTGKHFLDTMECVDFDESCEISSEWSMYV 2472
            +LER    +  +R   G   +N +LI  GG+NR ECL +VE Y P  + W+    MK  RAR    V        ++Y +GGS+G+ + L   E++D  +  W  V  +   R   G   +       G L +VGG   +G   L++C+++D     W+    ++  R Q+AV  + N+++++GG +SW CL+S E  +     W  +   + +RRGA +  Y GKL++ GG D   +L  +E +D   N+W + +  M  +R+N     + +++ A GGF G  FL+T+E  +       + EWS + 
Sbjct:  340 SLERVMSPMHYARSGLGTAELNGKLIAAGGYNREECLRTVECYDPETDIWTFIAPMKTPRARFQMAVLMD-----HLYVVGGSNGHSDDLSCGEKYDPKSNVWISVPELRSNRCNAGVCAL------NGKLYVVGGSDPYGQKGLKNCDVFDPITRMWTCCAQLNIRRHQSAVCELGNKMYIIGGAESWNCLNSVECYNPENDTWTLVAPMNVARRGAGVAVYEGKLFVVGGFDGTHALSCVESYDPERNEWKM-MGSMTSARSNAGMVAVGDQIYAAGGFDGNEFLNTIEVYNPQ-----TEEWSPFT 631          

HSP 2 Score: 100.908 bits (250), Expect = 3.658e-21
Identity = 67/228 (29.39%), Postives = 116/228 (50.88%), Query Frame = 1
Query:   88 RLNKLRISKAFCDVTVFAENKEFVAHKVILASSSDYFLSKFTEDPKCDRLSI----NMNKDIFNLLLDYFYTSNLIVSKEKVPQLFSAAKYLKVRRVVKVCAQFLTKILSLDNIIDVRESV-ALNDSEDLCQAANAFIKENMDKIISN---VKIQKLNMDIMVDTVPKKENDSRLAELVIDWLEYSIVEDNMKLSDFVNENLVFFLTPSNSLVQCSEMASSNKFSSTF 747
            +LN LR S  FCDV +     E +AH+ +LA  S +    F  D +   +S+    ++N D   +LL+Y YTS L    + V  ++SAAK LK+ RV +VC  +L   + + + I  R  V A+ D   L +  N +I+E++ +I      +K+ +LN++IM++      ++ +L   VI+W++ SI E+   L   + E    + +  + L+  S +     F   F
Sbjct:   21 KLNALRKSGQFCDVKLQVCGHEMLAHRAVLACCSPFLFEIFNSDGESHGISLVRFDDLNPDAVEVLLNYAYTSQLKAETDLVKDVYSAAKKLKIDRVKQVCGDYLLSKIDVQSCISYRNFVNAMGDWRLLSKIDN-YIQEHLLEISEQEDFLKLPRLNLEIMLEENVSLPSNGKLYTKVINWVQRSIWENGENLDALLEEVQTLYYSADHKLLDASLLGEHTDFKICF 247          

HSP 3 Score: 54.299 bits (129), Expect = 1.003e-6
Identity = 30/101 (29.70%), Postives = 53/101 (52.48%), Query Frame = 1
Query: 1579 LSTSRCAAGLVNVNDQLIVIGGFNRGECLNSVEIYQPLINKWSPSLSMKLCRARLVALVGQSDKENPYVYAIGGSDGYKELHTVERFDVNNQRWTRVANIN 1881
            ++ +R  AG+     +L V+GGF+    L+ VE Y P  N+W    SM   R+    +V   D+    +YA GG DG + L+T+E ++   + W+   +++
Sbjct:  539 MNVARRGAGVAVYEGKLFVVGGFDGTHALSCVESYDPERNEWKMMGSMTSARSN-AGMVAVGDQ----IYAAGGFDGNEFLNTIEVYNPQTEEWSPFTHLD 634          
BLAST of BTB domain-containing protein vs. Ensembl Xenopus
Match: IVNS1ABP (influenza virus NS1A binding protein [Source:NCBI gene;Acc:100145550])

HSP 1 Score: 163.696 bits (413), Expect = 2.141e-41
Identity = 93/309 (30.10%), Postives = 156/309 (50.49%), Query Frame = 1
Query: 1558 TLER-FDCLSTSRCAAGLVNVNDQLIVIGGFNRGECLNSVEIYQPLINKWSPSLSMKLCRARLVALVGQSDKENPYVYAIGGSDGYKE-LHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGNLAIVGGC--FGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPEPSYSRRGASLVPYNGKLYLFGGSDSNSSLRTLEIFDSVANQWSLSVQQMKQSRANLCGGVLLNKLMAIGGFTGKHFLDTMECVDFDESCEISSEWSMYV 2472
            +LER    +  +R   G   +N +LI  GG+NR ECL +VE Y P  + W+    MK  RAR    V        ++Y +GGS+G+ + L   E++D  +  W  V  +   R   G   +       G L +VGG   +G   L++C+++D     W+    ++  R Q+AV  + N+++++GG +SW CL+S E  +     W  +   + +RRGA +  Y GKL++ GG D   +L  +E +D   N+W + +  M  +R+N     + +++ A GGF G  FL+T+E  +       + EWS + 
Sbjct:  349 SLERVMSPMHYARSGLGTAELNGKLIAAGGYNREECLRTVECYDPETDIWTFIAPMKTPRARFQMAVLMD-----HLYVVGGSNGHSDDLSCGEKYDPKSNVWISVPELRSNRCNAGVCAL------NGKLYVVGGSDPYGQKGLKNCDVFDPITRMWTCCAQLNIRRHQSAVCELGNKMYIIGGAESWNCLNSVECYNPENDTWTLVAPMNVARRGAGVAVYEGKLFVVGGFDGTHALSCVESYDPERNEWKM-MGSMTSARSNAGMVAVGDQIYAAGGFDGNEFLNTIEVYNPQ-----TEEWSPFT 640          

HSP 2 Score: 98.2117 bits (243), Expect = 2.031e-20
Identity = 65/216 (30.09%), Postives = 113/216 (52.31%), Query Frame = 1
Query:   88 RLNKLRISKAFCDVTVFAENKEFVAHKVILASSSDYFLSKFTEDPKCDRLSI----NMNKDIFNLLLDYFYTSNLIVSKEKVPQLFSAAKYLKVRRVVKVCAQFLTKILSLDNIIDVRESV-ALNDSEDLCQAANAFIKENMDKIISN---VKIQKLNMDIMVDTVPKKENDSRLAELVIDWLEYSIVEDNMKLSDFVNENLVFFLTPSNSLVQCS 711
            +LN LR S  FCDV +     E +AH+ +LA  S +    F  D +   +S+    ++N D   +LL+Y YTS L    + V  ++SAAK LK+ RV +VC  +L   + + + I  R  V A+ D   L +  N +I+E++ +I      +K+ +LN++IM++      ++ +L   VI+W++ SI E+   L   + E    + +  + L+  S
Sbjct:   28 KLNALRKSGQFCDVKLQVCGHEMLAHRAVLACCSPFLFEIFNSDGESHGISLVRFDDLNPDAVEVLLNYAYTSQLKAETDLVKDVYSAAKKLKIDRVKQVCGDYLLSKIDVQSCISYRNFVNAMGDWRLLSKIDN-YIQEHLLEISEQEDFLKLPRLNLEIMLEENVSLPSNGKLYTKVINWVQRSIWENGENLDALLEEVQTLYYSADHKLLDAS 242          

HSP 3 Score: 60.4622 bits (145), Expect = 1.384e-8
Identity = 40/156 (25.64%), Postives = 68/156 (43.59%), Query Frame = 1
Query: 1579 LSTSRCAAGLVNVNDQLIVIGGFNRGECLNSVEIYQPLINKWSPSLSMKLCRARLVALVGQSDKENPYVYAIGGSDGYKELHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGNLAIVGGCFGPNNLRSCEIYDTTLDKWSDLKSMSTS 2046
            L+  R  + +  + +++ +IGG     CLNSVE Y P  + W+    M + R      V +       ++ +GG DG   L  VE +D     W  + ++   RS  G  ++ VG      +   GG  G   L + E+Y+   ++WS    +  S
Sbjct:  501 LNIRRHQSAVCELGNKMYIIGGAESWNCLNSVECYNPENDTWTLVAPMNVARRGAGVAVYEGK-----LFVVGGFDGTHALSCVESYDPERNEWKMMGSMTSARSNAG--MVAVG----DQIYAAGGFDGNEFLNTIEVYNPQTEEWSPFTHLCKS 645          
BLAST of BTB domain-containing protein vs. Ensembl Xenopus
Match: IVNS1ABP (influenza virus NS1A binding protein [Source:NCBI gene;Acc:100145550])

HSP 1 Score: 163.31 bits (412), Expect = 2.904e-41
Identity = 93/309 (30.10%), Postives = 156/309 (50.49%), Query Frame = 1
Query: 1558 TLER-FDCLSTSRCAAGLVNVNDQLIVIGGFNRGECLNSVEIYQPLINKWSPSLSMKLCRARLVALVGQSDKENPYVYAIGGSDGYKE-LHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGNLAIVGGC--FGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPEPSYSRRGASLVPYNGKLYLFGGSDSNSSLRTLEIFDSVANQWSLSVQQMKQSRANLCGGVLLNKLMAIGGFTGKHFLDTMECVDFDESCEISSEWSMYV 2472
            +LER    +  +R   G   +N +LI  GG+NR ECL +VE Y P  + W+    MK  RAR    V        ++Y +GGS+G+ + L   E++D  +  W  V  +   R   G   +       G L +VGG   +G   L++C+++D     W+    ++  R Q+AV  + N+++++GG +SW CL+S E  +     W  +   + +RRGA +  Y GKL++ GG D   +L  +E +D   N+W + +  M  +R+N     + +++ A GGF G  FL+T+E  +       + EWS + 
Sbjct:  334 SLERVMSPMHYARSGLGTAELNGKLIAAGGYNREECLRTVECYDPETDIWTFIAPMKTPRARFQMAVLMD-----HLYVVGGSNGHSDDLSCGEKYDPKSNVWISVPELRSNRCNAGVCAL------NGKLYVVGGSDPYGQKGLKNCDVFDPITRMWTCCAQLNIRRHQSAVCELGNKMYIIGGAESWNCLNSVECYNPENDTWTLVAPMNVARRGAGVAVYEGKLFVVGGFDGTHALSCVESYDPERNEWKM-MGSMTSARSNAGMVAVGDQIYAAGGFDGNEFLNTIEVYNPQ-----TEEWSPFT 625          

HSP 2 Score: 97.4413 bits (241), Expect = 4.000e-20
Identity = 65/216 (30.09%), Postives = 113/216 (52.31%), Query Frame = 1
Query:   88 RLNKLRISKAFCDVTVFAENKEFVAHKVILASSSDYFLSKFTEDPKCDRLSI----NMNKDIFNLLLDYFYTSNLIVSKEKVPQLFSAAKYLKVRRVVKVCAQFLTKILSLDNIIDVRESV-ALNDSEDLCQAANAFIKENMDKIISN---VKIQKLNMDIMVDTVPKKENDSRLAELVIDWLEYSIVEDNMKLSDFVNENLVFFLTPSNSLVQCS 711
            +LN LR S  FCDV +     E +AH+ +LA  S +    F  D +   +S+    ++N D   +LL+Y YTS L    + V  ++SAAK LK+ RV +VC  +L   + + + I  R  V A+ D   L +  N +I+E++ +I      +K+ +LN++IM++      ++ +L   VI+W++ SI E+   L   + E    + +  + L+  S
Sbjct:   21 KLNALRKSGQFCDVKLQVCGHEMLAHRAVLACCSPFLFEIFNSDGESHGISLVRFDDLNPDAVEVLLNYAYTSQLKAETDLVKDVYSAAKKLKIDRVKQVCGDYLLSKIDVQSCISYRNFVNAMGDWRLLSKIDN-YIQEHLLEISEQEDFLKLPRLNLEIMLEENVSLPSNGKLYTKVINWVQRSIWENGENLDALLEEVQTLYYSADHKLLDAS 235          

HSP 3 Score: 60.077 bits (144), Expect = 1.634e-8
Identity = 40/156 (25.64%), Postives = 68/156 (43.59%), Query Frame = 1
Query: 1579 LSTSRCAAGLVNVNDQLIVIGGFNRGECLNSVEIYQPLINKWSPSLSMKLCRARLVALVGQSDKENPYVYAIGGSDGYKELHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGNLAIVGGCFGPNNLRSCEIYDTTLDKWSDLKSMSTS 2046
            L+  R  + +  + +++ +IGG     CLNSVE Y P  + W+    M + R      V +       ++ +GG DG   L  VE +D     W  + ++   RS  G  ++ VG      +   GG  G   L + E+Y+   ++WS    +  S
Sbjct:  486 LNIRRHQSAVCELGNKMYIIGGAESWNCLNSVECYNPENDTWTLVAPMNVARRGAGVAVYEGK-----LFVVGGFDGTHALSCVESYDPERNEWKMMGSMTSARSNAG--MVAVG----DQIYAAGGFDGNEFLNTIEVYNPQTEEWSPFTHLCKS 630          
BLAST of BTB domain-containing protein vs. Ensembl Mouse
Match: Ivns1abp (influenza virus NS1A binding protein [Source:MGI Symbol;Acc:MGI:2152389])

HSP 1 Score: 171.4 bits (433), Expect = 2.878e-44
Identity = 96/305 (31.48%), Postives = 156/305 (51.15%), Query Frame = 1
Query: 1579 LSTSRCAAGLVNVNDQLIVIGGFNRGECLNSVEIYQPLINKWSPSLSMKLCRAR--LVALVGQSDKENPYVYAIGGSDGYKE-LHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGNLAIVGGC--FGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPEPSYSRRGASLVPYNGKLYLFGGSDSNSSLRTLEIFDSVANQWSLSVQQMKQSRANLCGGVLLNKLMAIGGFTGKHFLDTMECVDFDESCEISSEWSMYVPI 2478
            +  +R   G   +N +LI  GG+NR ECL +VE Y P  + WS    M+  RAR  +  L+GQ       +Y +GGS+G+ + L   E +D N   WT V  +   R   G   +       G L IVGG   +G   L++C+++D     W+    ++  R Q+AV  +   L+++GG +SW CL++ E  +     W  +   + +RRGA +   +GKL++ GG D + ++  +E++D   N+W + +  M   R+N     + N + A+GGF G  FL+T+E  +       S+EWS Y  I
Sbjct:  312 MQYARSGLGTAEMNGKLIAAGGYNREECLRTVECYDPHTDHWSFLAPMRTPRARFQMAVLMGQ-------LYVVGGSNGHSDDLSCGEMYDPNIDDWTPVPELRTNRCNAGVCAL------NGKLYIVGGSDPYGQKGLKNCDVFDPVTKSWTSCAPLNIRRHQSAVCELGGYLYIIGGAESWNCLNTVERYNPENNTWTLIAPMNVARRGAGVAVLDGKLFVGGGFDGSHAISCVEMYDPTRNEWKM-MGNMTSPRSNAGITTVGNTIYAVGGFDGNEFLNTVEVYN-----PQSNEWSPYTKI 597          

HSP 2 Score: 80.8777 bits (198), Expect = 4.315e-15
Identity = 49/153 (32.03%), Postives = 77/153 (50.33%), Query Frame = 1
Query:   88 RLNKLRISKAFCDVTVFAENKEFVAHKVILASSSDYFLSKFTEDPKCDRLSI----NMNKDIFNLLLDYFYTSNLIVSKEKVPQLFSAAKYLKVRRVVKVCAQFLTKILSLDNIIDVRESVALNDSEDLCQAANAFIKENMDKIISNVKIQKL 534
            +LN LR S  FCDV +     E +AH+ +LA  S Y    F  D     +S     ++N +   +LL+Y YT+ L   KE V  ++SAAK LK+ RV +VC  +L   + + + I  R   +      L    +A+I+E++ +I    +  KL
Sbjct:   21 KLNALRKSGQFCDVRLQVCGHEMLAHRAVLACCSPYLFEIFNSDSDPHGVSHVKLDDLNPEAVEVLLNYAYTAQLKADKELVKDVYSAAKKLKMDRVKQVCGDYLLSRMDVTSCISYRNFASCMGDSRLLNKVDAYIQEHLLQISEEEEFLKL 173          

HSP 3 Score: 55.0694 bits (131), Expect = 4.509e-7
Identity = 33/119 (27.73%), Postives = 62/119 (52.10%), Query Frame = 1
Query: 1531 LKKVNTKVSTLERFDCLSTSRCAAGLVNVNDQLIVIGGFNRGECLNSVEIYQPLINKWSPSLSMKLCRARL-VALVGQSDKENPYVYAIGGSDGYKELHTVERFDVNNQRWTRVANINQ 1884
            +++ N + +T      ++ +R  AG+  ++ +L V GGF+    ++ VE+Y P  N+W    +M   R+   +  VG +      +YA+GG DG + L+TVE ++  +  W+    I Q
Sbjct:  487 VERYNPENNTWTLIAPMNVARRGAGVAVLDGKLFVGGGFDGSHAISCVEMYDPTRNEWKMMGNMTSPRSNAGITTVGNT------IYAVGGFDGNEFLNTVEVYNPQSNEWSPYTKIFQ 599          

HSP 4 Score: 52.373 bits (124), Expect = 2.943e-6
Identity = 40/161 (24.84%), Postives = 68/161 (42.24%), Query Frame = 1
Query: 1999 DTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPEPSYSRRGASLVPYNGKLYLFGGSDSNS-SLRTLEIFDSVANQWSLSVQQMKQSRANLCGGVLLNKLMAIGGFTGKHFLDTMECVDFDESCEISSEWSMYVPI 2478
            D  L+K   +  M  +RS    A ++ +L   GG +  +CL + E  D     W  +      R    +    G+LY+ GGS+ +S  L   E++D   + W+  V +++ +R N     L  KL  +GG           C  FD    ++  W+   P+
Sbjct:  302 DELLEK--PMSPMQYARSGLGTAEMNGKLIAAGGYNREECLRTVECYDPHTDHWSFLAPMRTPRARFQMAVLMGQLYVVGGSNGHSDDLSCGEMYDPNIDDWT-PVPELRTNRCNAGVCALNGKLYIVGGSDPYGQKGLKNCDVFD---PVTKSWTSCAPL 456          
BLAST of BTB domain-containing protein vs. Ensembl Mouse
Match: Ivns1abp (influenza virus NS1A binding protein [Source:MGI Symbol;Acc:MGI:2152389])

HSP 1 Score: 171.4 bits (433), Expect = 5.261e-44
Identity = 96/305 (31.48%), Postives = 156/305 (51.15%), Query Frame = 1
Query: 1579 LSTSRCAAGLVNVNDQLIVIGGFNRGECLNSVEIYQPLINKWSPSLSMKLCRAR--LVALVGQSDKENPYVYAIGGSDGYKE-LHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGNLAIVGGC--FGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPEPSYSRRGASLVPYNGKLYLFGGSDSNSSLRTLEIFDSVANQWSLSVQQMKQSRANLCGGVLLNKLMAIGGFTGKHFLDTMECVDFDESCEISSEWSMYVPI 2478
            +  +R   G   +N +LI  GG+NR ECL +VE Y P  + WS    M+  RAR  +  L+GQ       +Y +GGS+G+ + L   E +D N   WT V  +   R   G   +       G L IVGG   +G   L++C+++D     W+    ++  R Q+AV  +   L+++GG +SW CL++ E  +     W  +   + +RRGA +   +GKL++ GG D + ++  +E++D   N+W + +  M   R+N     + N + A+GGF G  FL+T+E  +       S+EWS Y  I
Sbjct:  354 MQYARSGLGTAEMNGKLIAAGGYNREECLRTVECYDPHTDHWSFLAPMRTPRARFQMAVLMGQ-------LYVVGGSNGHSDDLSCGEMYDPNIDDWTPVPELRTNRCNAGVCAL------NGKLYIVGGSDPYGQKGLKNCDVFDPVTKSWTSCAPLNIRRHQSAVCELGGYLYIIGGAESWNCLNTVERYNPENNTWTLIAPMNVARRGAGVAVLDGKLFVGGGFDGSHAISCVEMYDPTRNEWKM-MGNMTSPRSNAGITTVGNTIYAVGGFDGNEFLNTVEVYN-----PQSNEWSPYTKI 639          

HSP 2 Score: 96.6709 bits (239), Expect = 4.970e-20
Identity = 60/212 (28.30%), Postives = 108/212 (50.94%), Query Frame = 1
Query:   88 RLNKLRISKAFCDVTVFAENKEFVAHKVILASSSDYFLSKFTEDPKCDRLSI----NMNKDIFNLLLDYFYTSNLIVSKEKVPQLFSAAKYLKVRRVVKVCAQFLTKILSLDNIIDVRESVALNDSEDLCQAANAFIKENMDKIISN---VKIQKLNMDIMVDTVPKKENDSRLAELVIDWLEYSIVEDNMKLSDFVNENLVFFLTPSNSLV 702
            +LN LR S  FCDV +     E +AH+ +LA  S Y    F  D     +S     ++N +   +LL+Y YT+ L   KE V  ++SAAK LK+ RV +VC  +L   + + + I  R   +      L    +A+I+E++ +I      +K+ +L +++M++      ++ +L   VI+W++ SI E+   L + + E    + +  + L+
Sbjct:   21 KLNALRKSGQFCDVRLQVCGHEMLAHRAVLACCSPYLFEIFNSDSDPHGVSHVKLDDLNPEAVEVLLNYAYTAQLKADKELVKDVYSAAKKLKMDRVKQVCGDYLLSRMDVTSCISYRNFASCMGDSRLLNKVDAYIQEHLLQISEEEEFLKLPRLKLEVMLEDNVCLPSNGKLYTKVINWVQRSIWENGDSLEELMEEVQTLYYSADHKLL 232          

HSP 3 Score: 55.0694 bits (131), Expect = 4.715e-7
Identity = 33/119 (27.73%), Postives = 62/119 (52.10%), Query Frame = 1
Query: 1531 LKKVNTKVSTLERFDCLSTSRCAAGLVNVNDQLIVIGGFNRGECLNSVEIYQPLINKWSPSLSMKLCRARL-VALVGQSDKENPYVYAIGGSDGYKELHTVERFDVNNQRWTRVANINQ 1884
            +++ N + +T      ++ +R  AG+  ++ +L V GGF+    ++ VE+Y P  N+W    +M   R+   +  VG +      +YA+GG DG + L+TVE ++  +  W+    I Q
Sbjct:  529 VERYNPENNTWTLIAPMNVARRGAGVAVLDGKLFVGGGFDGSHAISCVEMYDPTRNEWKMMGNMTSPRSNAGITTVGNT------IYAVGGFDGNEFLNTVEVYNPQSNEWSPYTKIFQ 641          

HSP 4 Score: 52.373 bits (124), Expect = 3.120e-6
Identity = 40/161 (24.84%), Postives = 68/161 (42.24%), Query Frame = 1
Query: 1999 DTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPEPSYSRRGASLVPYNGKLYLFGGSDSNS-SLRTLEIFDSVANQWSLSVQQMKQSRANLCGGVLLNKLMAIGGFTGKHFLDTMECVDFDESCEISSEWSMYVPI 2478
            D  L+K   +  M  +RS    A ++ +L   GG +  +CL + E  D     W  +      R    +    G+LY+ GGS+ +S  L   E++D   + W+  V +++ +R N     L  KL  +GG           C  FD    ++  W+   P+
Sbjct:  344 DELLEK--PMSPMQYARSGLGTAEMNGKLIAAGGYNREECLRTVECYDPHTDHWSFLAPMRTPRARFQMAVLMGQLYVVGGSNGHSDDLSCGEMYDPNIDDWT-PVPELRTNRCNAGVCALNGKLYIVGGSDPYGQKGLKNCDVFD---PVTKSWTSCAPL 498          
BLAST of BTB domain-containing protein vs. Ensembl Mouse
Match: Klhl18 (kelch-like 18 [Source:MGI Symbol;Acc:MGI:2143315])

HSP 1 Score: 143.665 bits (361), Expect = 2.781e-35
Identity = 99/312 (31.73%), Postives = 154/312 (49.36%), Query Frame = 1
Query: 1591 RCAAGLVNVNDQLIVIGGFNR-GECLNSVEIYQPLINKWSPSLSMKLCRARL-VALVGQSDKENPYVYAIGGSDGYKELHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGNLAIVGGCFGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPEPSY----SRRGASLVPYNGKLYLFGGSDSNSSLRTLEIFDSVANQWSLSV-QQMKQSRANL---CGGVLLNKLMAIGGFTGKHFLDTMECVDFDESCEISSEWSMYVPIGWSVNG 2496
            RC   +  +   +  +GG N  G+ LN VE++ P+ N+W     M   R+R+ VA+V      N  +YAIGG DG   L TVE ++     WTRV ++N +RS  G  V+       G + + GG  G ++L S E Y    DKW+ +  MS++RS A V   + +++V GG D  +  SS E  +     W   P  S      R GA+ +    K+++ GG D +  L   E++ SVA+QW L V    ++SR +L   CG     +L A+GG+ G+  L ++E  D +     +  W+   P+     G
Sbjct:  281 RCCTSIAGL---IYAVGGLNSAGDSLNVVEVFDPIANRWEKCHPMTTARSRVGVAVV------NGLLYAIGGYDGQLRLSTVEAYNPETDTWTRVGSMNSKRSAMGTVVLD------GQIYVCGGYDGNSSLNSVETYSPETDKWTVVTPMSSNRSAAGVTVFEGRIYVSGGHDGLQIFSSVEHYNHHTATWH--PAASMLNKRCRHGAASL--GSKMFVCGGYDGSGFLSIAEMYSSVADQWCLIVPMHTRRSRVSLVASCG-----RLYAVGGYDGQSNLSSVEMYDPE-----TDRWTFMAPMACHEGG 563          

HSP 2 Score: 109.383 bits (272), Expect = 4.223e-24
Identity = 77/251 (30.68%), Postives = 119/251 (47.41%), Query Frame = 1
Query: 1564 ERFDCLSTSRCAAGLVNVNDQLIVIGGFNRGECLNSVEIYQPLINKWSPSLSMKLCRARL--VALVGQSDKENPYVYAIGGSDGYKELHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGNLAIVGGCFGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPEPSYSRRG-ASLVPYNGKLYLFGGSDSNSSLRTLEIFDSVANQWSL 2307
            E+   ++T+R   G+  VN  L  IGG++    L++VE Y P  + W+   SM   R+ +  V L GQ       +Y  GG DG   L++VE +     +WT V  ++  RS  G  V        G + + GG  G     S E Y+     W    SM   R +   AS+ +++FV GG D    LS  E+      +W  +  P ++RR   SLV   G+LY  GG D  S+L ++E++D   ++W+ 
Sbjct:  317 EKCHPMTTARSRVGVAVVNGLLYAIGGYDGQLRLSTVEAYNPETDTWTRVGSMNSKRSAMGTVVLDGQ-------IYVCGGYDGNSSLNSVETYSPETDKWTVVTPMSSNRSAAGVTVF------EGRIYVSGGHDGLQIFSSVEHYNHHTATWHPAASMLNKRCRHGAASLGSKMFVCGGYDGSGFLSIAEMYSSVADQW-CLIVPMHTRRSRVSLVASCGRLYAVGGYDGQSNLSSVEMYDPETDRWTF 553          

HSP 3 Score: 97.0561 bits (240), Expect = 2.835e-20
Identity = 61/213 (28.64%), Postives = 99/213 (46.48%), Query Frame = 1
Query: 1531 LKKVNTKVSTLERFDCLSTSRCAAGLVNVNDQLIVIGGFNRGECLNSVEIYQPLINKWSPSLSMKLCRARLVALVGQSDKENPYVYAIGGSDGYKELHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGNLAIVGGCFGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTM 2169
            ++  N +  T  R   +++ R A G V ++ Q+ V GG++    LNSVE Y P  +KW+    M   R+     V +       +Y  GG DG +   +VE ++ +   W   A++  +R  HG       AS    + + GG  G   L   E+Y +  D+W  +  M T RS+ ++ +   +L+ VGG D    LSS E+ D    +W  M
Sbjct:  353 VEAYNPETDTWTRVGSMNSKRSAMGTVVLDGQIYVCGGYDGNSSLNSVETYSPETDKWTVVTPMSSNRSAAGVTVFEGR-----IYVSGGHDGLQIFSSVEHYNHHTATWHPAASMLNKRCRHG------AASLGSKMFVCGGYDGSGFLSIAEMYSSVADQWCLIVPMHTRRSRVSLVASCGRLYAVGGYDGQSNLSSVEMYDPETDRWTFM 554          

HSP 4 Score: 77.7962 bits (190), Expect = 3.576e-14
Identity = 50/194 (25.77%), Postives = 98/194 (50.52%), Query Frame = 1
Query:   73 SELLNR----LNKLRISKAFCDVTVFAENKEFVAHKVILASSSDYFLSKFTED-PKCDRLSI---NMNKDIFNLLLDYFYTSNLIVSKEKVPQLFSAAKYLKVRRVVKVCAQFLTKILSLDNIIDVRESVALNDSEDLCQAANAFIKENMDKIISNVKIQKLNMDIMVDTVPKKE----NDSRLAELVIDWLEY 618
            SEL +R    + ++R     CDVT+   + +F AH+++LA+S  YF + FT D  +C +  I    M+      L+++ Y  NL + ++ V  L   A +L+++ +   C  FL + L   N + VR+         L  AAN+FI ++  ++  + +   L ++ +++ V + E    ++ ++ E  + W+ Y
Sbjct:   18 SELPSRGYGVMEEIRRQGKLCDVTLKIGDHKFSAHRIVLAASIPYFHAMFTNDMMECKQDEIVMQGMDPSALEALINFAYNGNLAIDQQNVQSLLMGASFLQLQSIKDACCTFLRERLHPKNCLGVRQFAETMMCAVLYDAANSFIHQHFVEVSLSEEFLALPLEDVLELVSRDELNVKSEEQVFEAALAWVRY 211          
BLAST of BTB domain-containing protein vs. Ensembl Mouse
Match: Klhl18 (kelch-like 18 [Source:MGI Symbol;Acc:MGI:2143315])

HSP 1 Score: 143.665 bits (361), Expect = 3.524e-35
Identity = 101/314 (32.17%), Postives = 153/314 (48.73%), Query Frame = 1
Query: 1591 RCA---AGLVNVNDQLIVIGGFNRGECLNSVEIYQPLINKWSPSLSMKLCRARL-VALVGQSDKENPYVYAIGGSDGYKELHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGNLAIVGGCFGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPEPSY----SRRGASLVPYNGKLYLFGGSDSNSSLRTLEIFDSVANQWSLSV-QQMKQSRANL---CGGVLLNKLMAIGGFTGKHFLDTMECVDFDESCEISSEWSMYVPIGWSVNG 2496
            RC    AGL+     L     F  G+ LN VE++ P+ N+W     M   R+R+ VA+V      N  +YAIGG DG   L TVE ++     WTRV ++N +RS  G  V+       G + + GG  G ++L S E Y    DKW+ +  MS++RS A V   + +++V GG D  +  SS E  +     W   P  S      R GA+ +    K+++ GG D +  L   E++ SVA+QW L V    ++SR +L   CG     +L A+GG+ G+  L ++E  D +     +  W+   P+     G
Sbjct:  281 RCCTSIAGLIYAVGGLNSAANFYAGDSLNVVEVFDPIANRWEKCHPMTTARSRVGVAVV------NGLLYAIGGYDGQLRLSTVEAYNPETDTWTRVGSMNSKRSAMGTVVLD------GQIYVCGGYDGNSSLNSVETYSPETDKWTVVTPMSSNRSAAGVTVFEGRIYVSGGHDGLQIFSSVEHYNHHTATWH--PAASMLNKRCRHGAASL--GSKMFVCGGYDGSGFLSIAEMYSSVADQWCLIVPMHTRRSRVSLVASCG-----RLYAVGGYDGQSNLSSVEMYDPE-----TDRWTFMAPMACHEGG 568          

HSP 2 Score: 108.997 bits (271), Expect = 4.663e-24
Identity = 77/251 (30.68%), Postives = 119/251 (47.41%), Query Frame = 1
Query: 1564 ERFDCLSTSRCAAGLVNVNDQLIVIGGFNRGECLNSVEIYQPLINKWSPSLSMKLCRARL--VALVGQSDKENPYVYAIGGSDGYKELHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGNLAIVGGCFGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPEPSYSRRG-ASLVPYNGKLYLFGGSDSNSSLRTLEIFDSVANQWSL 2307
            E+   ++T+R   G+  VN  L  IGG++    L++VE Y P  + W+   SM   R+ +  V L GQ       +Y  GG DG   L++VE +     +WT V  ++  RS  G  V        G + + GG  G     S E Y+     W    SM   R +   AS+ +++FV GG D    LS  E+      +W  +  P ++RR   SLV   G+LY  GG D  S+L ++E++D   ++W+ 
Sbjct:  322 EKCHPMTTARSRVGVAVVNGLLYAIGGYDGQLRLSTVEAYNPETDTWTRVGSMNSKRSAMGTVVLDGQ-------IYVCGGYDGNSSLNSVETYSPETDKWTVVTPMSSNRSAAGVTVF------EGRIYVSGGHDGLQIFSSVEHYNHHTATWHPAASMLNKRCRHGAASLGSKMFVCGGYDGSGFLSIAEMYSSVADQW-CLIVPMHTRRSRVSLVASCGRLYAVGGYDGQSNLSSVEMYDPETDRWTF 558          

HSP 3 Score: 97.0561 bits (240), Expect = 2.843e-20
Identity = 61/213 (28.64%), Postives = 99/213 (46.48%), Query Frame = 1
Query: 1531 LKKVNTKVSTLERFDCLSTSRCAAGLVNVNDQLIVIGGFNRGECLNSVEIYQPLINKWSPSLSMKLCRARLVALVGQSDKENPYVYAIGGSDGYKELHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGNLAIVGGCFGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTM 2169
            ++  N +  T  R   +++ R A G V ++ Q+ V GG++    LNSVE Y P  +KW+    M   R+     V +       +Y  GG DG +   +VE ++ +   W   A++  +R  HG       AS    + + GG  G   L   E+Y +  D+W  +  M T RS+ ++ +   +L+ VGG D    LSS E+ D    +W  M
Sbjct:  358 VEAYNPETDTWTRVGSMNSKRSAMGTVVLDGQIYVCGGYDGNSSLNSVETYSPETDKWTVVTPMSSNRSAAGVTVFEGR-----IYVSGGHDGLQIFSSVEHYNHHTATWHPAASMLNKRCRHG------AASLGSKMFVCGGYDGSGFLSIAEMYSSVADQWCLIVPMHTRRSRVSLVASCGRLYAVGGYDGQSNLSSVEMYDPETDRWTFM 559          

HSP 4 Score: 77.7962 bits (190), Expect = 3.616e-14
Identity = 50/194 (25.77%), Postives = 98/194 (50.52%), Query Frame = 1
Query:   73 SELLNR----LNKLRISKAFCDVTVFAENKEFVAHKVILASSSDYFLSKFTED-PKCDRLSI---NMNKDIFNLLLDYFYTSNLIVSKEKVPQLFSAAKYLKVRRVVKVCAQFLTKILSLDNIIDVRESVALNDSEDLCQAANAFIKENMDKIISNVKIQKLNMDIMVDTVPKKE----NDSRLAELVIDWLEY 618
            SEL +R    + ++R     CDVT+   + +F AH+++LA+S  YF + FT D  +C +  I    M+      L+++ Y  NL + ++ V  L   A +L+++ +   C  FL + L   N + VR+         L  AAN+FI ++  ++  + +   L ++ +++ V + E    ++ ++ E  + W+ Y
Sbjct:   18 SELPSRGYGVMEEIRRQGKLCDVTLKIGDHKFSAHRIVLAASIPYFHAMFTNDMMECKQDEIVMQGMDPSALEALINFAYNGNLAIDQQNVQSLLMGASFLQLQSIKDACCTFLRERLHPKNCLGVRQFAETMMCAVLYDAANSFIHQHFVEVSLSEEFLALPLEDVLELVSRDELNVKSEEQVFEAALAWVRY 211          
BLAST of BTB domain-containing protein vs. Ensembl Mouse
Match: Klhl20 (kelch-like 20 [Source:MGI Symbol;Acc:MGI:2444855])

HSP 1 Score: 142.51 bits (358), Expect = 1.003e-34
Identity = 90/264 (34.09%), Postives = 134/264 (50.76%), Query Frame = 1
Query: 1552 VSTLERFD----------CLSTSRCAAGLVNVNDQLIVIGGFNRGECLNSVEIYQPLINKWSPSLS-MKLCRARL-VALVGQSDKENPYVYAIGGSDGYKELHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGNLAIVGGCFGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPEPSYSRRGASLVPYNGKLYLFGGSDSNSSLRTLEIFDSVANQWSL 2307
            +S++ER+D           +S  RC  G+  ++D L  +GG +    LNSVE Y P  N+WS  ++    CR  + VA++G       ++YA+GG DG   L+ VER+D    +WTRVA+++  R   G AV  +G    G L  VGG  G + L + E Y+   ++W  +  M T R     A   + ++ VGG D    LSS E  + R  +W  +   +  R G  L   NG+L   GG D  + L+T+E+FD  AN W L
Sbjct:  327 ISSVERYDPQTNEWRMVASMSKRRCGVGVSVLDDLLYAVGGHDGSSYLNSVERYDPKTNQWSSDVAPTSTCRTSVGVAVLGG------FLYAVGGQDGVSCLNIVERYDPKENKWTRVASMSTRRL--GVAVAVLG----GFLYAVGGSDGTSPLNTVERYNPQENRWHTIAPMGTRRKHLGCAVYQDMIYAVGGRDDTTELSSAERYNPRTNQWSPVVAMTSRRSGVGLAVVNGQLMAVGGFDGTTYLKTIEVFDPDANTWRL 578          

HSP 2 Score: 140.584 bits (353), Expect = 3.649e-34
Identity = 93/290 (32.07%), Postives = 144/290 (49.66%), Query Frame = 1
Query: 1609 VNVNDQLIVIGGFNRGECLNSVEIYQPLINKWS--PSLSMKLCRARLVALVGQSDKENPYVYAIGGSDGYKELHTVERFDVNNQRWTR-VANINQERSYHGGAVMPVGASSAGNLAIVGGCFGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPEPSYSRRGASLVPYNGKLYLFGGSDSNSSLRTLEIFDSVANQWSLSVQQMKQSRANLCGGVLLNKLMAIGGFTGKHFLDTMECVDFDESCEISSEWSMY 2469
            +   + L  +GG+  G+ ++SVE Y P  N+W    S+S + C   +  L       +  +YA+GG DG   L++VER+D    +W+  VA  +  R+  G AV+       G L  VGG  G + L   E YD   +KW+ + SMST R   AVA +   L+ VGG+D    L++ E  + +E +W T+      R+      Y   +Y  GG D  + L + E ++   NQWS  V  M   R+ +   V+  +LMA+GGF G  +L T+E  D D     ++ W +Y
Sbjct:  309 IRCGEVLFAVGGWCSGDAISSVERYDPQTNEWRMVASMSKRRCGVGVSVL-------DDLLYAVGGHDGSSYLNSVERYDPKTNQWSSDVAPTSTCRTSVGVAVL------GGFLYAVGGQDGVSCLNIVERYDPKENKWTRVASMSTRRLGVAVAVLGGFLYAVGGSDGTSPLNTVERYNPQENRWHTIAPMGTRRKHLGCAVYQDMIYAVGGRDDTTELSSAERYNPRTNQWS-PVVAMTSRRSGVGLAVVNGQLMAVGGFDGTTYLKTIEVFDPD-----ANTWRLY 579          

HSP 3 Score: 107.842 bits (268), Expect = 1.582e-23
Identity = 70/209 (33.49%), Postives = 102/209 (48.80%), Query Frame = 1
Query: 1582 STSRCAAGLVNVNDQLIVIGGFNRGECLNSVEIYQPLINKWSPSLSMKLCRARL-VALVGQSDKENPYVYAIGGSDGYKELHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGNLAIVGGCFGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPEPSYSRRGASL 2205
            ST R + G+  +   L  +GG +   CLN VE Y P  NKW+   SM   R  + VA++G       ++YA+GGSDG   L+TVER++    RW  +A +   R + G AV          +  VGG      L S E Y+   ++WS + +M++ RS   +A ++ QL  VGG D    L + EV D     WR     +Y R G  +
Sbjct:  395 STCRTSVGVAVLGGFLYAVGGQDGVSCLNIVERYDPKENKWTRVASMSTRRLGVAVAVLGG------FLYAVGGSDGTSPLNTVERYNPQENRWHTIAPMGTRRKHLGCAVY------QDMIYAVGGRDDTTELSSAERYNPRTNQWSPVVAMTSRRSGVGLAVVNGQLMAVGGFDGTTYLKTIEVFDPDANTWRLYGGMNYRRLGGGV 591          

HSP 4 Score: 97.8265 bits (242), Expect = 2.035e-20
Identity = 69/280 (24.64%), Postives = 131/280 (46.79%), Query Frame = 1
Query:   25 IPKSNKLSLIDDRSRHSELLNRLNKLRISKAFCDVTVFAENKEFVAHKVILASSSDYFLSKFTEDPKCDRLSINMNKDI----FNLLLDYFYTSNLIVSKEKVPQLFSAAKYLKVRRVVKVCAQFLTKILSLDNIIDVRESVALNDSEDLCQAANAFIKENMDKIISNVKIQKLNMDIMVDTVPKKENDSRLAE----LVIDWLEYSIVEDNMKLSDFVNENLVFFLTPS--NSLVQCSEMASSNKFSSTFINDYFNGFLSYQ-KNISKRVKCRPRSKER 831
            +P+  ++  I D+    + L  +N LR  +  CDV +    K+  AH+VIL++ S YF + FT +    R +  + +DI      LL+D+ YTS + V +  V  L  AA  L++  + + C +FL + L   N + +R     +   +L + A+ F + N  +++ + +   L  + ++D +   E + R  E     V+ W++YSI E   +L   +    +  L+P      V    +  S++     +++  N  L  Q + + +  + RPR   R
Sbjct:   32 VPQPARMPYISDK-HPRQTLEVINLLRKHRELCDVVLVVGAKKIYAHRVILSACSPYFRAMFTGELAESRQTEVVIRDIDERAMELLIDFAYTSQITVEEGNVQTLLPAACLLQLAEIQEACCEFLKRQLDPSNCLGIRAFADTHSCRELLRIADKFTQHNFQEVMESEEFMLLPANQLIDIISSDELNVRSEEQVFNAVMAWVKYSIQERRPQLPQVLQHVRLPLLSPKFLVGTVGSDPLIKSDEECRDLVDEAKNYLLLPQERPLMQGPRTRPRKPIR 310          

HSP 5 Score: 80.4925 bits (197), Expect = 6.202e-15
Identity = 57/181 (31.49%), Postives = 83/181 (45.86%), Query Frame = 1
Query: 1942 LAIVGGCFGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPEP-SYSRRGASLVPYNGKLYLFGGSDSNSSLRTLEIFDSVANQWSLSVQQMKQSRANLCGGVLLNKLMAIGGFTGKHFLDTMECVDFDESCEISSEWSMYVPIG 2481
             A+ G C G + + S E YD   ++W  + SMS  R    V+ +D+ L+ VGG D    L+S E  D +  +W +   P S  R    +    G LY  GG D  S L  +E +D   N+W+  V  M   R  +   VL   L A+GG  G   L+T+E  +  E     + W    P+G
Sbjct:  316 FAVGGWCSG-DAISSVERYDPQTNEWRMVASMSKRRCGVGVSVLDDLLYAVGGHDGSSYLNSVERYDPKTNQWSSDVAPTSTCRTSVGVAVLGGFLYAVGGQDGVSCLNIVERYDPKENKWT-RVASMSTRRLGVAVAVLGGFLYAVGGSDGTSPLNTVERYNPQE-----NRWHTIAPMG 489          

HSP 6 Score: 74.3294 bits (181), Expect = 4.486e-13
Identity = 51/182 (28.02%), Postives = 79/182 (43.41%), Query Frame = 1
Query: 1528 LLKKVNTKVSTLERFDCLSTSRCAAGLVNVNDQLIVIGGFNRGECLNSVEIYQPLINKWSPSLSMKLCRARLVALVGQSDKENPYVYAIGGSDGYKELHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGNLAIVGGCFGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASI 2073
            ++++ + K +   R   +ST R    +  +   L  +GG +    LN+VE Y P  N+W     M   R  L   V Q       +YA+GG D   EL + ER++    +W+ V  +   RS  G AV+       G L  VGG  G   L++ E++D   + W     M+  R    V  I
Sbjct:  424 IVERYDPKENKWTRVASMSTRRLGVAVAVLGGFLYAVGGSDGTSPLNTVERYNPQENRWHTIAPMGTRRKHLGCAVYQD-----MIYAVGGRDDTTELSSAERYNPRTNQWSPVVAMTSRRSGVGLAVV------NGQLMAVGGFDGTTYLKTIEVFDPDANTWRLYGGMNYRRLGGGVGVI 594          
BLAST of BTB domain-containing protein vs. UniProt/SwissProt
Match: sp|Q5RG82|NS1BA_DANRE (Influenza virus NS1A-binding protein homolog A OS=Danio rerio OX=7955 GN=ivns1abpa PE=2 SV=1)

HSP 1 Score: 177.563 bits (449), Expect = 3.036e-45
Identity = 102/301 (33.89%), Postives = 160/301 (53.16%), Query Frame = 1
Query: 1579 LSTSRCAAGLVNVNDQLIVIGGFNRGECLNSVEIYQPLINKWSPSLSMKLCRAR--LVALVGQSDKENPYVYAIGGSDGYK-ELHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGN-LAIVGGC--FGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPEPSYSRRGASLVPYNGKLYLFGGSDSNSSLRTLEIFDSVANQWSLSVQQMKQSRANLCGGVLLNKLMAIGGFTGKHFLDTMECVDFDESCEISSEWS 2463
            +  +R   G+ ++NDQLI  GG+NR ECL +VE Y    N W+    M+  RAR  +  L+GQ       +Y +GGS+G+  EL   E ++ N   WT+V  +   R          G  S  N L +VGG    G   L++C+++D     W++   ++  R QAAV  +D  ++V+GG +SW CL+S E  +     W  +   + +RRGA +  Y GKL++ GG D + +LR +E++D V N+W + +  M   R+N    VL + + AIGGF G  FL+++E  +       + EWS
Sbjct:  354 MHYARSGLGIASLNDQLIAAGGYNREECLRTVECYNIKTNSWTFIAPMRTPRARFQMAVLMGQ-------LYVMGGSNGHSDELSCGETYNPNADEWTQVPELRTNRCN-------AGVCSLNNKLYVVGGSDPCGQKGLKNCDVFDPISKAWTNCAPLNIRRHQAAVCELDGFMYVIGGAESWNCLNSVERYNPENNTWTLIASMNIARRGAGVAVYEGKLFVVGGFDGSHALRCVEMYDPVRNEWRM-LGSMNSPRSNAGAAVLNDVIYAIGGFDGNDFLNSVEAYN-----PKTEEWS 634          

HSP 2 Score: 103.219 bits (256), Expect = 3.233e-21
Identity = 62/198 (31.31%), Postives = 110/198 (55.56%), Query Frame = 1
Query: 1579 LSTSRCAAGLVNVNDQLIVIGGFNR--GECLNSVEIYQPLINKWSPSLSMKLCRARLVALVGQSDKENPYVYAIGGSDGYKELHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGNLAIVGGCFGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRT 2166
            L T+RC AG+ ++N++L V+GG +    + L + +++ P+   W+    + + R +  A V + D    ++Y IGG++ +  L++VER++  N  WT +A++N  R   G AV        G L +VGG  G + LR  E+YD   ++W  L SM++ RS A  A +++ ++ +GG D    L+S E  + +  +W T
Sbjct:  449 LRTNRCNAGVCSLNNKLYVVGGSDPCGQKGLKNCDVFDPISKAWTNCAPLNIRRHQ--AAVCELDG---FMYVIGGAESWNCLNSVERYNPENNTWTLIASMNIARRGAGVAVY------EGKLFVVGGFDGSHALRCVEMYDPVRNEWRMLGSMNSPRSNAGAAVLNDVIYAIGGFDGNDFLNSVEAYNPKTEEWST 635          

HSP 3 Score: 90.1225 bits (222), Expect = 3.927e-17
Identity = 57/232 (24.57%), Postives = 114/232 (49.14%), Query Frame = 1
Query:   37 NKLSLIDDRSRHSELLNRLNKLRISKAFCDVTVFAENKEFVAHKVILASSSDYFLSKFTEDPKCDRLSI----NMNKDIFNLLLDYFYTSNLIVSKEKVPQLFSAAKYLKVRRVVKVCAQFLTKILSLDNIIDVRESVALNDSEDLCQAANAFIKENMDKIISN---VKIQKLNMDIMVDTVPKKENDSRLAELVIDWLEYSIVEDNMKLSDFVNENLVFFLTPSNSLVQCS 711
            N   + +D S     + ++N LR +  FCDV +     E +AH+ +LA  S Y    F  D +   +S     +++ +   +LL+Y YT+ L   KE V +++SAAK LK+ RV ++C  +L   +   + I  R   +      L    +++I+E++ ++      +K+ +L +++M++      ++ +L   VI W++ S+ E+   L   + E    + +  + L+  S
Sbjct:    4 NGYLIFEDESFLDSTVAKMNALRKNGQFCDVRLQVCGHELMAHRAVLACCSPYLFEIFNSDLEPHGISHVKFEDLDPEAVEILLNYAYTAQLKADKELVKEVYSAAKRLKMDRVKQICGDYLLSKMDSQSAISYRNFASCMGDGRLLGKIDSYIQEHLLEVSEQEDFLKLPRLKLEVMLEDNLTLPSNGKLYSKVIGWVQRSLWENGEPLERLMEEVQTLYYSADHKLLDGS 235          

HSP 4 Score: 61.6178 bits (148), Expect = 3.029e-8
Identity = 42/152 (27.63%), Postives = 71/152 (46.71%), Query Frame = 1
Query: 2026 LKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPEPSYSRRGASLVPYNGKLYLFGGSDSNS-SLRTLEIFDSVANQWSLSVQQMKQSRANLCGGVLLNKLMAIGGFTGKHFLDTMECVDFDESCEISSEWSMYVPI 2478
            L  M  +RS   +AS+++QL   GG +  +CL + E  +++   W  +      R    +    G+LY+ GGS+ +S  L   E ++  A++W+  V +++ +R N     L NKL  +GG           C  FD    IS  W+   P+
Sbjct:  351 LSPMHYARSGLGIASLNDQLIAAGGYNREECLRTVECYNIKTNSWTFIAPMRTPRARFQMAVLMGQLYVMGGSNGHSDELSCGETYNPNADEWT-QVPELRTNRCNAGVCSLNNKLYVVGGSDPCGQKGLKNCDVFD---PISKAWTNCAPL 498          

HSP 5 Score: 58.5362 bits (140), Expect = 2.325e-7
Identity = 35/115 (30.43%), Postives = 59/115 (51.30%), Query Frame = 1
Query: 1531 LKKVNTKVSTLERFDCLSTSRCAAGLVNVNDQLIVIGGFNRGECLNSVEIYQPLINKWSPSLSMKLCRARLVALVGQSDKENPYVYAIGGSDGYKELHTVERFDVNNQRWTRVAN 1875
            +++ N + +T      ++ +R  AG+     +L V+GGF+    L  VE+Y P+ N+W    SM   R+   A V      N  +YAIGG DG   L++VE ++   + W+  A+
Sbjct:  529 VERYNPENNTWTLIASMNIARRGAGVAVYEGKLFVVGGFDGSHALRCVEMYDPVRNEWRMLGSMNSPRSNAGAAV-----LNDVIYAIGGFDGNDFLNSVEAYNPKTEEWSTCAD 638          
BLAST of BTB domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9Y6Y0|NS1BP_HUMAN (Influenza virus NS1A-binding protein OS=Homo sapiens OX=9606 GN=IVNS1ABP PE=1 SV=3)

HSP 1 Score: 173.326 bits (438), Expect = 6.733e-44
Identity = 96/305 (31.48%), Postives = 156/305 (51.15%), Query Frame = 1
Query: 1579 LSTSRCAAGLVNVNDQLIVIGGFNRGECLNSVEIYQPLINKWSPSLSMKLCRAR--LVALVGQSDKENPYVYAIGGSDGYKE-LHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGNLAIVGGC--FGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPEPSYSRRGASLVPYNGKLYLFGGSDSNSSLRTLEIFDSVANQWSLSVQQMKQSRANLCGGVLLNKLMAIGGFTGKHFLDTMECVDFDESCEISSEWSMYVPI 2478
            +  +R   G   +N +LI  GG+NR ECL +VE Y P  + WS    M+  RAR  +  L+GQ       +Y +GGS+G+ + L   E +D N   W  V  +   R   G   +       G L IVGG   +G   L++C+++D     W+    ++  R Q+AV  +   L+++GG +SW CL++ E  +     W  +   + +RRGA +   NGKL++ GG D + ++  +E++D   N+W + +  M   R+N     + N + A+GGF G  FL+T+E  + +     S+EWS Y  I
Sbjct:  354 MQYARSGLGTAEMNGKLIAAGGYNREECLRTVECYNPHTDHWSFLAPMRTPRARFQMAVLMGQ-------LYVVGGSNGHSDDLSCGEMYDSNIDDWIPVPELRTNRCNAGVCAL------NGKLYIVGGSDPYGQKGLKNCDVFDPVTKLWTSCAPLNIRRHQSAVCELGGYLYIIGGAESWNCLNTVERYNPENNTWTLIAPMNVARRGAGVAVLNGKLFVCGGFDGSHAISCVEMYDPTRNEWKM-MGNMTSPRSNAGIATVGNTIYAVGGFDGNEFLNTVEVYNLE-----SNEWSPYTKI 639          

HSP 2 Score: 96.6709 bits (239), Expect = 3.695e-19
Identity = 62/229 (27.07%), Postives = 114/229 (49.78%), Query Frame = 1
Query:   37 NKLSLIDDRSRHSELLNRLNKLRISKAFCDVTVFAENKEFVAHKVILASSSDYFLSKFTEDPKCDRLSI----NMNKDIFNLLLDYFYTSNLIVSKEKVPQLFSAAKYLKVRRVVKVCAQFLTKILSLDNIIDVRESVALNDSEDLCQAANAFIKENMDKIISN---VKIQKLNMDIMVDTVPKKENDSRLAELVIDWLEYSIVEDNMKLSDFVNENLVFFLTPSNSLV 702
            N   + +D +     + +LN LR S  FCDV +     E +AH+ +LA  S Y    F  D     +S     ++N +   +LL+Y YT+ L   KE V  ++SAAK LK+ RV +VC  +L   + + + I  R   +      L    +A+I+E++ +I      +K+ +L +++M++      ++ +L   VI+W++ SI E+   L + + E    + +  + L+
Sbjct:    4 NGYLMFEDENFIESSVAKLNALRKSGQFCDVRLQVCGHEMLAHRAVLACCSPYLFEIFNSDSDPHGISHVKFDDLNPEAVEVLLNYAYTAQLKADKELVKDVYSAAKKLKMDRVKQVCGDYLLSRMDVTSCISYRNFASCMGDSRLLNKVDAYIQEHLLQISEEEEFLKLPRLKLEVMLEDNVCLPSNGKLYTKVINWVQRSIWENGDSLEELMEEVQTLYYSADHKLL 232          

HSP 3 Score: 60.077 bits (144), Expect = 8.905e-8
Identity = 35/119 (29.41%), Postives = 64/119 (53.78%), Query Frame = 1
Query: 1531 LKKVNTKVSTLERFDCLSTSRCAAGLVNVNDQLIVIGGFNRGECLNSVEIYQPLINKWSPSLSMKLCRARL-VALVGQSDKENPYVYAIGGSDGYKELHTVERFDVNNQRWTRVANINQ 1884
            +++ N + +T      ++ +R  AG+  +N +L V GGF+    ++ VE+Y P  N+W    +M   R+   +A VG +      +YA+GG DG + L+TVE +++ +  W+    I Q
Sbjct:  529 VERYNPENNTWTLIAPMNVARRGAGVAVLNGKLFVCGGFDGSHAISCVEMYDPTRNEWKMMGNMTSPRSNAGIATVGNT------IYAVGGFDGNEFLNTVEVYNLESNEWSPYTKIFQ 641          
BLAST of BTB domain-containing protein vs. UniProt/SwissProt
Match: sp|Q920Q8|NS1BP_MOUSE (Influenza virus NS1A-binding protein homolog OS=Mus musculus OX=10090 GN=Ivns1abp PE=1 SV=2)

HSP 1 Score: 171.4 bits (433), Expect = 3.680e-43
Identity = 96/305 (31.48%), Postives = 156/305 (51.15%), Query Frame = 1
Query: 1579 LSTSRCAAGLVNVNDQLIVIGGFNRGECLNSVEIYQPLINKWSPSLSMKLCRAR--LVALVGQSDKENPYVYAIGGSDGYKE-LHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGNLAIVGGC--FGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPEPSYSRRGASLVPYNGKLYLFGGSDSNSSLRTLEIFDSVANQWSLSVQQMKQSRANLCGGVLLNKLMAIGGFTGKHFLDTMECVDFDESCEISSEWSMYVPI 2478
            +  +R   G   +N +LI  GG+NR ECL +VE Y P  + WS    M+  RAR  +  L+GQ       +Y +GGS+G+ + L   E +D N   WT V  +   R   G   +       G L IVGG   +G   L++C+++D     W+    ++  R Q+AV  +   L+++GG +SW CL++ E  +     W  +   + +RRGA +   +GKL++ GG D + ++  +E++D   N+W + +  M   R+N     + N + A+GGF G  FL+T+E  +       S+EWS Y  I
Sbjct:  354 MQYARSGLGTAEMNGKLIAAGGYNREECLRTVECYDPHTDHWSFLAPMRTPRARFQMAVLMGQ-------LYVVGGSNGHSDDLSCGEMYDPNIDDWTPVPELRTNRCNAGVCAL------NGKLYIVGGSDPYGQKGLKNCDVFDPVTKSWTSCAPLNIRRHQSAVCELGGYLYIIGGAESWNCLNTVERYNPENNTWTLIAPMNVARRGAGVAVLDGKLFVGGGFDGSHAISCVEMYDPTRNEWKM-MGNMTSPRSNAGITTVGNTIYAVGGFDGNEFLNTVEVYN-----PQSNEWSPYTKI 639          

HSP 2 Score: 96.6709 bits (239), Expect = 3.477e-19
Identity = 60/212 (28.30%), Postives = 108/212 (50.94%), Query Frame = 1
Query:   88 RLNKLRISKAFCDVTVFAENKEFVAHKVILASSSDYFLSKFTEDPKCDRLSI----NMNKDIFNLLLDYFYTSNLIVSKEKVPQLFSAAKYLKVRRVVKVCAQFLTKILSLDNIIDVRESVALNDSEDLCQAANAFIKENMDKIISN---VKIQKLNMDIMVDTVPKKENDSRLAELVIDWLEYSIVEDNMKLSDFVNENLVFFLTPSNSLV 702
            +LN LR S  FCDV +     E +AH+ +LA  S Y    F  D     +S     ++N +   +LL+Y YT+ L   KE V  ++SAAK LK+ RV +VC  +L   + + + I  R   +      L    +A+I+E++ +I      +K+ +L +++M++      ++ +L   VI+W++ SI E+   L + + E    + +  + L+
Sbjct:   21 KLNALRKSGQFCDVRLQVCGHEMLAHRAVLACCSPYLFEIFNSDSDPHGVSHVKLDDLNPEAVEVLLNYAYTAQLKADKELVKDVYSAAKKLKMDRVKQVCGDYLLSRMDVTSCISYRNFASCMGDSRLLNKVDAYIQEHLLQISEEEEFLKLPRLKLEVMLEDNVCLPSNGKLYTKVINWVQRSIWENGDSLEELMEEVQTLYYSADHKLL 232          

HSP 3 Score: 55.0694 bits (131), Expect = 3.298e-6
Identity = 33/119 (27.73%), Postives = 62/119 (52.10%), Query Frame = 1
Query: 1531 LKKVNTKVSTLERFDCLSTSRCAAGLVNVNDQLIVIGGFNRGECLNSVEIYQPLINKWSPSLSMKLCRARL-VALVGQSDKENPYVYAIGGSDGYKELHTVERFDVNNQRWTRVANINQ 1884
            +++ N + +T      ++ +R  AG+  ++ +L V GGF+    ++ VE+Y P  N+W    +M   R+   +  VG +      +YA+GG DG + L+TVE ++  +  W+    I Q
Sbjct:  529 VERYNPENNTWTLIAPMNVARRGAGVAVLDGKLFVGGGFDGSHAISCVEMYDPTRNEWKMMGNMTSPRSNAGITTVGNT------IYAVGGFDGNEFLNTVEVYNPQSNEWSPYTKIFQ 641          
BLAST of BTB domain-containing protein vs. UniProt/SwissProt
Match: sp|Q7ZVQ8|NS1BB_DANRE (Influenza virus NS1A-binding protein homolog B OS=Danio rerio OX=7955 GN=ivns1abpb PE=2 SV=1)

HSP 1 Score: 167.548 bits (423), Expect = 6.800e-42
Identity = 96/303 (31.68%), Postives = 156/303 (51.49%), Query Frame = 1
Query: 1579 LSTSRCAAGLVNVNDQLIVIGGFNRGECLNSVEIYQPLINKWSPSLSMKLCRAR--LVALVGQSDKENPYVYAIGGSDGYK-ELHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGNLAIVGGC--FGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPEPSYSRRGASLVPYNGKLYLFGGSDSNSSLRTLEIFDSVANQWSLSVQQMKQSRANLCGGVLLNKLMAIGGFTGKHFLDTMECVDFDESCEISSEWSMYV 2472
            +  +R   G   ++ +LI  GG+NR ECL +VE Y P  + W+    M+  RAR  +  L+G+       VY +GGS+G+  EL   E ++     W +V  +   R   G        S    L +VGG    G   L++C+ +D     W+    ++  R QAAV  +   ++V+GG +SW CL+S E  +     W  +   + +RRGA +  Y GKL++ GG D + +LR +E++D   N+W + +  M  +R+N    VL N L A+GGF G  FL++ME  + ++     +EWS ++
Sbjct:  351 MHYARSGLGTAELDCKLIAAGGYNREECLRTVECYDPKKDCWTFIAPMRTPRARFQMAVLMGE-------VYVMGGSNGHSDELSCGEMYNPRADEWIQVPELRTNRCNAGVC------SLQNKLFVVGGSDPCGQKGLKNCDSFDPVTKMWTSCAPLNIKRHQAAVCELSGYMYVIGGAESWNCLNSVERYNPENNTWTLVASMNVARRGAGVAVYEGKLFVVGGFDGSHALRCVEVYDPATNEWRM-LGSMTSARSNAGLAVLNNVLCAVGGFDGNEFLNSMEVYNLEK-----NEWSPFI 634          

HSP 2 Score: 91.2781 bits (225), Expect = 1.836e-17
Identity = 61/244 (25.00%), Postives = 114/244 (46.72%), Query Frame = 1
Query:   37 NKLSLIDDRSRHSELLNRLNKLRISKAFCDVTVFAENKEFVAHKVILASSSDYFLSKFTED--PKCDRLSI---NMNKDIFNLLLDYFYTSNLIVSKEKVPQLFSAAKYLKVRRVVKVCAQFLTKILSLDNIIDVRESVALNDSEDLCQAANAFIKENMDKIISN---VKIQKLNMDIMVDTVPKKENDSRLAELVIDWLEYSIVEDNMKLSDFVNENLVFFLTPSNSLVQCSEMASSNKFSST 744
            N   + +D S     + ++N LR S  FCDV +     E +AHK +LA  S Y    F  D  P+     +   ++N D   +LL+Y YT+ L   K  V  ++SAAK LK+ RV ++C ++L   +   + I  R   +      L    + +I++++ +I      +K+ +L +++M++       + +L   VI W++ S+ ++   L   + E    + +  + L   S +    +  ST
Sbjct:    4 NGYLIFEDESFLDSTVAKMNALRKSGQFCDVRLLVCGHELMAHKAVLACCSPYLFEIFNADTEPQGGVSLVKFDDLNPDAMEVLLNYAYTAQLKADKSLVSDVYSAAKKLKLERVKQICGEYLLSKMDSQSAISYRNFASSMADGRLLGKIDGYIQDHLHEISEQDDFLKLPRLKLEVMLEDNLNLPGNGKLYSKVISWVQRSLWKNGDPLEKLMEEVQTLYYSADHKLHDGSLLEGQAEVCST 247          

HSP 3 Score: 59.3066 bits (142), Expect = 1.733e-7
Identity = 40/152 (26.32%), Postives = 70/152 (46.05%), Query Frame = 1
Query: 2026 LKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPEPSYSRRGASLVPYNGKLYLFGGSDSNS-SLRTLEIFDSVANQWSLSVQQMKQSRANLCGGVLLNKLMAIGGFTGKHFLDTMECVDFDESCEISSEWSMYVPI 2478
            LK M  +RS    A +D +L   GG +  +CL + E  D ++  W  +      R    +    G++Y+ GGS+ +S  L   E+++  A++W + V +++ +R N     L NKL  +GG           C  FD    ++  W+   P+
Sbjct:  348 LKPMHYARSGLGTAELDCKLIAAGGYNREECLRTVECYDPKKDCWTFIAPMRTPRARFQMAVLMGEVYVMGGSNGHSDELSCGEMYNPRADEW-IQVPELRTNRCNAGVCSLQNKLFVVGGSDPCGQKGLKNCDSFD---PVTKMWTSCAPL 495          
BLAST of BTB domain-containing protein vs. UniProt/SwissProt
Match: sp|Q6DFU2|NS1BP_XENLA (Influenza virus NS1A-binding protein homolog OS=Xenopus laevis OX=8355 GN=ivns1abp PE=2 SV=1)

HSP 1 Score: 159.844 bits (403), Expect = 2.199e-39
Identity = 94/311 (30.23%), Postives = 158/311 (50.80%), Query Frame = 1
Query: 1558 TLER-FDCLSTSRCAAGLVNVNDQLIVIGGFNRGECLNSVEIYQPLINKWSPSLSMKLCRARLVALVGQSDKENPYVYAIGGSDGYKE-LHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGNLAIVGGC--FGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPEPSYSRRGASLVPYNGKLYLFGGSDSNSSLRTLEIFDSVANQWSLSVQQMKQSRANLCGGVLLNKLMAIGGFTGKHFLDTMECVDFDESCEISSEWSMYVPI 2478
            +LER    +  +R   G   +N +LI  GG+NR ECL +VE Y    + W+    MK  RAR    V        ++Y +GGS+G+ + L   E++D  +  WT V  +   R   G   +       GNL +VGG   +G   L++C++++     W+    ++  R Q AV  + N+++++GG +SW CL+S E  + +   W  +   + +RRG+ +  Y+GKL + GG D   +L  +E ++   N+W + V  M  SR+N     + N++ A GGF G  FL+T+E  +       + EWS +  +
Sbjct:  342 SLERVMSPMHYARSGLGTAELNGKLIAAGGYNREECLRTVECYDLETDIWTFIAPMKTPRARFQMAVLMD-----HLYVVGGSNGHSDDLSCGEKYDPKSNIWTPVPELRSNRCNAGVCAL------NGNLYVVGGSDPYGQKGLKNCDVFNPITRMWTCCAQLNIRRHQPAVCELGNKIYIIGGAESWNCLNSVECYNPQNDTWTLVAPMNVARRGSGVAVYDGKLLVVGGFDGTHALCCVESYNPERNEWKM-VGSMTSSRSNAGVVAVGNQIYAAGGFDGNEFLNTVEVYNPQ-----TDEWSPFTQL 635          

HSP 2 Score: 96.2857 bits (238), Expect = 5.083e-19
Identity = 61/218 (27.98%), Postives = 110/218 (50.46%), Query Frame = 1
Query:   88 RLNKLRISKAFCDVTVFAENKEFVAHKVILASSSDYFLSKFTEDPKCDRLSI----NMNKDIFNLLLDYFYTSNLIVSKEKVPQLFSAAKYLKVRRVVKVCAQFLTKILSLDNIIDVRESVALNDSEDLCQAANAFIKENMDKIISN---VKIQKLNMDIMVDTVPKKENDSRLAELVIDWLEYSIVEDNMKLSDFVNENLVFFLTPSNSLVQCSEMA 720
            +LN LR S  FCDV +     E +AH+ +LA  S +    F  D + + +S+    ++N +   +LL+Y YTS L    + V  ++SAAK LK+ RV +VC  +L   +   + I  R  V       L    + +I+E++ +I      +K+ +LN++IM++      ++ +L   VI+W++ SI E+   L   + E    + +  + L+  S + 
Sbjct:   21 KLNALRKSGQFCDVKLQVCGHEMLAHRAVLACCSPFLFEIFNSDSESNGISLVRFDDLNPEAVEVLLNYAYTSQLKAETDLVKDVYSAAKKLKIDRVKQVCGDYLISKIDAQSGISCRNFVNTMGDWRLLTKIDNYIQEHLLEISEQDDFLKLPRLNLEIMLEENVSLPSNGKLYTKVINWVQRSIWENGENLDALMEEVQTLYYSADHKLLDGSSLG 238          

HSP 3 Score: 60.077 bits (144), Expect = 9.103e-8
Identity = 44/156 (28.21%), Postives = 69/156 (44.23%), Query Frame = 1
Query: 1579 LSTSRCAAGLVNVNDQLIVIGGFNRGECLNSVEIYQPLINKWSPSLSMKLCRARLVALVGQSDKENPYVYAIGGSDGYKELHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGNLAIVGGCFGPNNLRSCEIYDTTLDKWSDLKSMSTS 2046
            L+  R    +  + +++ +IGG     CLNSVE Y P  + W+    M +  AR  + V   D +   +  +GG DG   L  VE ++     W  V ++   RS  G  V+ VG      +   GG  G   L + E+Y+   D+WS    +  S
Sbjct:  494 LNIRRHQPAVCELGNKIYIIGGAESWNCLNSVECYNPQNDTWTLVAPMNV--ARRGSGVAVYDGK---LLVVGGFDGTHALCCVESYNPERNEWKMVGSMTSSRSNAG--VVAVG----NQIYAAGGFDGNEFLNTVEVYNPQTDEWSPFTQLCES 638          
BLAST of BTB domain-containing protein vs. TrEMBL
Match: A0A1S6KMH6 (BTB domain-containing protein OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 1598.56 bits (4138), Expect = 0.000e+0
Identity = 865/866 (99.88%), Postives = 866/866 (100.00%), Query Frame = 1
Query:   19 MDIPKSNKLSLIDDRSRHSELLNRLNKLRISKAFCDVTVFAENKEFVAHKVILASSSDYFLSKFTEDPKCDRLSINMNKDIFNLLLDYFYTSNLIVSKEKVPQLFSAAKYLKVRRVVKVCAQFLTKILSLDNIIDVRESVALNDSEDLCQAANAFIKENMDKIISNVKIQKLNMDIMVDTVPKKENDSRLAELVIDWLEYSIVEDNMKLSDFVNENLVFFLTPSNSLVQCSEMASSNKFSSTFINDYFNGFLSYQKNISKRVKCRPRSKERXXXXXXXXXXTKHQVIDNPDKLEKDVIMIQSDEPSPEEWKYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLENFVDGDLDSNIYDEVXXXXXXXXXXAKPEHESCVISVNSTEIIENEIIRLKIKFLAKIDGKVACVSLHVKSVLEIINQGFQDSENSTDMALLYGQHKPXXXXXXXXXXXXXXXXXXXXXXXXXXHVDMICNMDDTFTKHEGPFTDSKSDDQSTVLQQLLKKVNTKVSTLERFDCLSTSRCAAGLVNVNDQLIVIGGFNRGECLNSVEIYQPLINKWSPSLSMKLCRARLVALVGQSDKENPYVYAIGGSDGYKELHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGNLAIVGGCFGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPEPSYSRRGASLVPYNGKLYLFGGSDSNSSLRTLEIFDSVANQWSLSVQQMKQSRANLCGGVLLNKLMAIGGFTGKHFLDTMECVDFDESCEISSEWSMYVPIGWSVNGHSFIENDAGDFNLDSQNTITSGTNNELLKQARLLDALEIQ 2616
            MDIPKSNKLSLIDDRSRHSELLNRLNKLRISKAFCDVTVFAENKEFVAHKVILASSSDYFLSKFTEDPKCDRLSINMNKDIFNLLLDYFYTSNLIVSKEKVPQLFSAAKYLKVRRVVKVCAQFLTKILSLDNIIDVRESVALNDSEDLCQAANAFIKENMDKIISNVKIQKLNMDIMVDTVPKKENDSRLAELVIDWLEYSIVEDNMKLSDFVNENLVFFLTPSNSLVQCSEMASSNKFSSTFINDYFNGFLSYQKNISKRVKCRPRSKERPSKNSNNPNKTKHQVIDNPDKLEKDVIMIQSDEPSPEEWKYKDDNKKLDESLSKKSDGSSRNSRFSSFDGNNDLENFVDGDLDSNIYDEVISTSIKSKTSAKPEHESCVISVNSTEI+ENEIIRLKIKFLAKIDGKVACVSLHVKSVLEIINQGFQDSENSTDMALLYGQHKPSRSTTYGSESTSGLSSSSVSAASSLLHVDMICNMDDTFTKHEGPFTDSKSDDQSTVLQQLLKKVNTKVSTLERFDCLSTSRCAAGLVNVNDQLIVIGGFNRGECLNSVEIYQPLINKWSPSLSMKLCRARLVALVGQSDKENPYVYAIGGSDGYKELHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGNLAIVGGCFGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPEPSYSRRGASLVPYNGKLYLFGGSDSNSSLRTLEIFDSVANQWSLSVQQMKQSRANLCGGVLLNKLMAIGGFTGKHFLDTMECVDFDESCEISSEWSMYVPIGWSVNGHSFIENDAGDFNLDSQNTITSGTNNELLKQARLLDALEIQ
Sbjct:    1 MDIPKSNKLSLIDDRSRHSELLNRLNKLRISKAFCDVTVFAENKEFVAHKVILASSSDYFLSKFTEDPKCDRLSINMNKDIFNLLLDYFYTSNLIVSKEKVPQLFSAAKYLKVRRVVKVCAQFLTKILSLDNIIDVRESVALNDSEDLCQAANAFIKENMDKIISNVKIQKLNMDIMVDTVPKKENDSRLAELVIDWLEYSIVEDNMKLSDFVNENLVFFLTPSNSLVQCSEMASSNKFSSTFINDYFNGFLSYQKNISKRVKCRPRSKERPSKNSNNPNKTKHQVIDNPDKLEKDVIMIQSDEPSPEEWKYKDDNKKLDESLSKKSDGSSRNSRFSSFDGNNDLENFVDGDLDSNIYDEVISTSIKSKTSAKPEHESCVISVNSTEIVENEIIRLKIKFLAKIDGKVACVSLHVKSVLEIINQGFQDSENSTDMALLYGQHKPSRSTTYGSESTSGLSSSSVSAASSLLHVDMICNMDDTFTKHEGPFTDSKSDDQSTVLQQLLKKVNTKVSTLERFDCLSTSRCAAGLVNVNDQLIVIGGFNRGECLNSVEIYQPLINKWSPSLSMKLCRARLVALVGQSDKENPYVYAIGGSDGYKELHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGNLAIVGGCFGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPEPSYSRRGASLVPYNGKLYLFGGSDSNSSLRTLEIFDSVANQWSLSVQQMKQSRANLCGGVLLNKLMAIGGFTGKHFLDTMECVDFDESCEISSEWSMYVPIGWSVNGHSFIENDAGDFNLDSQNTITSGTNNELLKQARLLDALEIQ 866          
BLAST of BTB domain-containing protein vs. TrEMBL
Match: V4CLR0 (BTB domain-containing protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_237773 PE=4 SV=1)

HSP 1 Score: 233.417 bits (594), Expect = 1.848e-61
Identity = 126/304 (41.45%), Postives = 176/304 (57.89%), Query Frame = 1
Query: 1570 FDCLSTSRCAAGLVNVNDQLIVIGGFNRGECLNSVEIYQPLINKWSPSLSMKLCRARL-VALVGQSDKENPYVYAIGGSDGYKELHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGNLAIVGGCFGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPEPSYSRRGASLVPYNGKLYLFGGSDSNSSLRTLEIFDSVANQWSLSVQQMKQSRANLCGGVLLNKLMAIGGFTGKHFLDTMECVDFDESCEISSEWSMYVPI 2478
             + +ST RC  GL +VN +LI  GG++RGECL S E +    N W+    MK  R R   A VG +      ++A GGSDGY EL TVE +DV    W+ VA + + RS  G AV+         L  +GGC G N++  CE+YD   D WS + S++T+R QA+V + + +L+V+GGTD W CL+S EV D    +WR +   +  RRGA +  + GKLY+ GG+D   SL++ EIFD V NQ  +    +   R+N+   VL  +L A+GGF GK FLDTME +D       ++EW+ Y P 
Sbjct:  371 LNTMSTPRCGFGLRSVNGKLIACGGYDRGECLKSTECFNLESNTWTMLADMKTTRGRFSAARVGDT------IFACGGSDGYHELRTVEVYDVEKDVWSFVAPMIKHRSSPGVAVL------GDQLFCIGGCMGQNSVAECEVYDAKTDSWSFIASLNTARYQASVRAYNGKLYVMGGTDGWNCLNSVEVYDPAINEWRYLESLNVCRRGAGVECFQGKLYVIGGNDGTHSLKSTEIFD-VENQKWIFGPVLVSPRSNIGSAVLDGRLFAVGGFNGKKFLDTMEYLD------DANEWTFYTPF 655          

HSP 2 Score: 91.2781 bits (225), Expect = 5.966e-15
Identity = 68/240 (28.33%), Postives = 111/240 (46.25%), Query Frame = 1
Query:   70 HSELLNRLNKLRISKAFCDVTVFAENKEFVAHKVILASSSDYFLSKFT--EDPKCDRLSINMNK---DIFNLLLDYFYTSNLIVSKEKVPQLFSAAKYLKVRRVVKVCAQFLTKILSLDNIIDVRESVALNDSEDLCQAANAFIKENMDKIISNVKIQKL-NMDIMV----DTVPKKENDSRLAELVIDWLEYSIVEDNMKLSDFVNENLVFFLTPSNSLVQCSEMASSNKFSSTFINDY 759
            HS +L+ LN LR  + FCDVT+  E  +  AHK IL + S +    FT  E+    R S  + +     F  LLDY YT  +++  E V  ++  A+ LK+  V   C  +L   L+  N + +R   +    E++    + +IK +++K+I +     L N+ I +    + V   E  S L +LV+ W + ++     KL     +  + +LT  N+L  C E           I DY
Sbjct:   22 HSNVLSTLNSLRQGQKFCDVTLVVERHDVPAHKCILVACSPFLFDLFTIDEENGVTRSSCKLREVSHKGFQYLLDYMYTGRILIRSEDVKLVYVTARKLKMDEVALKCVAYLANNLTSINCLGIR---SYAQDEEMKVKVDNYIKSDINKVIVSPNFFSLPNLQIEIVGRKEDVTDSEQISHLLDLVLIWAQNNLQGKKNKLDRLTEQMNLLYLTRDNTLQDCQEFEDEELKEDDGIQDY 258          
BLAST of BTB domain-containing protein vs. TrEMBL
Match: E0VYN3 (BTB domain-containing protein OS=Pediculus humanus subsp. corporis OX=121224 GN=8233211 PE=4 SV=1)

HSP 1 Score: 229.565 bits (584), Expect = 3.264e-60
Identity = 122/325 (37.54%), Postives = 180/325 (55.38%), Query Frame = 1
Query: 1525 QLLKKVNTKVSTLERFDCLSTSRCAAGLVNVNDQLIVIGGFNRGECLNSVEIYQPLINKWSPSLSMKLCRAR--LVALVGQSDKENPYVYAIGGSDGYKELHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAG------NLAIVGGCFGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPEPSYSRRGASLVPYNGKLYLFGGSDSNSSLRTLEIFDSVANQWSLSVQQMKQSRANLCGGVLLNKLMAIGGFTGKHFLDTMECVDFDESCEISSEWSMYVP 2475
            ++ + V+    T +    ++  +CAAG  N N+ L+V GG++RGECL SVE Y P  N W+    +K  R R  +  ++G        VYA+GGS+G  EL TVE++D    +WTRV+N            +P+  S+AG       L  +GG  G   ++ CE+YD   D+W  +  + T R+QA V +  N+L  VGG D+W CLSS E+ D  E +W   P  + +RRG  +  + GKLY+ GGSD   SL + EIFD     WS     M   RAN+   V+ N+L A+GGF+GK FL+++E +D     E ++EW+ +VP
Sbjct:  366 EITRSVSNGPDTYQMMAHMTDVKCAAGCANFNETLLVCGGYDRGECLKSVESYDPSTNVWAALAPLKEARGRFNIAVVLGN-------VYAVGGSNGCTELSTVEKYDPELHKWTRVSN------------LPIARSNAGVCSLNDKLYCIGGWNGEMGMKQCEMYDPLTDEWVTISPLKTGRNQAGVCAFGNKLVAVGGCDAWNCLSSMEIYDPVENEWVMGPSMTTNRRGCGIAEFKGKLYVVGGSDGTHSLASTEIFDYEEQTWSPG-PSMTTPRANVGVAVIGNRLYAVGGFSGKTFLNSIEYLD-----ETTNEWTTFVP 665          

HSP 2 Score: 107.071 bits (266), Expect = 6.907e-20
Identity = 70/250 (28.00%), Postives = 125/250 (50.00%), Query Frame = 1
Query:   58 DRSRHSELLNRLNKLRISKAFCDVTVFAENKEFVAHKVILASSSDYFLSKFT-EDPKCD----------RLSINMNKDIFNLLLDYFYTSNLIVSKEKVPQLFSAAKYLKVRRVVKVCAQFLTKILSLDNIIDVRESVALNDSEDLCQAANAFIKENMDKII---SNVKIQKLNMDIMVDTVPKKE--NDSRLAELVIDWLEYSIVEDNMKLSDFVNENLVFFLTPSNSLVQCSEMASSNKFSSTFINDY 759
            D S +S  L  LN +R +K FCDV +   + E   H+ ILAS+S Y    F+ ED K            +L+   +    N+L+DY YT  L V    V  ++ AA  LK+ +V   C ++L + L++DN  D+R    +++++ + +  N FI E  D ++   S + +    ++++  +  + E  N + L  L I W++    + ++K+   V +  + +L   N+L  CSE+ +S+   S  + DY
Sbjct:   34 DDSHNSRTLTSLNMMRKNKNFCDVVLHVGSSEIHGHRAILASASPYLFQMFSVEDEKKGNNRERSSMSFKLNGGFDTKSLNILIDYAYTGRLEVQDSMVKNVYLAATQLKMGKVANKCVEYLVENLTVDNCTDIRSLPGISNNKIILEKINGFITEKFDSLVKAPSFICLPCFKIEVLSQSRQEMELVNPAALIRLSIQWIQG---QQDVKMERLVEKTHLLYLALDNTLQDCSELPNSDLSDSEIVQDY 280          
BLAST of BTB domain-containing protein vs. TrEMBL
Match: E9FQT2 (BTB domain-containing protein OS=Daphnia pulex OX=6669 GN=DAPPUDRAFT_300096 PE=4 SV=1)

HSP 1 Score: 219.55 bits (558), Expect = 1.377e-56
Identity = 122/322 (37.89%), Postives = 179/322 (55.59%), Query Frame = 1
Query: 1510 STVLQQLLKKVNTKVSTLERFDCLSTSRCAAGLVNVNDQLIVIGGFNRGECLNSVEIYQPLINKWSPSLSMKLCRARL-VALVGQSDKENPYVYAIGGSDGYKELHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGNLAIVGGCFGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPEPSYSRRGASLVPYNGKLYLFGGSDSNSSLRTLEIFDSVANQWSLSVQQMKQSRANLCGGVLLNKLMAIGGFTGKHFLDTMECVDFDESCEISSEWSMYV 2472
            ST  Q     V     +L     +ST RCA G  N+N+ L V GG++RGECL +VE+Y P +N+WS   SM+  R R  +A++G        VYA+GG +G  EL T E +  +N +WT +  +   RS    AV  +    AG + ++GG  G   ++ C I+D    KW++++ ++  R QAAV +   +L+ VGG D+W CL++ EV D   G W  +P  + +RRG  +  Y  KLY+ GGSD   SL T E+FD   N WS     M   RAN+   V+  KL A+GGF+GK FL+++E +D +     S EW+ +V
Sbjct:  355 STPGQSRPPSVERSTESLSAIPHMSTPRCAVGCANLNNALFVCGGYDRGECLRTVELYDPSLNRWSQLPSMREARGRFDIAVIGGK------VYAVGGCNGTTELATAEVYSSDNSKWTALPPLELARS--NVAVCDL----AGKVYVIGGWNGQCGMKQCNIFDPVEGKWTEIEPLNYGRYQAAVTTRLGKLYAVGGCDAWNCLNTVEVYDPATGMWDFLPPMNTARRGCGVTLYQNKLYVVGGSDGTQSLCTTEVFDFETNSWSPG-PSMTSCRANISVTVIDGKLFAVGGFSGKVFLNSVEYLDSE-----SMEWTTFV 658          

HSP 2 Score: 101.679 bits (252), Expect = 3.714e-18
Identity = 76/293 (25.94%), Postives = 136/293 (46.42%), Query Frame = 1
Query:   49 LIDDRSRHSELLNRLNKLRISKAFCDVTVFAENKEFVAHKVILASSSDYFLSKFTED--PKCD-------RLSINMNKDIFNLLLDYFYTSNLIVSKEKVPQLFSAAKYLKVRRVVKVCAQFLTKILSLDNIIDVRESVALNDSEDLCQAANAFIKENMDKIISNVKIQKLNMDIMVDTVP--------KKENDSRLAELVIDWLEYSIVEDNMKLSDFVNENLVFFLTPSNSLVQCSEMASSNKFSSTFINDYFNGFLSYQKNISKRVKCRPRSKERXXXXXXXXXXTKHQV 876
            +  D   +S  L  L+KLR ++ FCDV +     E  AH+VILA  S Y    F+ D   KC        +L+    KD F  L++Y YT  + V+  +V  ++ AA  LK+ RVV  CAQ+L   L     I++R    +  + +L    +A++ E +  + +   ++ L + + V+ +         +  N + L  LV++W+  +     + +     +  + +L   NSL  C ++ S +   S  + DY        K +S R+  +P SK +   +S  P++ +H +
Sbjct:    2 IFTDAEFNSSTLQGLSKLRKNRQFCDVILQVGTWEIPAHRVILACCSPYLFELFSTDDGGKCSEENIITYKLNGGFEKDSFEQLINYAYTGKMEVAASQVKAVYVAAVRLKMERVVNYCAQYLVDNLDPATAIEIRSLPGIQRNSELAARVDAYLAEEITSVATTKALRNLPL-VQVEVLASSREEMALRDANVTILCNLVLEWIHRNWEPAQLNVDQLTAKTHLLYLNLDNSLHDCVDIESGDVIDSDIVQDY--------KKMSLRLS-QPGSKNKRRGSSQQPSRPRHSL 284          
BLAST of BTB domain-containing protein vs. TrEMBL
Match: A0A1S3HQ85 (influenza virus NS1A-binding protein homolog A OS=Lingula unguis OX=7574 GN=LOC106156818 PE=4 SV=1)

HSP 1 Score: 218.394 bits (555), Expect = 2.344e-56
Identity = 117/301 (38.87%), Postives = 174/301 (57.81%), Query Frame = 1
Query: 1579 LSTSRCAAGLVNVNDQLIVIGGFNRGECLNSVEIYQPLINKWSPSLSMKLCRARLVALVGQSDKENPYVYAIGGSDGYKELHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGNLAIVGGCFGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPEPSYSRRGASLVPYNGKLYLFGGSDSNS-SLRTLEIFDSVANQWSLSVQQMKQSRANLCGGVLLNKLMAIGGFTGKHFLDTMECVDFDESCEISSEWSMYVPI 2478
            +S+ RC  G   ++ ++I +GG++RGECL + E+Y    N W+   SM   R R      Q       +YA GGS+G+ EL + E +D  +++WT VA++ + +S  G AV+         L ++GG  G   ++SCE++D   +KWS +  ++  RSQAAV +++ +L+ VGG DSW CL+S EV    E KW  +   S  RRGA    +NGKL + GGSD  S SL T+E+FD   N W+     M   RAN+   V  NKL A+GGF+G  FLD++E +D D     ++EWS Y+P+
Sbjct:  373 MSSPRCGVGTAVLDGKIIALGGYDRGECLRTAEMYDMSTNSWTALPSMGTPRGRFDVSQIQG-----RLYACGGSNGHTELKSAECYDPESEKWTPVADMLKCKSSAGVAVL------NDKLYVIGGWSGLQGVKSCEVFDPETNKWSTIAKLNVGRSQAAVCAMNGKLYAVGGCDSWHCLNSVEVYSPEENKWTMVAPLSMPRRGAGTTVFNGKLCVVGGSDGCSPSLATMEVFDPATNSWAFG-PPMNVCRANVGVAVCDNKLYAVGGFSGSTFLDSIEYLDGD-----TNEWSSYLPM 656          

HSP 2 Score: 92.8189 bits (229), Expect = 1.984e-15
Identity = 64/249 (25.70%), Postives = 131/249 (52.61%), Query Frame = 1
Query:   49 LIDDRSRHSELLNRLNKLRISKAFCDVTVFAENKEFVAHKVILASSSDYFLSKFTEDPKCDRLS----INMNKDIFNLLLDYFYTSNLIVSKEKVPQLFSAAKYLKVRRVVKVCAQFLTKILSLDNIIDVRESVALNDSEDLCQAANAFIKENMDKIISN----VKIQKLNMDIM--VDTVPKKENDSRLAELVIDWLEYSIVEDNM--KLSDFVNENLVFFLTPSNSLVQCSEMASSNKFSSTFINDY 759
            + DD  +   +LN LN LR +  FCDV +  E  E  AH+ +LA +S Y    F ++ + + L+      ++ ++F  L+ Y YT+ L V+ + V  ++  A  LK++R    C+ +L + L+  N + +R   A++D ++L Q  + +I++ +  I       +++ ++ +DI+   +   +  N+  L +LV+DWL+ ++ + N    ++D+VN   + +L   N+L    ++   +  ++  I DY
Sbjct:   14 IFDDIQQKQTILNDLNILRKNAQFCDVILEVEGHEIPAHRAVLACASQYLFDLFQQE-EGNHLTHCKLQGLDYEVFEYLVTYAYTARLEVAGDLVKSVYKTATMLKMQRAADACSCYLAEHLTPINCLGIR-CCAISD-DNLKQKVDNYIQQEITAITETCPEFIRLPRIQVDIIGASEHGLQSSNEKHLCQLVLDWLKDNVGQTNNLDAVTDYVN---MLYLNNDNTLHDAKDLDDYSLNNAEIIQDY 256          

HSP 3 Score: 73.559 bits (179), Expect = 1.694e-9
Identity = 38/134 (28.36%), Postives = 68/134 (50.75%), Query Frame = 1
Query: 2026 LKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPEPSYSRRGASLVPYNGKLYLFGGSDSNSSLRTLEIFDSVANQWSLSVQQMKQSRANLCGGVLLNKLMAIGGFTGKHFLDTMECVD 2427
            L  MS+ R     A +D ++  +GG D  +CL + E+ D+    W  +P     R    +    G+LY  GGS+ ++ L++ E +D  + +W+  V  M + +++    VL +KL  IGG++G   + + E  D
Sbjct:  370 LAPMSSPRCGVGTAVLDGKIIALGGYDRGECLRTAEMYDMSTNSWTALPSMGTPRGRFDVSQIQGRLYACGGSNGHTELKSAECYDPESEKWT-PVADMLKCKSSAGVAVLNDKLYVIGGWSGLQGVKSCEVFD 502          
BLAST of BTB domain-containing protein vs. Ensembl Cavefish
Match: ivns1abpa (influenza virus NS1A-binding protein homolog A [Source:NCBI gene;Acc:103030302])

HSP 1 Score: 171.785 bits (434), Expect = 1.769e-44
Identity = 99/289 (34.26%), Postives = 151/289 (52.25%), Query Frame = 1
Query: 1579 LSTSRCAAGLVNVNDQLIVIGGFNRGECLNSVEIYQPLINKWSPSLSMKLCRAR--LVALVGQSDKENPYVYAIGGSDGYK-ELHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGN-LAIVGGC--FGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPEPSYSRRGASLVPYNGKLYLFGGSDSNSSLRTLEIFDSVANQWSLSVQQMKQSRANLCGGVLLNKLMAIGGFTGKHFLDTMECVD 2427
            +  +R   G   +N +LI  GG+NR ECL +VE Y    + WS    M+  RAR  +  L+GQ       +Y +GGS+G+  EL   E ++ N   WT+V  +   R          G  S  N L +VGG    G   L++C+ +D    +WS    ++  R QAAV  +D  ++V+GG +SW CL++ E  +     W      + +RRGA +  Y GKL++ GG D + +LR +E+FD   N+W + +  M  +R+N    VL + + A+GGF G  FL+TME  D
Sbjct:  318 MHYARSGLGTAALNGRLIAAGGYNREECLRTVECYDLKTDSWSFIAPMRTPRARFQMAVLMGQ-------LYVMGGSNGHSDELSCGETYNPNTDEWTQVPELRTNRCN-------AGVCSLNNKLYVVGGSDPCGQKGLKNCDAFDPVTKEWSSCAPLNIRRHQAAVCELDGFMYVIGGAESWNCLNTVERYNPENNTWTLTAPMNVARRGAGVGIYAGKLFVVGGFDGSHALRCVEVFDPARNEWRM-LGSMNSARSNAGVAVLDDLIFAVGGFDGNDFLNTMEAYD 591          

HSP 2 Score: 107.457 bits (267), Expect = 1.583e-23
Identity = 66/201 (32.84%), Postives = 109/201 (54.23%), Query Frame = 1
Query: 1579 LSTSRCAAGLVNVNDQLIVIGGFNR--GECLNSVEIYQPLINKWSPSLSMKLCRARLVALVGQSDKENPYVYAIGGSDGYKELHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGNLAIVGGCFGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPE 2175
            L T+RC AG+ ++N++L V+GG +    + L + + + P+  +WS    + + R +  A V + D    ++Y IGG++ +  L+TVER++  N  WT  A +N  R   G  +       AG L +VGG  G + LR  E++D   ++W  L SM+++RS A VA +D+ +F VGG D    L++ E  D    +W    E
Sbjct:  413 LRTNRCNAGVCSLNNKLYVVGGSDPCGQKGLKNCDAFDPVTKEWSSCAPLNIRRHQ--AAVCELDG---FMYVIGGAESWNCLNTVERYNPENNTWTLTAPMNVARRGAGVGIY------AGKLFVVGGFDGSHALRCVEVFDPARNEWRMLGSMNSARSNAGVAVLDDLIFAVGGFDGNDFLNTMEAYDPELDEWSACAE 602          

HSP 3 Score: 92.8189 bits (229), Expect = 6.439e-19
Identity = 59/216 (27.31%), Postives = 107/216 (49.54%), Query Frame = 1
Query:   37 NKLSLIDDRSRHSELLNRLNKLRISKAFCDVTVFAENKEFVAHKVILASSSDYFLSKFTEDPKCDRLSI----NMNKDIFNLLLDYFYTSNLIVSKEKVPQLFSAAKYLKVRRVVKVCAQFLTKILSLDNIIDVRESVALNDSEDLCQAANAFIKENMDKIISN---VKIQKLNMDIMVDTVPKKENDSRLAELVIDWLEYSIVEDNMKLSDFVNE 663
            N   + +D S     + ++N LR S  FCDV +     E +AH+ +LA  S Y    F  D +   +S     +++ +   +LL+Y YT+ L   KE V  ++SAAK LK+ RV ++C  +L   +   N I  R   +      L    +A+I+EN+ ++      +K+ +L +++M++      ++ +L   VI W++ S+ E+   L   + E
Sbjct:    4 NGYLIFEDESFLDSTVAKMNALRKSGQFCDVRLQVCGHELMAHRAVLACCSPYLFEIFNSDMEPHGISHVKFEDLDPEAVEVLLNYAYTAQLKADKELVKDVYSAAKRLKMERVKQICGDYLLSKMDSQNAILYRNFASSMGDVRLLAKIDAYIQENLLEVSEQDDFLKLPRLKLEVMMEDHLTLPSNGKLYSKVISWVQRSLWENGEPLERLMEE 219          

HSP 4 Score: 60.4622 bits (145), Expect = 6.395e-9
Identity = 41/152 (26.97%), Postives = 69/152 (45.39%), Query Frame = 1
Query: 2026 LKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPEPSYSRRGASLVPYNGKLYLFGGSDSNS-SLRTLEIFDSVANQWSLSVQQMKQSRANLCGGVLLNKLMAIGGFTGKHFLDTMECVDFDESCEISSEWSMYVPI 2478
            L  M  +RS    A+++ +L   GG +  +CL + E  DL+   W  +      R    +    G+LY+ GGS+ +S  L   E ++   ++W+  V +++ +R N     L NKL  +GG           C  FD    ++ EWS   P+
Sbjct:  315 LAPMHYARSGLGTAALNGRLIAAGGYNREECLRTVECYDLKTDSWSFIAPMRTPRARFQMAVLMGQLYVMGGSNGHSDELSCGETYNPNTDEWT-QVPELRTNRCNAGVCSLNNKLYVVGGSDPCGQKGLKNCDAFD---PVTKEWSSCAPL 462          
BLAST of BTB domain-containing protein vs. Ensembl Cavefish
Match: ivns1abpa (influenza virus NS1A-binding protein homolog A [Source:NCBI gene;Acc:103030302])

HSP 1 Score: 171.785 bits (434), Expect = 2.924e-44
Identity = 99/289 (34.26%), Postives = 151/289 (52.25%), Query Frame = 1
Query: 1579 LSTSRCAAGLVNVNDQLIVIGGFNRGECLNSVEIYQPLINKWSPSLSMKLCRAR--LVALVGQSDKENPYVYAIGGSDGYK-ELHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGN-LAIVGGC--FGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPEPSYSRRGASLVPYNGKLYLFGGSDSNSSLRTLEIFDSVANQWSLSVQQMKQSRANLCGGVLLNKLMAIGGFTGKHFLDTMECVD 2427
            +  +R   G   +N +LI  GG+NR ECL +VE Y    + WS    M+  RAR  +  L+GQ       +Y +GGS+G+  EL   E ++ N   WT+V  +   R          G  S  N L +VGG    G   L++C+ +D    +WS    ++  R QAAV  +D  ++V+GG +SW CL++ E  +     W      + +RRGA +  Y GKL++ GG D + +LR +E+FD   N+W + +  M  +R+N    VL + + A+GGF G  FL+TME  D
Sbjct:  354 MHYARSGLGTAALNGRLIAAGGYNREECLRTVECYDLKTDSWSFIAPMRTPRARFQMAVLMGQ-------LYVMGGSNGHSDELSCGETYNPNTDEWTQVPELRTNRCN-------AGVCSLNNKLYVVGGSDPCGQKGLKNCDAFDPVTKEWSSCAPLNIRRHQAAVCELDGFMYVIGGAESWNCLNTVERYNPENNTWTLTAPMNVARRGAGVGIYAGKLFVVGGFDGSHALRCVEVFDPARNEWRM-LGSMNSARSNAGVAVLDDLIFAVGGFDGNDFLNTMEAYD 627          

HSP 2 Score: 107.457 bits (267), Expect = 1.681e-23
Identity = 66/201 (32.84%), Postives = 109/201 (54.23%), Query Frame = 1
Query: 1579 LSTSRCAAGLVNVNDQLIVIGGFNR--GECLNSVEIYQPLINKWSPSLSMKLCRARLVALVGQSDKENPYVYAIGGSDGYKELHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGNLAIVGGCFGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPE 2175
            L T+RC AG+ ++N++L V+GG +    + L + + + P+  +WS    + + R +  A V + D    ++Y IGG++ +  L+TVER++  N  WT  A +N  R   G  +       AG L +VGG  G + LR  E++D   ++W  L SM+++RS A VA +D+ +F VGG D    L++ E  D    +W    E
Sbjct:  449 LRTNRCNAGVCSLNNKLYVVGGSDPCGQKGLKNCDAFDPVTKEWSSCAPLNIRRHQ--AAVCELDG---FMYVIGGAESWNCLNTVERYNPENNTWTLTAPMNVARRGAGVGIY------AGKLFVVGGFDGSHALRCVEVFDPARNEWRMLGSMNSARSNAGVAVLDDLIFAVGGFDGNDFLNTMEAYDPELDEWSACAE 638          

HSP 3 Score: 94.3597 bits (233), Expect = 2.485e-19
Identity = 60/229 (26.20%), Postives = 112/229 (48.91%), Query Frame = 1
Query:   37 NKLSLIDDRSRHSELLNRLNKLRISKAFCDVTVFAENKEFVAHKVILASSSDYFLSKFTEDPKCDRLSI----NMNKDIFNLLLDYFYTSNLIVSKEKVPQLFSAAKYLKVRRVVKVCAQFLTKILSLDNIIDVRESVALNDSEDLCQAANAFIKENMDKIISN---VKIQKLNMDIMVDTVPKKENDSRLAELVIDWLEYSIVEDNMKLSDFVNENLVFFLTPSNSLV 702
            N   + +D S     + ++N LR S  FCDV +     E +AH+ +LA  S Y    F  D +   +S     +++ +   +LL+Y YT+ L   KE V  ++SAAK LK+ RV ++C  +L   +   N I  R   +      L    +A+I+EN+ ++      +K+ +L +++M++      ++ +L   VI W++ S+ E+   L   + E    + +  + L+
Sbjct:    4 NGYLIFEDESFLDSTVAKMNALRKSGQFCDVRLQVCGHELMAHRAVLACCSPYLFEIFNSDMEPHGISHVKFEDLDPEAVEVLLNYAYTAQLKADKELVKDVYSAAKRLKMERVKQICGDYLLSKMDSQNAILYRNFASSMGDVRLLAKIDAYIQENLLEVSEQDDFLKLPRLKLEVMMEDHLTLPSNGKLYSKVISWVQRSLWENGEPLERLMEEVQTLYYSADHKLL 232          

HSP 4 Score: 60.4622 bits (145), Expect = 7.352e-9
Identity = 41/152 (26.97%), Postives = 69/152 (45.39%), Query Frame = 1
Query: 2026 LKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPEPSYSRRGASLVPYNGKLYLFGGSDSNS-SLRTLEIFDSVANQWSLSVQQMKQSRANLCGGVLLNKLMAIGGFTGKHFLDTMECVDFDESCEISSEWSMYVPI 2478
            L  M  +RS    A+++ +L   GG +  +CL + E  DL+   W  +      R    +    G+LY+ GGS+ +S  L   E ++   ++W+  V +++ +R N     L NKL  +GG           C  FD    ++ EWS   P+
Sbjct:  351 LAPMHYARSGLGTAALNGRLIAAGGYNREECLRTVECYDLKTDSWSFIAPMRTPRARFQMAVLMGQLYVMGGSNGHSDELSCGETYNPNTDEWT-QVPELRTNRCNAGVCSLNNKLYVVGGSDPCGQKGLKNCDAFD---PVTKEWSSCAPL 498          
BLAST of BTB domain-containing protein vs. Ensembl Cavefish
Match: ivns1abpb (influenza virus NS1A-binding protein homolog B [Source:NCBI gene;Acc:103032964])

HSP 1 Score: 151.754 bits (382), Expect = 6.548e-38
Identity = 97/300 (32.33%), Postives = 155/300 (51.67%), Query Frame = 1
Query: 1579 LSTSRCAAGLVNVNDQLIVIGGFNRGECLNSVEIYQPLINKWSPSLSMKLCRAR--LVALVGQSDKENPYVYAIGGSDGYK-ELHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGNLAIVGGC--FGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPEPSYSRRGASLVPYNGKLYLFGGSDSNSSLRTLEIFDSVANQWSLSVQQMKQSRANLCGGVLLNKLMAIGGFTGKHFLDTMECVDFDESCEISSEWS 2463
            +  +R   G   ++ +LI  GG+NR ECL +VE Y P  + W+    M+  RAR  +  L+GQ       +Y +GGS+G+  EL   E +D     W+RV  +   R   G        S    L +VGG    G   L++C+ +D     W+   S++  R QAAV  +D  ++V+GG +SW CL+S E  +     W  +   + +RRGA +  + GKL++ GG D + +L  +E++D   N+W + +  M  +R+N    V+   + A+GGF G  FL+TME  D +     ++EWS
Sbjct:  307 MHYARSGLGTAEIDGKLIAAGGYNREECLRTVECYDPKKDCWTFIAPMRTPRARFQMAVLMGQ-------LYVMGGSNGHSDELSCGEMYDPRADEWSRVPELRTNRCNAGVC------SLHNKLFVVGGSDPCGQKGLKNCDSFDPVTKTWTSCASLNIRRHQAAVCELDGFVYVIGGAESWNCLNSVERYNPENNTWTLVAPMNVARRGAGVAVHEGKLFVAGGFDGSRALSCVEVYDPARNEWRM-LGSMTTARSNAGVAVVNGVVCAVGGFDGNDFLNTMEVYDPE-----TNEWS 587          

HSP 2 Score: 84.3445 bits (207), Expect = 2.415e-16
Identity = 66/201 (32.84%), Postives = 106/201 (52.74%), Query Frame = 1
Query: 1579 LSTSRCAAGLVNVNDQLIVIGGFNR--GECLNSVEIYQPLINKWSPSLSMKLCRARLVALVGQSDKENPYVYAIGGSDGYKELHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGNLAIVGGCFGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPE 2175
            L T+RC AG+ +++++L V+GG +    + L + + + P+   W+   S+ + R +  A V + D    +VY IGG++ +  L++VER++  N  WT VA +N  R   G AV        G L + GG  G   L   E+YD   ++W  L SM+T+RS A VA ++  +  VGG D    L++ EV D    +W    E
Sbjct:  402 LRTNRCNAGVCSLHNKLFVVGGSDPCGQKGLKNCDSFDPVTKTWTSCASLNIRRHQ--AAVCELDG---FVYVIGGAESWNCLNSVERYNPENNTWTLVAPMNVARRGAGVAV------HEGKLFVAGGFDGSRALSCVEVYDPARNEWRMLGSMTTARSNAGVAVVNGVVCAVGGFDGNDFLNTMEVYDPETNEWSPCAE 591          

HSP 3 Score: 70.0922 bits (170), Expect = 8.355e-12
Identity = 47/190 (24.74%), Postives = 91/190 (47.89%), Query Frame = 1
Query:   37 NKLSLIDDRSRHSELLNRLNKLRISKAFCDVTVFAENKEFVAHKVILASSSDYFLSKF-TEDPKCDRLSI----NMNKDIFNLLLDYFYTSNLIVSKEKVPQLFSAAKYLKVRRVVKVCAQFLTKILSLDNIIDVRESVALNDSEDLCQAANAFIKENMDKIISN---VKIQKLNMDIMVDTVPKKENDS 582
            N   + +D S     + ++N LR S  FCDV +     E +AH+ +LA  S Y    F +E      +S+    ++N +   +LL++ YT+ L   ++ V  ++SAAK LK+ RV ++C  +L   +   + I  R   +      L    + +I+E++ ++      +K+ +L +  +  +   K +D 
Sbjct:    4 NGCLVFEDESFLDSTVAKMNALRKSGQFCDVRLQVCGHELMAHRAVLACCSPYLFEVFNSEAEPQGGVSLVKFDDLNPEAVEILLNFAYTAQLKAERDLVRDVYSAAKKLKMERVKQICGDYLLSKMDCQSAIAYRHFASSMGDGRLLGKIDGYIQEHLLELSEKDDFLKLPRLKVQTLYYSADHKLHDG 193          

HSP 4 Score: 63.1586 bits (152), Expect = 9.149e-10
Identity = 38/121 (31.40%), Postives = 61/121 (50.41%), Query Frame = 1
Query: 2026 LKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPEPSYSRRGASLVPYNGKLYLFGGSDSNS-SLRTLEIFDSVANQWSLSVQQMKQSRANLCGGVLLNKLMAIGG 2385
            L+ M  +RS    A ID +L   GG +  +CL + E  D ++  W  +      R    +    G+LY+ GGS+ +S  L   E++D  A++WS  V +++ +R N     L NKL  +GG
Sbjct:  304 LRPMHYARSGLGTAEIDGKLIAAGGYNREECLRTVECYDPKKDCWTFIAPMRTPRARFQMAVLMGQLYVMGGSNGHSDELSCGEMYDPRADEWS-RVPELRTNRCNAGVCSLHNKLFVVGG 423          
BLAST of BTB domain-containing protein vs. Ensembl Cavefish
Match: ivns1abpb (influenza virus NS1A-binding protein homolog B [Source:NCBI gene;Acc:103032964])

HSP 1 Score: 152.14 bits (383), Expect = 8.342e-38
Identity = 97/300 (32.33%), Postives = 155/300 (51.67%), Query Frame = 1
Query: 1579 LSTSRCAAGLVNVNDQLIVIGGFNRGECLNSVEIYQPLINKWSPSLSMKLCRAR--LVALVGQSDKENPYVYAIGGSDGYK-ELHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGNLAIVGGC--FGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPEPSYSRRGASLVPYNGKLYLFGGSDSNSSLRTLEIFDSVANQWSLSVQQMKQSRANLCGGVLLNKLMAIGGFTGKHFLDTMECVDFDESCEISSEWS 2463
            +  +R   G   ++ +LI  GG+NR ECL +VE Y P  + W+    M+  RAR  +  L+GQ       +Y +GGS+G+  EL   E +D     W+RV  +   R   G        S    L +VGG    G   L++C+ +D     W+   S++  R QAAV  +D  ++V+GG +SW CL+S E  +     W  +   + +RRGA +  + GKL++ GG D + +L  +E++D   N+W + +  M  +R+N    V+   + A+GGF G  FL+TME  D +     ++EWS
Sbjct:  349 MHYARSGLGTAEIDGKLIAAGGYNREECLRTVECYDPKKDCWTFIAPMRTPRARFQMAVLMGQ-------LYVMGGSNGHSDELSCGEMYDPRADEWSRVPELRTNRCNAGVC------SLHNKLFVVGGSDPCGQKGLKNCDSFDPVTKTWTSCASLNIRRHQAAVCELDGFVYVIGGAESWNCLNSVERYNPENNTWTLVAPMNVARRGAGVAVHEGKLFVAGGFDGSRALSCVEVYDPARNEWRM-LGSMTTARSNAGVAVVNGVVCAVGGFDGNDFLNTMEVYDPE-----TNEWS 629          

HSP 2 Score: 84.7297 bits (208), Expect = 2.190e-16
Identity = 66/201 (32.84%), Postives = 106/201 (52.74%), Query Frame = 1
Query: 1579 LSTSRCAAGLVNVNDQLIVIGGFNR--GECLNSVEIYQPLINKWSPSLSMKLCRARLVALVGQSDKENPYVYAIGGSDGYKELHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGNLAIVGGCFGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPE 2175
            L T+RC AG+ +++++L V+GG +    + L + + + P+   W+   S+ + R +  A V + D    +VY IGG++ +  L++VER++  N  WT VA +N  R   G AV        G L + GG  G   L   E+YD   ++W  L SM+T+RS A VA ++  +  VGG D    L++ EV D    +W    E
Sbjct:  444 LRTNRCNAGVCSLHNKLFVVGGSDPCGQKGLKNCDSFDPVTKTWTSCASLNIRRHQ--AAVCELDG---FVYVIGGAESWNCLNSVERYNPENNTWTLVAPMNVARRGAGVAV------HEGKLFVAGGFDGSRALSCVEVYDPARNEWRMLGSMTTARSNAGVAVVNGVVCAVGGFDGNDFLNTMEVYDPETNEWSPCAE 633          

HSP 3 Score: 84.3445 bits (207), Expect = 2.764e-16
Identity = 55/229 (24.02%), Postives = 110/229 (48.03%), Query Frame = 1
Query:   37 NKLSLIDDRSRHSELLNRLNKLRISKAFCDVTVFAENKEFVAHKVILASSSDYFLSKF-TEDPKCDRLSI----NMNKDIFNLLLDYFYTSNLIVSKEKVPQLFSAAKYLKVRRVVKVCAQFLTKILSLDNIIDVRESVALNDSEDLCQAANAFIKENMDKIISN---VKIQKLNMDIMVDTVPKKENDSRLAELVIDWLEYSIVEDNMKLSDFVNENLVFFLTPSNSL 699
            N   + +D S     + ++N LR S  FCDV +     E +AH+ +LA  S Y    F +E      +S+    ++N +   +LL++ YT+ L   ++ V  ++SAAK LK+ RV ++C  +L   +   + I  R   +      L    + +I+E++ ++      +K+ +L +++M++      ++ +L   VI W++ S+ E    L   + E    + +  + L
Sbjct:    4 NGCLVFEDESFLDSTVAKMNALRKSGQFCDVRLQVCGHELMAHRAVLACCSPYLFEVFNSEAEPQGGVSLVKFDDLNPEAVEILLNFAYTAQLKAERDLVRDVYSAAKKLKMERVKQICGDYLLSKMDCQSAIAYRHFASSMGDGRLLGKIDGYIQEHLLELSEKDDFLKLPRLKLEVMLEENLNLPSNGKLYSKVISWVQRSLWESGEPLDKLMEEVQTLYYSADHKL 232          

HSP 4 Score: 63.1586 bits (152), Expect = 1.019e-9
Identity = 38/121 (31.40%), Postives = 61/121 (50.41%), Query Frame = 1
Query: 2026 LKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPEPSYSRRGASLVPYNGKLYLFGGSDSNS-SLRTLEIFDSVANQWSLSVQQMKQSRANLCGGVLLNKLMAIGG 2385
            L+ M  +RS    A ID +L   GG +  +CL + E  D ++  W  +      R    +    G+LY+ GGS+ +S  L   E++D  A++WS  V +++ +R N     L NKL  +GG
Sbjct:  346 LRPMHYARSGLGTAEIDGKLIAAGGYNREECLRTVECYDPKKDCWTFIAPMRTPRARFQMAVLMGQLYVMGGSNGHSDELSCGEMYDPRADEWS-RVPELRTNRCNAGVCSLHNKLFVVGG 465          
BLAST of BTB domain-containing protein vs. Ensembl Cavefish
Match: ivns1abpb (influenza virus NS1A-binding protein homolog B [Source:NCBI gene;Acc:103032964])

HSP 1 Score: 152.14 bits (383), Expect = 8.342e-38
Identity = 97/300 (32.33%), Postives = 155/300 (51.67%), Query Frame = 1
Query: 1579 LSTSRCAAGLVNVNDQLIVIGGFNRGECLNSVEIYQPLINKWSPSLSMKLCRAR--LVALVGQSDKENPYVYAIGGSDGYK-ELHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGNLAIVGGC--FGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPEPSYSRRGASLVPYNGKLYLFGGSDSNSSLRTLEIFDSVANQWSLSVQQMKQSRANLCGGVLLNKLMAIGGFTGKHFLDTMECVDFDESCEISSEWS 2463
            +  +R   G   ++ +LI  GG+NR ECL +VE Y P  + W+    M+  RAR  +  L+GQ       +Y +GGS+G+  EL   E +D     W+RV  +   R   G        S    L +VGG    G   L++C+ +D     W+   S++  R QAAV  +D  ++V+GG +SW CL+S E  +     W  +   + +RRGA +  + GKL++ GG D + +L  +E++D   N+W + +  M  +R+N    V+   + A+GGF G  FL+TME  D +     ++EWS
Sbjct:  349 MHYARSGLGTAEIDGKLIAAGGYNREECLRTVECYDPKKDCWTFIAPMRTPRARFQMAVLMGQ-------LYVMGGSNGHSDELSCGEMYDPRADEWSRVPELRTNRCNAGVC------SLHNKLFVVGGSDPCGQKGLKNCDSFDPVTKTWTSCASLNIRRHQAAVCELDGFVYVIGGAESWNCLNSVERYNPENNTWTLVAPMNVARRGAGVAVHEGKLFVAGGFDGSRALSCVEVYDPARNEWRM-LGSMTTARSNAGVAVVNGVVCAVGGFDGNDFLNTMEVYDPE-----TNEWS 629          

HSP 2 Score: 84.7297 bits (208), Expect = 2.190e-16
Identity = 66/201 (32.84%), Postives = 106/201 (52.74%), Query Frame = 1
Query: 1579 LSTSRCAAGLVNVNDQLIVIGGFNR--GECLNSVEIYQPLINKWSPSLSMKLCRARLVALVGQSDKENPYVYAIGGSDGYKELHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGNLAIVGGCFGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPE 2175
            L T+RC AG+ +++++L V+GG +    + L + + + P+   W+   S+ + R +  A V + D    +VY IGG++ +  L++VER++  N  WT VA +N  R   G AV        G L + GG  G   L   E+YD   ++W  L SM+T+RS A VA ++  +  VGG D    L++ EV D    +W    E
Sbjct:  444 LRTNRCNAGVCSLHNKLFVVGGSDPCGQKGLKNCDSFDPVTKTWTSCASLNIRRHQ--AAVCELDG---FVYVIGGAESWNCLNSVERYNPENNTWTLVAPMNVARRGAGVAV------HEGKLFVAGGFDGSRALSCVEVYDPARNEWRMLGSMTTARSNAGVAVVNGVVCAVGGFDGNDFLNTMEVYDPETNEWSPCAE 633          

HSP 3 Score: 84.3445 bits (207), Expect = 2.764e-16
Identity = 55/229 (24.02%), Postives = 110/229 (48.03%), Query Frame = 1
Query:   37 NKLSLIDDRSRHSELLNRLNKLRISKAFCDVTVFAENKEFVAHKVILASSSDYFLSKF-TEDPKCDRLSI----NMNKDIFNLLLDYFYTSNLIVSKEKVPQLFSAAKYLKVRRVVKVCAQFLTKILSLDNIIDVRESVALNDSEDLCQAANAFIKENMDKIISN---VKIQKLNMDIMVDTVPKKENDSRLAELVIDWLEYSIVEDNMKLSDFVNENLVFFLTPSNSL 699
            N   + +D S     + ++N LR S  FCDV +     E +AH+ +LA  S Y    F +E      +S+    ++N +   +LL++ YT+ L   ++ V  ++SAAK LK+ RV ++C  +L   +   + I  R   +      L    + +I+E++ ++      +K+ +L +++M++      ++ +L   VI W++ S+ E    L   + E    + +  + L
Sbjct:    4 NGCLVFEDESFLDSTVAKMNALRKSGQFCDVRLQVCGHELMAHRAVLACCSPYLFEVFNSEAEPQGGVSLVKFDDLNPEAVEILLNFAYTAQLKAERDLVRDVYSAAKKLKMERVKQICGDYLLSKMDCQSAIAYRHFASSMGDGRLLGKIDGYIQEHLLELSEKDDFLKLPRLKLEVMLEENLNLPSNGKLYSKVISWVQRSLWESGEPLDKLMEEVQTLYYSADHKL 232          

HSP 4 Score: 63.1586 bits (152), Expect = 1.019e-9
Identity = 38/121 (31.40%), Postives = 61/121 (50.41%), Query Frame = 1
Query: 2026 LKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPEPSYSRRGASLVPYNGKLYLFGGSDSNS-SLRTLEIFDSVANQWSLSVQQMKQSRANLCGGVLLNKLMAIGG 2385
            L+ M  +RS    A ID +L   GG +  +CL + E  D ++  W  +      R    +    G+LY+ GGS+ +S  L   E++D  A++WS  V +++ +R N     L NKL  +GG
Sbjct:  346 LRPMHYARSGLGTAEIDGKLIAAGGYNREECLRTVECYDPKKDCWTFIAPMRTPRARFQMAVLMGQLYVMGGSNGHSDELSCGEMYDPRADEWS-RVPELRTNRCNAGVCSLHNKLFVVGG 465          
BLAST of BTB domain-containing protein vs. Ensembl Sea Lamprey
Match: IVNS1ABP (influenza virus NS1A binding protein [Source:HGNC Symbol;Acc:HGNC:16951])

HSP 1 Score: 158.303 bits (399), Expect = 1.269e-43
Identity = 97/285 (34.04%), Postives = 150/285 (52.63%), Query Frame = 1
Query: 1639 GGFNRGECLNSVEIYQPLINKWSPSLSMKLCRAR--LVALVGQSDKENPYVYAIGGSDGYK-ELHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGNLAIVGGC--FGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPEPSYSRRGASLVPYNGKLYLFGGSDSNSSLRTLEIFDSVANQWSLSVQQMKQSRANLCGGVLLNKLMAIGGFTGKHFLDTMECVDFDESCEISSEWSMYVPI 2478
            GG+NR ECL +VE Y    + WS    M   RAR  +  L+G+       ++A+GGS+G+  EL + E +D +  +W  +  +   R   G AV+         L IVGG   +G   LRSC+ +D     W      +T R QA+V  +D  L+VVGG+++W CL++ E  D     W  +   + +RRGA +  YNGKL++ GG +  SSL  +E++D V ++W++ +  +   R+N    V   +L A+GGFTG  FL ++E  D   +      WS Y+ I
Sbjct:    3 GGYNREECLRTVERYDASTDSWSFIAPMNTPRARFQMATLMGK-------LFALGGSNGHSDELSSGEVYDPDADQWMSIPELRTNRCNAGVAVL------KDRLYIVGGSDPYGQKGLRSCDAFDPISKTWITCSPTNTHRHQASVCELDGFLYVVGGSEAWNCLNTVERYDPLGDTWTFVAPMNVARRGAGVAAYNGKLFVVGGFNGASSLGAVEVYDPVRDEWTV-LASLSVVRSNAGVAVAGGRLYAVGGFTGAQFLRSVEVYDAQANL-----WSPYIAI 268          

HSP 2 Score: 97.8265 bits (242), Expect = 1.042e-22
Identity = 68/199 (34.17%), Postives = 105/199 (52.76%), Query Frame = 1
Query: 1579 LSTSRCAAGLVNVNDQLIVIGGFNR--GECLNSVEIYQPLINKW---SPSLSMKLCRARLVALVGQSDKENPYVYAIGGSDGYKELHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGNLAIVGGCFGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKW 2160
            L T+RC AG+  + D+L ++GG +    + L S + + P+   W   SP+ + +  +A +  L G       ++Y +GGS+ +  L+TVER+D     WT VA +N  R   G  V    A+  G L +VGG  G ++L + E+YD   D+W+ L S+S  RS A VA    +L+ VGG    + L S EV D +   W
Sbjct:   78 LRTNRCNAGVAVLKDRLYIVGGSDPYGQKGLRSCDAFDPISKTWITCSPTNTHRH-QASVCELDG-------FLYVVGGSEAWNCLNTVERYDPLGDTWTFVAPMNVAR--RGAGV----AAYNGKLFVVGGFNGASSLGAVEVYDPVRDEWTVLASLSVVRSNAGVAVAGGRLYAVGGFTGAQFLRSVEVYDAQANLW 262          

HSP 3 Score: 71.2478 bits (173), Expect = 9.381e-14
Identity = 49/146 (33.56%), Postives = 71/146 (48.63%), Query Frame = 1
Query: 1585 TSRCAAGLVNVNDQLIVIGGFNRGECLNSVEIYQPLINKWSPSLSMKLCRARLVALVGQSDKENPYVYAIGGSDGYKELHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGNLAIVGGCFGPNNLRSCEIYDTTLDKWS 2022
            T R  A +  ++  L V+GG     CLN+VE Y PL + W+    M + R R   +   + K    ++ +GG +G   L  VE +D     WT +A+++  RS  G AV      + G L  VGG  G   LRS E+YD   + WS
Sbjct:  129 THRHQASVCELDGFLYVVGGSEAWNCLNTVERYDPLGDTWTFVAPMNVAR-RGAGVAAYNGK----LFVVGGFNGASSLGAVEVYDPVRDEWTVLASLSVVRSNAGVAV------AGGRLYAVGGFTGAQFLRSVEVYDAQANLWS 263          

HSP 4 Score: 63.1586 bits (152), Expect = 4.699e-11
Identity = 38/123 (30.89%), Postives = 64/123 (52.03%), Query Frame = 1
Query: 1552 VSTLERFDCL----------STSRCAAGLVNVNDQLIVIGGFNRGECLNSVEIYQPLINKWSPSLSMKLCRARL-VALVGQSDKENPYVYAIGGSDGYKELHTVERFDVNNQRWTRVANINQE 1887
            ++T+ER+D L          + +R  AG+   N +L V+GGFN    L +VE+Y P+ ++W+   S+ + R+   VA+ G        +YA+GG  G + L +VE +D     W+    I +E
Sbjct:  155 LNTVERYDPLGDTWTFVAPMNVARRGAGVAAYNGKLFVVGGFNGASSLGAVEVYDPVRDEWTVLASLSVVRSNAGVAVAGGR------LYAVGGFTGAQFLRSVEVYDAQANLWSPYIAIKRE 271          
BLAST of BTB domain-containing protein vs. Ensembl Sea Lamprey
Match: klhl18 (kelch-like family member 18 [Source:ZFIN;Acc:ZDB-GENE-030131-5785])

HSP 1 Score: 152.14 bits (383), Expect = 8.838e-39
Identity = 95/306 (31.05%), Postives = 160/306 (52.29%), Query Frame = 1
Query: 1591 RCAAGLVNVNDQLIVIGGFNR-GECLNSVEIYQPLINKWSPSLSMKLCRARL-VALVGQSDKENPYVYAIGGSDGYKELHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGNLAIVGGCFGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKW-RTMP-EPSYSRRGASLVPYNGKLYLFGGSDSNSSLRTLEIFDSVANQWSLSVQQMKQSRANLCGGVLLNKLMAIGGFTGKHFLDTMECVDFDESCEISSEWSMYVPIGWSVNG 2496
            RC   L     ++  +GG N  G+ +  VE+Y PL N+W     M   R+R+ VA++G        +YA+GGSDG + L +VE +D +   WT+VA++N +RS  G AV+       G + + GG  G ++L S E Y +  DKW+ + +M++ RS   VA  + +++V GG D  +  ++ E  +   G W +  P +    R GA+ +  +G+LY  GG   ++ L ++E +D+ ++QWS ++  M  SR+ +       +L A+GG+ G   L T+EC   +     S+ W     + W   G
Sbjct:  290 RCCTSLAG---RVYAVGGLNSAGDAVTMVEVYDPLTNRWEACCPMGSPRSRVGVAVLGGR------LYAVGGSDGQERLSSVEVYDPDRNIWTKVASMNSKRSAMGVAVLD------GQIYVCGGYDGVSSLSSVECYSSEADKWTMVTAMNSPRSATGVAFFEGRVYVTGGHDGLQIFNTVEYYNPHTGSWHKAAPMQQRRCRHGAAAL--SGRLYAVGGYTGSAFLSSVETYDTASDQWS-ALTPMLASRSRVALAACSGRLYALGGYDGYANLGTVECFTPE-----SNTWRQAAQMSWHTGG 572          

HSP 2 Score: 107.071 bits (266), Expect = 3.500e-24
Identity = 69/221 (31.22%), Postives = 108/221 (48.87%), Query Frame = 1
Query: 1534 KKVNTKVSTLERFDCLSTSRCAAGLVNVNDQLIVIGGFNRGECLNSVEIYQPLINKWSPSLSMKLCRARLVALVGQSDKENPYVYAIGGSDGYKELHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGNLAIVGGCFGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPEPSYSRRG 2196
            + + TKV+++      ++ R A G+  ++ Q+ V GG++    L+SVE Y    +KW+   +M   R+      G +  E   VY  GG DG +  +TVE ++ +   W + A + Q R  HG A +      +G L  VGG  G   L S E YDT  D+WS L  M  SRS+ A+A+   +L+ +GG D +  L + E        WR   + S+   G
Sbjct:  369 RNIWTKVASM------NSKRSAMGVAVLDGQIYVCGGYDGVSSLSSVECYSSEADKWTMVTAMNSPRS----ATGVAFFEG-RVYVTGGHDGLQIFNTVEYYNPHTGSWHKAAPMQQRRCRHGAAAL------SGRLYAVGGYTGSAFLSSVETYDTASDQWSALTPMLASRSRVALAACSGRLYALGGYDGYANLGTVECFTPESNTWRQAAQMSWHTGG 572          

HSP 3 Score: 69.3218 bits (168), Expect = 2.576e-12
Identity = 44/183 (24.04%), Postives = 85/183 (46.45%), Query Frame = 1
Query:   91 LNKLRISKAFCDVTVFAENKEFVAHKVILASSSDYFLSKFTED-PKCDRLSINM---NKDIFNLLLDYFYTSNLIVSKEKVPQLFSAAKYLKVRRVVKVCAQFLTKILSLDNIIDVRESVALNDSEDLCQAANAFIKENMDKIISNVKIQKLNMDIMVDTVPKK----ENDSRLAELVIDWLE 615
            + ++R     CDVT+     ++ AH+V+LA+S  YF + FT D  +  R  I M   +      L+++ Y   + + +  V  L  AA +L++  V   C  FL + L   N++ VR          L   AN+F++++  +  S  +   L  + +++   +     E + ++ E V+ W+ 
Sbjct:   37 MEEIRRQGKLCDVTLRVGEHKYSAHRVVLAASIPYFHAMFTTDMAESKREEIVMQGTDPSALEALINFAYNGRVAIDQHNVQALLMAASFLQLHAVKDACCHFLKERLHPKNVLGVRSFAEAMMCPALYDTANSFLQQHFVEASSGEEFLGLPGEELLELAARDELHVEGEEQVFEAVLAWVR 219          

HSP 4 Score: 62.3882 bits (150), Expect = 3.789e-10
Identity = 39/123 (31.71%), Postives = 58/123 (47.15%), Query Frame = 1
Query: 1543 NTKVSTLERFDCLSTSRCAAGLVNVNDQLIVIGGFNRGECLNSVEIYQPLINKWSPSLSMKLCRARLVALVGQSDKENPYVYAIGGSDGYKELHTVERFDVNNQRWTRVANINQERSYHGGAV 1911
            N    +  +   +   RC  G   ++ +L  +GG+     L+SVE Y    ++WS    M   R+R VAL   S +    +YA+GG DGY  L TVE F   +  W + A +    S+H G V
Sbjct:  460 NPHTGSWHKAAPMQQRRCRHGAAALSGRLYAVGGYTGSAFLSSVETYDTASDQWSALTPMLASRSR-VALAACSGR----LYALGGYDGYANLGTVECFTPESNTWRQAAQM----SWHTGGV 573          
BLAST of BTB domain-containing protein vs. Ensembl Sea Lamprey
Match: klhl8 (kelch-like family member 8 [Source:ZFIN;Acc:ZDB-GENE-070209-226])

HSP 1 Score: 139.043 bits (349), Expect = 2.461e-34
Identity = 87/255 (34.12%), Postives = 135/255 (52.94%), Query Frame = 1
Query: 1579 LSTSRCAAGLVNVNDQLIVIGGFNRGECLNSVEIYQPLINKWSPSLSMKLCRARLVALVGQSDKENPYVYAIGGSDGYKELHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGN-LAIVGGCFGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPEPSYSRRGASLVPYNGKLYLFGGSDSNSSLRTLEIFDSVANQWSLSVQQMKQSRAN 2340
            +++ R   G+++V  ++  +GG +  E L S+E++ PL NKW P  SM   R R +AL   +      +YAIGG D      TVER+DV    W+ V  +N  R   GG    VGA + G  +  VGG  G  +L + E YD  LDKW ++K M   R+ A V  ++  L+VVGG D    L+S E  D ++ +W  + + +  R G  +    GK++  GG + ++ L T+E +D + N+W  +V  + Q RA 
Sbjct:  344 MNSRRRHVGVISVGGKVYAVGGHDGNEHLTSMEMFDPLTNKWIPRASMNTKR-RGIALAALASGP---IYAIGGLDDSACFQTVERYDVAADSWSTVHCMNLPR---GG----VGAVALGRYIYAVGGNNGQTSLATVERYDPPLDKWEEVKGMKQRRAGAGVTVLNRCLYVVGGFDDNAPLNSVEKYDPQKDRWEEVADLTTPRGGVGVATLIGKIFAVGGHNGSTYLNTVEAYDPLTNKWE-AVGSISQCRAG 586          

HSP 2 Score: 92.4337 bits (228), Expect = 1.666e-19
Identity = 64/217 (29.49%), Postives = 104/217 (47.93%), Query Frame = 1
Query: 1783 VYAIGGSDGYKE-LHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGNLAIVGGCFGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASI-DNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPEPSYSRRGASLVPYNGKLYLFGGSDSNSSLRTLEIFDSVANQWSLSVQQMKQSRANLCGGVLLNKLMAIGGFTGKHFLDTMECVD 2427
            ++ +GG     +   ++E +D+    W   A +N  R + G  V+ VG    G +  VGG  G  +L S E++D   +KW    SM+T R   A+A++    ++ +GG D   C  + E  D+    W T+   +  R G   V     +Y  GG++  +SL T+E +D   ++W   V+ MKQ RA     VL   L  +GGF     L+++E  D
Sbjct:  312 LFCVGGRGSMGDPFRSIECYDLQTGSWFLAAEMNSRRRHVG--VISVG----GKVYAVGGHDGNEHLTSMEMFDPLTNKWIPRASMNTKRRGIALAALASGPIYAIGGLDDSACFQTVERYDVAADSWSTVHCMNLPRGGVGAVALGRYIYAVGGNNGQTSLATVERYDPPLDKWE-EVKGMKQRRAGAGVTVLNRCLYVVGGFDDNAPLNSVEKYD 521          

HSP 3 Score: 80.8777 bits (198), Expect = 6.589e-16
Identity = 57/197 (28.93%), Postives = 85/197 (43.15%), Query Frame = 1
Query: 1477 GPFTDSKSDDQSTVLQQLLKKVNTKVSTLERFDCLSTSRCAAGLVNVNDQLIVIGGFNRGECLNSVEIYQPLINKWSPSLSMKLCRARLVALVGQSDKENPYVYAIGGSDGYKELHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGNLAIVGGCFGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVA 2067
            GP       D S   Q + ++ +    +     C++  R   G V +   +  +GG N    L +VE Y P ++KW     MK  RA     V      N  +Y +GG D    L++VE++D    RW  VA++   R   G A +       G +  VGG  G   L + E YD   +KW  + S+S  R+ A VA
Sbjct:  406 GPIYAIGGLDDSACFQTV-ERYDVAADSWSTVHCMNLPRGGVGAVALGRYIYAVGGNNGQTSLATVERYDPPLDKWEEVKGMKQRRAGAGVTV-----LNRCLYVVGGFDDNAPLNSVEKYDPQKDRWEEVADLTTPRGGVGVATL------IGKIFAVGGHNGSTYLNTVEAYDPLTNKWEAVGSISQCRAGAGVA 590          

HSP 4 Score: 76.6406 bits (187), Expect = 1.261e-14
Identity = 54/171 (31.58%), Postives = 81/171 (47.37%), Query Frame = 1
Query: 1924 ASSAGNLAIVGG--CFGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPEPSYSRRGASLVPY-NGKLYLFGGSDSNSSLRTLEIFDSVANQWSLSVQQMKQSRANLCGGVLLNKLMAIGGFTGKHFLDTMECVD 2427
            A+  G L  VGG    G +  RS E YD     W     M++ R    V S+  +++ VGG D  + L+S E+ D    KW      +  RRG +L    +G +Y  GG D ++  +T+E +D  A+ WS +V  M   R  +    L   + A+GG  G+  L T+E  D
Sbjct:  306 AAGEGVLFCVGGRGSMG-DPFRSIECYDLQTGSWFLAAEMNSRRRHVGVISVGGKVYAVGGHDGNEHLTSMEMFDPLTNKWIPRASMNTKRRGIALAALASGPIYAIGGLDDSACFQTVERYDVAADSWS-TVHCMNLPRGGVGAVALGRYIYAVGGNNGQTSLATVERYD 474          

HSP 5 Score: 64.6994 bits (156), Expect = 7.691e-11
Identity = 41/135 (30.37%), Postives = 67/135 (49.63%), Query Frame = 1
Query: 1543 NTKVSTLERFD----------CLSTSRCAAGLVNVNDQLIVIGGFNRGECLNSVEIYQPLINKWSPSLSMKLCRARL--VALVGQSDKENPYVYAIGGSDGYKELHTVERFDVNNQRWTRVANINQERSYHGGAV 1911
             T ++T+ER+D           +   R  AG+  +N  L V+GGF+    LNSVE Y P  ++W     +   R  +    L+G+       ++A+GG +G   L+TVE +D    +W  V +I+Q R+  G A+
Sbjct:  464 QTSLATVERYDPPLDKWEEVKGMKQRRAGAGVTVLNRCLYVVGGFDDNAPLNSVEKYDPQKDRWEEVADLTTPRGGVGVATLIGK-------IFAVGGHNGSTYLNTVEAYDPLTNKWEAVGSISQCRAGAGVAI 591          

HSP 6 Score: 61.6178 bits (148), Expect = 6.631e-10
Identity = 46/154 (29.87%), Postives = 67/154 (43.51%), Query Frame = 1
Query: 2038 STSRSQAAVASIDNQLFVVGGTDSWK-CLSSCEVMDLREGKWRTMPEPSYSRRGASLVPYNGKLYLFGGSDSNSSLRTLEIFDSVANQWSLSVQQMKQSRANLCGGVLLNKLMAIGGFTGKHFLDTMECVDFDESCEISSE-WS----MYVPIG 2481
            +T R  AA   +   LF VGG  S      S E  DL+ G W    E +  RR   ++   GK+Y  GG D N  L ++E+FD + N+W        + R      +    + AIGG      LD   C    E  +++++ WS    M +P G
Sbjct:  300 TTPRKSAAGEGV---LFCVGGRGSMGDPFRSIECYDLQTGSWFLAAEMNSRRRHVGVISVGGKVYAVGGHDGNEHLTSMEMFDPLTNKWIPRASMNTKRRGIALAALASGPIYAIGG------LDDSACFQTVERYDVAADSWSTVHCMNLPRG 444          

HSP 7 Score: 56.9954 bits (136), Expect = 1.960e-8
Identity = 39/159 (24.53%), Postives = 73/159 (45.91%), Query Frame = 1
Query:   49 LIDDRSRHSELLNRLNKLRISKAFCDVTVFAENKEFVAHKVILASSSDYFLSKFTED---PKCDRLSI---NMNKDIFNLLLDYFYTSNLIVSKEKVPQLFSAAKYLKVRRVVKVCAQFLTKILSLDNIIDVRESVALNDSEDLCQAANAFIKENMDKI 507
            ++ +  RHS +   L  L   +  CDVT+    K    H+V+LAS+  YF   F  D    +   +S+    + +     ++ + Y     ++ + V  L  AA  L+V  +V  C+ ++ + L   N + VR    +++ + L  AA+ F +EN   +
Sbjct:   31 MVPESWRHS-VSQALLALFEKEQLCDVTIKVGAKRIPCHRVVLASAVPYFRDMFLSDMLETRQGEVSLQDQQLEEGAVEAIVRFAYEGRARLAPDGVQALLYAACILQVEVLVGACSTYMQRNLDASNCLGVRAFAEMHNLKKLMSAADDFTRENFGAV 188          
BLAST of BTB domain-containing protein vs. Ensembl Sea Lamprey
Match: KLHL12 (kelch like family member 12 [Source:HGNC Symbol;Acc:HGNC:19360])

HSP 1 Score: 136.346 bits (342), Expect = 9.757e-34
Identity = 93/281 (33.10%), Postives = 135/281 (48.04%), Query Frame = 1
Query: 1606 LVNVNDQLIVIGGFNRGEC-LNSVEIYQPLINKWS--PSLSMKLCRARLVALVGQSDKENPYVYAIGGSDGYKELHTVERFDVNNQR---WTRVANINQERSYHGGAVMPVGASSAGNLAIVGGCF-GPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPEPSYSRRGASLVPYNGKLYLFGGSDSNSSLRTLEIFDSVANQWSLSVQQMKQSRANLCGGVLLNKLMAIGGFTGKHFLDTMECVD 2427
            L+  N+ L+VIGGF   +  ++ VE Y P    WS  PS++ K    R VA V  +++    VY +GG DG   L +VE  D        W  VA +N  R          GA++ G++  V G F G     S E YD  +D+WS L  M+T+R  A +   +  +F VGG D    L+S E  D   G W  +   S  R GA +   N  +Y+ GG D  + L ++E ++   + WS S+  M   R  +   VL  +L AI G+ G   L ++EC D
Sbjct:  260 LIGANEVLLVIGGFGSQQSPIDVVEKYDPKSQDWSLLPSITRK---RRYVATVSLNER----VYVMGGYDGRSRLSSVECLDYGADEDGVWYSVAPMNVRRGL-------AGATTLGDMIYVAGGFDGSRRHTSMERYDPNIDQWSMLGDMATAREGAGLVVANGVIFCVGGYDGINILNSVERFDPHTGHWSHVSPMSTKRSGAGVALLNDHVYVVGGFDGAAHLASVESYNIRTDTWS-SITSMTTPRCYVGAAVLRGRLYAIAGYDGNSLLSSIECYD 525          

HSP 2 Score: 104.375 bits (259), Expect = 1.907e-23
Identity = 77/278 (27.70%), Postives = 130/278 (46.76%), Query Frame = 1
Query: 1528 LLKKVNTKVSTLERFDCLSTSRCAAGLVNVNDQLIVIGGFNRGECLNSVEIYQPLINK---WSPSLSMKLCRARLVALVGQSDKENPYVYAIGGSDGYKELHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGNLAIVGGCFGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPEPSYSRRGASLVPYNGKLYLFGGSDSNSSLRTLEIFDSVANQWSLSVQQMKQSR--ANLC 2346
            +++K + K         ++  R     V++N+++ V+GG++    L+SVE      ++   W     M + R     L G +   +  +Y  GG DG +   ++ER+D N  +W+ + ++   R   G  V      + G +  VGG  G N L S E +D     WS +  MST RS A VA +++ ++VVGG D    L+S E  ++R   W ++   +  R         G+LY   G D NS L ++E +D + + W + V  M   R  A +C
Sbjct:  282 VVEKYDPKSQDWSLLPSITRKRRYVATVSLNERVYVMGGYDGRSRLSSVECLDYGADEDGVWYSVAPMNVRRG----LAGATTLGD-MIYVAGGFDGSRRHTSMERYDPNIDQWSMLGDMATAREGAGLVV------ANGVIFCVGGYDGINILNSVERFDPHTGHWSHVSPMSTKRSGAGVALLNDHVYVVGGFDGAAHLASVESYNIRTDTWSSITSMTTPRCYVGAAVLRGRLYAIAGYDGNSLLSSIECYDPIIDTWEV-VSSMGTQRCDAGVC 547          

HSP 3 Score: 87.0409 bits (214), Expect = 6.766e-18
Identity = 49/147 (33.33%), Postives = 77/147 (52.38%), Query Frame = 1
Query:   91 LNKLRISKAFCDVTVFAENKEFVAHKVILASSSDYFLSKFT-----EDPKCDRLSINMNKDIFNLLLDYFYTSNLIVSKEKVPQLFSAAKYLKVRRVVKVCAQFLTKILSLDNIIDVRESVALNDSEDLCQAANAFIKENMDKIISN 516
            +N LR S   CDVT+  +  +F AH+++LA+ SDYF + FT     +D  C  L   +      +LLD+ YT  + V+ E V +L  AA  L+++ V + C +FL   L   N + +RE    +   DL QAA  F  ++   ++ N
Sbjct:    2 MNALRKSNTLCDVTLRVDEMDFPAHRIVLAACSDYFCAMFTNELSEKDKPCVDLQ-GLTAATMEILLDFVYTETVHVTVENVQELLPAACLLQLKGVKQACCEFLESQLDPSNCLGIREFAEAHSCMDLQQAAELFSLKHFPDVVYN 147          
BLAST of BTB domain-containing protein vs. Ensembl Sea Lamprey
Match: klhl5 (kelch-like family member 5 [Source:ZFIN;Acc:ZDB-GENE-080424-7])

HSP 1 Score: 132.494 bits (332), Expect = 2.269e-32
Identity = 92/278 (33.09%), Postives = 139/278 (50.00%), Query Frame = 1
Query: 1531 LKKVNTKVSTLERFDCLSTSRCAAGLVNVNDQLIVIGGFNRGECLNSVEIYQPLINKWSPSLSMKLCRARLVALVGQSDKENPYVYAIGGSDGYKELHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGNLAIVGGCFGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTD---SWKC--LSSC-EVMDLREGKWRTMPEPSYSRRGASLVPYNGKLYLFGGSDSNSSLRTLEIFDSVANQWSLSVQQMKQSRANLC 2346
            +++ + + +T  +   LS  R   G+  ++D++ V+GG +  + LN+VE Y P  + WS    M   R  L    G +  E P +YA+GG DG+  L+TVER+D   ++W  VAN++  RS  G AV+       G L  VGG  G + LRS E +D   +KW+    M   R    V++ +  L+ VGG D   S  C  +S C E  D +   W  +   S SR    +     +LY  GG D  + L T+E +D VAN+W+  V  +   RA  C
Sbjct:  314 IERYDLRTNTWTQVAMLSGRRLQFGVAVLDDKVYVVGGRDGLKTLNTVECYNPRTHTWSVLPPMSTHRHGL----GVAVLEGP-MYAVGGHDGWSYLNTVERWDPQARQWNYVANMSNPRSTVGVAVL------NGKLYAVGGRDGSSCLRSVECFDPHTNKWTACAPMCKRRGGVGVSACNGFLYAVGGHDTPASNHCSRISDCVERFDPKTDAWTAVAPLSVSRDAVGVGLLGDRLYAVGGYDGQTYLNTVEAYDPVANEWT-QVAPLCLGRAGAC 579          

HSP 2 Score: 115.161 bits (287), Expect = 8.889e-27
Identity = 76/284 (26.76%), Postives = 123/284 (43.31%), Query Frame = 1
Query: 1783 VYAIGGSDGYKELHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGNLAIVGGCFGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPEPSYSRRGASLVPYNGKLYLFGGSDSNSSLRTLEIFDSVANQWS----------------------------------------------------LSVQQMKQSRANLCGGVLLNKLMAIGGFTGKHFLDTMECVDFDESCEISSEWSMYVPI 2478
            ++A+GG D  K   ++ER+D+    WT+VA ++  R   G AV+         + +VGG  G   L + E Y+     WS L  MST R    VA ++  ++ VGG D W  L++ E  D +  +W  +   S  R    +   NGKLY  GG D +S LR++E FD   N+W+                                                     +V  +  SR  +  G+L ++L A+GG+ G+ +L+T+E  D      +++EW+   P+
Sbjct:  299 MFAVGGMDATKGATSIERYDLRTNTWTQVAMLSGRRLQFGVAVL------DDKVYVVGGRDGLKTLNTVECYNPRTHTWSVLPPMSTHRHGLGVAVLEGPMYAVGGHDGWSYLNTVERWDPQARQWNYVANMSNPRSTVGVAVLNGKLYAVGGRDGSSCLRSVECFDPHTNKWTACAPMCKRRGGVGVSACNGFLYAVGGHDTPASNHCSRISDCVERFDPKTDAWTAVAPLSVSRDAVGVGLLGDRLYAVGGYDGQTYLNTVEAYD-----PVANEWTQVAPL 571          

HSP 3 Score: 101.293 bits (251), Expect = 2.514e-22
Identity = 63/201 (31.34%), Postives = 95/201 (47.26%), Query Frame = 1
Query: 1876 INQERSYHGGAVMPVGASSAGNLAIVGGCFGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPEPSYSRRGASLVPYNGKLYLFGGSDSNSSLRTLEIFDSVANQWSLSVQQMKQSRANLCGGVLLNKLMAIGGFTGKHFLDTMECVDFDESCEISSEWSMYVPI 2478
            + + R    GA      S+ G +  VGG        S E YD   + W+ +  +S  R Q  VA +D++++VVGG D  K L++ E  + R   W  +P  S  R G  +    G +Y  GG D  S L T+E +D  A QW+  V  M   R+ +   VL  KL A+GG  G   L ++EC D       +++W+   P+
Sbjct:  277 LPERRPAMQGASTRPRKSTVGTMFAVGGMDATKGATSIERYDLRTNTWTQVAMLSGRRLQFGVAVLDDKVYVVGGRDGLKTLNTVECYNPRTHTWSVLPPMSTHRHGLGVAVLEGPMYAVGGHDGWSYLNTVERWDPQARQWNY-VANMSNPRSTVGVAVLNGKLYAVGGRDGSSCLRSVECFD-----PHTNKWTACAPM 471          

HSP 4 Score: 77.7962 bits (190), Expect = 6.320e-15
Identity = 57/190 (30.00%), Postives = 86/190 (45.26%), Query Frame = 1
Query: 1552 VSTLERFDC----------LSTSRCAAGLVNVNDQLIVIGGFNRGECLNSVEIYQPLINKWSPSLSMKLCRARLVALVGQSDKENPYVYAIGGSDGYKELHT------VERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGNLAIVGGCFGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASI 2073
            ++T+ER+D           +S  R   G+  +N +L  +GG +   CL SVE + P  NKW+    M  C+ R    VG S   N ++YA+GG D     H       VERFD     WT VA ++  R   G  ++         L  VGG  G   L + E YD   ++W+ +  +   R+ A V ++
Sbjct:  405 LNTVERWDPQARQWNYVANMSNPRSTVGVAVLNGKLYAVGGRDGSSCLRSVECFDPHTNKWTACAPM--CKRR--GGVGVS-ACNGFLYAVGGHDTPASNHCSRISDCVERFDPKTDAWTAVAPLSVSRDAVGVGLL------GDRLYAVGGYDGQTYLNTVEAYDPVANEWTQVAPLCLGRAGACVVTV 583          

HSP 5 Score: 66.6254 bits (161), Expect = 1.663e-11
Identity = 51/215 (23.72%), Postives = 98/215 (45.58%), Query Frame = 1
Query:   70 HSE-LLNRLNKLRISKAFCDVTVFAENKEFVAHKVILASSSDYFLSKFTED---PKCDRLSI-NMNKDIFNLLLDYFYTSNLIVSKEKVPQLFSAAKYLKVRRVVKVCAQFLTKILSLDNIIDVRESVALNDSEDLCQAANAFIKENMDKIISNVKIQKLNMDIMVDTVPKKE----NDSRLAELVIDWLEYSIVEDNMKLSDFVNENLVFFLTP 687
            H+E +  R+      K  CDV + A ++   AH+++L+S SDYF + FT D    K + + +  +       L+ Y YT  L + ++ +  L +AA  L++  VV+ C  FL K L   N + +R         DL + A+ +  EN  +++ N +   L  + + D    +E     +  + + ++ W+ + +      L   +    +  L+P
Sbjct:   32 HAEQMARRMEGYLRHKQLCDVVLLAGDRRIPAHRLVLSSVSDYFAAMFTSDVREAKQEEVKLEGVEPTALWALVQYAYTGRLDLREDTIEGLLAAACLLQLSPVVEACCGFLMKQLHPSNCLGIRSFADAQGCTDLHKVAHNYTMENFLEVMRNQEFLLLPTEAVADLFASEEMNVPGEETVFQALMAWVMHEVETRRHVLPGLLAHVRLPLLSP 246          
BLAST of BTB domain-containing protein vs. Ensembl Nematostella
Match: EDO37852 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SEQ3])

HSP 1 Score: 161.384 bits (407), Expect = 6.768e-42
Identity = 97/295 (32.88%), Postives = 157/295 (53.22%), Query Frame = 1
Query: 1591 RCAAGLVNVNDQLIVIGGFNRGECLNSVEIYQPLINKWSPSLSMKLCRARL-VALVGQSDKENPYVYAIGGSDGYKELHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGNLAIVGGCFGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPEPSYSRRGASLVPYNGKLYLFGGSDSNSSLRTLEIFDSVANQWSLSVQQMKQSRANLCGGVLLNKLMAIGGFTGKHFLDTMECVDFDESCEISSEWSMYV 2472
            RC+ G   VN +L  +GG++RG+CL +V  Y    N+W P  S++  R RL VA++G        +YA+GGSDG+ EL++ E +D  +  W  VA +N  RS  G A +         + +VGG  G +NL++ E+Y+   +KW  +  MS+ R   +  ++D +++V+GG + W   ++ E        W  +    ++RRGA      G LY+ GG D  S L + E +D   N+W+ ++ +M   R N+   V+   + A+GGF G  FL TME  D       +++WS +V
Sbjct:  259 RCSVGAAEVNGKLYAVGGYDRGQCLETVAYYDIQTNEWMPVTSLRRRRGRLQVAILGGK------MYAVGGSDGHSELNSCECYDEASDSWHIVAPMNYCRSNFGMATI------NNRIYVVGGYQGSHNLKTAEVYNPDSNKWVMVTPMSSGRDNLSAVALDGKMYVLGGYNGWAYFNTVECYTPETDSWSFVTPMKFARRGAGAAAVGGYLYVIGGYDGTSFLTSCERYDPSTNEWT-TIAEMNTPRHNVGVAVVNGLIFAVGGFNGSAFLKTMEYYD-----PKTNKWSSFV 535          

HSP 2 Score: 73.559 bits (179), Expect = 2.030e-13
Identity = 49/155 (31.61%), Postives = 71/155 (45.81%), Query Frame = 1
Query: 1579 LSTSRCAAGLVNVNDQLIVIGGFNRGECLNSVEIYQPLINKWSPSLSMKLCRARLVALVGQSDKENPYVYAIGGSDGYKELHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGNLAIVGGCFGPNNLRSCEIYDTTLDKWSDLKSMST 2043
            +S+ R     V ++ ++ V+GG+N     N+VE Y P  + WS    MK            +     Y+Y IGG DG   L + ER+D +   WT +A +N  R   G AV+       G +  VGG  G   L++ E YD   +KWS   S  T
Sbjct:  396 MSSGRDNLSAVALDGKMYVLGGYNGWAYFNTVECYTPETDSWSFVTPMKF-----ARRGAGAAAVGGYLYVIGGYDGTSFLTSCERYDPSTNEWTTIAEMNTPRHNVGVAVV------NGLIFAVGGFNGSAFLKTMEYYDPKTNKWSSFVSSFT 539          

HSP 3 Score: 60.4622 bits (145), Expect = 2.746e-9
Identity = 44/176 (25.00%), Postives = 82/176 (46.59%), Query Frame = 1
Query:   19 MDIPK--SNKLSLIDDRSRHSE-LLNRLNKLRISKAFCDVTVFAENKEFVAHKVILASSSDYFLSKFTEDPKCDRLSI-NMNKDIFNLLLDYFYTSNLIVSKEKVPQLFSAAKYLKVRRVVKVCAQFLTKILSLDNIIDVRESVALNDSEDLCQAANAFIKENMDKIISNVKIQKL 534
            M++P    ++  L   R  H + LL  LN+ R +  FCDV +   + E  AH+ IL++S      + ++  +  ++ +  +  +    ++DY YTS L V  + V  ++ AA+ L +  +V     F+ K +     + +R     ND ++L      FI  N+++I       KL
Sbjct:    1 MEMPSIVQSQSRLTFSRENHEKRLLELLNEQRKATKFCDVLLEVGDSEIAAHRAILSASIPVLSERLSDRKEGLKIKLEGLQHNAVKAIVDYLYTSCLDVPADSVLNVYLAARSLGMNELVSDLEDFIRKEILPTEWLAIRVFAVRNDVQELLAMVEEFIANNIEEIFQKQAFLKL 176          
BLAST of BTB domain-containing protein vs. Ensembl Nematostella
Match: EDO49374 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG74])

HSP 1 Score: 150.984 bits (380), Expect = 3.198e-38
Identity = 106/295 (35.93%), Postives = 145/295 (49.15%), Query Frame = 1
Query: 1597 AAGLVNVNDQLIVIGGFNR-GECLNSVEIYQPLINKWSPSLSMKLCRARLVALVGQSDKENPYVYAIGGSDGYKELHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGNLAIVGGCFGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPEPSYSRRGASLVPYNGKLYLFGGSDSNSSLRTLEIFDSVANQWSLSVQQMKQSRANLCGGVLLNKLMAIGGFTGKHFLDTMECVDFDESCEISSEWSMYVPI 2478
            AAGL+        IGG N  GE L SVE +  L  +WSP+  M   R R    VG +  +N  +YA+GG DG+K L TVE ++    +W   A +N  RS  G A +       G + +VGG  G  +L + E Y  T + WS L  MST RS A V  ++ +LFV+GG +     SS EV D +  KW         R    +   N  +Y+ GG D +S L T+E +D    QWS  V  M   R+ +    L N L AIGG+ G   L+T+EC D       ++ WS   P+
Sbjct:  280 AAGLI------YAIGGLNSSGEALCSVETFDMLSCQWSPTSPMNTLRTR----VGVAVLDN-RLYALGGFDGHKRLSTVEFYNPVLDKWIPAAPMNTRRSALGAATV------NGKIYVVGGYDGHISLSTMECYSATANSWSFLAPMSTLRSAAGVTELNGKLFVIGGHNGLSIFSSVEVYDPQTDKWGPGASLLMRRCRVGVATLNSCIYVCGGYDGSSFLNTVECYDPQTQQWSF-VAPMNTRRSRVAVVALGNCLYAIGGYDGLTNLNTVECFD-----PRANRWSFVSPM 551          

HSP 2 Score: 127.872 bits (320), Expect = 1.299e-30
Identity = 84/286 (29.37%), Postives = 139/286 (48.60%), Query Frame = 1
Query: 1531 LKKVNTKVSTLERFDCLS----------TSRCAAGLVNVNDQLIVIGGFNRGECLNSVEIYQPLINKWSPSLSMKLCRARLVALVGQSDKENPYVYAIGGSDGYKELHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGNLAIVGGCFGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPEPSYSRRGASLVPYNGKLYLFGGSDSNSSLRTLEIFDSVANQWSLSVQQMKQSRANLCGGVL 2358
            L      + ++E FD LS          T R   G+  ++++L  +GGF+  + L++VE Y P+++KW P+  M   R+ L A        N  +Y +GG DG+  L T+E +      W+ +A ++  RS  G   +       G L ++GG  G +   S E+YD   DKW    S+   R +  VA++++ ++V GG D    L++ E  D +  +W  +   +  R   ++V     LY  GG D  ++L T+E FD  AN+WS  V  M + +  +  GVL
Sbjct:  290 LNSSGEALCSVETFDMLSCQWSPTSPMNTLRTRVGVAVLDNRLYALGGFDGHKRLSTVEFYNPVLDKWIPAAPMNTRRSALGAAT-----VNGKIYVVGGYDGHISLSTMECYSATANSWSFLAPMSTLRSAAGVTEL------NGKLFVIGGHNGLSIFSSVEVYDPQTDKWGPGASLLMRRCRVGVATLNSCIYVCGGYDGSSFLNTVECYDPQTQQWSFVAPMNTRRSRVAVVALGNCLYAIGGYDGLTNLNTVECFDPRANRWSF-VSPMCKHQGGVGAGVL 563          

HSP 3 Score: 86.2705 bits (212), Expect = 2.040e-17
Identity = 57/203 (28.08%), Postives = 106/203 (52.22%), Query Frame = 1
Query:   73 SELLNRLNKLRISKAFCDVTVFAENKEFVAHKVILASSSDYFLSKFTEDPKCDRLS-INMNKDIFNLL---LDYFYTSNLIVSKEKVPQLFSAAKYLKVRRVVKVCAQFLTKILSLDNIIDVRESVALNDSEDLCQAANAFIKENMDKIISNVKIQKLNMDIMVDTVPKKENDSRLAELVIDWLEYSIVEDNMKLSDFVNENL 669
            +++ + LN+LR  +  CDVT+  +++  V+H+V+LA++S YF + FT D    RL  + ++   F  L   +++ YT    +  E V  L  A+  L++  V + C +FL + L   N + +R         DL QAA+ F  +N  ++  + + Q L  D +V  +  +E + R  E V + + + + +D  +  DF++E L
Sbjct:   16 TKVFSSLNELRSEEKLCDVTLVVKDRSLVSHRVVLAAASPYFNAMFTGDMLESRLQKVTLHGIEFAALEELINFCYTGRTEIHVENVQSLMCASSLLQLSNVKQACVEFLHRALHPANCLGIRSFADTFCCGDLVQAADVFALKNFSEVSQSEEFQALAPDEVVALISSEELNVRAEEEVFEAVMFWLKKDLDERRDFLSELL 218          

HSP 4 Score: 72.4034 bits (176), Expect = 5.012e-13
Identity = 41/111 (36.94%), Postives = 59/111 (53.15%), Query Frame = 1
Query: 1591 RCAAGLVNVNDQLIVIGGFNRGECLNSVEIYQPLINKWSPSLSMKLCRARLVALVGQSDKENPYVYAIGGSDGYKELHTVERFDVNNQRWTRVANINQERSYHGGAVMPVG 1923
            RC  G+  +N  + V GG++    LN+VE Y P   +WS    M   R+R VA+V   +     +YAIGG DG   L+TVE FD    RW+ V+ + + +   G  V+P G
Sbjct:  461 RCRVGVATLNSCIYVCGGYDGSSFLNTVECYDPQTQQWSFVAPMNTRRSR-VAVVALGN----CLYAIGGYDGLTNLNTVECFDPRANRWSFVSPMCKHQGGVGAGVLPRG 566          
BLAST of BTB domain-containing protein vs. Ensembl Nematostella
Match: EDO47170 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMV8])

HSP 1 Score: 146.362 bits (368), Expect = 9.456e-37
Identity = 95/285 (33.33%), Postives = 146/285 (51.23%), Query Frame = 1
Query: 1552 VSTLERFD----------CLSTSRCAAGLVNVNDQLIVIGGFNRGECLNSVEIYQPLINKWSPSLS-MKLCRARL-VALVGQSDKENPYVYAIGGSDGYKELHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGNLAIVGGCFGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPEPSYSRRGASLVPYNGKLYLFGGSDSNSSLRTLEIFDSVANQWSLSVQQMKQSRANLCGGVLLNKL 2370
            +S++ER+D           +   RC  G+  +++ L  +GG +    LNSVE Y P  N+WS  ++    CR  + VA++      + ++YA+GG DG   L+ VE++D +  RW RVA ++  R   G AV+         L  +GG  G + L + E YD + +KW  + SM T R     A   ++L+VVGG D    LSS E  D +  +W  +   +  R G  L   NG+L   GG D  + L+T+E+FD++ NQW +S   M   R  L GGV + +L
Sbjct:  290 ISSVERYDPQTSEWKMVATMMKRRCGVGVTVLDNLLYAVGGHDGSSYLNSVERYDPKTNQWSSEVAPTSTCRTSVGVAVL------DGFMYAVGGQDGVSCLNIVEKYDPSENRWARVAPMSTRRLGVGVAVVD------SFLYAIGGSDGTSPLNTVERYDPSCNKWVSVASMGTRRKHLGAAVFQDKLYVVGGRDDATELSSAERYDPKTNQWSPVVAMNSRRSGVGLAVVNGQLLAVGGFDGTTYLKTIEVFDTLTNQWKMS-GGMNYRR--LGGGVGVVRL 559          

HSP 2 Score: 132.494 bits (332), Expect = 3.919e-32
Identity = 88/281 (31.32%), Postives = 143/281 (50.89%), Query Frame = 1
Query: 1627 LIVIGGFNRGECLNSVEIYQPLINKWSPSLSMKLCRARLVALVGQSDKENPYVYAIGGSDGYKELHTVERFDVNNQRW-TRVANINQERSYHGGAVMPVGASSAGNLAIVGGCFGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPEPSYSRRGASLVPYNGKLYLFGGSDSNSSLRTLEIFDSVANQWSLSVQQMKQSRANLCGGVLLNKLMAIGGFTGKHFLDTMECVDFDESCEISSEWSM 2466
            +  +GG+  G+ ++SVE Y P  ++W    +M   R      VG +  +N  +YA+GG DG   L++VER+D    +W + VA  +  R+  G AV+       G +  VGG  G + L   E YD + ++W+ +  MST R    VA +D+ L+ +GG+D    L++ E  D    KW ++      R+      +  KLY+ GG D  + L + E +D   NQWS  V  M   R+ +   V+  +L+A+GGF G  +L T+E  D      ++++W M
Sbjct:  278 IFAVGGWCSGDAISSVERYDPQTSEWKMVATMMKRRCG----VGVTVLDN-LLYAVGGHDGSSYLNSVERYDPKTNQWSSEVAPTSTCRTSVGVAVLD------GFMYAVGGQDGVSCLNIVEKYDPSENRWARVAPMSTRRLGVGVAVVDSFLYAIGGSDGTSPLNTVERYDPSCNKWVSVASMGTRRKHLGAAVFQDKLYVVGGRDDATELSSAERYDPKTNQWS-PVVAMNSRRSGVGLAVVNGQLLAVGGFDGTTYLKTIEVFD-----TLTNQWKM 541          

HSP 3 Score: 113.62 bits (283), Expect = 4.416e-26
Identity = 79/248 (31.85%), Postives = 122/248 (49.19%), Query Frame = 1
Query: 1513 TVLQQLLKKV-----NTKVSTLERFDC-----------LSTSRCAAGLVNVNDQLIVIGGFNRGECLNSVEIYQPLINKWSPSLSMKLCRARL-VALVGQSDKENPYVYAIGGSDGYKELHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGNLAIVGGCFGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPEPSYSRRGASL 2205
            TVL  LL  V     ++ ++++ER+D             ST R + G+  ++  +  +GG +   CLN VE Y P  N+W+    M   R  + VA+V      + ++YAIGGSDG   L+TVER+D +  +W  VA++   R + G AV          L +VGG      L S E YD   ++WS + +M++ RS   +A ++ QL  VGG D    L + EV D    +W+     +Y R G  +
Sbjct:  319 TVLDNLLYAVGGHDGSSYLNSVERYDPKTNQWSSEVAPTSTCRTSVGVAVLDGFMYAVGGQDGVSCLNIVEKYDPSENRWARVAPMSTRRLGVGVAVV------DSFLYAIGGSDGTSPLNTVERYDPSCNKWVSVASMGTRRKHLGAAVF------QDKLYVVGGRDDATELSSAERYDPKTNQWSPVVAMNSRRSGVGLAVVNGQLLAVGGFDGTTYLKTIEVFDTLTNQWKMSGGMNYRRLGGGV 554          

HSP 4 Score: 90.8929 bits (224), Expect = 7.241e-19
Identity = 64/263 (24.33%), Postives = 124/263 (47.15%), Query Frame = 1
Query:   67 RHS-ELLNRLNKLRISKAFCDVTVFAENKEFVAHKVILASSSDYFLSKFTEDPKCDRLSINMNKDI----FNLLLDYFYTSNLIVSKEKVPQLFSAAKYLKVRRVVKVCAQFLTKILSLDNIIDVRESVALNDSEDLCQAANAFIKENMDKIISNVKIQKLNMDIMVDTVPKKENDSRLAE----LVIDWLEYSIVEDNMKLSDFVNENLVFFLTPS--NSLVQCSEMASSNKFSSTFINDYFNG-FLSYQKNISKRVKCRPR 819
            RH  + L+ L  LR  +  CDV +   +    AH+V+LA+ S YF + FT +    R +    +D+     NLL+ + YT+++ + +  V  L  AA  L++  + ++C +FL + L   N + +R     +   DL + A+ F + N  +++ + +   L    +VD +   E + R  E     V++W++Y++ E    LS  +    +  L P     +V    +  S++     +++  N   L  Q+ + +  + RPR
Sbjct:    7 RHPKQTLDSLEALRQCEELCDVVIKVGSSTIHAHRVVLAACSPYFRAMFTREMAESRQAEITIRDVDESAMNLLITFAYTASITIEETNVQTLLPAACLLQLTEIQEICCEFLKRQLDPSNCLGIRAFADTHSCRDLLRVADLFTQHNFQEVMESEEFLLLPFAQLVDILSSDELNVRSEEQVFYAVMNWMKYNVTERRAYLSHILQHVRLPLLGPKFLVGVVGTDGLIKSDETCRDLVDEAKNYLLLPEQRLLMQGPRTRPR 269          

HSP 5 Score: 85.8853 bits (211), Expect = 3.301e-17
Identity = 60/182 (32.97%), Postives = 86/182 (47.25%), Query Frame = 1
Query: 1528 LLKKVNTKVSTLERFDCLSTSRCAAGLVNVNDQLIVIGGFNRGECLNSVEIYQPLINKWSPSLSMKLCRARLVALVGQSDKENPYVYAIGGSDGYKELHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGNLAIVGGCFGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASI 2073
            +++K +   +   R   +ST R   G+  V+  L  IGG +    LN+VE Y P  NKW    SM   R  L A V Q DK    +Y +GG D   EL + ER+D    +W+ V  +N  RS  G AV+       G L  VGG  G   L++ E++DT  ++W     M+  R    V  +
Sbjct:  387 IVEKYDPSENRWARVAPMSTRRLGVGVAVVDSFLYAIGGSDGTSPLNTVERYDPSCNKWVSVASMGTRRKHLGAAVFQ-DK----LYVVGGRDDATELSSAERYDPKTNQWSPVVAMNSRRSGVGLAVV------NGQLLAVGGFDGTTYLKTIEVFDTLTNQWKMSGGMNYRRLGGGVGVV 557          

HSP 6 Score: 58.151 bits (139), Expect = 1.252e-8
Identity = 39/132 (29.55%), Postives = 60/132 (45.45%), Query Frame = 1
Query: 2083 LFVVGGTDSWKCLSSCEVMDLREGKWRTMPEPSYSRRGASLVPYNGKLYLFGGSDSNSSLRTLEIFDSVANQWSLSVQQMKQSRANLCGGVLLNKLMAIGGFTGKHFLDTMECVDFDESCEISSEWSMYVPI 2478
            +F VGG  S   +SS E  D +  +W+ +      R G  +   +  LY  GG D +S L ++E +D   NQWS  V      R ++   VL   + A+GG  G   L+ +E  D  E     + W+   P+
Sbjct:  278 IFAVGGWCSGDAISSVERYDPQTSEWKMVATMMKRRCGVGVTVLDNLLYAVGGHDGSSYLNSVERYDPKTNQWSSEVAPTSTCRTSVGVAVLDGFMYAVGGQDGVSCLNIVEKYDPSE-----NRWARVAPM 404          
BLAST of BTB domain-containing protein vs. Ensembl Nematostella
Match: EDO38065 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDY1])

HSP 1 Score: 137.887 bits (346), Expect = 4.753e-34
Identity = 89/269 (33.09%), Postives = 129/269 (47.96%), Query Frame = 1
Query: 1627 LIVIGGFNRGECL-NSVEIYQPLINKWSPSLSMKLCRARL-VALVGQSDKENPYVYAIGGSDGYKELHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGNLAIVGGCFGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPEPSYSRRGASLVPYNGKLYLFGGSDSNSSLRTLEIFDSVANQWSLSVQQMKQSRANLCGGVLLNKLMAIGGFTGKHFLDTMECVD 2427
            +  IGG   GE + N+ E Y    N W  S  + + R +L V  +G        +YA+GGS+GY  L TVE F   + +WT   ++N  RS  G  V+         L  +GG  G   L++ E YD  +D WS + S + +RS   VA +  +LFV+GG D    L+S E  D    KW T+P     R G      +G L+  GG D    L  +E+F+S  N W+  V  +K  R  +C       + A+GG  G  +L+T+E  D
Sbjct:  262 MFAIGGKEAGETISNTTECYSLQTNTWQSSAPLIVPRQQLGVGNIGNR------LYAVGGSNGYTRLSTVEMFTPESNKWTYCKSLNTSRSGVGLGVL------GETLYALGGYDGRTCLKTVERYDPQVDCWSSVASTTVTRSFPGVAELGGRLFVIGGNDGASFLNSVECYDPLSNKWTTLPSMCRPRAGIGAGAIDGLLFAIGGFDGMLRLDIVEMFESRMNTWT-QVSPLKSCRDGVCVAAYGCWIYAVGGIDGPSYLNTVEAYD 517          

HSP 2 Score: 124.02 bits (310), Expect = 1.821e-29
Identity = 80/254 (31.50%), Postives = 124/254 (48.82%), Query Frame = 1
Query: 1579 LSTSRCAAGLVNVNDQLIVIGGFNRGECLNSVEIYQPLINKWSPSLSMKLCRARL-VALVGQSDKENPYVYAIGGSDGYKELHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGNLAIVGGCFGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPEPSYSRRGASLVPYNGKLYLFGGSDSNSSLRTLEIFDSVANQWSLSVQQMKQSRA 2337
            L   R   G+ N+ ++L  +GG N    L++VE++ P  NKW+   S+   R+ + + ++G++      +YA+GG DG   L TVER+D     W+ VA+    RS+ G A +       G L ++GG  G + L S E YD   +KW+ L SM   R+     +ID  LF +GG D    L   E+ + R   W  +      R G  +  Y   +Y  GG D  S L T+E +D   + W  ++  M + RA
Sbjct:  294 LIVPRQQLGVGNIGNRLYAVGGSNGYTRLSTVEMFTPESNKWTYCKSLNTSRSGVGLGVLGET------LYALGGYDGRTCLKTVERYDPQVDCWSSVASTTVTRSFPGVAEL------GGRLFVIGGNDGASFLNSVECYDPLSNKWTTLPSMCRPRAGIGAGAIDGLLFAIGGFDGMLRLDIVEMFESRMNTWTQVSPLKSCRDGVCVAAYGCWIYAVGGIDGPSYLNTVEAYDPKTDLWE-TMPSMSRCRA 534          

HSP 3 Score: 97.0561 bits (240), Expect = 8.386e-21
Identity = 66/232 (28.45%), Postives = 113/232 (48.71%), Query Frame = 1
Query: 1546 TKVSTLERF----------DCLSTSRCAAGLVNVNDQLIVIGGFNRGECLNSVEIYQPLINKWSPSLSMKLCRA-RLVALVGQSDKENPYVYAIGGSDGYKELHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGNLAIVGGCFGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPEPSYSRRGASLV 2208
            T++ST+E F            L+TSR   GL  + + L  +GG++   CL +VE Y P ++ WS   S  + R+   VA +G        ++ IGG+DG   L++VE +D  + +WT + ++ + R+  G   +       G L  +GG  G   L   E++++ ++ W+ +  + + R    VA+    ++ VGG D    L++ E  D +   W TMP  S  R  A +V
Sbjct:  320 TRLSTVEMFTPESNKWTYCKSLNTSRSGVGLGVLGETLYALGGYDGRTCLKTVERYDPQVDCWSSVASTTVTRSFPGVAELGGR------LFVIGGNDGASFLNSVECYDPLSNKWTTLPSMCRPRAGIGAGAID------GLLFAIGGFDGMLRLDIVEMFESRMNTWTQVSPLKSCRDGVCVAAYGCWIYAVGGIDGPSYLNTVEAYDPKTDLWETMPSMSRCRAAAGVV 539          

HSP 4 Score: 78.9518 bits (193), Expect = 4.513e-15
Identity = 54/195 (27.69%), Postives = 85/195 (43.59%), Query Frame = 1
Query: 1879 NQERSYHGGAVMPVGASSAGNLAIVGGCFGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPEPSYSRRGASLVPYNGKLYLFGGSDSNSSLRTLEIFDSVANQWSLSVQQMKQSRANLCGGVLLNKLMAIGGFTGKHFLDTMECVDFDESCEISSEWS 2463
            +Q   +    + P  +      AI G   G     + E Y    + W     +   R Q  V +I N+L+ VGG++ +  LS+ E+      KW      + SR G  L      LY  GG D  + L+T+E +D   + WS SV     +R+      L  +L  IGG  G  FL+++EC D      +S++W+
Sbjct:  242 DQRARFRSDRMRPRKSMMGTMFAIGGKEAGETISNTTECYSLQTNTWQSSAPLIVPRQQLGVGNIGNRLYAVGGSNGYTRLSTVEMFTPESNKWTYCKSLNTSRSGVGLGVLGETLYALGGYDGRTCLKTVERYDPQVDCWS-SVASTTVTRSFPGVAELGGRLFVIGGNDGASFLNSVECYD-----PLSNKWT 430          

HSP 5 Score: 67.0106 bits (162), Expect = 2.101e-11
Identity = 41/191 (21.47%), Postives = 86/191 (45.03%), Query Frame = 1
Query:  109 SKAFCDVTVFAENKEFVAHKVILASSSDYFLSKFTEDPKCDRLSINMNKDIF----NLLLDYFYTSNLIVSKEKVPQLFSAAKYLKVRRVVKVCAQFLTKILSLDNIIDVRESVALNDSEDLCQAANAFIKENMDKIISNVKIQKLNMDIMVDTVPKKE----NDSRLAELVIDWLEYSIVEDNMKLSDFV 657
            S   CDV +  + + +  H+ +LAS S YF + F  +    +  I   KDI      +L+++ YT  + ++ E V  L + A  L+   V  +C QFL   L   N + +R+    +      +  + ++ EN  +++ + +   L  +++V  +   +     +  + E V++W+ + +     KL   +
Sbjct:    8 STKLCDVVLRIDEQSYAGHRAVLASCSAYFYAMFNGELAESKQKIITMKDILPDYMQVLVEFAYTGRVEITVENVQNLLATASLLQFHEVKDLCCQFLESQLDPSNCLGIRKFTESHGCCKFLEVIDKYVLENFKQVMKSEEYALLPSELLVKVISSDDLNIIEEEEVFEAVMNWIRHDLNTRVAKLPSLI 198          

HSP 6 Score: 58.9214 bits (141), Expect = 8.044e-9
Identity = 50/178 (28.09%), Postives = 76/178 (42.70%), Query Frame = 1
Query: 1546 TKVSTLERFD----CLST------SRCAAGLVNVNDQLIVIGGFNRGECLNSVEIYQPLINKWSPSLSMKLCRAR----------LVALVGQSD-------------------KENP---------------YVYAIGGSDGYKELHTVERFDVNNQRWTRVANINQERSYHGGAVMP 1917
            T + T+ER+D    C S+      +R   G+  +  +L VIGG +    LNSVE Y PL NKW+   SM  CR R          L+  +G  D                   + +P               ++YA+GG DG   L+TVE +D     W  + ++++ R+  G  V+P
Sbjct:  367 TCLKTVERYDPQVDCWSSVASTTVTRSFPGVAELGGRLFVIGGNDGASFLNSVECYDPLSNKWTTLPSM--CRPRAGIGAGAIDGLLFAIGGFDGMLRLDIVEMFESRMNTWTQVSPLKSCRDGVCVAAYGCWIYAVGGIDGPSYLNTVEAYDPKTDLWETMPSMSRCRAAAGVVVLP 542          
BLAST of BTB domain-containing protein vs. Ensembl Nematostella
Match: EDO42382 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1L8])

HSP 1 Score: 131.724 bits (330), Expect = 6.236e-32
Identity = 83/268 (30.97%), Postives = 139/268 (51.87%), Query Frame = 1
Query: 1579 LSTSRCAAGLVNVNDQLIVIGGFNRGECLNSVEIYQPLINKWSPSLSMKLCRARL-VALVGQSDKENPYVYAIGGSDGYKELHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGNLAIVGGCFGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPEPSYSRRGASLVPYNGKLYLFGGSDSNSSLRTLEIFDSVANQWSLSVQQMKQSRANLCGGVLLNKLMAI 2379
            +ST R   G+  VN  +  +GG++    L +VE+Y P  N+WS    M   R+ L VA++      +  +YA+GG DG   L+++ER+D    +WT VA ++ +R Y    V+       G +  VGG  G ++L + E +D   + W  + +M++ RS A V  ++N L+VVGG D   CL++ E  +     W ++   S  R    +      LY  GG+D +SSL ++E +D   N WS +V  M   R+++  GV +  ++ +
Sbjct:  325 MSTKRARVGVGVVNGCIYAVGGYDGSVDLATVEVYCPQDNQWSTVTPMGTRRSCLGVAVI------SGLIYAVGGYDGASCLNSIERYDPLTAQWTSVAAMSTKRRYVRVGVV------GGIIYAVGGYDGSSHLNTVECFDPVTNTWKSVANMASRRSSAGVVVLNNMLYVVGGNDGASCLNTMERYNPETNTWTSLAAMSVRRSTHDIAIIESCLYAVGGNDGSSSLNSIEKYDPATNMWS-TVVPMSTRRSSV--GVTVAGVLVV 577          

HSP 2 Score: 123.25 bits (308), Expect = 4.175e-29
Identity = 87/286 (30.42%), Postives = 142/286 (49.65%), Query Frame = 1
Query: 1627 LIVIGGFNRGECLNSVEIYQPLINKWSPSLSMKLCRARL-VALVGQSDKENPYVYAIGGSDGYKELHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGNLAIVGGCFGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPEPSYSRRGASLVPYNGKLYLFGGSDSNSSLRTLEIFDSVANQW-SLSVQQMKQSRANLCGGVLLNKLMAIGGFTGKHFLDTMECVDFDESCEISSEWSMYVPI 2478
            L  IGG +     +  E Y P I++W     M   RAR+ V +V      N  +YA+GG DG  +L TVE +   + +W+ V  +   RS  G AV+      +G +  VGG  G + L S E YD    +W+ + +MST R    V  +   ++ VGG D    L++ E  D     W+++   +  R  A +V  N  LY+ GG+D  S L T+E ++   N W SL+   +++S  ++   ++ + L A+GG  G   L+++E   +D +   ++ WS  VP+
Sbjct:  294 LFAIGGGSLFAIHSECECYDPRIDRWCMITPMSTKRARVGVGVV------NGCIYAVGGYDGSVDLATVEVYCPQDNQWSTVTPMGTRRSCLGVAVI------SGLIYAVGGYDGASCLNSIERYDPLTAQWTSVAAMSTKRRYVRVGVVGGIIYAVGGYDGSSHLNTVECFDPVTNTWKSVANMASRRSSAGVVVLNNMLYVVGGNDGASCLNTMERYNPETNTWTSLAAMSVRRSTHDI--AIIESCLYAVGGNDGSSSLNSIE--KYDPA---TNMWSTVVPM 560          

HSP 3 Score: 109.383 bits (272), Expect = 1.137e-24
Identity = 71/214 (33.18%), Postives = 102/214 (47.66%), Query Frame = 1
Query: 1777 PYVYAIGGSDGYKELHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGNLAIVGGCFGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPEPSYSRRGASLVPYNGKLYLFGGSDSNSSLRTLEIFDSVANQWSLSVQQMKQSRANLCGGVLLNKLMAIGGFTGKHFLDTME 2418
            P ++AIGG   +      E +D    RW  +  ++ +R+  G  V+       G +  VGG  G  +L + E+Y    ++WS +  M T RS   VA I   ++ VGG D   CL+S E  D    +W ++   S  RR   +    G +Y  GG D +S L T+E FD V N W  SV  M   R++    VL N L  +GG  G   L+TME
Sbjct:  292 PILFAIGGGSLFAIHSECECYDPRIDRWCMITPMSTKRARVGVGVV------NGCIYAVGGYDGSVDLATVEVYCPQDNQWSTVTPMGTRRSCLGVAVISGLIYAVGGYDGASCLNSIERYDPLTAQWTSVAAMSTKRRYVRVGVVGGIIYAVGGYDGSSHLNTVECFDPVTNTWK-SVANMASRRSSAGVVVLNNMLYVVGGNDGASCLNTME 498          

HSP 4 Score: 71.2478 bits (173), Expect = 1.042e-12
Identity = 42/184 (22.83%), Postives = 93/184 (50.54%), Query Frame = 1
Query:   91 LNKLRISKAFCDVTVFAENKEFVAHKVILASSSDYFLSKFTED---PKCDRLSI-NMNKDIFNLLLDYFYTSNLIVSKEKVPQLFSAAKYLKVRRVVKVCAQFLTKILSLDNIIDVRESVALNDSEDLCQAANAFIKENMDKIISNVKIQKLNMDIMVDTVPKKE----NDSRLAELVIDWLEY 618
            + ++R +   CDV +   ++   AH+++LA+ S YF + FT +    +   +S+  +  D   LL+++ YT+ + VS++ V  L  AA  L++  V   C +FL   L   N + +R    ++   DL +++  F  ++  ++    +   L ++ ++D +   +    N+ ++   VI W+++
Sbjct:   32 MKQMRCNSELCDVVLLVGDRRIYAHRLVLAACSQYFHAMFTSELLESRQKEISLQGLQPDAMELLVEFAYTARIQVSEDNVQALLPAASLLQLESVKDACCEFLKNQLHPSNCLGIRSFADVHVCTDLHESSYRFALQHFVEVSQTEEFMLLKVNEVLDLISSNDLNVKNEEQVFNGVISWVKH 215          
BLAST of BTB domain-containing protein vs. Ensembl Medaka
Match: ivns1abpa (influenza virus NS1A binding protein [Source:NCBI gene;Acc:101173694])

HSP 1 Score: 169.859 bits (429), Expect = 8.566e-44
Identity = 98/328 (29.88%), Postives = 169/328 (51.52%), Query Frame = 1
Query: 1483 FTDSKSDDQST------VLQQLLKKVNTKVSTLERFDCLSTSRCAAGLVNVNDQLIVIGGFNRGECLNSVEIYQPLINKWSPSLSMKLCRAR--LVALVGQSDKENPYVYAIGGSDGYK-ELHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGNLAIVGGC--FGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPEPSYSRRGASLVPYNGKLYLFGGSDSNSSLRTLEIFDSVANQWSLSVQQMKQSRANLCGGVLLNKLMAIGGFTGKHFLDTMECVDFD 2433
            F   +S  Q++      +++ L  +V  + S       +  +R   G   +N +LI  GG+NR ECL +VE Y P  ++W+    M+  RAR  +  L+GQ       ++ +GGS+G+  EL++ E +D +   W +V  +   R   G   +         L +VGG    G   L++C+ +D     WS+  S++  R QAAV  +D  ++ +GG +SW CL++ E  +     W  +   + +RRGA++  + GKL++ GG D + +LR +E++D   N+W + +  M  SR+N    VL   + A+GGF G  FL+T+E  + +
Sbjct:  284 FLHGRSSPQTSPSATPCLMKSLSFEVQPEESEEHPLSPMHYARSGLGTAALNGKLIAAGGYNREECLRTVECYDPTEDRWTFIAPMRTPRARFQMAVLMGQ-------LFVVGGSNGHSDELNSGETYDPHTDEWIQVPELRTNRCNAGVCAL------NNKLYVVGGSDPCGQKGLKNCDAFDPVNKSWSNCASLNIRRHQAAVCELDGFMYAIGGAESWNCLNTVERYNPDNNTWTLVAPMNVARRGAAVAVHAGKLFVVGGFDGSRALRCVEVYDPSRNEWKM-LGSMTSSRSNAGVAVLDESIYAVGGFDGNDFLNTVEVYNLE 597          

HSP 2 Score: 119.013 bits (297), Expect = 3.429e-27
Identity = 75/202 (37.13%), Postives = 114/202 (56.44%), Query Frame = 1
Query: 1579 LSTSRCAAGLVNVNDQLIVIGGFNR--GECLNSVEIYQPLINKWSPSLSMKLCRARLVALVGQSDKENPYVYAIGGSDGYKELHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGNLAIVGGCFGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPEP 2178
            L T+RC AG+  +N++L V+GG +    + L + + + P+   WS   S+ + R +  A V + D    ++YAIGG++ +  L+TVER++ +N  WT VA +N  R   G AV    A  AG L +VGG  G   LR  E+YD + ++W  L SM++SRS A VA +D  ++ VGG D    L++ EV +L   KW     P
Sbjct:  417 LRTNRCNAGVCALNNKLYVVGGSDPCGQKGLKNCDAFDPVNKSWSNCASLNIRRHQ--AAVCELDG---FMYAIGGAESWNCLNTVERYNPDNNTWTLVAPMNVAR--RGAAV----AVHAGKLFVVGGFDGSRALRCVEVYDPSRNEWKMLGSMTSSRSNAGVAVLDESIYAVGGFDGNDFLNTVEVYNLEMDKWNDCASP 607          

HSP 3 Score: 91.2781 bits (225), Expect = 2.123e-18
Identity = 55/216 (25.46%), Postives = 106/216 (49.07%), Query Frame = 1
Query:   37 NKLSLIDDRSRHSELLNRLNKLRISKAFCDVTVFAENKEFVAHKVILASSSDYFLSKFTEDPKCDRLSI----NMNKDIFNLLLDYFYTSNLIVSKEKVPQLFSAAKYLKVRRVVKVCAQFLTKILSLDNIIDVRESVALNDSEDLCQAANAFIKENMDKIISN---VKIQKLNMDIMVDTVPKKENDSRLAELVIDWLEYSIVEDNMKLSDFVNE 663
            N   + +D +     + ++N LR S  FCDV +     E +AH+ +LA  S Y    F  D +   +S     ++N +   +LL+Y YT+ L   KE V  ++SAAK  K+ RV ++C  +L   +   N I  R   +      L    +AFI++++  +      +K+ +L +++M++      ++ +L   V++W++  + E+  +L   + E
Sbjct:    4 NGFLIFEDENFMDSTVAKMNALRKSGQFCDVRLQVCGHELMAHRAVLACCSPYLFEIFNSDVEAHGVSHVTFEDLNPEAVEVLLNYAYTAQLKADKELVKDVYSAAKRFKMERVKQICGDYLLSKMDSQNAISFRNFASSMGDGRLVAKVDAFIQDHLLDVSEQDDFLKLPRLKLEVMLEDNLTLPSNGKLYSKVLNWVQRCLWENGEQLEQLMEE 219          
BLAST of BTB domain-containing protein vs. Ensembl Medaka
Match: ivns1abpa (influenza virus NS1A binding protein [Source:NCBI gene;Acc:101173694])

HSP 1 Score: 170.244 bits (430), Expect = 1.330e-43
Identity = 98/328 (29.88%), Postives = 169/328 (51.52%), Query Frame = 1
Query: 1483 FTDSKSDDQST------VLQQLLKKVNTKVSTLERFDCLSTSRCAAGLVNVNDQLIVIGGFNRGECLNSVEIYQPLINKWSPSLSMKLCRAR--LVALVGQSDKENPYVYAIGGSDGYK-ELHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGNLAIVGGC--FGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPEPSYSRRGASLVPYNGKLYLFGGSDSNSSLRTLEIFDSVANQWSLSVQQMKQSRANLCGGVLLNKLMAIGGFTGKHFLDTMECVDFD 2433
            F   +S  Q++      +++ L  +V  + S       +  +R   G   +N +LI  GG+NR ECL +VE Y P  ++W+    M+  RAR  +  L+GQ       ++ +GGS+G+  EL++ E +D +   W +V  +   R   G   +         L +VGG    G   L++C+ +D     WS+  S++  R QAAV  +D  ++ +GG +SW CL++ E  +     W  +   + +RRGA++  + GKL++ GG D + +LR +E++D   N+W + +  M  SR+N    VL   + A+GGF G  FL+T+E  + +
Sbjct:  337 FLHGRSSPQTSPSATPCLMKSLSFEVQPEESEEHPLSPMHYARSGLGTAALNGKLIAAGGYNREECLRTVECYDPTEDRWTFIAPMRTPRARFQMAVLMGQ-------LFVVGGSNGHSDELNSGETYDPHTDEWIQVPELRTNRCNAGVCAL------NNKLYVVGGSDPCGQKGLKNCDAFDPVNKSWSNCASLNIRRHQAAVCELDGFMYAIGGAESWNCLNTVERYNPDNNTWTLVAPMNVARRGAAVAVHAGKLFVVGGFDGSRALRCVEVYDPSRNEWKM-LGSMTSSRSNAGVAVLDESIYAVGGFDGNDFLNTVEVYNLE 650          

HSP 2 Score: 119.398 bits (298), Expect = 3.332e-27
Identity = 75/202 (37.13%), Postives = 114/202 (56.44%), Query Frame = 1
Query: 1579 LSTSRCAAGLVNVNDQLIVIGGFNR--GECLNSVEIYQPLINKWSPSLSMKLCRARLVALVGQSDKENPYVYAIGGSDGYKELHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGNLAIVGGCFGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPEP 2178
            L T+RC AG+  +N++L V+GG +    + L + + + P+   WS   S+ + R +  A V + D    ++YAIGG++ +  L+TVER++ +N  WT VA +N  R   G AV    A  AG L +VGG  G   LR  E+YD + ++W  L SM++SRS A VA +D  ++ VGG D    L++ EV +L   KW     P
Sbjct:  470 LRTNRCNAGVCALNNKLYVVGGSDPCGQKGLKNCDAFDPVNKSWSNCASLNIRRHQ--AAVCELDG---FMYAIGGAESWNCLNTVERYNPDNNTWTLVAPMNVAR--RGAAV----AVHAGKLFVVGGFDGSRALRCVEVYDPSRNEWKMLGSMTSSRSNAGVAVLDESIYAVGGFDGNDFLNTVEVYNLEMDKWNDCASP 660          

HSP 3 Score: 91.2781 bits (225), Expect = 1.973e-18
Identity = 55/216 (25.46%), Postives = 106/216 (49.07%), Query Frame = 1
Query:   37 NKLSLIDDRSRHSELLNRLNKLRISKAFCDVTVFAENKEFVAHKVILASSSDYFLSKFTEDPKCDRLSI----NMNKDIFNLLLDYFYTSNLIVSKEKVPQLFSAAKYLKVRRVVKVCAQFLTKILSLDNIIDVRESVALNDSEDLCQAANAFIKENMDKIISN---VKIQKLNMDIMVDTVPKKENDSRLAELVIDWLEYSIVEDNMKLSDFVNE 663
            N   + +D +     + ++N LR S  FCDV +     E +AH+ +LA  S Y    F  D +   +S     ++N +   +LL+Y YT+ L   KE V  ++SAAK  K+ RV ++C  +L   +   N I  R   +      L    +AFI++++  +      +K+ +L +++M++      ++ +L   V++W++  + E+  +L   + E
Sbjct:    4 NGFLIFEDENFMDSTVAKMNALRKSGQFCDVRLQVCGHELMAHRAVLACCSPYLFEIFNSDVEAHGVSHVTFEDLNPEAVEVLLNYAYTAQLKADKELVKDVYSAAKRFKMERVKQICGDYLLSKMDSQNAISFRNFASSMGDGRLVAKVDAFIQDHLLDVSEQDDFLKLPRLKLEVMLEDNLTLPSNGKLYSKVLNWVQRCLWENGEQLEQLMEE 219          
BLAST of BTB domain-containing protein vs. Ensembl Medaka
Match: ivns1abpa (influenza virus NS1A binding protein [Source:NCBI gene;Acc:101173694])

HSP 1 Score: 169.859 bits (429), Expect = 1.344e-43
Identity = 98/328 (29.88%), Postives = 169/328 (51.52%), Query Frame = 1
Query: 1483 FTDSKSDDQST------VLQQLLKKVNTKVSTLERFDCLSTSRCAAGLVNVNDQLIVIGGFNRGECLNSVEIYQPLINKWSPSLSMKLCRAR--LVALVGQSDKENPYVYAIGGSDGYK-ELHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGNLAIVGGC--FGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPEPSYSRRGASLVPYNGKLYLFGGSDSNSSLRTLEIFDSVANQWSLSVQQMKQSRANLCGGVLLNKLMAIGGFTGKHFLDTMECVDFD 2433
            F   +S  Q++      +++ L  +V  + S       +  +R   G   +N +LI  GG+NR ECL +VE Y P  ++W+    M+  RAR  +  L+GQ       ++ +GGS+G+  EL++ E +D +   W +V  +   R   G   +         L +VGG    G   L++C+ +D     WS+  S++  R QAAV  +D  ++ +GG +SW CL++ E  +     W  +   + +RRGA++  + GKL++ GG D + +LR +E++D   N+W + +  M  SR+N    VL   + A+GGF G  FL+T+E  + +
Sbjct:  321 FLHGRSSPQTSPSATPCLMKSLSFEVQPEESEEHPLSPMHYARSGLGTAALNGKLIAAGGYNREECLRTVECYDPTEDRWTFIAPMRTPRARFQMAVLMGQ-------LFVVGGSNGHSDELNSGETYDPHTDEWIQVPELRTNRCNAGVCAL------NNKLYVVGGSDPCGQKGLKNCDAFDPVNKSWSNCASLNIRRHQAAVCELDGFMYAIGGAESWNCLNTVERYNPDNNTWTLVAPMNVARRGAAVAVHAGKLFVVGGFDGSRALRCVEVYDPSRNEWKM-LGSMTSSRSNAGVAVLDESIYAVGGFDGNDFLNTVEVYNLE 634          

HSP 2 Score: 119.013 bits (297), Expect = 3.994e-27
Identity = 75/202 (37.13%), Postives = 114/202 (56.44%), Query Frame = 1
Query: 1579 LSTSRCAAGLVNVNDQLIVIGGFNR--GECLNSVEIYQPLINKWSPSLSMKLCRARLVALVGQSDKENPYVYAIGGSDGYKELHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGNLAIVGGCFGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPEP 2178
            L T+RC AG+  +N++L V+GG +    + L + + + P+   WS   S+ + R +  A V + D    ++YAIGG++ +  L+TVER++ +N  WT VA +N  R   G AV    A  AG L +VGG  G   LR  E+YD + ++W  L SM++SRS A VA +D  ++ VGG D    L++ EV +L   KW     P
Sbjct:  454 LRTNRCNAGVCALNNKLYVVGGSDPCGQKGLKNCDAFDPVNKSWSNCASLNIRRHQ--AAVCELDG---FMYAIGGAESWNCLNTVERYNPDNNTWTLVAPMNVAR--RGAAV----AVHAGKLFVVGGFDGSRALRCVEVYDPSRNEWKMLGSMTSSRSNAGVAVLDESIYAVGGFDGNDFLNTVEVYNLEMDKWNDCASP 644          

HSP 3 Score: 97.4413 bits (241), Expect = 2.334e-20
Identity = 58/229 (25.33%), Postives = 112/229 (48.91%), Query Frame = 1
Query:   37 NKLSLIDDRSRHSELLNRLNKLRISKAFCDVTVFAENKEFVAHKVILASSSDYFLSKFTEDPKCDRLSI----NMNKDIFNLLLDYFYTSNLIVSKEKVPQLFSAAKYLKVRRVVKVCAQFLTKILSLDNIIDVRESVALNDSEDLCQAANAFIKENMDKIISN---VKIQKLNMDIMVDTVPKKENDSRLAELVIDWLEYSIVEDNMKLSDFVNENLVFFLTPSNSLV 702
            N   + +D +     + ++N LR S  FCDV +     E +AH+ +LA  S Y    F  D +   +S     ++N +   +LL+Y YT+ L   KE V  ++SAAK  K+ RV ++C  +L   +   N I  R   +      L    +AFI++++  +      +K+ +L +++M++      ++ +L   V++W++  + E+  +L   + E    + +P + LV
Sbjct:    4 NGFLIFEDENFMDSTVAKMNALRKSGQFCDVRLQVCGHELMAHRAVLACCSPYLFEIFNSDVEAHGVSHVTFEDLNPEAVEVLLNYAYTAQLKADKELVKDVYSAAKRFKMERVKQICGDYLLSKMDSQNAISFRNFASSMGDGRLVAKVDAFIQDHLLDVSEQDDFLKLPRLKLEVMLEDNLTLPSNGKLYSKVLNWVQRCLWENGEQLEQLMEEVQTLYYSPDHKLV 232          
BLAST of BTB domain-containing protein vs. Ensembl Medaka
Match: klhl20 (kelch like family member 20 [Source:NCBI gene;Acc:101170463])

HSP 1 Score: 142.51 bits (358), Expect = 8.510e-35
Identity = 90/264 (34.09%), Postives = 134/264 (50.76%), Query Frame = 1
Query: 1552 VSTLERFD----------CLSTSRCAAGLVNVNDQLIVIGGFNRGECLNSVEIYQPLINKWSPSLS-MKLCRARL-VALVGQSDKENPYVYAIGGSDGYKELHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGNLAIVGGCFGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPEPSYSRRGASLVPYNGKLYLFGGSDSNSSLRTLEIFDSVANQWSL 2307
            +S++ER+D           +S  RC  G+  ++D L  +GG +    LNSVE Y P  N+WS  ++    CR  + VA++G       Y+YA+GG DG   L+ VER+D    +WTRVA+++  R   G AV  +G    G L  VGG  G + L + E Y+   ++W  +  M T R     A   + ++ VGG D    LSS E  + R  +W  +   +  R G  L   NG+L   GG D  + L+T+E++D  AN W L
Sbjct:  332 ISSVERYDPQTNEWRMVASMSKRRCGVGVSVLDDLLYAVGGHDGSSYLNSVERYDPKTNQWSSDVAPTSTCRTSVGVAVLGG------YLYAVGGQDGVSCLNIVERYDPKENKWTRVASMSTRRL--GVAVAVLG----GFLYAVGGSDGTSPLNTVERYNPQENRWHTVSPMGTRRKHLGCAVYQDMIYSVGGRDDTTELSSAERYNPRTNQWSPVVAMTSRRSGVGLAVVNGQLMAVGGFDGTTYLKTIEVYDPDANTWRL 583          

HSP 2 Score: 140.584 bits (353), Expect = 3.385e-34
Identity = 93/290 (32.07%), Postives = 144/290 (49.66%), Query Frame = 1
Query: 1609 VNVNDQLIVIGGFNRGECLNSVEIYQPLINKWS--PSLSMKLCRARLVALVGQSDKENPYVYAIGGSDGYKELHTVERFDVNNQRWTR-VANINQERSYHGGAVMPVGASSAGNLAIVGGCFGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPEPSYSRRGASLVPYNGKLYLFGGSDSNSSLRTLEIFDSVANQWSLSVQQMKQSRANLCGGVLLNKLMAIGGFTGKHFLDTMECVDFDESCEISSEWSMY 2469
            +   + L  +GG+  G+ ++SVE Y P  N+W    S+S + C   +  L       +  +YA+GG DG   L++VER+D    +W+  VA  +  R+  G AV+       G L  VGG  G + L   E YD   +KW+ + SMST R   AVA +   L+ VGG+D    L++ E  + +E +W T+      R+      Y   +Y  GG D  + L + E ++   NQWS  V  M   R+ +   V+  +LMA+GGF G  +L T+E  D D     ++ W +Y
Sbjct:  314 IRCGEVLFAVGGWCSGDAISSVERYDPQTNEWRMVASMSKRRCGVGVSVL-------DDLLYAVGGHDGSSYLNSVERYDPKTNQWSSDVAPTSTCRTSVGVAVL------GGYLYAVGGQDGVSCLNIVERYDPKENKWTRVASMSTRRLGVAVAVLGGFLYAVGGSDGTSPLNTVERYNPQENRWHTVSPMGTRRKHLGCAVYQDMIYSVGGRDDTTELSSAERYNPRTNQWS-PVVAMTSRRSGVGLAVVNGQLMAVGGFDGTTYLKTIEVYDPD-----ANTWRLY 584          

HSP 3 Score: 107.071 bits (266), Expect = 2.217e-23
Identity = 70/209 (33.49%), Postives = 102/209 (48.80%), Query Frame = 1
Query: 1582 STSRCAAGLVNVNDQLIVIGGFNRGECLNSVEIYQPLINKWSPSLSMKLCRARL-VALVGQSDKENPYVYAIGGSDGYKELHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGNLAIVGGCFGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPEPSYSRRGASL 2205
            ST R + G+  +   L  +GG +   CLN VE Y P  NKW+   SM   R  + VA++G       ++YA+GGSDG   L+TVER++    RW  V+ +   R + G AV          +  VGG      L S E Y+   ++WS + +M++ RS   +A ++ QL  VGG D    L + EV D     WR     +Y R G  +
Sbjct:  400 STCRTSVGVAVLGGYLYAVGGQDGVSCLNIVERYDPKENKWTRVASMSTRRLGVAVAVLGG------FLYAVGGSDGTSPLNTVERYNPQENRWHTVSPMGTRRKHLGCAVY------QDMIYSVGGRDDTTELSSAERYNPRTNQWSPVVAMTSRRSGVGLAVVNGQLMAVGGFDGTTYLKTIEVYDPDANTWRLYGGMNYRRLGGGV 596          

HSP 4 Score: 98.9821 bits (245), Expect = 7.430e-21
Identity = 69/280 (24.64%), Postives = 132/280 (47.14%), Query Frame = 1
Query:   25 IPKSNKLSLIDDRSRHSELLNRLNKLRISKAFCDVTVFAENKEFVAHKVILASSSDYFLSKFTEDPKCDRLSINMNKDI----FNLLLDYFYTSNLIVSKEKVPQLFSAAKYLKVRRVVKVCAQFLTKILSLDNIIDVRESVALNDSEDLCQAANAFIKENMDKIISNVKIQKLNMDIMVDTVPKKENDSRLAE----LVIDWLEYSIVEDNMKLSDFVNENLVFFLTPS--NSLVQCSEMASSNKFSSTFINDYFNGFLSYQ-KNISKRVKCRPRSKER 831
            +P+  ++  + D+    + L  +N LR  +  CDV +    K+  AH+VIL++ S YF + FT +    R +  + +DI      LL+D+ YTS +IV +  V  L  AA  L++  + + C +FL + L   N + +R     +   +L + A+ F + N  +++ + +   L  + ++D +   E + R  E     V+ W++YSI E   +L   +    +  L+P      V    +  S++     +++  N  L  Q + + +  + RPR   R
Sbjct:   37 VPQPARMPYVSDK-HPRQTLEVINLLRKHRELCDVVLVVGAKKIYAHRVILSACSPYFRAMFTGELAESRQTEVVIRDIDERAMELLIDFAYTSQVIVEEGNVQTLLPAACLLQLAEIQEACCEFLKRQLDPSNCLGIRAFADTHSCRELLRIADKFTQHNFQEVMESEEFMLLPANQLIDIISSDELNVRSEEQVFNAVMAWVKYSIQERRPQLPQVLQHVRLPLLSPKFLVGTVGSDPLIKSDEECRDLVDEAKNYLLLPQERPLMQGPRTRPRKPIR 315          

HSP 5 Score: 80.4925 bits (197), Expect = 4.524e-15
Identity = 57/181 (31.49%), Postives = 83/181 (45.86%), Query Frame = 1
Query: 1942 LAIVGGCFGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPEP-SYSRRGASLVPYNGKLYLFGGSDSNSSLRTLEIFDSVANQWSLSVQQMKQSRANLCGGVLLNKLMAIGGFTGKHFLDTMECVDFDESCEISSEWSMYVPIG 2481
             A+ G C G + + S E YD   ++W  + SMS  R    V+ +D+ L+ VGG D    L+S E  D +  +W +   P S  R    +    G LY  GG D  S L  +E +D   N+W+  V  M   R  +   VL   L A+GG  G   L+T+E  +  E     + W    P+G
Sbjct:  321 FAVGGWCSG-DAISSVERYDPQTNEWRMVASMSKRRCGVGVSVLDDLLYAVGGHDGSSYLNSVERYDPKTNQWSSDVAPTSTCRTSVGVAVLGGYLYAVGGQDGVSCLNIVERYDPKENKWT-RVASMSTRRLGVAVAVLGGFLYAVGGSDGTSPLNTVERYNPQE-----NRWHTVSPMG 494          

HSP 6 Score: 74.3294 bits (181), Expect = 3.267e-13
Identity = 51/182 (28.02%), Postives = 79/182 (43.41%), Query Frame = 1
Query: 1528 LLKKVNTKVSTLERFDCLSTSRCAAGLVNVNDQLIVIGGFNRGECLNSVEIYQPLINKWSPSLSMKLCRARLVALVGQSDKENPYVYAIGGSDGYKELHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGNLAIVGGCFGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASI 2073
            ++++ + K +   R   +ST R    +  +   L  +GG +    LN+VE Y P  N+W     M   R  L   V Q       +Y++GG D   EL + ER++    +W+ V  +   RS  G AV+       G L  VGG  G   L++ E+YD   + W     M+  R    V  I
Sbjct:  429 IVERYDPKENKWTRVASMSTRRLGVAVAVLGGFLYAVGGSDGTSPLNTVERYNPQENRWHTVSPMGTRRKHLGCAVYQD-----MIYSVGGRDDTTELSSAERYNPRTNQWSPVVAMTSRRSGVGLAVV------NGQLMAVGGFDGTTYLKTIEVYDPDANTWRLYGGMNYRRLGGGVGVI 599          
BLAST of BTB domain-containing protein vs. Ensembl Medaka
Match: klhl17 (kelch like family member 17 [Source:NCBI gene;Acc:101175399])

HSP 1 Score: 135.576 bits (340), Expect = 1.349e-32
Identity = 81/254 (31.89%), Postives = 130/254 (51.18%), Query Frame = 1
Query: 1543 NTKVSTLERFDCLSTSRCAAGLVNVNDQLIVIGGFNRGECLNSVEIYQPLINKWSPSLSMKLCRARL-VALVGQSDKENPYVYAIGGSDGYKELHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGNLAIVGGCFGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPEPSYSRRGASLVPYNGKLYLFGGSDSNSSLRTLEIFDSVANQW 2301
            +T+         +ST R   G+  + ++L  +GG++    L +VE Y P+ N W P +SM   R+ L VA++      +  +YA GG DG   L++ ER+D     WT VA ++  R Y   A +       G+L  VGG    ++L + E YD   + W+ + +M + RS A VA +D  L+V GG D   CL+S E  + +   W  +   +  R    LV  +G LY  GG+D +SSL ++E ++  +N+W
Sbjct:  312 DTRTDRWHMVASMSTRRARVGVAAIGNRLYAVGGYDGTSDLATVESYDPITNSWQPEVSMGTRRSCLGVAVL------HGLLYAAGGYDGASCLNSAERYDPLTSTWTSVAAMSTRRRYVRVATLD------GSLYAVGGYDSSSHLATVEKYDPQSNTWTTIANMLSRRSSAGVAVLDGMLYVAGGNDGTSCLNSVERFNPKTNTWEGVAAMNIRRSTHDLVAMDGWLYAVGGNDGSSSLNSIEKYNPRSNKW 553          

HSP 2 Score: 117.087 bits (292), Expect = 1.273e-26
Identity = 83/266 (31.20%), Postives = 125/266 (46.99%), Query Frame = 1
Query: 1627 LIVIGGFNRGECLNSVEIYQPLINKWSPSLSMKLCRARL-VALVGQSDKENPYVYAIGGSDGYKELHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGNLAIVGGCFGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPEPSYSRRGASLVPYNGKLYLFGGSDSNSSLRTLEIFDSVANQW-SLSVQQMKQSRANLCGGVLLNKLMAIGGFTGKHFLDTME 2418
            L  +GG +        E Y    ++W    SM   RAR+ VA +G        +YA+GG DG  +L TVE +D     W    ++   RS  G AV+       G L   GG  G + L S E YD     W+ + +MST R    VA++D  L+ VGG DS   L++ E  D +   W T+      R  A +   +G LY+ GG+D  S L ++E F+   N W  ++   +++S  +L    +   L A+GG  G   L+++E
Sbjct:  293 LFAVGGGSLFAIHGDCEAYDTRTDRWHMVASMSTRRARVGVAAIGNR------LYAVGGYDGTSDLATVESYDPITNSWQPEVSMGTRRSCLGVAVL------HGLLYAAGGYDGASCLNSAERYDPLTSTWTSVAAMSTRRRYVRVATLDGSLYAVGGYDSSSHLATVEKYDPQSNTWTTIANMLSRRSSAGVAVLDGMLYVAGGNDGTSCLNSVERFNPKTNTWEGVAAMNIRRSTHDLVA--MDGWLYAVGGNDGSSSLNSIE 544          

HSP 3 Score: 107.071 bits (266), Expect = 1.709e-23
Identity = 69/219 (31.51%), Postives = 105/219 (47.95%), Query Frame = 1
Query: 1765 DKENPYVYAIGGSDGYKELHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGN-LAIVGGCFGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPEPSYSRRGASLVPYNGKLYLFGGSDSNSSLRTLEIFDSVANQWSLSVQQMKQSRANLCGGVLLNKLMAIGGFTGKHFLDTME 2418
            +  +P ++A+GG   +      E +D    RW  VA+++  R+        VG ++ GN L  VGG  G ++L + E YD   + W    SM T RS   VA +   L+  GG D   CL+S E  D     W ++   S  RR   +   +G LY  GG DS+S L T+E +D  +N W+ ++  M   R++    VL   L   GG  G   L+++E
Sbjct:  287 EGASPVLFAVGGGSLFAIHGDCEAYDTRTDRWHMVASMSTRRAR-------VGVAAIGNRLYAVGGYDGTSDLATVESYDPITNSWQPEVSMGTRRSCLGVAVLHGLLYAAGGYDGASCLNSAERYDPLTSTWTSVAAMSTRRRYVRVATLDGSLYAVGGYDSSSHLATVEKYDPQSNTWT-TIANMLSRRSSAGVAVLDGMLYVAGGNDGTSCLNSVE 497          

HSP 4 Score: 78.5666 bits (192), Expect = 1.553e-14
Identity = 51/189 (26.98%), Postives = 90/189 (47.62%), Query Frame = 1
Query:   91 LNKLRISKAFCDVTVFAENKEFVAHKVILASSSDYFLSKFTEDPKCDRLSINMNKDI----FNLLLDYFYTSNLIVSKEKVPQLFSAAKYLKVRRVVKVCAQFLTKILSLDNIIDVRESVALNDSEDLCQAANAFIKENMDKIISNVKIQKLNMDIMVD-------TVPKKENDSRLAELVIDWLEYSI 624
            +N++R     CD+ +   NKE  AHKV+LAS S YF + FT +    R +     DI       L+ Y YT+ ++V +  V  L  AA  L++  V   C +FL   L   N + +R     +   DL ++A+ ++ ++  ++    +   L +  ++D        VP +E   R    V++W+++ I
Sbjct:   31 MNRMRQRGLLCDIVLHVSNKEIKAHKVVLASCSPYFHAMFTNEMSESRQTHVTLHDIDSQALEQLVQYAYTAEIVVGEGNVQTLLPAASLLQLNGVRDACCKFLLSQLDPSNCLGIRGFADTHSCSDLLKSAHKYVLQHFVEVSKTEEFMLLPLKQVLDLISSDNLNVPSEEEVYR---AVLNWVKHDI 216          

HSP 5 Score: 72.7886 bits (177), Expect = 9.307e-13
Identity = 58/209 (27.75%), Postives = 82/209 (39.23%), Query Frame = 1
Query: 1579 LSTSRCAAGLVNVNDQLIVIGGFNRGECLNSVEIYQPLINKWSPSLSMKLCR--ARLVALVGQSDKENPYVYAIGGSDGYKELHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGN-----------------------------------------LAIVGGCFGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASID 2076
            + T R   G+  ++  L   GG++   CLNS E Y PL + W+   +M   R   R+  L G        +YA+GG D    L TVE++D  +  WT +AN+   RS  G AV+      AG                                          L  VGG  G ++L S E Y+   +KW     M T RS   VA ++
Sbjct:  371 MGTRRSCLGVAVLHGLLYAAGGYDGASCLNSAERYDPLTSTWTSVAAMSTRRRYVRVATLDGS-------LYAVGGYDSSSHLATVEKYDPQSNTWTTIANMLSRRSSAGVAVLDGMLYVAGGNDGTSCLNSVERFNPKTNTWEGVAAMNIRRSTHDLVAMDGWLYAVGGNDGSSSLNSIEKYNPRSNKWVAASCMFTRRSSVGVAVLE 572          

HSP 6 Score: 64.6994 bits (156), Expect = 3.571e-10
Identity = 40/136 (29.41%), Postives = 73/136 (53.68%), Query Frame = 1
Query: 1543 NTKVSTLERFDCLSTS----------RCAAGLVNVNDQLIVIGGFNRGECLNSVEIYQPLINKWSPSLSMKLCRAR--LVALVGQSDKENPYVYAIGGSDGYKELHTVERFDVNNQRWTRVANINQERSYHGGAVM 1914
            ++ ++T+E++D  S +          R +AG+  ++  L V GG +   CLNSVE + P  N W    +M + R+   LVA+ G       ++YA+GG+DG   L+++E+++  + +W   + +   RS  G AV+
Sbjct:  443 SSHLATVEKYDPQSNTWTTIANMLSRRSSAGVAVLDGMLYVAGGNDGTSCLNSVERFNPKTNTWEGVAAMNIRRSTHDLVAMDG-------WLYAVGGNDGSSSLNSIEKYNPRSNKWVAASCMFTRRSSVGVAVL 571          
BLAST of BTB domain-containing protein vs. Planmine SMEST
Match: SMESG000045114.1 (SMESG000045114.1)

HSP 1 Score: 1597.41 bits (4135), Expect = 0.000e+0
Identity = 864/866 (99.77%), Postives = 866/866 (100.00%), Query Frame = 1
Query:   19 MDIPKSNKLSLIDDRSRHSELLNRLNKLRISKAFCDVTVFAENKEFVAHKVILASSSDYFLSKFTEDPKCDRLSINMNKDIFNLLLDYFYTSNLIVSKEKVPQLFSAAKYLKVRRVVKVCAQFLTKILSLDNIIDVRESVALNDSEDLCQAANAFIKENMDKIISNVKIQKLNMDIMVDTVPKKENDSRLAELVIDWLEYSIVEDNMKLSDFVNENLVFFLTPSNSLVQCSEMASSNKFSSTFINDYFNGFLSYQKNISKRVKCRPRSKERXXXXXXXXXXTKHQVIDNPDKLEKDVIMIQSDEPSPEEWKYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLENFVDGDLDSNIYDEVXXXXXXXXXXAKPEHESCVISVNSTEIIENEIIRLKIKFLAKIDGKVACVSLHVKSVLEIINQGFQDSENSTDMALLYGQHKPXXXXXXXXXXXXXXXXXXXXXXXXXXHVDMICNMDDTFTKHEGPFTDSKSDDQSTVLQQLLKKVNTKVSTLERFDCLSTSRCAAGLVNVNDQLIVIGGFNRGECLNSVEIYQPLINKWSPSLSMKLCRARLVALVGQSDKENPYVYAIGGSDGYKELHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGNLAIVGGCFGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPEPSYSRRGASLVPYNGKLYLFGGSDSNSSLRTLEIFDSVANQWSLSVQQMKQSRANLCGGVLLNKLMAIGGFTGKHFLDTMECVDFDESCEISSEWSMYVPIGWSVNGHSFIENDAGDFNLDSQNTITSGTNNELLKQARLLDALEIQ 2616
            MDIPKSNKLSLIDDRSRHSELLNRLNKLRISKAFCDVTVFAENKEFVAHKVILASSSDYFLSKFTEDPKCDRLSINMNKDIFNLLLDYFYTSNLIVSKEKVPQLFSAAKYLKVRRVVKVCAQFLTKILSLDNIIDVRESVALNDSEDLCQAANAFIKENMDKIISNVKIQKLNMDIMVDTVPKKENDSRLAELVIDWLEYSIVEDNMKLSDFVNENLVFFLTPSNSLVQCSEMASSNKFSSTFINDYFNGFLSYQKNISKRVKCRPRSKERPSKNSNNPNKTKHQV+DNPDKLEKDVIMIQSDEPSPEEWKYKDDNKKLDESLSKKSDGSSRNSRFSSFDGNNDLENFVDGDLDSNIYDEVISTSIKSKTSAKPEHESCVISVNSTEIIENEIIRLKIKFLAKIDGKVAC+SLHVKSVLEIINQGFQDSENSTDMALLYGQHKPSRSTTYGSESTSGLSSSSVSAASSLLHVDMICNMDDTFTKHEGPFTDSKSDDQSTVLQQLLKKVNTKVSTLERFDCLSTSRCAAGLVNVNDQLIVIGGFNRGECLNSVEIYQPLINKWSPSLSMKLCRARLVALVGQSDKENPYVYAIGGSDGYKELHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGNLAIVGGCFGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPEPSYSRRGASLVPYNGKLYLFGGSDSNSSLRTLEIFDSVANQWSLSVQQMKQSRANLCGGVLLNKLMAIGGFTGKHFLDTMECVDFDESCEISSEWSMYVPIGWSVNGHSFIENDAGDFNLDSQNTITSGTNNELLKQARLLDALEIQ
Sbjct:    1 MDIPKSNKLSLIDDRSRHSELLNRLNKLRISKAFCDVTVFAENKEFVAHKVILASSSDYFLSKFTEDPKCDRLSINMNKDIFNLLLDYFYTSNLIVSKEKVPQLFSAAKYLKVRRVVKVCAQFLTKILSLDNIIDVRESVALNDSEDLCQAANAFIKENMDKIISNVKIQKLNMDIMVDTVPKKENDSRLAELVIDWLEYSIVEDNMKLSDFVNENLVFFLTPSNSLVQCSEMASSNKFSSTFINDYFNGFLSYQKNISKRVKCRPRSKERPSKNSNNPNKTKHQVMDNPDKLEKDVIMIQSDEPSPEEWKYKDDNKKLDESLSKKSDGSSRNSRFSSFDGNNDLENFVDGDLDSNIYDEVISTSIKSKTSAKPEHESCVISVNSTEIIENEIIRLKIKFLAKIDGKVACISLHVKSVLEIINQGFQDSENSTDMALLYGQHKPSRSTTYGSESTSGLSSSSVSAASSLLHVDMICNMDDTFTKHEGPFTDSKSDDQSTVLQQLLKKVNTKVSTLERFDCLSTSRCAAGLVNVNDQLIVIGGFNRGECLNSVEIYQPLINKWSPSLSMKLCRARLVALVGQSDKENPYVYAIGGSDGYKELHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGNLAIVGGCFGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPEPSYSRRGASLVPYNGKLYLFGGSDSNSSLRTLEIFDSVANQWSLSVQQMKQSRANLCGGVLLNKLMAIGGFTGKHFLDTMECVDFDESCEISSEWSMYVPIGWSVNGHSFIENDAGDFNLDSQNTITSGTNNELLKQARLLDALEIQ 866          
BLAST of BTB domain-containing protein vs. Planmine SMEST
Match: SMESG000012968.1 (SMESG000012968.1)

HSP 1 Score: 142.51 bits (358), Expect = 8.000e-35
Identity = 86/256 (33.59%), Postives = 134/256 (52.34%), Query Frame = 1
Query: 1579 LSTSRCAAGLVNVNDQLIVIGGFNRGECLNSVEIYQPLINKWSPSLSMKLCRARL-VALVGQSDKENPYVYAIGGSDGYKELHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGNLAIVGGCFGPNN--LRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPEPSYSRRGASLVPYNGKLYLFGGSDSNSSLRTLEIFDSVANQWSLSVQQMKQSRA 2337
            L + RC  G V     + +IGGFN    + +VE Y P+ +KW     M+  R+ L VA++      +  VYA+GG DG + L + E +D N   W  +A+++  RS  G AV+       G L +VGG  G +   L S E Y    D W+ + +MS  RS AAV ++D  L+ +GG D     ++ E       KW  + + +Y+RR A +V +NG LY+ GG D +S+L ++E ++ + N W+L    M   R+
Sbjct:  380 LPSRRCRCGAVLNKGLIYIIGGFNGSLRVRTVETYDPIKDKWESVSQMEARRSTLGVAVL------DGLVYAVGGFDGAQGLSSAEVYDPNTDTWRNIASMSLRRSSVGVAVL------NGLLYVVGGYDGMDRECLSSVECYSPKKDTWTSITNMSCKRSGAAVGTLDGYLYAIGGHDGPNIRNTVERYSPETDKWSLVAKMNYNRRNAGVVTHNGTLYVVGGDDGSSNLSSIEYYNPLTNTWTLLNSNMMIGRS 623          

HSP 2 Score: 121.709 bits (304), Expect = 3.216e-28
Identity = 84/272 (30.88%), Postives = 132/272 (48.53%), Query Frame = 1
Query: 1615 VNDQLIVIGGFNRGECLNSVEIYQPLINKWSPSLSMKLCRARLVALVGQSDKENPYVYAIGGSDGYKELHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGNLAIVGGCFGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSW--KCLSSCEVMDLREGKWRTMPEPSYSRRGASLVPYNGKLYLFGGSDSNSSLRTLEIFDSVANQWSLSVQQMKQSRANLCGGVLLNK--LMAIGGFTGKHFLDTME 2418
            +N +++++ G    + + SVE Y     +W     +   R R  A++ +       +Y IGG +G   + TVE +D    +W  V+ +   RS  G AV+       G +  VGG  G   L S E+YD   D W ++ SMS  RS   VA ++  L+VVGG D    +CLSS E    ++  W ++   S  R GA++   +G LY  GG D  +   T+E +    ++WSL V +M  +R N   GV+ +   L  +GG  G   L ++E
Sbjct:  345 INPKILMVIGGQAPKAVKSVEEYDFKTEQWRQVTELPSRRCRCGAVLNKG-----LIYIIGGFNGSLRVRTVETYDPIKDKWESVSQMEARRSTLGVAVLD------GLVYAVGGFDGAQGLSSAEVYDPNTDTWRNIASMSLRRSSVGVAVLNGLLYVVGGYDGMDRECLSSVECYSPKKDTWTSITNMSCKRSGAAVGTLDGYLYAIGGHDGPNIRNTVERYSPETDKWSL-VAKMNYNRRN--AGVVTHNGTLYVVGGDDGSSNLSSIE 602          

HSP 3 Score: 65.4698 bits (158), Expect = 1.680e-10
Identity = 42/183 (22.95%), Postives = 83/183 (45.36%), Query Frame = 1
Query: 1879 NQERSYHGGAVMPVGASSAGNLAIVGGCFGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPEPSYSRRGASLVPYNGKLYLFGGSDSNSSLRTLEIFDSVANQWSLSVQQMKQSRANLCGGVLLNKLMAIGGFTG--KHFLDTMEC 2421
            N+  S H    +P  A +   L ++GG   P  ++S E YD   ++W  +  + + R +         ++++GG +    + + E  D  + KW ++ +    R    +   +G +Y  GG D    L + E++D   + W  ++  M   R+++   VL   L  +GG+ G  +  L ++EC
Sbjct:  331 NRNESLHTTPRIP--AINPKILMVIGGQ-APKAVKSVEEYDFKTEQWRQVTELPSRRCRCGAVLNKGLIYIIGGFNGSLRVRTVETYDPIKDKWESVSQMEARRSTLGVAVLDGLVYAVGGFDGAQGLSSAEVYDPNTDTWR-NIASMSLRRSSVGVAVLNGLLYVVGGYDGMDRECLSSVEC 509          

HSP 4 Score: 63.1586 bits (152), Expect = 7.155e-10
Identity = 62/258 (24.03%), Postives = 121/258 (46.90%), Query Frame = 1
Query:   91 LNKLRISKAFCDVTVFAENKEFVAHKVILASSSDYFLSKFTED-----PKCDRLSINMNKDIFNLLLDYFYTSNLIVSKEKVPQLFSAAKYLKVRRVVKVCAQFLTKILSLDNIIDVRESVALNDSEDLCQAANAFIKENMDKIIS-----NVKIQKLNMDIMVDTVPKKENDSRLAELVIDWLEYSIVEDNMKLSDFVNENLVFFLTPSNSLVQCS---EMASSNKFSSTFI--NDYFNGFLSYQKNISKRVKCRPR 819
             + LR +   CDV + A + E  AHKVILAS S YF + F+ +       C  L+ ++N +    L+++ YT  + V++E V  L   A  L++  V   C +FL   L   N + +     L+  ++L   +  + + +  +I++     N+ +  L   I  + +  KE +  + E V  W+++++  + ++ +  +  ++ F L     LV+ S   E   +N+    F+     F+   S +KN ++ +   PR
Sbjct:   88 FDDLRRNNILCDVVLKAGDLEINAHKVILASCSPYFHAMFSGNMCESKAPCVYLN-DVNGEALQQLINFIYTCEIHVTEENVQTLLPTANLLQLNEVKDACCEFLQYQLHPSNCLGIHRFADLHSCKELLLYSKQYSETHFCEILNQDEFVNLPVDHLESLISSNNLSAKEEE--VFEAVRKWIKHNL-NNRLQYTQKLFAHVRFPLLSKEFLVKLSKDDEFIKTNEACKDFLIYGLRFHLLSSEEKNRNESLHTTPR 341          
BLAST of BTB domain-containing protein vs. Planmine SMEST
Match: SMESG000078117.1 (SMESG000078117.1)

HSP 1 Score: 135.576 bits (340), Expect = 1.408e-34
Identity = 96/269 (35.69%), Postives = 136/269 (50.56%), Query Frame = 1
Query: 1627 LIVIGGFNRGECLNSVEIYQPLINKWSPSLSMKLCRARL-VALVGQSDKENPYVYAIGGSDGYKELHTVERFDVNNQRW-TRVANINQERSYHGGAVMPVGASSAGNLAIVGGCFGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPEPSYSRRGASLVPYNGKLYLFGGSDSNSSLRTLEIFDSVANQWSLSVQQMKQSRANLCGGVLLNKLMAIGGFTGKHFLDTMECVD 2427
            L  +GG+  G+ + SVE Y P  N+W     M   R  + VA+V      N  +YA+GG DG   L++VER+D    +W T VA  +  R+  G AV+         +  VGG  G + L   E YD  ++KW  + SMST R    VA +D QL+ VGG+D  + L+S E  D R G W+ +   +  R+   +  YNG +Y  GG D ++ L + E FD  A  W   V  M   R+ +   V+   L AIGGF G  +L T+E  D
Sbjct:   18 LYAVGGWCSGDAIASVERYDPRSNEWFLVAPMNKRRCGVGVAVV------NDLLYAVGGHDGQSYLNSVERYDPQTNQWSTDVAPTSSCRTSVGVAVL------DNCMYAVGGQDGVSCLNFVEKYDPAINKWMKVTSMSTRRLGVGVAVLDGQLYAVGGSDGQQPLNSVEHYDPRVGIWQKVSPMNTRRKHLGVAVYNGIIYAVGGRDDSTELSSAECFDIKAGTW-CPVVAMTSRRSGVGLSVVNGFLTAIGGFDGSTYLKTVEVYD 273          

HSP 2 Score: 130.954 bits (328), Expect = 6.387e-33
Identity = 93/292 (31.85%), Postives = 140/292 (47.95%), Query Frame = 1
Query: 1474 EGPFTDSKSDDQSTVLQQLLKKVNT-----KVSTLERFDC----------LSTSRCAAGLVNVNDQLIVIGGFNRGECLNSVEIYQPLINKWSPSLS-MKLCRARLVALVGQSDKENPYVYAIGGSDGYKELHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGNLAIVGGCFGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPEPSYSRRGASLVPYNGKLYLFGGSDSNSSLRTLEIFDSVANQW 2301
            +GP T  +   QS    ++L  V        ++++ER+D           ++  RC  G+  VND L  +GG +    LNSVE Y P  N+WS  ++    CR      VG +  +N  +YA+GG DG   L+ VE++D    +W +V +++  R   G AV+       G L  VGG  G   L S E YD  +  W  +  M+T R    VA  +  ++ VGG D    LSS E  D++ G W  +   +  R G  L   NG L   GG D ++ L+T+E++D +A  W
Sbjct:    2 QGPRTRPRKPIQSG---EVLYAVGGWCSGDAIASVERYDPRSNEWFLVAPMNKRRCGVGVAVVNDLLYAVGGHDGQSYLNSVERYDPQTNQWSTDVAPTSSCRTS----VGVAVLDN-CMYAVGGQDGVSCLNFVEKYDPAINKWMKVTSMSTRRLGVGVAVL------DGQLYAVGGSDGQQPLNSVEHYDPRVGIWQKVSPMNTRRKHLGVAVYNGIIYAVGGRDDSTELSSAECFDIKAGTWCPVVAMTSRRSGVGLSVVNGFLTAIGGFDGSTYLKTVEVYDPIAKNW 279          

HSP 3 Score: 90.5077 bits (223), Expect = 3.468e-19
Identity = 64/210 (30.48%), Postives = 98/210 (46.67%), Query Frame = 1
Query: 1582 STSRCAAGLVNVNDQLIVIGGFNRGECLNSVEIYQPLINKWSPSLSMKLCR--ARLVALVGQSDKENPYVYAIGGSDGYKELHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGNLAIVGGCFGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPEPSYSRRGASL 2205
            S+ R + G+  +++ +  +GG +   CLN VE Y P INKW    SM   R    +  L GQ       +YA+GGSDG + L++VE +D     W +V+ +N  R + G AV        G +  VGG      L S E +D     W  + +M++ RS   ++ ++  L  +GG D    L + EV D     WR     +  R G  +
Sbjct:   98 SSCRTSVGVAVLDNCMYAVGGQDGVSCLNFVEKYDPAINKWMKVTSMSTRRLGVGVAVLDGQ-------LYAVGGSDGQQPLNSVEHYDPRVGIWQKVSPMNTRRKHLGVAVY------NGIIYAVGGRDDSTELSSAECFDIKAGTWCPVVAMTSRRSGVGLSVVNGFLTAIGGFDGSTYLKTVEVYDPIAKNWRPRGSMNSRRLGGGV 294          

HSP 4 Score: 78.1814 bits (191), Expect = 3.623e-15
Identity = 53/182 (29.12%), Postives = 80/182 (43.96%), Query Frame = 1
Query: 1528 LLKKVNTKVSTLERFDCLSTSRCAAGLVNVNDQLIVIGGFNRGECLNSVEIYQPLINKWSPSLSMKLCRARLVALVGQSDKENPYVYAIGGSDGYKELHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGNLAIVGGCFGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASI 2073
             ++K +  ++   +   +ST R   G+  ++ QL  +GG +  + LNSVE Y P +  W     M   R  L   V      N  +YA+GG D   EL + E FD+    W  V  +   RS  G +V+       G L  +GG  G   L++ E+YD     W    SM++ R    V  I
Sbjct:  127 FVEKYDPAINKWMKVTSMSTRRLGVGVAVLDGQLYAVGGSDGQQPLNSVEHYDPRVGIWQKVSPMNTRRKHLGVAV-----YNGIIYAVGGRDDSTELSSAECFDIKAGTWCPVVAMTSRRSGVGLSVV------NGFLTAIGGFDGSTYLKTVEVYDPIAKNWRPRGSMNSRRLGGGVGVI 297          
BLAST of BTB domain-containing protein vs. Planmine SMEST
Match: SMESG000078467.1 (SMESG000078467.1)

HSP 1 Score: 122.865 bits (307), Expect = 3.925e-28
Identity = 82/278 (29.50%), Postives = 133/278 (47.84%), Query Frame = 1
Query: 1618 NDQLIVIGGFNRGEC-LNSVEIYQPLINKWSPSLSMKLCRARLVALVGQSDKENPYVYAIGGSDGYKELHTVERFDVNN--QRWTRVANINQERSYHGGAVMPVGASSAGNLAIVGGCFGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPEPSYSRRGASLVPYNGKLYLFGG-----SDSNSSLRTLEIFDSVANQWSLSVQQMKQSRANLCGGVLLNKLMAIGGFTGKHFLDTMECVD 2427
            N  L+++GGF   +  ++SVEI+ P   +W  SL     R R VA    +      +Y IGG DG + L+TV   DV N  Q W  +A++  +R      V        G + + GG  G   L+S E+YD ++++WS  +SM TSR  A +  +D+ L+ VGG +  + L + E  D+   +W       Y R GA     N  +Y+ GG           L ++E ++++  QWS  +  M++ R  +    + N +    G+ G   L+T+E  D
Sbjct:  295 NHFLVLLGGFGSDQAPISSVEIFDPRSQRWG-SLPSLPGRYRYVAACSIAS----CIYVIGGFDGRERLNTVSVLDVGNLSQGWMELASMQYKRGLAATCVY------NGRIFVCGGFDGIARLKSLEVYDPSINQWSRKESMETSREGAGLVVVDSYLYCVGGYNGMQLLDTVEKYDILNDQWSKSEPMHYRRSGAGCAVMNETIYVCGGYGGAIRQGPQHLDSVECYNTLTQQWSF-ITSMQEPRCYIGACQMDNMIWVAAGYDGNRLLNTVEAHD 560          

HSP 2 Score: 82.8037 bits (203), Expect = 8.773e-16
Identity = 77/311 (24.76%), Postives = 141/311 (45.34%), Query Frame = 1
Query:   37 NKLSLIDDRSRHS-ELLNRLNKLRISKAFCDVTVFAENKEFVAHKVILASSSDYFLSKFTEDPKCDRLSI----NMNKDIFNLLLDYFYTSNLIVSKEKVPQLFSAAKYLKVRRVVKVCAQFLTKILSLDNIIDVRESVALNDSEDLCQAANAFIKENMDKIISN---------------VKIQKLNM------------------DIMVDTVPKKENDSRLAELVIDWL-----EYSIVEDNMKLSDFVNENLVFFLTP--SNSLVQCS---EMASSNKFSSTFINDYFNGFLSYQKNISKRVKCRPRSK 825
            N +SL DD  R+S     ++N+ R+    CDV +  ++KEF AHK++LA++SD+F + F+        S+    +++ DI N +L+Y YT N++V+ E V +L  AA   ++  + + C  +L + +   N++ +R    ++D   L + A  F   NM+ ++                 +K+  LN+                  +     +P      RL++L I +L        ++ +++   D V+E  ++ L P   ++L++ S      S N  +S        GF S Q  IS      PRS+
Sbjct:   12 NNISLNDDIQRYSTNTYGKINEFRLQNRLCDVVLKVQDKEFPAHKIVLAAASDFFSAMFSCGMAESEQSVIELKSISIDIINDILEYVYTGNIVVTNENVQELLPAANLTQLIGLKQACCIYLMRQIDPSNVLGIRRFAEIHDCHLLEKFARKFAAHNMEAVLQQSEEFVQLSRSELRQLIKMTDLNIYTEESVYNAVIRWIYYSKETRAKWLPHLLAKVRLSQLSIRFLTDIISNEPLIRESLPCRDLVDEAKLYHLRPDLRSTLMKKSAHERFWSRNDGASNHFLVLLGGFGSDQAPISSVEIFDPRSQ 322          

HSP 3 Score: 59.3066 bits (142), Expect = 1.581e-8
Identity = 49/180 (27.22%), Postives = 81/180 (45.00%), Query Frame = 1
Query: 1531 LKKVNTKVSTLERFDCLSTSRCAAGLVNVNDQLIVIGGFNRGECLNSVEIYQPLINKWSPSLSMKLCRARLVALVGQSDKENPYVYAIGG-----SDGYKELHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGNLAIVGGCFGPNN-LRSCEIYD------TTLDKWSDLKS 2034
            L+  +  ++   R + + TSR  AGLV V+  L  +GG+N  + L++VE Y  L ++WS S  M   R+     V      N  +Y  GG       G + L +VE ++   Q+W+ + ++ + R Y       +GA    N+  V   +  N  L + E +D       T + W   KS
Sbjct:  410 LEVYDPSINQWSRKESMETSREGAGLVVVDSYLYCVGGYNGMQLLDTVEKYDILNDQWSKSEPMHYRRSGAGCAV-----MNETIYVCGGYGGAIRQGPQHLDSVECYNTLTQQWSFITSMQEPRCY-------IGACQMDNMIWVAAGYDGNRLLNTVEAHDRYGLVSPTPNSWITFKS 577          
BLAST of BTB domain-containing protein vs. Planmine SMEST
Match: SMESG000077860.1 (SMESG000077860.1)

HSP 1 Score: 114.39 bits (285), Expect = 3.192e-26
Identity = 80/272 (29.41%), Postives = 131/272 (48.16%), Query Frame = 1
Query: 1627 LIVIGG-FNRGECLNSVEIYQPLINKWSPSLSMKLCRARL-VALVGQSDKENPYVYAIGGSDGYKELHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGNLAIVGGCFGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPEPSYSRR---GASLVPYNGKLYLFGGSDSNSSLRTLEIFDSVANQWSLSVQQMKQSRANLCGGVLLNKLMAIGGFTGKHFLDTMECVD 2427
            + VIGG F  G  +N +E+Y P++ +W     +   + R+ VA++        Y+Y IGG DG + L  V+ F+    +W+ VAN+N  RS  G  +M         + + GG  G   L+SCE Y   L++W  +  M   RS   V  +  +L+ +GG +     +S E  +     W  +  P  +RR   G +++  N  +Y  GG D  + L ++E+F    +QW+  +  MK  R+ +       ++ AIGGF G   L T EC +
Sbjct:  224 IFVIGGSFQNGNQVN-MEVYHPILRQWCSLDQLGTNKTRVGVAVLDH------YIYVIGGFDGSRRLSHVDVFNTKTMKWSSVANMNCNRSALGATMM------NDKIYVCGGYDGTIALKSCEEYCPKLNRWRVIPPMLECRSATGVVHLSQKLYAIGGHNGLAIDNSVECFNPVMKCW-DLITPMLNRRCRHGVAVL--NQSIYAAGGYDGVNFLSSVEVFSVTTSQWTY-IASMKVPRSRMSLISTFGEIFAIGGFDGSGNLKTTECFN 478          

HSP 2 Score: 91.6633 bits (226), Expect = 6.595e-19
Identity = 63/209 (30.14%), Postives = 99/209 (47.37%), Query Frame = 1
Query: 1543 NTKVSTLERFDCLSTSRCAAGLVNVNDQLIVIGGFNRGECLNSVEIYQPLINKWSPSLSMKLCRARLVALVGQSDKENPYVYAIGGSDGYKELHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGNLAIVGGCFGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTM 2169
            NTK         ++ +R A G   +ND++ V GG++    L S E Y P +N+W     M  CR+    +V  S K    +YAIGG +G    ++VE F+   + W  +  +   R  HG AV+     +AG      G  G N L S E++  T  +W+ + SM   RS+ ++ S   ++F +GG D    L + E  + R  +W  M
Sbjct:  290 NTKTMKWSSVANMNCNRSALGATMMNDKIYVCGGYDGTIALKSCEEYCPKLNRWRVIPPMLECRSA-TGVVHLSQK----LYAIGGHNGLAIDNSVECFNPVMKCWDLITPMLNRRCRHGVAVLNQSIYAAG------GYDGVNFLSSVEVFSVTTSQWTYIASMKVPRSRMSLISTFGEIFAIGGFDGSGNLKTTECFNARSQQWLEM 487          

HSP 3 Score: 85.1149 bits (209), Expect = 8.850e-17
Identity = 49/181 (27.07%), Postives = 90/181 (49.72%), Query Frame = 1
Query: 1936 GNLAIVGGCFGPNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKCLSSCEVMDLREGKWRTMPEPSYSRRGASLVPYNGKLYLFGGSDSNSSLRTLEIFDSVANQWSLSVQQMKQSRANLCGGVLLNKLMAIGGFTGKHFLDTMECVDFDESCEISSEWSMYVPI 2478
            G + ++GG F   N  + E+Y   L +W  L  + T++++  VA +D+ ++V+GG D  + LS  +V + +  KW ++   + +R        N K+Y+ GG D   +L++ E +    N+W + +  M + R+      L  KL AIGG  G    +++EC +    C     W +  P+
Sbjct:  222 GFIFVIGGSFQNGNQVNMEVYHPILRQWCSLDQLGTNKTRVGVAVLDHYIYVIGGFDGSRRLSHVDVFNTKTMKWSSVANMNCNRSALGATMMNDKIYVCGGYDGTIALKSCEEYCPKLNRWRV-IPPMLECRSATGVVHLSQKLYAIGGHNGLAIDNSVECFNPVMKC-----WDLITPM 396          

HSP 4 Score: 70.8626 bits (172), Expect = 2.609e-12
Identity = 49/152 (32.24%), Postives = 80/152 (52.63%), Query Frame = 1
Query: 1591 RCAAGLVNVNDQLIVIGGFNRGECLNSVEIYQPLINKW---SPSLSMKLCRARLVALVGQSDKENPYVYAIGGSDGYKELHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGNLAIVGGCFGPNNLRSCEIYDTTLDKWSDLKSM 2037
            R A G+V+++ +L  IGG N     NSVE + P++  W   +P L+ + CR   VA++ QS      +YA GG DG   L +VE F V   +WT +A++   RS      M +  S+ G +  +GG  G  NL++ E ++    +W ++  +
Sbjct:  353 RSATGVVHLSQKLYAIGGHNGLAIDNSVECFNPVMKCWDLITPMLNRR-CRHG-VAVLNQS------IYAAGGYDGVNFLSSVEVFSVTTSQWTYIASMKVPRSR-----MSL-ISTFGEIFAIGGFDGSGNLKTTECFNARSQQWLEMSRL 490          

HSP 5 Score: 57.7658 bits (138), Expect = 3.680e-8
Identity = 36/123 (29.27%), Postives = 65/123 (52.85%), Query Frame = 1
Query: 1591 RCAAGLVNVNDQLIVIGGFNRGECLNSVEIYQPLINKWSPSLSMKLCRAR--LVALVGQSDKENPYVYAIGGSDGYKELHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGNLAIV 1953
            RC  G+  +N  +   GG++    L+SVE++    ++W+   SMK+ R+R  L++  G+       ++AIGG DG   L T E F+  +Q+W  ++ +    ++ GG    + A S  +L I+
Sbjct:  400 RCRHGVAVLNQSIYAAGGYDGVNFLSSVEVFSVTTSQWTYIASMKVPRSRMSLISTFGE-------IFAIGGFDGSGNLKTTECFNARSQQWLEMSRL---LNHDGGVGCAIVAFSDAHLNIL 512          

HSP 6 Score: 53.5286 bits (127), Expect = 6.996e-7
Identity = 32/135 (23.70%), Postives = 65/135 (48.15%), Query Frame = 1
Query:  271 LLDYFYTSNLIVSKEKVPQLFSAAKYLKVRRVVKVCAQFLTKILSLDNIIDVRESVALNDSEDLCQAANAFIKENMDKIISNVKIQKLNMDIMVDTVPKKE----NDSRLAELVIDWLEYSIVEDNMKLSDFVNE 663
            L+++ Y   + ++   V  +F  A +L++  V   C +F+   +S   ++ +R         DL  AA+ +I  N   II+  +   L+ + +++ + K E     +  + E VI W+EY+I E    L+D + +
Sbjct:   25 LINFAYRGEVYITPNNVQSIFMGANFLQISSVRVACCEFMKNRISSQTVLPLRTFAKSLFCHDLLHAADIYIYNNFMSIINLNEFFDLSFEDLLEIICKDELQVITEEIVFEAVIRWIEYAISERKHYLADLMKQ 159          
The following BLAST results are available for this feature:
BLAST of BTB domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
IVNS1ABP1.402e-4431.48influenza virus NS1A binding protein [Source:HGNC ... [more]
KLHL182.477e-3531.49kelch like family member 18 [Source:HGNC Symbol;Ac... [more]
KLHL201.478e-3434.09kelch like family member 20 [Source:HGNC Symbol;Ac... [more]
KLHL82.566e-3333.99kelch like family member 8 [Source:HGNC Symbol;Acc... [more]
KLHL83.954e-3333.86kelch like family member 8 [Source:HGNC Symbol;Acc... [more]
back to top
BLAST of BTB domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ivns-17.398e-4332.11Influenza Virus NS1a (A) binding protein homolog ... [more]
ivns-17.398e-4332.11Influenza Virus NS1a (A) binding protein homolog ... [more]
ivns-17.398e-4332.11Influenza Virus NS1a (A) binding protein homolog ... [more]
kel-36.831e-3832.13KELch-repeat containing protein [Source:UniProtKB... [more]
kel-37.115e-3832.13KELch-repeat containing protein [Source:UniProtKB... [more]
back to top
BLAST of BTB domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dbo5.382e-3434.08gene:FBgn0040230 transcript:FBtr0332133[more]
dbo6.263e-3434.08gene:FBgn0040230 transcript:FBtr0075505[more]
kel1.450e-3131.42gene:FBgn0001301 transcript:FBtr0081042[more]
kel1.016e-3030.88gene:FBgn0001301 transcript:FBtr0081043[more]
CG177542.297e-2928.96gene:FBgn0030114 transcript:FBtr0340121[more]
back to top
BLAST of BTB domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ivns1abpa4.022e-4633.89influenza virus NS1A binding protein a [Source:NCB... [more]
ivns1abpb9.174e-4331.68influenza virus NS1A binding protein b [Source:NCB... [more]
klhl183.931e-3531.49kelch-like family member 18 [Source:ZFIN;Acc:ZDB-G... [more]
ivns1abpb9.331e-3530.97influenza virus NS1A binding protein b [Source:NCB... [more]
klhl201.101e-3434.09kelch-like family member 20 [Source:ZFIN;Acc:ZDB-G... [more]
back to top
BLAST of BTB domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
IVNS1ABP1.428e-4130.10influenza virus NS1A binding protein [Source:NCBI ... [more]
IVNS1ABP1.962e-4130.10influenza virus NS1A binding protein [Source:NCBI ... [more]
IVNS1ABP1.984e-4130.10influenza virus NS1A binding protein [Source:NCBI ... [more]
IVNS1ABP2.141e-4130.10influenza virus NS1A binding protein [Source:NCBI ... [more]
IVNS1ABP2.904e-4130.10influenza virus NS1A binding protein [Source:NCBI ... [more]
back to top
BLAST of BTB domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ivns1abp2.878e-4431.48influenza virus NS1A binding protein [Source:MGI S... [more]
Ivns1abp5.261e-4431.48influenza virus NS1A binding protein [Source:MGI S... [more]
Klhl182.781e-3531.73kelch-like 18 [Source:MGI Symbol;Acc:MGI:2143315][more]
Klhl183.524e-3532.17kelch-like 18 [Source:MGI Symbol;Acc:MGI:2143315][more]
Klhl201.003e-3434.09kelch-like 20 [Source:MGI Symbol;Acc:MGI:2444855][more]
back to top
BLAST of BTB domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5RG82|NS1BA_DANRE3.036e-4533.89Influenza virus NS1A-binding protein homolog A OS=... [more]
sp|Q9Y6Y0|NS1BP_HUMAN6.733e-4431.48Influenza virus NS1A-binding protein OS=Homo sapie... [more]
sp|Q920Q8|NS1BP_MOUSE3.680e-4331.48Influenza virus NS1A-binding protein homolog OS=Mu... [more]
sp|Q7ZVQ8|NS1BB_DANRE6.800e-4231.68Influenza virus NS1A-binding protein homolog B OS=... [more]
sp|Q6DFU2|NS1BP_XENLA2.199e-3930.23Influenza virus NS1A-binding protein homolog OS=Xe... [more]
back to top
BLAST of BTB domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S6KMH60.000e+099.88BTB domain-containing protein OS=Schmidtea mediter... [more]
V4CLR01.848e-6141.45BTB domain-containing protein OS=Lottia gigantea O... [more]
E0VYN33.264e-6037.54BTB domain-containing protein OS=Pediculus humanus... [more]
E9FQT21.377e-5637.89BTB domain-containing protein OS=Daphnia pulex OX=... [more]
A0A1S3HQ852.344e-5638.87influenza virus NS1A-binding protein homolog A OS=... [more]
back to top
BLAST of BTB domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ivns1abpa1.769e-4434.26influenza virus NS1A-binding protein homolog A [So... [more]
ivns1abpa2.924e-4434.26influenza virus NS1A-binding protein homolog A [So... [more]
ivns1abpb6.548e-3832.33influenza virus NS1A-binding protein homolog B [So... [more]
ivns1abpb8.342e-3832.33influenza virus NS1A-binding protein homolog B [So... [more]
ivns1abpb8.342e-3832.33influenza virus NS1A-binding protein homolog B [So... [more]
back to top
BLAST of BTB domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
IVNS1ABP1.269e-4334.04influenza virus NS1A binding protein [Source:HGNC ... [more]
klhl188.838e-3931.05kelch-like family member 18 [Source:ZFIN;Acc:ZDB-G... [more]
klhl82.461e-3434.12kelch-like family member 8 [Source:ZFIN;Acc:ZDB-GE... [more]
KLHL129.757e-3433.10kelch like family member 12 [Source:HGNC Symbol;Ac... [more]
klhl52.269e-3233.09kelch-like family member 5 [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of BTB domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of BTB domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO378526.768e-4232.88Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO493743.198e-3835.93Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO471709.456e-3733.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO380654.753e-3433.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO423826.236e-3230.97Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of BTB domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ivns1abpa8.566e-4429.88influenza virus NS1A binding protein [Source:NCBI ... [more]
ivns1abpa1.330e-4329.88influenza virus NS1A binding protein [Source:NCBI ... [more]
ivns1abpa1.344e-4329.88influenza virus NS1A binding protein [Source:NCBI ... [more]
klhl208.510e-3534.09kelch like family member 20 [Source:NCBI gene;Acc:... [more]
klhl171.349e-3231.89kelch like family member 17 [Source:NCBI gene;Acc:... [more]
back to top
BLAST of BTB domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000045114.10.000e+099.77SMESG000045114.1[more]
SMESG000012968.18.000e-3533.59SMESG000012968.1[more]
SMESG000078117.11.408e-3435.69SMESG000078117.1[more]
SMESG000078467.13.925e-2829.50SMESG000078467.1[more]
SMESG000077860.13.192e-2629.41SMESG000077860.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30028384 ID=SMED30028384|Name=BTB domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=3011bp
TATATAAATCTTATATGAATGGATATTCCTAAATCAAATAAGTTATCGCT
CATTGATGACAGAAGCCGACATTCAGAATTACTAAATCGCCTGAATAAAT
TAAGAATTTCCAAAGCATTTTGCGATGTAACAGTTTTTGCTGAAAATAAA
GAATTTGTCGCTCATAAAGTTATATTGGCTTCATCAAGTGATTACTTTCT
TTCGAAATTTACTGAAGATCCGAAATGCGATCGACTTTCGATTAACATGA
ATAAAGATATTTTTAATTTATTGTTGGATTATTTTTATACTTCAAATCTT
ATTGTTTCCAAAGAAAAAGTACCGCAATTGTTTTCAGCTGCGAAGTATTT
AAAAGTTCGTCGTGTTGTCAAAGTTTGTGCACAATTTTTAACTAAAATAT
TATCTCTAGATAATATTATTGATGTACGTGAGTCAGTAGCACTCAACGAC
AGTGAAGATTTGTGTCAAGCTGCTAATGCTTTTATTAAAGAAAACATGGA
TAAAATTATTTCGAATGTAAAAATTCAGAAGTTAAATATGGATATAATGG
TCGACACTGTACCAAAGAAGGAAAACGATTCACGATTGGCCGAATTAGTA
ATTGATTGGCTGGAGTATTCAATTGTTGAAGATAATATGAAATTATCAGA
TTTTGTGAATGAAAATTTGGTCTTCTTTCTAACTCCTTCCAATAGTCTCG
TCCAATGTAGTGAAATGGCTTCCAGCAATAAATTTTCATCTACATTTATC
AATGATTATTTTAATGGATTTTTATCCTATCAAAAAAATATAAGTAAAAG
AGTGAAATGTAGACCTAGAAGTAAAGAGCGGCCATCAAAAAATTCTAATA
ACCCAAACAAAACAAAACATCAAGTTATAGATAATCCAGATAAACTTGAA
AAGGATGTAATTATGATCCAAAGTGATGAACCTAGTCCCGAGGAATGGAA
ATATAAAGACGATAATAAAAAATTAGATGAGTCTTTATCGAAAAAAAGTG
ATGGAAGCTCTAGAAATAGCCGTTTTAGTAGTTTTGATGGCAATAATGAT
CTTGAAAACTTTGTGGACGGTGATCTTGATAGCAATATATACGATGAGGT
AATCAGCACCTCAATCAAATCGAAAACGTCCGCTAAACCCGAACATGAAA
GTTGCGTTATTTCAGTAAACTCCACCGAAATTATTGAAAATGAAATAATT
CGATTAAAGATCAAATTTTTGGCAAAAATCGACGGAAAAGTTGCATGCGT
TTCTTTGCATGTAAAATCGGTTCTGGAAATCATCAATCAAGGATTTCAAG
ACAGTGAGAATTCAACGGACATGGCTTTATTATACGGTCAGCACAAGCCA
TCTCGGTCAACTACGTATGGCAGTGAATCAACGAGTGGTCTCTCTTCATC
ATCAGTTTCAGCGGCAAGTTCTCTGCTCCATGTCGATATGATATGTAATA
TGGACGATACTTTCACTAAACACGAAGGACCTTTCACTGACTCTAAATCC
GATGATCAATCTACCGTTTTACAGCAGTTATTAAAGAAGGTCAATACCAA
AGTTTCGACTTTAGAACGATTTGATTGTTTATCAACTTCACGGTGTGCTG
CTGGATTGGTCAATGTCAATGATCAGTTGATTGTTATCGGTGGATTCAAT
AGAGGTGAATGCTTGAATTCCGTTGAAATCTACCAACCATTGATCAACAA
ATGGTCACCTAGTCTATCGATGAAATTGTGTCGTGCACGACTTGTTGCTT
TAGTCGGTCAATCAGATAAAGAAAATCCTTATGTCTATGCAATAGGTGGA
TCAGACGGATATAAGGAATTGCATACTGTAGAAAGGTTCGATGTCAACAA
TCAGCGATGGACTCGAGTAGCTAATATAAACCAAGAGAGAAGTTATCACG
GTGGTGCTGTTATGCCTGTTGGAGCTAGCTCGGCAGGCAACTTGGCCATT
GTTGGAGGTTGTTTTGGTCCGAATAATTTGCGTAGCTGTGAGATATATGA
TACCACTTTGGATAAATGGTCCGATCTTAAATCAATGAGCACTTCTAGAA
GTCAAGCTGCAGTTGCATCCATTGATAATCAGTTATTCGTTGTCGGTGGC
ACGGATAGTTGGAAATGTCTATCGAGTTGTGAGGTCATGGATTTACGAGA
AGGGAAATGGCGAACGATGCCGGAACCAAGCTATTCTCGTCGTGGAGCGT
CTTTAGTTCCGTATAATGGAAAACTGTATTTGTTTGGAGGCAGTGACAGT
AACTCATCTCTTAGAACTCTGGAAATATTTGATTCGGTAGCCAATCAGTG
GTCATTATCTGTTCAGCAAATGAAACAGTCCAGAGCCAATCTTTGTGGGG
GAGTTTTGCTCAATAAACTAATGGCAATCGGTGGTTTCACCGGAAAGCAT
TTTTTGGACACGATGGAATGTGTAGACTTTGATGAGTCATGTGAAATATC
GAGCGAGTGGTCGATGTACGTTCCGATCGGGTGGTCGGTTAATGGCCATT
CTTTCATTGAAAATGATGCTGGAGATTTCAATCTGGACTCACAAAATACA
ATCACATCCGGTACCAATAATGAACTTCTTAAGCAGGCCCGTCTTTTGGA
TGCTTTGGAAATACAGTAGCGGTAGTCGTGACAACAGGCGCACTGATGGT
GACGACGTGATAAAGTCGTCAGTTTTATCCAATGAAAATGTTGTCTGCTA
TCCTGTAAAGTCTCTGTAGTAGTTGTTTTCATTTTATATTGTGAAATTAG
AATGCTTCAATTCTCTTTATTTTGAATGTGTGTTATTATTGATGTGTTCC
GGTTGCGTTTTCTATGTTTCAGTATTTTCATGATATACATATATATATAT
GTTGCCATTGGTGATATTTATGCCTGCGATGTGTGAGTGTGTTTCTGTCA
TTCAGTGGAATCTTAGATTATTGATTAGACATTTGTTCGCGTTATAAAAG
TTTTGATTTTGTAATTTTGATTTGGTGTAGTACGGAAAATAAAAGCAAAT
ATGAAAAAAAA
back to top

protein sequence of SMED30028384-orf-1

>SMED30028384-orf-1 ID=SMED30028384-orf-1|Name=SMED30028384-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=140bp
MKTTTTETLQDSRQHFHWIKLTTLSRRHHQCACCHDYRYCISKASKRRAC
LRSSLLVPDVIVFCESRLKSPASFSMKEWPLTDHPIGTYIDHSLDISHDS
SKSTHSIVSKKCFPVKPPIAISLLSKTPPQRLALDCFIC*
back to top

protein sequence of SMED30028384-orf-2

>SMED30028384-orf-2 ID=SMED30028384-orf-2|Name=SMED30028384-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=867bp
MDIPKSNKLSLIDDRSRHSELLNRLNKLRISKAFCDVTVFAENKEFVAHK
VILASSSDYFLSKFTEDPKCDRLSINMNKDIFNLLLDYFYTSNLIVSKEK
VPQLFSAAKYLKVRRVVKVCAQFLTKILSLDNIIDVRESVALNDSEDLCQ
AANAFIKENMDKIISNVKIQKLNMDIMVDTVPKKENDSRLAELVIDWLEY
SIVEDNMKLSDFVNENLVFFLTPSNSLVQCSEMASSNKFSSTFINDYFNG
FLSYQKNISKRVKCRPRSKERPSKNSNNPNKTKHQVIDNPDKLEKDVIMI
QSDEPSPEEWKYKDDNKKLDESLSKKSDGSSRNSRFSSFDGNNDLENFVD
GDLDSNIYDEVISTSIKSKTSAKPEHESCVISVNSTEIIENEIIRLKIKF
LAKIDGKVACVSLHVKSVLEIINQGFQDSENSTDMALLYGQHKPSRSTTY
GSESTSGLSSSSVSAASSLLHVDMICNMDDTFTKHEGPFTDSKSDDQSTV
LQQLLKKVNTKVSTLERFDCLSTSRCAAGLVNVNDQLIVIGGFNRGECLN
SVEIYQPLINKWSPSLSMKLCRARLVALVGQSDKENPYVYAIGGSDGYKE
LHTVERFDVNNQRWTRVANINQERSYHGGAVMPVGASSAGNLAIVGGCFG
PNNLRSCEIYDTTLDKWSDLKSMSTSRSQAAVASIDNQLFVVGGTDSWKC
LSSCEVMDLREGKWRTMPEPSYSRRGASLVPYNGKLYLFGGSDSNSSLRT
LEIFDSVANQWSLSVQQMKQSRANLCGGVLLNKLMAIGGFTGKHFLDTME
CVDFDESCEISSEWSMYVPIGWSVNGHSFIENDAGDFNLDSQNTITSGTN
NELLKQARLLDALEIQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: INTERPRO
TermDefinition
IPR000210BTB/POZ_dom
IPR006652Kelch_1
IPR015915Kelch-typ_b-propeller
IPR011333SKP1/BTB/POZ_sf
IPR030374PABS
Vocabulary: cellular component
TermDefinition
GO:0015629actin cytoskeleton