GCR130

Overview
NameGCR130
Smed IDSMED30028381
Length (bp)1217
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30028381

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
testisSMED30028381h1SMcG0021205 GCR130smed_ncbi_20240424PMID:27163480
Saberi et al., 2016
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of GCR130 vs. TrEMBL
Match: A0A193KUD6 (GCR130 OS=Schmidtea mediterranea OX=79327 GN=gcr130 PE=2 SV=1)

HSP 1 Score: 603.208 bits (1554), Expect = 0.000e+0
Identity = 361/361 (100.00%), Postives = 361/361 (100.00%), Query Frame = 3
Query:   78 MSDDVPPPLHPVEIALMAIGMVGNILCCMLMFRNRLMPDKXXXXXXXXXXXXXXXDFFSNLFYIISLISYPKIKSEALGAFVCRVIRSQALFWMISTLRAGVNVVIAILNFIKLLYPFLSTSXXXXXXXXXXXXXXFVVSLIQVVPHVSTVSFSPNSTKHNCNFSAILNFQEVTGLVGMVRFFALFNFIYLYIFPLTATMFLYKQVFNCLKESDDEPRKIAYREIMKSFLMDTVLYLLCFSMHSILFFLYQFSSKIGYLVTSTLYRIGMXXXXXXXXXXPYISMATRRAYRKPISDVMKIFGFKQYNTTIYKQSISKYGHSIDNXXXXXXXXXXXXXXXXXXGNTSKPTSSVNDWSDNDSF 1160
            MSDDVPPPLHPVEIALMAIGMVGNILCCMLMFRNRLMPDKNVNLNAVLNLLQSLLDFFSNLFYIISLISYPKIKSEALGAFVCRVIRSQALFWMISTLRAGVNVVIAILNFIKLLYPFLSTSGNLIGFIGIGLALLFVVSLIQVVPHVSTVSFSPNSTKHNCNFSAILNFQEVTGLVGMVRFFALFNFIYLYIFPLTATMFLYKQVFNCLKESDDEPRKIAYREIMKSFLMDTVLYLLCFSMHSILFFLYQFSSKIGYLVTSTLYRIGMLLVALYAVLYPYISMATRRAYRKPISDVMKIFGFKQYNTTIYKQSISKYGHSIDNSGSRFSKFFSSKQKNKPSGNTSKPTSSVNDWSDNDSF
Sbjct:    1 MSDDVPPPLHPVEIALMAIGMVGNILCCMLMFRNRLMPDKNVNLNAVLNLLQSLLDFFSNLFYIISLISYPKIKSEALGAFVCRVIRSQALFWMISTLRAGVNVVIAILNFIKLLYPFLSTSGNLIGFIGIGLALLFVVSLIQVVPHVSTVSFSPNSTKHNCNFSAILNFQEVTGLVGMVRFFALFNFIYLYIFPLTATMFLYKQVFNCLKESDDEPRKIAYREIMKSFLMDTVLYLLCFSMHSILFFLYQFSSKIGYLVTSTLYRIGMLLVALYAVLYPYISMATRRAYRKPISDVMKIFGFKQYNTTIYKQSISKYGHSIDNSGSRFSKFFSSKQKNKPSGNTSKPTSSVNDWSDNDSF 361          
BLAST of GCR130 vs. TrEMBL
Match: A0A193KUT4 (GCR127 OS=Schmidtea mediterranea OX=79327 GN=gcr127 PE=2 SV=1)

HSP 1 Score: 332.798 bits (852), Expect = 1.994e-108
Identity = 190/358 (53.07%), Postives = 255/358 (71.23%), Query Frame = 3
Query:   87 DVPPPLHPVEIALMAIGMVGNILCCMLMFRNRLMPDKXXXXXXXXXXXXXXXDFFSNLFYIISLISYPKIKSEALGAFVCRVIRSQALFWMISTLRAGVNVVIAILNFIKLLYPFLSTSXXXXXXXXXXXXXXFVVSLIQVVPHVSTVSFSPNSTKHNCNFSAILNFQEVTGLVGMVRFFALFNFIYLYIFPLTATMFLYKQVFNCLKESDDEPRKIAYREIMKSFLMDTVLYLLCFSMHSILFFLYQFSSKIGYLVTSTLYRIGMXXXXXXXXXXPYISMATRRAYRKPISDVMKIFGFKQYNTTIYKQSISKYGHSIDNXXXXXXXXXXXXXXXXXXGNTSKPTSSVNDWSDNDSF 1160
            + P  L+ +EI++M IGM GNI CC+LM R+RLMPD+NVN+NAV +L+QS LDFF  LFYI+SL+ YPKI ++ LG FVCR+I+S+ALFWMI +LRA +N+VI I NFIKLLYPFL +  NLI F+  GL +L  VSL+Q++P++  VSF  N    NCNFSAI  F E T L G++R +A+FNFIYLY+FP+T T+F+YKQ+++CLK+S+D  RKI  +EIMKSFL+DTV Y  CFS HSI+ FL +F+    Y +T   YRIGM ++ +YAV+YPYISM TRR Y+KP+SD+ K+ G K     + K+S SKY    +   +        ++  K S   SK +S+   WSD+ SF
Sbjct:    5 EEPYGLYSIEISIMVIGMSGNIACCILMSRSRLMPDRNVNMNAVFSLVQSALDFFLCLFYILSLMDYPKIHNDFLGIFVCRIIKSKALFWMICSLRAAINIVIGIFNFIKLLYPFLKSVSNLIMFLTAGLGMLVTVSLLQIIPNIGMVSFIRNDKMRNCNFSAIHRFVEFTKLFGILRLYAVFNFIYLYLFPITVTLFVYKQIYDCLKDSEDTSRKIVMKEIMKSFLLDTVFYFFCFSFHSIIMFLSEFNDNFEYSITDKSYRIGMAMIVMYAVVYPYISMITRRPYKKPMSDIAKLLGVKSPAIILDKRSTSKYA---NYETASSIFNALFQKTTKFSATLSKGSSTAKRWSDDASF 359          
BLAST of GCR130 vs. TrEMBL
Match: A0A3S5C8R3 (Uncharacterized protein OS=Protopolystoma xenopodis OX=117903 GN=PXEA_LOCUS36153 PE=4 SV=1)

HSP 1 Score: 83.5741 bits (205), Expect = 3.150e-14
Identity = 78/288 (27.08%), Postives = 145/288 (50.35%), Query Frame = 3
Query:  111 VEIALMAIGMVGNILCCMLMFRNRLMPDKXXXXXXXXXXXXXXXDFFSNLFYIISLISYPKIKSEALGAFVCRVIRSQALFWMISTLRAGVNVVIAILNFIKLLYPFLSTSXXXXXXXXXXXXXXFVVSLIQVVPHVSTVSFSPNSTKHNCNFSAILNFQEVTGLVGMVRFFALFNFIYLYIFPLTATMFLYKQVFNCLKESDDEPRKIAYREIMKSFLMDTVLYLLC---FSMHSILFFLYQFSSKIGYLVTSTLYRIGMXXXXXXXXXXPYISMATRRAYRKPISD 965
            +E+   AIG+ GNI C + +FR RL  D++ N   +L+LLQ+   FF  L  +  L S   +++ AL  F C  +  + L W    LR     ++A +NFI+LL+PF+     L+  +     +  + + I ++P +    F+ +            +         ++    LFN    ++ P +A   +Y+++   L  SDDE R++AY+E+ K++L+D++   +C    +++  L  L+Q +++   L  +T   I      ++A  YP++S+A RR Y+K I +
Sbjct:   11 IELLTSAIGIFGNITCLVALFRVRLQSDRSYNPLVLLHLLQA---FFDLLICMHGLCS--PLEAFALSIFTCLTLVLRPLIWFFYCLRLYCTFLLAGINFIRLLHPFIKAPAQLLLMVFFTCIVCLITASIGMLPLLIEPRFA-DGLCPTLGAKGQKDVSPAGDRAAVIHLLILFNLAINFLGPYSAIFHMYRKILASLGNSDDETRQLAYQELNKTYLLDSLFLGVCNLPLNLYC-LVALHQSANRPTVLFLATYPSI------VFATFYPFLSLAFRRMYKKAIME 285          
BLAST of GCR130 vs. TrEMBL
Match: A0A5J4NHK8 (G_PROTEIN_RECEP_F1_2 domain-containing protein (Fragment) OS=Paragonimus westermani OX=34504 GN=DEA37_0007624 PE=4 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 5.159e-13
Identity = 54/198 (27.27%), Postives = 96/198 (48.48%), Query Frame = 3
Query:  354 WMISTLRAGVNVVIAILNFIKLLYPFLSTSXXXXXXXXXXXXXXFVVSLIQVVPHVSTVSFSPNSTKHNCNFSAILNFQEVTGLVGMVRFFALFNFIYLYIFPLTATMFLYKQVFNCLKESDDEPRKIAYREIMKSFLMDTVLYLLCFSMHSILFFLYQFSSKIGYLVTSTLYRIGMXXXXXXXXXXPYISMATRRAY 947
            W+++ LR  +N  +A  +FI+L+YPF+  S      + +G   +        V H+ +     + T   C F        +   VG VR F L  F+Y ++FPLTA+ ++Y ++F+ ++ +  +  +  Y+E+ K+ + D  L+L C S   I  FL +  S+      S L  I   L+  Y +  P  S+  RR++
Sbjct:   40 WLLTGLRGALNFSVATHSFIQLVYPFVHVSIRRGVLVILGGFSVTFTLFTMAVAHLDS-----SETDRRCAFVP----DSLVDYVGFVRVFHLITFVYQFLFPLTASAYMYHKIFDTIRGAHSQVGRNVYKELWKTRMCDVYLFLFCVSPAHICAFLVRMHSEKTSYSNSRLELINTYLMIFYHIASPIYSLTFRRSF 228          
BLAST of GCR130 vs. TrEMBL
Match: A0A4S2LBB4 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_008559 PE=4 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 1.073e-12
Identity = 70/286 (24.48%), Postives = 126/286 (44.06%), Query Frame = 3
Query:  117 IALMAIGMVGNILCCMLMFRNRLMPDKXXXXXXXXXXXXXXXDFFSNLFYIISLISYPKIKSEALGAFVCRVIRSQALFWMISTLRAGVNVVIAILNFIKLLYPFLSTSXXXXXXXXXXXXXXFVVSLIQVVPHVSTVSFSPN-STKHNCNFSAILNFQEVTGLVGMVRFFALFNFIYLYIFPLTATMFLYKQVFNCLKESDDEPRKIAYREIMKSFLMDTVLYLLCFSMHSILFFLYQFSSKIGYLVTSTLYRIGMXXXXXXXXXXPYISMATRRAYRKPISDVM 971
            I L  +G V NI+  + + R              + ++Q  +D  + + Y++S +    +  +    F CR++R++ALFW     RA +NV  ++   ++++YPF ST  N          L    +++Q +        S + ST   C         +     G+  F  L++ IY + FP  A    +  +   L + D +  +  Y+E  ++  +D VL+++C S H  LF L  F+S   Y + +  Y +  LL   Y VL P  SM  R+    P+ + +
Sbjct:   10 ILLATVGTVINIISLIFVSRTTCQAGTLAKKVLYIIIVQHSIDIVACIAYLLSSV---DLDEQFPSIFTCRILRTRALFWAAINYRAYINVYGSLWQHVRIIYPFWSTVLNRTEGCVGLFLLATAANILQTLAFTRLSELSADQSTCIPCTPC------QTGENAGIYSFLVLYSTIYRFAFPAMAMFASFGYLMQVLSDCDGKVYRQMYKETRRNLFIDAVLFVICLSTHEALFTLNVFASNKEYGLRTAPYEVASLLALGYPVLSPCFSMCLRKTNYTPVLEAV 286          
BLAST of GCR130 vs. Planmine SMEST
Match: SMESG000062854.1 (SMESG000062854.1)

HSP 1 Score: 603.208 bits (1554), Expect = 0.000e+0
Identity = 361/361 (100.00%), Postives = 361/361 (100.00%), Query Frame = 3
Query:   78 MSDDVPPPLHPVEIALMAIGMVGNILCCMLMFRNRLMPDKXXXXXXXXXXXXXXXDFFSNLFYIISLISYPKIKSEALGAFVCRVIRSQALFWMISTLRAGVNVVIAILNFIKLLYPFLSTSXXXXXXXXXXXXXXFVVSLIQVVPHVSTVSFSPNSTKHNCNFSAILNFQEVTGLVGMVRFFALFNFIYLYIFPLTATMFLYKQVFNCLKESDDEPRKIAYREIMKSFLMDTVLYLLCFSMHSILFFLYQFSSKIGYLVTSTLYRIGMXXXXXXXXXXPYISMATRRAYRKPISDVMKIFGFKQYNTTIYKQSISKYGHSIDNXXXXXXXXXXXXXXXXXXGNTSKPTSSVNDWSDNDSF 1160
            MSDDVPPPLHPVEIALMAIGMVGNILCCMLMFRNRLMPDKNVNLNAVLNLLQSLLDFFSNLFYIISLISYPKIKSEALGAFVCRVIRSQALFWMISTLRAGVNVVIAILNFIKLLYPFLSTSGNLIGFIGIGLALLFVVSLIQVVPHVSTVSFSPNSTKHNCNFSAILNFQEVTGLVGMVRFFALFNFIYLYIFPLTATMFLYKQVFNCLKESDDEPRKIAYREIMKSFLMDTVLYLLCFSMHSILFFLYQFSSKIGYLVTSTLYRIGMLLVALYAVLYPYISMATRRAYRKPISDVMKIFGFKQYNTTIYKQSISKYGHSIDNSGSRFSKFFSSKQKNKPSGNTSKPTSSVNDWSDNDSF
Sbjct:    1 MSDDVPPPLHPVEIALMAIGMVGNILCCMLMFRNRLMPDKNVNLNAVLNLLQSLLDFFSNLFYIISLISYPKIKSEALGAFVCRVIRSQALFWMISTLRAGVNVVIAILNFIKLLYPFLSTSGNLIGFIGIGLALLFVVSLIQVVPHVSTVSFSPNSTKHNCNFSAILNFQEVTGLVGMVRFFALFNFIYLYIFPLTATMFLYKQVFNCLKESDDEPRKIAYREIMKSFLMDTVLYLLCFSMHSILFFLYQFSSKIGYLVTSTLYRIGMLLVALYAVLYPYISMATRRAYRKPISDVMKIFGFKQYNTTIYKQSISKYGHSIDNSGSRFSKFFSSKQKNKPSGNTSKPTSSVNDWSDNDSF 361          
BLAST of GCR130 vs. Planmine SMEST
Match: SMESG000062853.1 (SMESG000062853.1)

HSP 1 Score: 332.798 bits (852), Expect = 5.546e-112
Identity = 190/358 (53.07%), Postives = 255/358 (71.23%), Query Frame = 3
Query:   87 DVPPPLHPVEIALMAIGMVGNILCCMLMFRNRLMPDKXXXXXXXXXXXXXXXDFFSNLFYIISLISYPKIKSEALGAFVCRVIRSQALFWMISTLRAGVNVVIAILNFIKLLYPFLSTSXXXXXXXXXXXXXXFVVSLIQVVPHVSTVSFSPNSTKHNCNFSAILNFQEVTGLVGMVRFFALFNFIYLYIFPLTATMFLYKQVFNCLKESDDEPRKIAYREIMKSFLMDTVLYLLCFSMHSILFFLYQFSSKIGYLVTSTLYRIGMXXXXXXXXXXPYISMATRRAYRKPISDVMKIFGFKQYNTTIYKQSISKYGHSIDNXXXXXXXXXXXXXXXXXXGNTSKPTSSVNDWSDNDSF 1160
            + P  L+ +EI++M IGM GNI CC+LM R+RLMPD+NVN+NAV +L+QS LDFF  LFYI+SL+ YPKI ++ LG FVCR+I+S+ALFWMI +LRA +N+VI I NFIKLLYPFL +  NLI F+  GL +L  VSL+Q++P++  VSF  N    NCNFSAI  F E T L G++R +A+FNFIYLY+FP+T T+F+YKQ+++CLK+S+D  RKI  +EIMKSFL+DTV Y  CFS HSI+ FL +F+    Y +T   YRIGM ++ +YAV+YPYISM TRR Y+KP+SD+ K+ G K     + K+S SKY    +   +        ++  K S   SK +S+   WSD+ SF
Sbjct:    5 EEPYGLYSIEISIMVIGMSGNIACCILMSRSRLMPDRNVNMNAVFSLVQSALDFFLCLFYILSLMDYPKIHNDFLGIFVCRIIKSKALFWMICSLRAAINIVIGIFNFIKLLYPFLKSVSNLIMFLTAGLGMLVTVSLLQIIPNIGMVSFIRNDKMRNCNFSAIHRFVEFTKLFGILRLYAVFNFIYLYLFPITVTLFVYKQIYDCLKDSEDTSRKIVMKEIMKSFLLDTVFYFFCFSFHSIIMFLSEFNDNFEYSITDKSYRIGMAMIVMYAVVYPYISMITRRPYKKPMSDIAKLLGVKSPAIILDKRSTSKYA---NYETASSIFNALFQKTTKFSATLSKGSSTAKRWSDDASF 359          
BLAST of GCR130 vs. Planmine SMEST
Match: SMESG000062839.1 (SMESG000062839.1)

HSP 1 Score: 112.079 bits (279), Expect = 1.586e-27
Identity = 64/202 (31.68%), Postives = 109/202 (53.96%), Query Frame = 3
Query:  258 LFYIISLISYPKIKSEALGAFVCRVIRSQALFWMISTLRAGVNVVIAILNFIKLLYPFLSTSXXXXXXXXXXXXXXFVVSLIQVVPHVSTVSFSPNST-------KHNCNFSAILNFQEVTGLVGMVRFFALFNFIYLYIFPLTATMFLYKQVFNCLKESDDEPRKIAYREIMKSFLMDTVLYLLCFSMHSILFFLYQFSSK 842
            L YI+    YP+         +C+ + + AL W + T R+ + VVI + NFIKLLYPF++  GN+     +G+ + F +S + V+P+V  +S +PN         +  CNF  I      T  +G+   ++++ F+YLY+FP+ A   LY Q+ +CL +  D  R  AYRE++K + +D  L+ + +  +      Y FS++
Sbjct:   55 LLYILRFTKYPERNGNLSKIIICKYVVNLALLWFVVTFRSLLKVVICLNNFIKLLYPFMNVRGNVEIVFVVGIIINFAISCVAVIPYV--ISSAPNENVELNVDIESYCNFKKIEKIINETDFIGLQYIYSIYQFVYLYLFPIIACYILYNQILDCLCQHVDSTRMQAYREVLKCYWLDVFLFAILYGPYCFYSLSYCFSAQ 254          
BLAST of GCR130 vs. Planmine SMEST
Match: SMESG000062838.1 (SMESG000062838.1)

HSP 1 Score: 103.219 bits (256), Expect = 1.528e-24
Identity = 62/207 (29.95%), Postives = 118/207 (57.00%), Query Frame = 3
Query:  243 DFFSNLFYIISLISYPKIKSEALGAFVCRVIRSQALFWMISTLRAGVNVVIAILNFIKLLYPFLSTSXXXXXXXXXXXXXXFVVSLIQVVPHVSTVSFSPN-------STKHNCNFSAILNFQEVTGLVGMVRFFALFNFIYLYIFPLTATMFLYKQVFNCLKESDDEPRKIAYREIMKSFLMDTVLYLLCFSMHSILFFLYQFSSK 842
            D    + Y++  I+YP    +     +C+ I + A FW + + R+ +NVVI + NF+KLLYPF++  G       +GL +  ++S I +VP+V  ++  PN       +T+  C+F  I    + +  +G+   +++++F+YLY+FP+ A   LY Q+ NCL ++ D+ R + Y+E++K + +DT L+ + +  + +    + FSS+
Sbjct:   26 DILICVLYLLRAINYPLNNGKISRVIICKFIMNLAFFWFVVSFRSLLNVVICLNNFVKLLYPFMNIRGTFESIFLVGLLINIIISFISIVPYV--LASGPNEQVTVSVNTESYCHFDEITKVIQDSDFIGLQYIYSIYHFVYLYLFPIIACYILYNQILNCLCQNVDKTRILIYQELLKCYWLDTYLFAILYGPYCLYSLSFCFSSQ 230          
BLAST of GCR130 vs. Planmine SMEST
Match: SMESG000062805.1 (SMESG000062805.1)

HSP 1 Score: 61.6178 bits (148), Expect = 2.498e-10
Identity = 61/246 (24.80%), Postives = 119/246 (48.37%), Query Frame = 3
Query:  108 PVEIALMAIGMVGNILCCMLMFRNRLMPDKXXXXXXXXXXXXXXXDFFSNLFYIISLISYPKIKSEALGAFVCRVIRSQALFWMISTLRAGVNVVIAILNFIKLLYPFLSTSXXXXXXXXXXXXXXFVVSLIQVVPHV---STVSFSPNSTKHNCNFSAILNFQEVTGLVGMVRFFALFNFIYLYIFPLTATMFLYKQVFNCLKESDDEPRKIAYREIMKSFLMDTVLYLLCFSMHSILFFLYQFS 836
            P       +G++ N++   L+  NR + DK +N + + NL  +L D    L ++I+L+         +G  +C +  + + F+ + + R+G+ +++ + +FIKLLYPFL  S      +  G  LL   S++  +P +    T+ +        C      N++    L+ +V       F Y ++ P   T+F Y  +   +   +   R+ A+ E+ KSFL+D++L+++C+   S+    Y FS
Sbjct:    2 PFTTLAFGLGVIINVIFFYLLLINRHLSDKTINKSILFNLAITLCDGLICLEFLINLMDKWMFYEGFVGKLMCILFYNDSAFYFLMSCRSGLTLLMCLYHFIKLLYPFLVNSVYFTFVVSSGFVLLLGNSIL--IPFIIIRRTLIYGYEYELTYCLLEP-FNYEGTQFLINIVF------FTYSFLMPGIGTVFFYAHILKSINSIETISREKAFVELRKSFLIDSLLFIICYLHFSLKLLSYCFS 238          
The following BLAST results are available for this feature:
BLAST of GCR130 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR130 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR130 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR130 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR130 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR130 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR130 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR130 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A193KUD60.000e+0100.00GCR130 OS=Schmidtea mediterranea OX=79327 GN=gcr13... [more]
A0A193KUT41.994e-10853.07GCR127 OS=Schmidtea mediterranea OX=79327 GN=gcr12... [more]
A0A3S5C8R33.150e-1427.08Uncharacterized protein OS=Protopolystoma xenopodi... [more]
A0A5J4NHK85.159e-1327.27G_PROTEIN_RECEP_F1_2 domain-containing protein (Fr... [more]
A0A4S2LBB41.073e-1224.48Uncharacterized protein OS=Opisthorchis felineus O... [more]
back to top
BLAST of GCR130 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR130 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR130 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR130 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR130 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR130 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000062854.10.000e+0100.00SMESG000062854.1[more]
SMESG000062853.15.546e-11253.07SMESG000062853.1[more]
SMESG000062839.11.586e-2731.68SMESG000062839.1[more]
SMESG000062838.11.528e-2429.95SMESG000062838.1[more]
SMESG000062805.12.498e-1024.80SMESG000062805.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30028381 ID=SMED30028381|Name=GCR130|organism=Schmidtea mediterranea sexual|type=transcript|length=1217bp
CTTCCGATCTATTATAATATATATTCAATAAGATTGATTTTACTATAGTA
AAATAATAATAATTTGAAATTTTCGAAATGTCCGATGACGTCCCACCCCC
CTTGCATCCAGTAGAAATAGCTTTAATGGCGATCGGAATGGTTGGGAATA
TTCTTTGCTGCATGCTCATGTTTAGGAATCGACTTATGCCGGATAAAAAT
GTCAATTTAAATGCAGTTCTTAACCTTTTGCAATCCTTGTTGGATTTCTT
TTCGAATCTGTTTTATATAATTTCATTAATCAGTTATCCGAAAATAAAAT
CCGAAGCCCTTGGAGCATTTGTCTGTCGAGTAATCAGGAGCCAGGCGTTG
TTTTGGATGATTTCCACTCTTCGAGCCGGTGTAAATGTCGTGATTGCTAT
TTTGAACTTCATAAAACTGCTTTATCCGTTTTTGAGTACTTCCGGAAACC
TGATCGGTTTCATTGGAATCGGTTTGGCATTGTTGTTCGTCGTTTCTCTA
ATTCAGGTTGTTCCGCACGTCAGCACAGTCAGCTTCAGTCCAAATTCAAC
GAAGCACAATTGCAATTTTTCGGCTATTTTAAACTTTCAAGAAGTCACTG
GTTTAGTAGGAATGGTTCGATTTTTCGCGTTGTTTAACTTTATTTATTTG
TATATTTTTCCATTGACAGCGACAATGTTTCTGTATAAACAAGTATTTAA
TTGTTTAAAAGAAAGTGATGATGAACCAAGGAAAATAGCTTATAGAGAAA
TCATGAAAAGTTTTCTAATGGATACTGTGCTTTATTTATTGTGTTTTTCG
ATGCACAGTATTCTTTTTTTTCTCTACCAATTTTCTAGCAAAATTGGATA
TTTGGTTACTAGTACATTATATAGAATAGGAATGCTACTCGTTGCATTGT
ACGCAGTGTTGTATCCATATATATCAATGGCTACGAGGAGAGCATACAGG
AAACCGATTTCTGATGTTATGAAAATATTTGGTTTTAAACAGTATAACAC
GACAATTTATAAACAATCAATCTCCAAATACGGACATTCTATAGACAACA
GTGGGAGTAGGTTCTCAAAGTTCTTTTCATCAAAACAAAAAAATAAACCT
AGTGGTAACACATCTAAACCTACTTCTTCGGTCAATGACTGGTCTGATAA
TGATAGTTTTTAATTATTTATTTGTAACGTTAATTTAATATTTTATTAAA
TAAAAATAAAAATAATT
back to top

protein sequence of SMED30028381-orf-1

>SMED30028381-orf-1 ID=SMED30028381-orf-1|Name=SMED30028381-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=362bp
MSDDVPPPLHPVEIALMAIGMVGNILCCMLMFRNRLMPDKNVNLNAVLNL
LQSLLDFFSNLFYIISLISYPKIKSEALGAFVCRVIRSQALFWMISTLRA
GVNVVIAILNFIKLLYPFLSTSGNLIGFIGIGLALLFVVSLIQVVPHVST
VSFSPNSTKHNCNFSAILNFQEVTGLVGMVRFFALFNFIYLYIFPLTATM
FLYKQVFNCLKESDDEPRKIAYREIMKSFLMDTVLYLLCFSMHSILFFLY
QFSSKIGYLVTSTLYRIGMLLVALYAVLYPYISMATRRAYRKPISDVMKI
FGFKQYNTTIYKQSISKYGHSIDNSGSRFSKFFSSKQKNKPSGNTSKPTS
SVNDWSDNDSF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000208testis
Vocabulary: INTERPRO
TermDefinition
IPR017452GPCR_Rhodpsn_7TM
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:1.20.1070.10coord: 9..305
e-value: 7.5E-13
score: 50.3
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 332..361
NoneNo IPR availablePANTHERPTHR45698FAMILY NOT NAMEDcoord: 10..309
NoneNo IPR availableCDDcd006377tm_classA_rhodopsin-likecoord: 14..282
e-value: 2.00885E-7
score: 49.5834
NoneNo IPR availableSUPERFAMILYSSF81321Family A G protein-coupled receptor-likecoord: 9..304
NoneNo IPR availableTMHMMTMhelixcoord: 45..67
NoneNo IPR availableTMHMMTMhelixcoord: 90..112
NoneNo IPR availableTMHMMTMhelixcoord: 260..282
NoneNo IPR availableTMHMMTMhelixcoord: 228..250
NoneNo IPR availableTMHMMTMhelixcoord: 180..202
NoneNo IPR availableTMHMMTMhelixcoord: 10..32
NoneNo IPR availableTMHMMTMhelixcoord: 125..147
IPR017452GPCR, rhodopsin-like, 7TMPROSITEPS50262G_PROTEIN_RECEP_F1_2coord: 23..283
score: 13.33