Receptor-type tyrosine-protein phosphatase eta

Overview
NameReceptor-type tyrosine-protein phosphatase eta
Smed IDSMED30028362
Length (bp)2924
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Receptor-type tyrosine-protein phosphatase eta (SMED30028362) t-SNE clustered cells

Violin plots show distribution of expression levels for Receptor-type tyrosine-protein phosphatase eta (SMED30028362) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Receptor-type tyrosine-protein phosphatase eta (SMED30028362) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Receptor-type tyrosine-protein phosphatase eta (SMED30028362) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30028362

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30028362SMESG000032456.1 SMESG000032323.1 Contig697uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30028362SMESG000032456.1 SMESG000032323.1 Contig697newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30028362SMESG000046951.1 Contig697uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30028362SMESG000046951.1 Contig697newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
parenchymal cellSMED30028362SMESG000032467.1 SMESG000032456.1 SMESG000032323.1 dd_Smed_v4_1783_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30028362SMESG000032456.1 SMESG000032323.1 dd_Smed_v4_4358_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30028362SMESG000032467.1 SMESG000032456.1 SMESG000032323.1 dd_1783dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30028362SMESG000032467.1 SMESG000032456.1 SMESG000032323.1 dd_1783dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
parenchymal cellSMED30028362SMESG000032467.1 SMESG000032456.1 SMESG000032323.1 dd_Smed_v6_1783_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Ensembl Human
Match: PTPRJ (protein tyrosine phosphatase receptor type J [Source:HGNC Symbol;Acc:HGNC:9673])

HSP 1 Score: 172.17 bits (435), Expect = 6.528e-43
Identity = 105/306 (34.31%), Postives = 167/306 (54.58%), Query Frame = 2
Query: 1934 NERIFDIKNSIKYSRVDSIEN-----KKNESKNLEQFTKEFKDLALRARKYEKLNNYTTFVGESEKNKSKNRFVNILPYDQTRVVLQ-NNSKKNDYINANYIPFVEKRDKYEFIASQGPIQNSISDFWDMIWENNVTMIVMLTRTYEEDKFKCLQYWPESKGKTVKFGENQEYEVSMEEELKENSFLERKLEVLNKNSNEQRSIIHLQMIEWYDYSAPKFEDFEFLLFRF--QDIILRADFH-PILIHCSAGVGRTGTFIVLDRIIRKMMQGXXXXXXXXXXXXXRKYRKMMVQRVVQFIFIRDFV 2824
            NE  F    S+K S++  +EN     KK ++ +   F +E++DL L      K      +  E  +N+ KNR+ N+LPYD +RV L       +DYINANY+P      K +FIA+QGP+ N++ DFW M+WE NV  I+MLT+  E+ + KC +YWP  + +   +G   +  V+M  E+    +  R   V N  ++E   +       W D+  P   D   + FR+  +D + ++    PIL+HCSAGVGRTGTFI +DR+I + ++    + +   + ++R +R +MVQ   Q++F+   V
Sbjct: 1006 NEVSFSQIKSLKRSKLIRVENFEAYFKKQQADSNCGFAEEYEDLKLVGISQPK------YAAELAENRGKNRYNNVLPYDISRVKLSVQTHSTDDYINANYMPGYHS--KKDFIATQGPLPNTLKDFWRMVWEKNVYAIIMLTKCVEQGRTKCEEYWPSKQAQ--DYG---DITVAMTSEIVLPEWTIRDFTVKNIQTSESHPLRQFHFTSWPDHGVPDTTDL-LINFRYLVRDYMKQSPPESPILVHCSAGVGRTGTFIAIDRLIYQ-IENENTVDVYGIVYDLRMHRPLMVQTEDQYVFLNQCV 1296          
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Ensembl Human
Match: PTPRJ (protein tyrosine phosphatase receptor type J [Source:HGNC Symbol;Acc:HGNC:9673])

HSP 1 Score: 171.785 bits (434), Expect = 6.840e-43
Identity = 105/306 (34.31%), Postives = 167/306 (54.58%), Query Frame = 2
Query: 1934 NERIFDIKNSIKYSRVDSIEN-----KKNESKNLEQFTKEFKDLALRARKYEKLNNYTTFVGESEKNKSKNRFVNILPYDQTRVVLQ-NNSKKNDYINANYIPFVEKRDKYEFIASQGPIQNSISDFWDMIWENNVTMIVMLTRTYEEDKFKCLQYWPESKGKTVKFGENQEYEVSMEEELKENSFLERKLEVLNKNSNEQRSIIHLQMIEWYDYSAPKFEDFEFLLFRF--QDIILRADFH-PILIHCSAGVGRTGTFIVLDRIIRKMMQGXXXXXXXXXXXXXRKYRKMMVQRVVQFIFIRDFV 2824
            NE  F    S+K S++  +EN     KK ++ +   F +E++DL L      K      +  E  +N+ KNR+ N+LPYD +RV L       +DYINANY+P      K +FIA+QGP+ N++ DFW M+WE NV  I+MLT+  E+ + KC +YWP  + +   +G   +  V+M  E+    +  R   V N  ++E   +       W D+  P   D   + FR+  +D + ++    PIL+HCSAGVGRTGTFI +DR+I + ++    + +   + ++R +R +MVQ   Q++F+   V
Sbjct: 1010 NEVSFSQIKSLKRSKLIRVENFEAYFKKQQADSNCGFAEEYEDLKLVGISQPK------YAAELAENRGKNRYNNVLPYDISRVKLSVQTHSTDDYINANYMPGYHS--KKDFIATQGPLPNTLKDFWRMVWEKNVYAIIMLTKCVEQGRTKCEEYWPSKQAQ--DYG---DITVAMTSEIVLPEWTIRDFTVKNIQTSESHPLRQFHFTSWPDHGVPDTTDL-LINFRYLVRDYMKQSPPESPILVHCSAGVGRTGTFIAIDRLIYQ-IENENTVDVYGIVYDLRMHRPLMVQTEDQYVFLNQCV 1300          
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Ensembl Human
Match: PTPRJ (protein tyrosine phosphatase receptor type J [Source:HGNC Symbol;Acc:HGNC:9673])

HSP 1 Score: 167.548 bits (423), Expect = 1.499e-41
Identity = 101/292 (34.59%), Postives = 161/292 (55.14%), Query Frame = 2
Query: 1967 KYSRVDSIEN--KKNESKNLEQFTKEFKDLALRARKYEKLNNYTTFVGESEKNKSKNRFVNILPYDQTRVVLQ-NNSKKNDYINANYIPFVEKRDKYEFIASQGPIQNSISDFWDMIWENNVTMIVMLTRTYEEDKFKCLQYWPESKGKTVKFGENQEYEVSMEEELKENSFLERKLEVLNKNSNEQRSIIHLQMIEWYDYSAPKFEDFEFLLFRF--QDIILRADFH-PILIHCSAGVGRTGTFIVLDRIIRKMMQGXXXXXXXXXXXXXRKYRKMMVQRVVQFIFIRDFV 2824
            K  RV++ E   KK ++ +   F +E++DL L      K      +  E  +N+ KNR+ N+LPYD +RV L       +DYINANY+P      K +FIA+QGP+ N++ DFW M+WE NV  I+MLT+  E+ + KC +YWP  + +   +G   +  V+M  E+    +  R   V N  ++E   +       W D+  P   D   + FR+  +D + ++    PIL+HCSAGVGRTGTFI +DR+I + ++    + +   + ++R +R +MVQ   Q++F+   V
Sbjct: 1019 KLIRVENFEAYFKKQQADSNCGFAEEYEDLKLVGISQPK------YAAELAENRGKNRYNNVLPYDISRVKLSVQTHSTDDYINANYMPGYHS--KKDFIATQGPLPNTLKDFWRMVWEKNVYAIIMLTKCVEQGRTKCEEYWPSKQAQ--DYG---DITVAMTSEIVLPEWTIRDFTVKNIQTSESHPLRQFHFTSWPDHGVPDTTDL-LINFRYLVRDYMKQSPPESPILVHCSAGVGRTGTFIAIDRLIYQ-IENENTVDVYGIVYDLRMHRPLMVQTEDQYVFLNQCV 1295          
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Ensembl Human
Match: PTPRN2 (protein tyrosine phosphatase receptor type N2 [Source:HGNC Symbol;Acc:HGNC:9677])

HSP 1 Score: 151.369 bits (381), Expect = 5.715e-40
Identity = 91/275 (33.09%), Postives = 143/275 (52.00%), Query Frame = 2
Query: 2012 KNLEQFTKEFKDLALRARKYEKLNNYTTFVGESEKNKSKNRFVNILPYDQTRVVL--QNNSKKNDYINANYIPFVEKRDKYEFIASQGPIQNSISDFWDMIWENNVTMIVMLTRTYEEDKFKCLQYWPESKGKTVKFGENQEYEVSM-EEELKENSFLERKLEVLNKNSNEQRSIIHLQMIEWYDYSAPKFEDFEFLLFRFQDIILRADFHPILIHCSAGVGRTGTFIVLDRIIRKMMQGXXXXXXXXXXXXXRKYRKMMVQRVVQFIFIRDFVS 2827
            KN  +  KE++ L      Y+   N ++FV + E+N  KNR + +L YD +RV+L  +N+   +DYINA+ I   + R+   +IA+QGP+  +++DFW M+WE+   +IVMLT   E    +C  YWP+             YEV++  E +    FL R   + N  +NE R++     + WYD   P          R  +   R    PI++HCS G GR+GT++++D ++ KM +G  +I I   +  +R  R  MVQ   QF F    V+
Sbjct:    8 KNKNRLEKEWEALC----AYQAEPN-SSFVAQREENVPKNRSLAVLTYDHSRVLLKAENSHSHSDYINASPIMDHDPRNP-AYIATQGPLPATVADFWQMVWESGCVVIVMLTPLAENGVRQCYHYWPDEGSNLYHI-----YEVNLVSEHIWCEDFLVRSFYLKNLQTNETRTVTQFHFLSWYDRGVPSSSRSLLDFRRKVNKCYRGRSCPIIVHCSDGAGRSGTYVLIDMVLNKMAKGAKEIDIAATLEHLRDQRPGMVQTKEQFEFALTAVA 271          
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Ensembl Human
Match: PTPN13 (protein tyrosine phosphatase non-receptor type 13 [Source:HGNC Symbol;Acc:HGNC:9646])

HSP 1 Score: 162.925 bits (411), Expect = 7.557e-40
Identity = 90/262 (34.35%), Postives = 143/262 (54.58%), Query Frame = 2
Query: 2096 FVGESEKNKSKNRFVNILPYDQTRVVLQNNSKKNDYINANYIPFVEKRDKYEFIASQGPIQNSISDFWDMIWENNVTMIVMLTRTYEEDKFKCLQYWPESKGKTVKFGENQEYEVSMEEELKENSFLERKLEVLNKNSNEQRSIIHLQMIEWYDYSAPKFEDFEFLLFRFQDIILRADFHPILIHCSAGVGRTGTFIVLDRIIRKMMQGXXXXXXXXXXXXXRKYRKMMVQRVVQFIFIRDFVSYFLHKYSQQDENNNEENL 2881
             +G++++N+ KNR+ NILPYD TRV L +   +  YINA++I     ++++ +IA QGP+  ++ DFW MIWE   T+I M+T+  E +K KC +YWP   GKT          +   ++LK   F+ R + + +  + E R I HL    W D+  P   D       +   I R+   PI+ HCSAG+GR+GT I +D ++  ++  +LD  I+D +  +R  R  MVQ   Q+IF    + Y L +   ++E   +  L
Sbjct: 2039 LIGQTKENRRKNRYKNILPYDATRVPLGD---EGGYINASFIKIPVGKEEFVYIACQGPLPTTVGDFWQMIWEQKSTVIAMMTQEVEGEKIKCQRYWPNILGKTTMVSNRLRLALVRMQQLK--GFVVRAMTLEDIQTREVRHISHLNFTAWPDHDTPSQPDDLLTFISYMRHIHRSG--PIITHCSAGIGRSGTLICID-VVLGLISQDLDFDISDLVRCMRLQRHGMVQTEDQYIFCYQVILYVLTRLQAEEEQKQQPQL 2292          
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Ensembl Celegans
Match: Y41D4A.5 (Tyrosine-protein phosphatase [Source:UniProtKB/TrEMBL;Acc:Q95Y26])

HSP 1 Score: 152.91 bits (385), Expect = 3.325e-39
Identity = 92/292 (31.51%), Postives = 162/292 (55.48%), Query Frame = 2
Query: 1997 KKNESKNLEQFTKEFKDLALRARKYEKLNNYTTFVGESEKNKSKNRFVNILPYDQTRVVLQNNSKKND-YINANYIPFVEKRDKYEFIASQGPIQNSISDFWDMIWENNVTMIVMLTRTYEEDKFKCLQYWPESKGKTVKFGENQEYEVSMEEE--LKENSFLERKLEVLNKNSNEQRSIIHLQMIEWYDYSAPKFE----DFEFLLFRFQDIILRADFHPILIHCSAGVGRTGTFIVLDRIIRKMMQGXXXXXXX--XXXXXXRKYRKMMVQRVVQFIFIRDFVSYFLHKY 2845
            K+ E+   + + + F  + +   K      Y +    + ++ ++NR+ +ILPYD+ RV +Q +S+  + Y+NA+ I       K EFIA+Q P+  ++ ++W MI E+ V+++V+L +  E +K KC +YWPE  G++  FG   +YE+++EEE    ++ +L R L++ N+ + E R +  L   EW D+  P  E    +   L+    + +   D  PIL+HCSAGVGRTGT I ++  IR+ M+      I+    ++ +RK R  MVQ   QF F+   ++ +  ++
Sbjct:   86 KEEEAYTPQDYLRRFYQIRVEQEKLRMEAEYRSECAVAPQHYARNRYRDILPYDKNRVEIQKDSENPEGYMNASLIQL--PGGKTEFIAAQAPLPATLDEWWKMIDEHRVSLVVILCKLVELNKIKCERYWPEQVGESELFG---DYEITLEEEKLFDDDEYLMRCLKMENQTTGECRKVHQLHYREWPDHGCPSGEKQLLNMIDLMENIHEEVSPQDSSPILVHCSAGVGRTGTIIAIN-FIREQMKAETLHSIDIFGLVMTLRKQRASMVQTQDQFQFVHRCIASYCRRH 371          
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Ensembl Celegans
Match: ptp-3 (Tyrosine-protein phosphatase Lar-like [Source:UniProtKB/Swiss-Prot;Acc:Q9BMN8])

HSP 1 Score: 154.836 bits (390), Expect = 4.248e-38
Identity = 102/300 (34.00%), Postives = 146/300 (48.67%), Query Frame = 2
Query: 1985 SIENKKNESKNLEQFTKEFKDLALRARKYEKL--NNYTTFVGE----------------SEKNKSKNRFVNILPYDQTRVVLQN--NSKKNDYINANYIPFVEKRDKYEFIASQGPIQNSISDFWDMIWENNVTMIVMLTRTYEEDKFKCLQYWPESKGKTVKFGENQEYEVSMEEELKENSFLERKLEVLNKNSNEQRSIIHLQMIEWYDYSAPKFEDFEFLLFRFQDIILRADFHPILIHCSAGVGRTGTFIVLDRIIRKMMQGXXXXXXXXXXXXXRKYRKMMVQRVVQFIFIRDFV 2824
            +I +  N   N+   +     +A  A   E+L  NN   F  E                ++ NK KNR+ N+  YD +RVVL N       DYINANY+   +K   Y  IA+QGP+  + SDFW M+WE     IVMLT   E  + KC QYWP S+G T  +G   + EV++ E +    +  R + +      E R I HLQ   W D+  P       +  +    +   D  PI+ HCSAG+GRTG FIV+D ++ + ++ +  + I   +  +R  R  MVQ   Q+IFI D V
Sbjct:  491 AIPSLPNNGNNMTTVSHPAVPIAELANHIERLRMNNNAGFQSEFESIETGQHFTWEHSSADMNKHKNRYANVAAYDHSRVVLSNVEGYPGMDYINANYVDGYDKPRSY--IATQGPLPETFSDFWRMVWEEQSVTIVMLTNLEERSRVKCDQYWP-SRG-TATYG---DIEVTLLESVHLAHYTMRTMRLKMVGEPEVREIKHLQYTAWPDHGVPDHPTPFLIFLKRVKTLNPNDAGPIISHCSAGIGRTGAFIVIDCMLER-LRYDNTVDIYGCVTALRAQRSYMVQTEEQYIFIHDAV 782          

HSP 2 Score: 123.25 bits (308), Expect = 3.212e-28
Identity = 80/248 (32.26%), Postives = 122/248 (49.19%), Query Frame = 2
Query: 2117 NKSKNRFVNILPYDQTRVVLQ--NNSKKNDYINANYIPFVEKRDKYEFIASQGPIQNSISDFWDMIWENNVTMIVMLTRTYEEDKFKCLQYWPESKGKTVKFGENQEYEVSMEEELKENSFLERKLEVLNKNSNEQRSIIHLQMIEWYDYSAPKFEDFEFLLFRFQDIILRADF---HPILIHCSAGVGRTGTFIVLDRIIRKMMQGXXXXXXXXXXXXXRKYRKMMVQRVVQFIFIRDFVSYFLHKY 2845
            N+ KNR ++ +PYD  RV+++    +  +DYINA++I   ++R  Y  IA+Q P   + +DFW  IWE+N  +I ML RT E  + +C  YWP   G  V        E   E ++K   +  R+  + + N+ E R++     +EW D   P   D  FL F  Q     A F    PI +HC +G GRT  FI L  II   M+    + +   +  +R  R+ M+Q   Q+ F+      +L  Y
Sbjct:  841 NRPKNRMLSAVPYDSNRVIMRLLPGADGSDYINASWIDGYKERGAY--IATQAPTNETAADFWRAIWEHNSPIIAMLVRTNERGQEQCSDYWPLETGVQVGM---LVVEPMAEYDMKH--YHLREFRISDINTREVRTVRQFHFMEWPDVGKPHTAD-HFLDFVTQVHNTYAQFGCTGPITVHCCSGAGRTAVFIALS-IILDRMRAEHVVDVFTTVKLLRTERQNMIQEPEQYHFLYLAAYEYLAAY 1079          
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Ensembl Celegans
Match: ptp-3 (Tyrosine-protein phosphatase Lar-like [Source:UniProtKB/Swiss-Prot;Acc:Q9BMN8])

HSP 1 Score: 155.221 bits (391), Expect = 5.047e-38
Identity = 102/300 (34.00%), Postives = 146/300 (48.67%), Query Frame = 2
Query: 1985 SIENKKNESKNLEQFTKEFKDLALRARKYEKL--NNYTTFVGE----------------SEKNKSKNRFVNILPYDQTRVVLQN--NSKKNDYINANYIPFVEKRDKYEFIASQGPIQNSISDFWDMIWENNVTMIVMLTRTYEEDKFKCLQYWPESKGKTVKFGENQEYEVSMEEELKENSFLERKLEVLNKNSNEQRSIIHLQMIEWYDYSAPKFEDFEFLLFRFQDIILRADFHPILIHCSAGVGRTGTFIVLDRIIRKMMQGXXXXXXXXXXXXXRKYRKMMVQRVVQFIFIRDFV 2824
            +I +  N   N+   +     +A  A   E+L  NN   F  E                ++ NK KNR+ N+  YD +RVVL N       DYINANY+   +K   Y  IA+QGP+  + SDFW M+WE     IVMLT   E  + KC QYWP S+G T  +G   + EV++ E +    +  R + +      E R I HLQ   W D+  P       +  +    +   D  PI+ HCSAG+GRTG FIV+D ++ + ++ +  + I   +  +R  R  MVQ   Q+IFI D V
Sbjct:  875 AIPSLPNNGNNMTTVSHPAVPIAELANHIERLRMNNNAGFQSEFESIETGQHFTWEHSSADMNKHKNRYANVAAYDHSRVVLSNVEGYPGMDYINANYVDGYDKPRSY--IATQGPLPETFSDFWRMVWEEQSVTIVMLTNLEERSRVKCDQYWP-SRG-TATYG---DIEVTLLESVHLAHYTMRTMRLKMVGEPEVREIKHLQYTAWPDHGVPDHPTPFLIFLKRVKTLNPNDAGPIISHCSAGIGRTGAFIVIDCMLER-LRYDNTVDIYGCVTALRAQRSYMVQTEEQYIFIHDAV 1166          

HSP 2 Score: 123.635 bits (309), Expect = 2.875e-28
Identity = 80/248 (32.26%), Postives = 122/248 (49.19%), Query Frame = 2
Query: 2117 NKSKNRFVNILPYDQTRVVLQ--NNSKKNDYINANYIPFVEKRDKYEFIASQGPIQNSISDFWDMIWENNVTMIVMLTRTYEEDKFKCLQYWPESKGKTVKFGENQEYEVSMEEELKENSFLERKLEVLNKNSNEQRSIIHLQMIEWYDYSAPKFEDFEFLLFRFQDIILRADF---HPILIHCSAGVGRTGTFIVLDRIIRKMMQGXXXXXXXXXXXXXRKYRKMMVQRVVQFIFIRDFVSYFLHKY 2845
            N+ KNR ++ +PYD  RV+++    +  +DYINA++I   ++R  Y  IA+Q P   + +DFW  IWE+N  +I ML RT E  + +C  YWP   G  V        E   E ++K   +  R+  + + N+ E R++     +EW D   P   D  FL F  Q     A F    PI +HC +G GRT  FI L  II   M+    + +   +  +R  R+ M+Q   Q+ F+      +L  Y
Sbjct: 1225 NRPKNRMLSAVPYDSNRVIMRLLPGADGSDYINASWIDGYKERGAY--IATQAPTNETAADFWRAIWEHNSPIIAMLVRTNERGQEQCSDYWPLETGVQVGM---LVVEPMAEYDMKH--YHLREFRISDINTREVRTVRQFHFMEWPDVGKPHTAD-HFLDFVTQVHNTYAQFGCTGPITVHCCSGAGRTAVFIALS-IILDRMRAEHVVDVFTTVKLLRTERQNMIQEPEQYHFLYLAAYEYLAAY 1463          
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Ensembl Celegans
Match: ptp-3 (Tyrosine-protein phosphatase Lar-like [Source:UniProtKB/Swiss-Prot;Acc:Q9BMN8])

HSP 1 Score: 154.836 bits (390), Expect = 5.221e-38
Identity = 102/300 (34.00%), Postives = 146/300 (48.67%), Query Frame = 2
Query: 1985 SIENKKNESKNLEQFTKEFKDLALRARKYEKL--NNYTTFVGE----------------SEKNKSKNRFVNILPYDQTRVVLQN--NSKKNDYINANYIPFVEKRDKYEFIASQGPIQNSISDFWDMIWENNVTMIVMLTRTYEEDKFKCLQYWPESKGKTVKFGENQEYEVSMEEELKENSFLERKLEVLNKNSNEQRSIIHLQMIEWYDYSAPKFEDFEFLLFRFQDIILRADFHPILIHCSAGVGRTGTFIVLDRIIRKMMQGXXXXXXXXXXXXXRKYRKMMVQRVVQFIFIRDFV 2824
            +I +  N   N+   +     +A  A   E+L  NN   F  E                ++ NK KNR+ N+  YD +RVVL N       DYINANY+   +K   Y  IA+QGP+  + SDFW M+WE     IVMLT   E  + KC QYWP S+G T  +G   + EV++ E +    +  R + +      E R I HLQ   W D+  P       +  +    +   D  PI+ HCSAG+GRTG FIV+D ++ + ++ +  + I   +  +R  R  MVQ   Q+IFI D V
Sbjct:  624 AIPSLPNNGNNMTTVSHPAVPIAELANHIERLRMNNNAGFQSEFESIETGQHFTWEHSSADMNKHKNRYANVAAYDHSRVVLSNVEGYPGMDYINANYVDGYDKPRSY--IATQGPLPETFSDFWRMVWEEQSVTIVMLTNLEERSRVKCDQYWP-SRG-TATYG---DIEVTLLESVHLAHYTMRTMRLKMVGEPEVREIKHLQYTAWPDHGVPDHPTPFLIFLKRVKTLNPNDAGPIISHCSAGIGRTGAFIVIDCMLER-LRYDNTVDIYGCVTALRAQRSYMVQTEEQYIFIHDAV 915          

HSP 2 Score: 123.25 bits (308), Expect = 3.146e-28
Identity = 80/248 (32.26%), Postives = 122/248 (49.19%), Query Frame = 2
Query: 2117 NKSKNRFVNILPYDQTRVVLQ--NNSKKNDYINANYIPFVEKRDKYEFIASQGPIQNSISDFWDMIWENNVTMIVMLTRTYEEDKFKCLQYWPESKGKTVKFGENQEYEVSMEEELKENSFLERKLEVLNKNSNEQRSIIHLQMIEWYDYSAPKFEDFEFLLFRFQDIILRADF---HPILIHCSAGVGRTGTFIVLDRIIRKMMQGXXXXXXXXXXXXXRKYRKMMVQRVVQFIFIRDFVSYFLHKY 2845
            N+ KNR ++ +PYD  RV+++    +  +DYINA++I   ++R  Y  IA+Q P   + +DFW  IWE+N  +I ML RT E  + +C  YWP   G  V        E   E ++K   +  R+  + + N+ E R++     +EW D   P   D  FL F  Q     A F    PI +HC +G GRT  FI L  II   M+    + +   +  +R  R+ M+Q   Q+ F+      +L  Y
Sbjct:  974 NRPKNRMLSAVPYDSNRVIMRLLPGADGSDYINASWIDGYKERGAY--IATQAPTNETAADFWRAIWEHNSPIIAMLVRTNERGQEQCSDYWPLETGVQVGM---LVVEPMAEYDMKH--YHLREFRISDINTREVRTVRQFHFMEWPDVGKPHTAD-HFLDFVTQVHNTYAQFGCTGPITVHCCSGAGRTAVFIALS-IILDRMRAEHVVDVFTTVKLLRTERQNMIQEPEQYHFLYLAAYEYLAAY 1212          
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Ensembl Celegans
Match: ptp-3 (Tyrosine-protein phosphatase Lar-like [Source:UniProtKB/Swiss-Prot;Acc:Q9BMN8])

HSP 1 Score: 155.221 bits (391), Expect = 5.372e-38
Identity = 102/300 (34.00%), Postives = 146/300 (48.67%), Query Frame = 2
Query: 1985 SIENKKNESKNLEQFTKEFKDLALRARKYEKL--NNYTTFVGE----------------SEKNKSKNRFVNILPYDQTRVVLQN--NSKKNDYINANYIPFVEKRDKYEFIASQGPIQNSISDFWDMIWENNVTMIVMLTRTYEEDKFKCLQYWPESKGKTVKFGENQEYEVSMEEELKENSFLERKLEVLNKNSNEQRSIIHLQMIEWYDYSAPKFEDFEFLLFRFQDIILRADFHPILIHCSAGVGRTGTFIVLDRIIRKMMQGXXXXXXXXXXXXXRKYRKMMVQRVVQFIFIRDFV 2824
            +I +  N   N+   +     +A  A   E+L  NN   F  E                ++ NK KNR+ N+  YD +RVVL N       DYINANY+   +K   Y  IA+QGP+  + SDFW M+WE     IVMLT   E  + KC QYWP S+G T  +G   + EV++ E +    +  R + +      E R I HLQ   W D+  P       +  +    +   D  PI+ HCSAG+GRTG FIV+D ++ + ++ +  + I   +  +R  R  MVQ   Q+IFI D V
Sbjct:  895 AIPSLPNNGNNMTTVSHPAVPIAELANHIERLRMNNNAGFQSEFESIETGQHFTWEHSSADMNKHKNRYANVAAYDHSRVVLSNVEGYPGMDYINANYVDGYDKPRSY--IATQGPLPETFSDFWRMVWEEQSVTIVMLTNLEERSRVKCDQYWP-SRG-TATYG---DIEVTLLESVHLAHYTMRTMRLKMVGEPEVREIKHLQYTAWPDHGVPDHPTPFLIFLKRVKTLNPNDAGPIISHCSAGIGRTGAFIVIDCMLER-LRYDNTVDIYGCVTALRAQRSYMVQTEEQYIFIHDAV 1186          

HSP 2 Score: 123.635 bits (309), Expect = 2.998e-28
Identity = 80/248 (32.26%), Postives = 122/248 (49.19%), Query Frame = 2
Query: 2117 NKSKNRFVNILPYDQTRVVLQ--NNSKKNDYINANYIPFVEKRDKYEFIASQGPIQNSISDFWDMIWENNVTMIVMLTRTYEEDKFKCLQYWPESKGKTVKFGENQEYEVSMEEELKENSFLERKLEVLNKNSNEQRSIIHLQMIEWYDYSAPKFEDFEFLLFRFQDIILRADF---HPILIHCSAGVGRTGTFIVLDRIIRKMMQGXXXXXXXXXXXXXRKYRKMMVQRVVQFIFIRDFVSYFLHKY 2845
            N+ KNR ++ +PYD  RV+++    +  +DYINA++I   ++R  Y  IA+Q P   + +DFW  IWE+N  +I ML RT E  + +C  YWP   G  V        E   E ++K   +  R+  + + N+ E R++     +EW D   P   D  FL F  Q     A F    PI +HC +G GRT  FI L  II   M+    + +   +  +R  R+ M+Q   Q+ F+      +L  Y
Sbjct: 1245 NRPKNRMLSAVPYDSNRVIMRLLPGADGSDYINASWIDGYKERGAY--IATQAPTNETAADFWRAIWEHNSPIIAMLVRTNERGQEQCSDYWPLETGVQVGM---LVVEPMAEYDMKH--YHLREFRISDINTREVRTVRQFHFMEWPDVGKPHTAD-HFLDFVTQVHNTYAQFGCTGPITVHCCSGAGRTAVFIALS-IILDRMRAEHVVDVFTTVKLLRTERQNMIQEPEQYHFLYLAAYEYLAAY 1483          
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Ensembl Fly
Match: Ptp69D (gene:FBgn0014007 transcript:FBtr0075913)

HSP 1 Score: 158.303 bits (399), Expect = 7.081e-39
Identity = 97/261 (37.16%), Postives = 147/261 (56.32%), Query Frame = 2
Query: 2063 RKYEKLNNY----TTFVGESEKNKSKNRFVNILPYDQTRVVLQ--NNSKKNDYINANYIPFVEKRDKYEFIASQGPIQNSISDFWDMIWENNVTMIVMLTRTYEEDKFKCLQYWPESKGKTVKFGENQEYEVSMEEELKENSFLERKLEVLNKNSN-----EQRSIIHLQMIEWYDYSAPKFEDFEFLLFRFQDIILRADFHPILIHCSAGVGRTGTFIVLDRIIRKMMQGXXXXXXXXXXXXXRKYRKMMVQRVVQFIFI 2812
            R+YE L N     TT   + ++N  KNR+ +I  YDQTRV L   N  +  DYINAN++   ++R K  FI +QGP++++I DFW MIWE ++ +IVMLT   E +K KC +YWPE    T +FG   +  V   +E K   ++ER L V    +N     ++R I     + W D+ AP+         R  + +      PIL+HCSAGVGRTGT + LD +I+++ +    + I + + ++R  R  +VQ + Q+IF+
Sbjct:  895 REYEMLPNRFSDRTTKNSDLKENACKNRYPDIKAYDQTRVKLAVINGLQTTDYINANFVIGYKERKK--FICAQGPMESTIDDFWRMIWEQHLEIIVMLTNLEEYNKAKCAKYWPEKVFDTKQFG---DILVKFAQERKTGDYIERTLNVSKNKANVGEEEDRRQITQYHYLTWKDFMAPEHPHGIIKFIRQINSVYSLQRGPILVHCSAGVGRTGTLVALDSLIQQLEE-EDSVSIYNTVCDLRHQRNFLVQSLKQYIFL 1149          

HSP 2 Score: 85.5001 bits (210), Expect = 2.061e-16
Identity = 73/268 (27.24%), Postives = 127/268 (47.39%), Query Frame = 2
Query: 1949 DIKNSIKYSRVDSIENKKNESKNLEQFTKEFKDLALRARKYEKLNNYTTFVGESEKNKSKNRFVNILPYDQTRVVLQNNSKKND--YINANYIPFVEKRDKYE-FIASQGPIQNSISDFWDMIWENNVTMIVMLTRTYEEDKFKCLQYWPESKGKTVKFGENQEYEVSMEEELKENS---FLERKLEVLNKNSNEQRSIIHLQMIEW--YDYSAPK-----FEDFEFLLFRFQDIILRADFHPILIHCSAGVGRTGTFIVLDRIIRKM 2713
            DI      S ++S++ K NE K   +   EF+ L   A +  K    +  VGE+E+N  KNR   I+PYD+ RV+L     + +  YINA+   F+E  D  E FI +Q P++N+I DFW MI E +VT +VM++   +  + KC +YW +         +  +Y+  + + +   S   +  R+  V N   ++   +   Q   W   D   P+      E  +     +++        P+ +HCS G  R+  F+ +  +++ +
Sbjct: 1163 DICIDTMASAIESLKRKPNEGKC--KLEVEFEKLLATADEISK----SCSVGENEENNMKNRSQEIIPYDRNRVILTPLPMRENSTYINAS---FIEGYDNSETFIIAQDPLENTIGDFWRMISEQSVTTLVMISEIGDGPR-KCPRYWAD---------DEVQYDHILVKYVHSESCPYYTRREFYVTNCKIDDTLKVTQFQYNGWPTVDGEVPEVCRGIIELVDQAYNHYKNNKNSGCRSPLTVHCSLGTDRSSIFVAMCILVQHL 1411          
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Ensembl Fly
Match: Ptp69D (gene:FBgn0014007 transcript:FBtr0075914)

HSP 1 Score: 157.918 bits (398), Expect = 7.917e-39
Identity = 97/261 (37.16%), Postives = 147/261 (56.32%), Query Frame = 2
Query: 2063 RKYEKLNNY----TTFVGESEKNKSKNRFVNILPYDQTRVVLQ--NNSKKNDYINANYIPFVEKRDKYEFIASQGPIQNSISDFWDMIWENNVTMIVMLTRTYEEDKFKCLQYWPESKGKTVKFGENQEYEVSMEEELKENSFLERKLEVLNKNSN-----EQRSIIHLQMIEWYDYSAPKFEDFEFLLFRFQDIILRADFHPILIHCSAGVGRTGTFIVLDRIIRKMMQGXXXXXXXXXXXXXRKYRKMMVQRVVQFIFI 2812
            R+YE L N     TT   + ++N  KNR+ +I  YDQTRV L   N  +  DYINAN++   ++R K  FI +QGP++++I DFW MIWE ++ +IVMLT   E +K KC +YWPE    T +FG   +  V   +E K   ++ER L V    +N     ++R I     + W D+ AP+         R  + +      PIL+HCSAGVGRTGT + LD +I+++ +    + I + + ++R  R  +VQ + Q+IF+
Sbjct:  894 REYEMLPNRFSDRTTKNSDLKENACKNRYPDIKAYDQTRVKLAVINGLQTTDYINANFVIGYKERKK--FICAQGPMESTIDDFWRMIWEQHLEIIVMLTNLEEYNKAKCAKYWPEKVFDTKQFG---DILVKFAQERKTGDYIERTLNVSKNKANVGEEEDRRQITQYHYLTWKDFMAPEHPHGIIKFIRQINSVYSLQRGPILVHCSAGVGRTGTLVALDSLIQQLEE-EDSVSIYNTVCDLRHQRNFLVQSLKQYIFL 1148          

HSP 2 Score: 85.5001 bits (210), Expect = 2.131e-16
Identity = 73/268 (27.24%), Postives = 127/268 (47.39%), Query Frame = 2
Query: 1949 DIKNSIKYSRVDSIENKKNESKNLEQFTKEFKDLALRARKYEKLNNYTTFVGESEKNKSKNRFVNILPYDQTRVVLQNNSKKND--YINANYIPFVEKRDKYE-FIASQGPIQNSISDFWDMIWENNVTMIVMLTRTYEEDKFKCLQYWPESKGKTVKFGENQEYEVSMEEELKENS---FLERKLEVLNKNSNEQRSIIHLQMIEW--YDYSAPK-----FEDFEFLLFRFQDIILRADFHPILIHCSAGVGRTGTFIVLDRIIRKM 2713
            DI      S ++S++ K NE K   +   EF+ L   A +  K    +  VGE+E+N  KNR   I+PYD+ RV+L     + +  YINA+   F+E  D  E FI +Q P++N+I DFW MI E +VT +VM++   +  + KC +YW +         +  +Y+  + + +   S   +  R+  V N   ++   +   Q   W   D   P+      E  +     +++        P+ +HCS G  R+  F+ +  +++ +
Sbjct: 1162 DICIDTMASAIESLKRKPNEGKC--KLEVEFEKLLATADEISK----SCSVGENEENNMKNRSQEIIPYDRNRVILTPLPMRENSTYINAS---FIEGYDNSETFIIAQDPLENTIGDFWRMISEQSVTTLVMISEIGDGPR-KCPRYWAD---------DEVQYDHILVKYVHSESCPYYTRREFYVTNCKIDDTLKVTQFQYNGWPTVDGEVPEVCRGIIELVDQAYNHYKNNKNSGCRSPLTVHCSLGTDRSSIFVAMCILVQHL 1410          
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Ensembl Fly
Match: Ptp10D (gene:FBgn0004370 transcript:FBtr0330393)

HSP 1 Score: 149.828 bits (377), Expect = 3.769e-36
Identity = 100/267 (37.45%), Postives = 150/267 (56.18%), Query Frame = 2
Query: 2024 QFTKEFKDLALRARKYEKLNNYTTFVGESEKNKSKNRFVNILPYDQTRVVLQ--NNSKKNDYINANYIPFVEKRDKYEFIASQGPIQNSISDFWDMIWENNVTMIVMLTRTYEEDKFKCLQYWPESKGKTVKFGENQEYEVSMEEELKENSFLERKL-EVLNKNSNEQRSIIHLQMIEWYDYSAPKFEDFEFLLFR-FQDIILRADFHPILIHCSAGVGRTGTFIVLDRIIRKMMQGXXXXXXXXXXXXXRKYRKMMVQRVVQFIFI 2812
            +F++EF++L     K+   +   TF  +   N+ KNRF NILPYD +R  LQ  ++ + +DYINANY+P        EFI +QGP+ ++  DFW M WE+N   IVMLTR +E+ + KC QYWP      V +G   + +V +   L ++ + +  + E +    +EQR + H     W D+  P          R F+D I  A+  PI++HCSAGVGR+GTFI LDRI+++ +  +  + I   +  +RK R  MVQ   Q+I I
Sbjct: 1271 RFSEEFEEL-----KHVGRDQPCTF-ADLPCNRPKNRFTNILPYDHSRFKLQPVDDDEGSDYINANYVP--GHNSPREFIVTQGPLHSTRDDFWRMCWESNSRAIVMLTRCFEKGREKCDQYWPNDT-VPVFYG---DIKVQI---LNDSHYADWVMTEFMLCRGSEQRILRHFHFTTWPDFGVPNPPQTLVRFVRAFRDRI-GAEQRPIVVHCSAGVGRSGTFITLDRILQQ-INTSDYVDIFGIVYAMRKERVWMVQTEQQYICI 1520          
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Ensembl Fly
Match: Ptp10D (gene:FBgn0004370 transcript:FBtr0330392)

HSP 1 Score: 149.828 bits (377), Expect = 3.769e-36
Identity = 100/267 (37.45%), Postives = 150/267 (56.18%), Query Frame = 2
Query: 2024 QFTKEFKDLALRARKYEKLNNYTTFVGESEKNKSKNRFVNILPYDQTRVVLQ--NNSKKNDYINANYIPFVEKRDKYEFIASQGPIQNSISDFWDMIWENNVTMIVMLTRTYEEDKFKCLQYWPESKGKTVKFGENQEYEVSMEEELKENSFLERKL-EVLNKNSNEQRSIIHLQMIEWYDYSAPKFEDFEFLLFR-FQDIILRADFHPILIHCSAGVGRTGTFIVLDRIIRKMMQGXXXXXXXXXXXXXRKYRKMMVQRVVQFIFI 2812
            +F++EF++L     K+   +   TF  +   N+ KNRF NILPYD +R  LQ  ++ + +DYINANY+P        EFI +QGP+ ++  DFW M WE+N   IVMLTR +E+ + KC QYWP      V +G   + +V +   L ++ + +  + E +    +EQR + H     W D+  P          R F+D I  A+  PI++HCSAGVGR+GTFI LDRI+++ +  +  + I   +  +RK R  MVQ   Q+I I
Sbjct: 1271 RFSEEFEEL-----KHVGRDQPCTF-ADLPCNRPKNRFTNILPYDHSRFKLQPVDDDEGSDYINANYVP--GHNSPREFIVTQGPLHSTRDDFWRMCWESNSRAIVMLTRCFEKGREKCDQYWPNDT-VPVFYG---DIKVQI---LNDSHYADWVMTEFMLCRGSEQRILRHFHFTTWPDFGVPNPPQTLVRFVRAFRDRI-GAEQRPIVVHCSAGVGRSGTFITLDRILQQ-INTSDYVDIFGIVYAMRKERVWMVQTEQQYICI 1520          
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Ensembl Fly
Match: Ptp10D (gene:FBgn0004370 transcript:FBtr0330394)

HSP 1 Score: 149.443 bits (376), Expect = 4.118e-36
Identity = 100/267 (37.45%), Postives = 150/267 (56.18%), Query Frame = 2
Query: 2024 QFTKEFKDLALRARKYEKLNNYTTFVGESEKNKSKNRFVNILPYDQTRVVLQ--NNSKKNDYINANYIPFVEKRDKYEFIASQGPIQNSISDFWDMIWENNVTMIVMLTRTYEEDKFKCLQYWPESKGKTVKFGENQEYEVSMEEELKENSFLERKL-EVLNKNSNEQRSIIHLQMIEWYDYSAPKFEDFEFLLFR-FQDIILRADFHPILIHCSAGVGRTGTFIVLDRIIRKMMQGXXXXXXXXXXXXXRKYRKMMVQRVVQFIFI 2812
            +F++EF++L     K+   +   TF  +   N+ KNRF NILPYD +R  LQ  ++ + +DYINANY+P        EFI +QGP+ ++  DFW M WE+N   IVMLTR +E+ + KC QYWP      V +G   + +V +   L ++ + +  + E +    +EQR + H     W D+  P          R F+D I  A+  PI++HCSAGVGR+GTFI LDRI+++ +  +  + I   +  +RK R  MVQ   Q+I I
Sbjct: 1293 RFSEEFEEL-----KHVGRDQPCTF-ADLPCNRPKNRFTNILPYDHSRFKLQPVDDDEGSDYINANYVP--GHNSPREFIVTQGPLHSTRDDFWRMCWESNSRAIVMLTRCFEKGREKCDQYWPNDT-VPVFYG---DIKVQI---LNDSHYADWVMTEFMLCRGSEQRILRHFHFTTWPDFGVPNPPQTLVRFVRAFRDRI-GAEQRPIVVHCSAGVGRSGTFITLDRILQQ-INTSDYVDIFGIVYAMRKERVWMVQTEQQYICI 1542          
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Ensembl Zebrafish
Match: ptprh (protein tyrosine phosphatase receptor type H [Source:ZFIN;Acc:ZDB-GENE-091118-90])

HSP 1 Score: 164.466 bits (415), Expect = 2.283e-41
Identity = 102/298 (34.23%), Postives = 164/298 (55.03%), Query Frame = 2
Query: 2027 FTKEFKDLALRARKYEKLNNYTTFVGESEKNKSKNRFVNILPYDQTRVVLQ-NNSKKNDYINANYIPFVEKRDKYEFIASQGPIQNSISDFWDMIWENNVTMIVMLTRTYEEDKFKCLQYWPESKGKTVKFGENQEYEVSMEEELKENSFLERKLEVLNKNSNEQRSIIHLQMIEWYDYSAPKFEDFEFLLFRFQDII---LRADFH--PILIHCSAGVGRTGTFIVLDRIIRKMMQGXXXXXXXXXXXXXRKYRKMMVQRVVQFIFIRDFVSYFLH-KYSQQDEN--NNEENLYFNS 2893
            F+ E+ DL+    +  K+           +NK KNRF N+LPYD +RV L  N +  +DYINANY+P      + E+IA+QGP+ ++++DFW MIWE   + IVM+T   E  + KC QYWP      +     +   V+++ E K  S+  R+  V NK ++E R++ H     W D+  P+  +    L +F+D+I   + + F   P ++HCSAGVGRTGT I LD +++++ +    + +   + E+R  R +MVQ   Q++F+   +   L  K+ QQ E    N + +Y N+
Sbjct:  485 FSAEYDDLSSVGVEQSKV------AALLPENKDKNRFSNVLPYDTSRVHLTINKAGDSDYINANYMPGYGNASR-EYIAAQGPLPSTVNDFWRMIWEKKSSTIVMVTNCTEGGRVKCEQYWPLDYTPCLY----ENLLVTVKSENKSQSWTLREFNVKNKMTSETRTVRHFHFTAWPDHGVPRGTE---ELIQFRDLIRQHIESHFSTGPTVVHCSAGVGRTGTLIALDVLLQQLNR-EKAVGVAAFVQEMRLNRPLMVQTESQYVFLHQCILDSLQTKFVQQSEPIYQNTDTIYVNA 767          
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Ensembl Zebrafish
Match: ptprsa (protein tyrosine phosphatase receptor type Sa [Source:ZFIN;Acc:ZDB-GENE-020107-3])

HSP 1 Score: 164.081 bits (414), Expect = 3.820e-41
Identity = 93/258 (36.05%), Postives = 141/258 (54.65%), Query Frame = 2
Query: 2060 ARKYEKLNNYTTFVGES---EKNKSKNRFVNILPYDQTRVVLQ--NNSKKNDYINANYIPFVEKRDKYEFIASQGPIQNSISDFWDMIWENNVTMIVMLTRTYEEDKFKCLQYWPESKGKTVKFGENQEYEVSMEEELKENSFLERKLEVLNKNSNEQRSIIHLQMIEWYDYSAPKFEDFEFLLFRFQDIILRADFHPILIHCSAGVGRTGTFIVLDRIIRKMMQGXXXXXXXXXXXXXRKYRKMMVQRVVQFIFIRD 2818
            +++YE ++    F  E    E NK KNR+ N++ YD TRV+L   +    +DYINANYI    K++ Y  IA+QGP+  + +DFW M+WE     +VM+TR  E+ + KC QYWP S+G T  FG  Q   VS+ + ++  +F  R   +    SNE+R +   Q   W D+  P++        R        D  P+++HCSAGVGRTG FIV+D ++ ++ Q    + +   +  +R  R  MVQ   Q+ FI +
Sbjct:  229 SQEYESIDPGQQFTWEHSNLEVNKQKNRYANVIAYDHTRVILAPVDGIMGSDYINANYIDGYRKQNAY--IATQGPLPETFADFWRMVWEQRAATVVMMTRLEEKSRVKCDQYWP-SRG-TDSFGAVQ---VSLLDTMELATFCVRTFSLHKNGSNERREVRQFQFTAWPDHGVPEYPTPFLAFLRRVKACNPPDAGPVIVHCSAGVGRTGCFIVIDAMLERLRQ-ERAVDVYGHVTLMRSQRNYMVQTEDQYGFIHE 478          

HSP 2 Score: 136.732 bits (343), Expect = 1.841e-32
Identity = 76/205 (37.07%), Postives = 113/205 (55.12%), Query Frame = 2
Query: 2117 NKSKNRFVNILPYDQTRVVLQ--NNSKKNDYINANYIPFVEKRDKY-EFIASQGPIQNSISDFWDMIWENNVTMIVMLTRTYEEDKFKCLQYWPESKGKTVKFGENQEYEVSMEEELKENSFLERKLEVLNKNSNEQRSIIHLQMIEWYDYSAPKFEDFEFLLFRFQDIILRADF---HPILIHCSAGVGRTGTFIVLDRIIRKM 2713
            NK KNR VNI+PY+ TRV LQ     + +DYINA++I      D Y  +IA+QGP+  +  DFW M+WE+N T++VMLT+  E  + KC QYWP  +    ++     + V    E     ++ R+ +V +    + R++   Q  +W +   PK  +  F+ F  Q    +  F    PI +HCSAGVGRTG FI L  ++ +M
Sbjct:  540 NKFKNRLVNIMPYETTRVCLQPIRGLEGSDYINASFI------DGYRAYIATQGPLAETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWPAERSARYQY-----FVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPEQGVPKSGE-GFIDFIGQVHKTKEQFGQDGPITVHCSAGVGRTGVFITLSIVLERM 732          
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Ensembl Zebrafish
Match: ptprfa (protein tyrosine phosphatase receptor type Fa [Source:ZFIN;Acc:ZDB-GENE-020107-2])

HSP 1 Score: 163.696 bits (413), Expect = 1.629e-40
Identity = 94/258 (36.43%), Postives = 144/258 (55.81%), Query Frame = 2
Query: 2060 ARKYEKLNNYTTFVGES---EKNKSKNRFVNILPYDQTRVVLQ--NNSKKNDYINANYIPFVEKRDKYEFIASQGPIQNSISDFWDMIWENNVTMIVMLTRTYEEDKFKCLQYWPESKGKTVKFGENQEYEVSMEEELKENSFLERKLEVLNKNSNEQRSIIHLQMIEWYDYSAPKFEDFEFLLFRFQDIILRADFHPILIHCSAGVGRTGTFIVLDRIIRKMMQGXXXXXXXXXXXXXRKYRKMMVQRVVQFIFIRD 2818
            +++YE ++    F  E+   E NK KNR+ N++ YD +RVVL   +    +DYIN NYI    K++ Y  IA+QGP+  ++SDFW M+WE   + IVM+TR  E+ + KC QYWP S+G T  +G  Q   VSM + ++  ++  R   +    S+E+R +   Q + W D+  P++        R        D  P+++HCSAGVGRTG FIV+D ++ +M      + I   +  +R  R  MVQ   Q+IFI +
Sbjct:  632 SQEYESVDPGQQFTWENSNLEVNKPKNRYANVIAYDHSRVVLTPVDGVPGSDYINGNYIDGYRKQNAY--IATQGPLPETLSDFWRMVWEQRTSTIVMMTRLEEKSRVKCDQYWP-SRG-TETYGMIQ---VSMLDTVELATYSVRTFALYKNGSSEKREVRQFQFMAWPDHGVPEYPTPILAFLRRVKACNPPDAGPMVVHCSAGVGRTGCFIVIDAMLERMKH-EKSVDIYGHVTCMRSQRNYMVQTEDQYIFIHE 881          

HSP 2 Score: 136.346 bits (342), Expect = 4.437e-32
Identity = 74/204 (36.27%), Postives = 113/204 (55.39%), Query Frame = 2
Query: 2117 NKSKNRFVNILPYDQTRVVLQ--NNSKKNDYINANYIPFVEKRDKYEFIASQGPIQNSISDFWDMIWENNVTMIVMLTRTYEEDKFKCLQYWPESKGKTVKFGENQEYEVSMEEELKENSFLERKLEVLNKNSNEQRSIIHLQMIEWYDYSAPKFEDFEFLLFRFQDIILRADF---HPILIHCSAGVGRTGTFIVLDRIIRKM 2713
            NK KNR VNI+P++ +RV LQ     + +DYINA++I    ++  Y  IA+QGP+  +  DFW M+WE+N T++VMLT+  E  + KC QYWP  +    ++     + V    E     ++ R+ +V +    + R+I   Q  +W +   PK  +  F+ F  Q    +  F    PI +HCSAGVGRTG FI L  ++ +M
Sbjct:  943 NKFKNRLVNIMPFESSRVCLQPIRGVEGSDYINASFIDGYRQQKAY--IATQGPLSETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWPAERSARYQY-----FVVDPMAEYNMPQYILREFKVTDARDGQSRTIRQFQFTDWPEQGVPKTGE-GFIDFIGQVHKTKEQFGQDGPITVHCSAGVGRTGVFITLSIVLERM 1138          
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Ensembl Zebrafish
Match: ptprz1b (protein tyrosine phosphatase receptor type Z1b [Source:ZFIN;Acc:ZDB-GENE-050506-100])

HSP 1 Score: 160.999 bits (406), Expect = 1.202e-39
Identity = 118/349 (33.81%), Postives = 174/349 (49.86%), Query Frame = 2
Query: 1838 KTRVINKPSLTKNLTSNLLPKTEIMNLKRTEVNERIFDIKNSIKYSRVDSIENKKNESKNLEQFTKEFKDLALRARKYEKLNNYTTFVG------ESEKNKSKNRFVNILPYDQTRVVLQNNSKKN----DYINANYIPFVEKRDKYEFIASQGPIQNSISDFWDMIWENNVTMIVMLTRTYEEDKFKCLQYWPESKGKTVKFGENQEYEVSMEEELKEN---------SFLERKLEV---LNKNSNEQRSIIHLQMIEWYDYSAPKFEDFEFLLFRFQDIILRADFHPILIHCSAGVGRTGTFIVLDRIIRKMMQGXXXXXXXXXXXXXRKYRKMMVQRVVQFIFIRD 2818
              R I+ PS     T  LLP         TE NE +  +K+ +K+   D   N K        F+KEF+ L      YE++   T  +G          NKSKNR++NIL YD +RV L  NS K+    DYINANY+    +   Y  IA+QGP++ S+ DFW MIWE NV +IVM+T   E+ + KC QYWP          ENQE        LK +         +F  R +++     K  +++R+++H    +W D   P++        R       A+  P+++HCSAGVGRTGT+IV+D +++++ +    + I   +  IR  R  +VQ   Q++FI D
Sbjct:  662 SARAISAPS-----TPLLLP---------TEDNEAL-PVKDFVKHV-ADLHANHK--------FSKEFEILK---ESYEEIQGCTADMGITTDSSNHPDNKSKNRYINILAYDHSRVKLSQNSDKDGKTGDYINANYVDGFNQPKAY--IAAQGPLKGSLEDFWRMIWEQNVGVIVMITNLVEKGRRKCDQYWPL---------ENQEDYGCFLVTLKSSRTLAYYTLRTFTLRNVQIKKGSQKGRSQERTVLHFHYTQWPDMGVPEYTLPLLSFIRTSSQARTAEMGPVVVHCSAGVGRTGTYIVIDSMLKQIKE-ENTVNIMGFLKHIRTQRNYLVQTEEQYVFIHD 971          

HSP 2 Score: 92.0485 bits (227), Expect = 2.546e-18
Identity = 74/236 (31.36%), Postives = 118/236 (50.00%), Query Frame = 2
Query: 2033 KEFKDLALRARKYEKLNNYTTFVGESEKNKSKNRFVNILPYDQTRVVLQNNS-KKNDYINANYI-PFVEKRDKYEFIASQGPIQNSISDFWDMIWENNVTMIVMLTRTYE-EDKFKCLQYWP------ESKGKTVKFGENQEYEVSMEEELKENSFLERKLEVLNKNSNEQRSIIHLQMIEWYDYSAPKFEDFEFLLFRFQDIILRADFHPILIHCSAGVGRTGTFIVLDRIIRKM 2713
            K+FK   L ++   K ++YTT + ES  N SKNR   ++P +++RV L   + + +DYINA+Y+  F + R   EFI +Q P+ N+I DFW MIW++N  +IV L  T+    + +C+ YWP        +  TV F +     +S EE +    F+   LE L  +   +  +   Q   W D  +P    FE +    ++   R    P+LIH   G    G F  L  ++ ++
Sbjct: 1009 KQFK---LVSQSCAKQSDYTTALKES--NVSKNRTACLMPVERSRVSLSAAAGESSDYINASYLLGFHQSR---EFIVTQNPLPNTIHDFWRMIWDHNTQIIVSLPDTHNMSSEAECV-YWPTKDEPISCETFTVSFRDEDSLNLSNEEPVLVQHFI---LEALKDDYVLE--VHQFQSPRWPDPDSPISNCFELINIIREESSRREG--PVLIHDGCGGSSAGLFCALVTLVNQL 1228          
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Ensembl Zebrafish
Match: ptprz1b (protein tyrosine phosphatase receptor type Z1b [Source:ZFIN;Acc:ZDB-GENE-050506-100])

HSP 1 Score: 160.614 bits (405), Expect = 1.472e-39
Identity = 118/349 (33.81%), Postives = 174/349 (49.86%), Query Frame = 2
Query: 1838 KTRVINKPSLTKNLTSNLLPKTEIMNLKRTEVNERIFDIKNSIKYSRVDSIENKKNESKNLEQFTKEFKDLALRARKYEKLNNYTTFVG------ESEKNKSKNRFVNILPYDQTRVVLQNNSKKN----DYINANYIPFVEKRDKYEFIASQGPIQNSISDFWDMIWENNVTMIVMLTRTYEEDKFKCLQYWPESKGKTVKFGENQEYEVSMEEELKEN---------SFLERKLEV---LNKNSNEQRSIIHLQMIEWYDYSAPKFEDFEFLLFRFQDIILRADFHPILIHCSAGVGRTGTFIVLDRIIRKMMQGXXXXXXXXXXXXXRKYRKMMVQRVVQFIFIRD 2818
              R I+ PS     T  LLP         TE NE +  +K+ +K+   D   N K        F+KEF+ L      YE++   T  +G          NKSKNR++NIL YD +RV L  NS K+    DYINANY+    +   Y  IA+QGP++ S+ DFW MIWE NV +IVM+T   E+ + KC QYWP          ENQE        LK +         +F  R +++     K  +++R+++H    +W D   P++        R       A+  P+++HCSAGVGRTGT+IV+D +++++ +    + I   +  IR  R  +VQ   Q++FI D
Sbjct:  667 SARAISAPS-----TPLLLP---------TEDNEAL-PVKDFVKHV-ADLHANHK--------FSKEFEILK---ESYEEIQGCTADMGITTDSSNHPDNKSKNRYINILAYDHSRVKLSQNSDKDGKTGDYINANYVDGFNQPKAY--IAAQGPLKGSLEDFWRMIWEQNVGVIVMITNLVEKGRRKCDQYWPL---------ENQEDYGCFLVTLKSSRTLAYYTLRTFTLRNVQIKKGSQKGRSQERTVLHFHYTQWPDMGVPEYTLPLLSFIRTSSQARTAEMGPVVVHCSAGVGRTGTYIVIDSMLKQIKE-ENTVNIMGFLKHIRTQRNYLVQTEEQYVFIHD 976          

HSP 2 Score: 92.0485 bits (227), Expect = 2.486e-18
Identity = 74/236 (31.36%), Postives = 118/236 (50.00%), Query Frame = 2
Query: 2033 KEFKDLALRARKYEKLNNYTTFVGESEKNKSKNRFVNILPYDQTRVVLQNNS-KKNDYINANYI-PFVEKRDKYEFIASQGPIQNSISDFWDMIWENNVTMIVMLTRTYE-EDKFKCLQYWP------ESKGKTVKFGENQEYEVSMEEELKENSFLERKLEVLNKNSNEQRSIIHLQMIEWYDYSAPKFEDFEFLLFRFQDIILRADFHPILIHCSAGVGRTGTFIVLDRIIRKM 2713
            K+FK   L ++   K ++YTT + ES  N SKNR   ++P +++RV L   + + +DYINA+Y+  F + R   EFI +Q P+ N+I DFW MIW++N  +IV L  T+    + +C+ YWP        +  TV F +     +S EE +    F+   LE L  +   +  +   Q   W D  +P    FE +    ++   R    P+LIH   G    G F  L  ++ ++
Sbjct: 1014 KQFK---LVSQSCAKQSDYTTALKES--NVSKNRTACLMPVERSRVSLSAAAGESSDYINASYLLGFHQSR---EFIVTQNPLPNTIHDFWRMIWDHNTQIIVSLPDTHNMSSEAECV-YWPTKDEPISCETFTVSFRDEDSLNLSNEEPVLVQHFI---LEALKDDYVLE--VHQFQSPRWPDPDSPISNCFELINIIREESSRREG--PVLIHDGCGGSSAGLFCALVTLVNQL 1233          
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Ensembl Xenopus
Match: rasgrf1 (Ras protein specific guanine nucleotide releasing factor 1 [Source:Xenbase;Acc:XB-GENE-493672])

HSP 1 Score: 169.859 bits (429), Expect = 3.969e-42
Identity = 89/249 (35.74%), Postives = 142/249 (57.03%), Query Frame = 2
Query: 2096 FVGESEKNKSKNRFVNILPYDQTRVVLQNNSKKNDYINANYIPFVEKRDKYEFIASQGPIQNSISDFWDMIWENNVTMIVMLTRTYEEDKFKCLQYWPESKGKTVKFGENQEYEVSMEEELKENSFLERKLEVLNKNSNEQRSIIHLQMIEWYDYSAPKFEDFEFLLFRFQDIILRADFHPILIHCSAGVGRTGTFIVLDRIIRKMMQGXXXXXXXXXXXXXRKYRKMMVQRVVQFIFIRDFVSYFLHK 2842
             +G++++NK KNR+ NILPYD TRV L     ++ YINA++I      ++  +IA QGP+ +++SDFW M+WE N ++I M+T+  E  K KC +YWPE  G+ ++     +  + M + L+  SF+ R LE+ +    E R I HL    W D+  P   +       F   I R+   PI+ HCSAG+GR+GT I LD ++  ++  +L+  I + +  +R +R  M+Q   Q+IF    + Y L +
Sbjct: 2163 LIGQTKENKKKNRYKNILPYDATRVPL---GAEHGYINASFIKMPVGNEELIYIACQGPLPSTVSDFWQMVWEQNSSVIAMMTQEVEAGKIKCQRYWPEELGRPIRISNQLQLTLVMTQHLE--SFVLRVLELEDVQGEEVRQIAHLNYTAWPDHDTPSDPNQLLTFISFMRHIYRSG--PIITHCSAGIGRSGTLICLD-VMLALISKDLEFDILNMVHTMRLHRHGMIQTEEQYIFCYQVILYILKR 2403          
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Ensembl Xenopus
Match: ENSXETT00000033793.1 (protein tyrosine phosphatase, receptor type H [Source:NCBI gene;Acc:101733801])

HSP 1 Score: 156.762 bits (395), Expect = 1.351e-41
Identity = 100/287 (34.84%), Postives = 151/287 (52.61%), Query Frame = 2
Query: 2060 ARKYEKLNNY----TTFVGESEKNKSKNRFVNILPYDQTRVVLQ--NNSKKNDYINANYIPFVEKRDKYEFIASQGPIQNSISDFWDMIWENNVTMIVMLTRTYEEDKFKCLQYWPESKGKTVKFGENQEYEVSMEEELKENSFLERKLEVLNKNSNEQRSIIHLQMIEWYDYSAPK----FEDFEFLLFRFQDIILRADFHPILIHCSAGVGRTGTFIVLDRIIRKMMQGXXXXXXXXXXXXXRKYRKMMVQRVVQFIFIRDFVSYFLHKYSQQDENNNEENLYFN 2890
            A +Y++L+N     +    E  +N+SKNRF N+LPYD +RV L   +  + +DYINANY+P        EFIASQGP+ N+ +DFW MIWEN V+ IVMLT   E  + KC  YWP        +G   +  V++  E+    +  R   + +      +   H     W D+  P+      +F  L+  + D  L+    P ++HCSAGVGRTGT I LD +I+K M+    I I   + ++R+ R +MVQ   Q++F+   +   +       +N  +EN+Y N
Sbjct:   21 AEEYQQLSNVGINQSKLAAELSENRSKNRFTNVLPYDHSRVRLNRIDADETSDYINANYMPGYNSSK--EFIASQGPLPNTSADFWRMIWENQVSTIVMLTNCMENGRVKCEHYWPLDY-TPCTYG---DITVTVTSEMILPDWTVRDFTLKHAKQQGNKHARHFHFTVWPDHGVPENTTTIVEFRNLVREYMD--LKRSSGPTVVHCSAGVGRTGTLIALDYLIQK-MEKEQRIGIYSFVQKMRQNRPLMVQTESQYVFLNKCMLDLI-------QNPPDENIYEN 291          
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Ensembl Xenopus
Match: rasgrf1 (Ras protein specific guanine nucleotide releasing factor 1 [Source:Xenbase;Acc:XB-GENE-493672])

HSP 1 Score: 162.925 bits (411), Expect = 5.876e-40
Identity = 89/249 (35.74%), Postives = 142/249 (57.03%), Query Frame = 2
Query: 2096 FVGESEKNKSKNRFVNILPYDQTRVVLQNNSKKNDYINANYIPFVEKRDKYEFIASQGPIQNSISDFWDMIWENNVTMIVMLTRTYEEDKFKCLQYWPESKGKTVKFGENQEYEVSMEEELKENSFLERKLEVLNKNSNEQRSIIHLQMIEWYDYSAPKFEDFEFLLFRFQDIILRADFHPILIHCSAGVGRTGTFIVLDRIIRKMMQGXXXXXXXXXXXXXRKYRKMMVQRVVQFIFIRDFVSYFLHK 2842
             +G++++NK KNR+ NILPYD TRV L     ++ YINA++I      ++  +IA QGP+ +++SDFW M+WE N ++I M+T+  E  K KC +YWPE  G+ ++     +  + M + L+  SF+ R LE+ +    E R I HL    W D+  P   +       F   I R+   PI+ HCSAG+GR+GT I LD ++  ++  +L+  I + +  +R +R  M+Q   Q+IF    + Y L +
Sbjct: 2264 LIGQTKENKKKNRYKNILPYDATRVPL---GAEHGYINASFIKMPVGNEELIYIACQGPLPSTVSDFWQMVWEQNSSVIAMMTQEVEAGKIKCQRYWPEELGRPIRISNQLQLTLVMTQHLE--SFVLRVLELEDVQGEEVRQIAHLNYTAWPDHDTPSDPNQLLTFISFMRHIYRSG--PIITHCSAGIGRSGTLICLD-VMLALISKDLEFDILNMVHTMRLHRHGMIQTEEQYIFCYQVILYILKR 2504          
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Ensembl Xenopus
Match: rasgrf1 (Ras protein specific guanine nucleotide releasing factor 1 [Source:Xenbase;Acc:XB-GENE-493672])

HSP 1 Score: 162.54 bits (410), Expect = 8.969e-40
Identity = 89/249 (35.74%), Postives = 142/249 (57.03%), Query Frame = 2
Query: 2096 FVGESEKNKSKNRFVNILPYDQTRVVLQNNSKKNDYINANYIPFVEKRDKYEFIASQGPIQNSISDFWDMIWENNVTMIVMLTRTYEEDKFKCLQYWPESKGKTVKFGENQEYEVSMEEELKENSFLERKLEVLNKNSNEQRSIIHLQMIEWYDYSAPKFEDFEFLLFRFQDIILRADFHPILIHCSAGVGRTGTFIVLDRIIRKMMQGXXXXXXXXXXXXXRKYRKMMVQRVVQFIFIRDFVSYFLHK 2842
             +G++++NK KNR+ NILPYD TRV L     ++ YINA++I      ++  +IA QGP+ +++SDFW M+WE N ++I M+T+  E  K KC +YWPE  G+ ++     +  + M + L+  SF+ R LE+ +    E R I HL    W D+  P   +       F   I R+   PI+ HCSAG+GR+GT I LD ++  ++  +L+  I + +  +R +R  M+Q   Q+IF    + Y L +
Sbjct: 2212 LIGQTKENKKKNRYKNILPYDATRVPL---GAEHGYINASFIKMPVGNEELIYIACQGPLPSTVSDFWQMVWEQNSSVIAMMTQEVEAGKIKCQRYWPEELGRPIRISNQLQLTLVMTQHLE--SFVLRVLELEDVQGEEVRQIAHLNYTAWPDHDTPSDPNQLLTFISFMRHIYRSG--PIITHCSAGIGRSGTLICLD-VMLALISKDLEFDILNMVHTMRLHRHGMIQTEEQYIFCYQVILYILKR 2452          
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Ensembl Xenopus
Match: ptpn6 (protein tyrosine phosphatase non-receptor type 6 [Source:NCBI gene;Acc:100144699])

HSP 1 Score: 155.992 bits (393), Expect = 4.276e-39
Identity = 99/280 (35.36%), Postives = 149/280 (53.21%), Query Frame = 2
Query: 2102 GESEKNKSKNRFVNILPYDQTRVVLQ---NNSKKNDYINANYIP---FVEKRDKYEFIASQGPIQNSISDFWDMIWENNVTMIVMLTRTYEEDKFKCLQYWPESKGKTVKFGENQEYEVSMEEELKENSFLERKLEV-LNKNSNEQRSIIHLQMIEWYDYSAPKFED--FEFL--LFRFQDIILRADFHPILIHCSAGVGRTGTFIVLDRIIRKM-MQGXXXX-XXXXXXXXXRKYRKMMVQRVVQFIFIRDFVSYFL----HKYSQQDENNNEENLYFN 2890
            G+  +NKSKNR+ NILPYD TRV+L+   NN+  +DYINANY+    + E      FIA QG + ++  DFW+M+W+ N  +IVM T+  E+ + KC+ YWP+      +FG    + V +  E     +  R L V L +++ + R I H Q + W D+  P        FL  +   Q+ + RA    I++HCSAG+GRTGT I +D ++  + M+G      +   I  +R  R  MVQ   Q+ FI   ++ F+    HK    +  N  E+ Y N
Sbjct:  263 GQRPENKSKNRYKNILPYDHTRVILKCGDNNTPGSDYINANYVNNLLWAEGEPPKRFIACQGCLNSTTGDFWEMVWQENSRVIVMTTKEIEKGRTKCVPYWPDVGTNMKEFG---RFLVQLMSERDTKEYKVRLLRVSLTESTEKSRDIHHYQYLTWPDHGVPADPGGVLSFLEEVNSMQESMPRAG--AIVVHCSAGIGRTGTIIAIDMLLDLIQMKGVDSDIDVQKTIQMVRNQRSGMVQTEAQYKFIYSAIAQFIDSTKHKLKAMENRNATESEYGN 537          
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Ensembl Mouse
Match: Ptprj (protein tyrosine phosphatase, receptor type, J [Source:MGI Symbol;Acc:MGI:104574])

HSP 1 Score: 167.162 bits (422), Expect = 1.180e-41
Identity = 102/293 (34.81%), Postives = 158/293 (53.92%), Query Frame = 2
Query: 1967 KYSRVDSIEN--KKNESKNLEQFTKEFKDLALRARKYEKLNNYTTFVGESEKNKSKNRFVNILPYDQTRVVLQ-NNSKKNDYINANYIPFVEKRDKYEFIASQGPIQNSISDFWDMIWENNVTMIVMLTRTYEEDKFKCLQYWPESKGKTVKFGENQEYEVSMEEELKENSFLERKLEVLNKNSNEQRSIIHLQMIEWYDYSAPKFED----FEFLLFRFQDIILRADFHPILIHCSAGVGRTGTFIVLDRIIRKMMQGXXXXXXXXXXXXXRKYRKMMVQRVVQFIFIRDFV 2824
            K  RV++ E   KK ++ +   F +E++DL L      K      +  E  +N+ KNR+ N+LPYD +RV L       +DYINANY+P      K +FIA+QGP+ N++ DFW M+WE NV  IVMLT+  E+ + KC +YWP  + +   +G   +  V+M  E+    +  R   V N  ++E   +       W D+  P   D    F +L+  +   I      PIL+HCSAGVGRTGTFI +DR+I + ++    + +   + ++R +R +MVQ   Q++F+   V
Sbjct:  846 KLIRVENFEAYFKKQQADSNCGFAEEYEDLKLIGISLPK------YTAEIAENRGKNRYNNVLPYDISRVKLSVQTHSTDDYINANYMP--GYHSKKDFIATQGPLPNTLKDFWRMVWEKNVYAIVMLTKCVEQGRTKCEEYWPSKQAQ--DYG---DITVAMTSEVVLPEWTIRDFVVKNMQNSESHPLRQFHFTSWPDHGVPDTTDLLINFRYLVRDYMKQIPPES--PILVHCSAGVGRTGTFIAIDRLIYQ-IENENTVDVYGIVYDLRMHRPLMVQTEDQYVFLNQCV 1122          
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Ensembl Mouse
Match: Ptprj (protein tyrosine phosphatase, receptor type, J [Source:MGI Symbol;Acc:MGI:104574])

HSP 1 Score: 166.777 bits (421), Expect = 1.691e-41
Identity = 102/293 (34.81%), Postives = 158/293 (53.92%), Query Frame = 2
Query: 1967 KYSRVDSIEN--KKNESKNLEQFTKEFKDLALRARKYEKLNNYTTFVGESEKNKSKNRFVNILPYDQTRVVLQ-NNSKKNDYINANYIPFVEKRDKYEFIASQGPIQNSISDFWDMIWENNVTMIVMLTRTYEEDKFKCLQYWPESKGKTVKFGENQEYEVSMEEELKENSFLERKLEVLNKNSNEQRSIIHLQMIEWYDYSAPKFED----FEFLLFRFQDIILRADFHPILIHCSAGVGRTGTFIVLDRIIRKMMQGXXXXXXXXXXXXXRKYRKMMVQRVVQFIFIRDFV 2824
            K  RV++ E   KK ++ +   F +E++DL L      K      +  E  +N+ KNR+ N+LPYD +RV L       +DYINANY+P      K +FIA+QGP+ N++ DFW M+WE NV  IVMLT+  E+ + KC +YWP  + +   +G   +  V+M  E+    +  R   V N  ++E   +       W D+  P   D    F +L+  +   I      PIL+HCSAGVGRTGTFI +DR+I + ++    + +   + ++R +R +MVQ   Q++F+   V
Sbjct:  939 KLIRVENFEAYFKKQQADSNCGFAEEYEDLKLIGISLPK------YTAEIAENRGKNRYNNVLPYDISRVKLSVQTHSTDDYINANYMP--GYHSKKDFIATQGPLPNTLKDFWRMVWEKNVYAIVMLTKCVEQGRTKCEEYWPSKQAQ--DYG---DITVAMTSEVVLPEWTIRDFVVKNMQNSESHPLRQFHFTSWPDHGVPDTTDLLINFRYLVRDYMKQIPPES--PILVHCSAGVGRTGTFIAIDRLIYQ-IENENTVDVYGIVYDLRMHRPLMVQTEDQYVFLNQCV 1215          
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Ensembl Mouse
Match: Ptprj (protein tyrosine phosphatase, receptor type, J [Source:MGI Symbol;Acc:MGI:104574])

HSP 1 Score: 166.777 bits (421), Expect = 1.795e-41
Identity = 102/293 (34.81%), Postives = 158/293 (53.92%), Query Frame = 2
Query: 1967 KYSRVDSIEN--KKNESKNLEQFTKEFKDLALRARKYEKLNNYTTFVGESEKNKSKNRFVNILPYDQTRVVLQ-NNSKKNDYINANYIPFVEKRDKYEFIASQGPIQNSISDFWDMIWENNVTMIVMLTRTYEEDKFKCLQYWPESKGKTVKFGENQEYEVSMEEELKENSFLERKLEVLNKNSNEQRSIIHLQMIEWYDYSAPKFED----FEFLLFRFQDIILRADFHPILIHCSAGVGRTGTFIVLDRIIRKMMQGXXXXXXXXXXXXXRKYRKMMVQRVVQFIFIRDFV 2824
            K  RV++ E   KK ++ +   F +E++DL L      K      +  E  +N+ KNR+ N+LPYD +RV L       +DYINANY+P      K +FIA+QGP+ N++ DFW M+WE NV  IVMLT+  E+ + KC +YWP  + +   +G   +  V+M  E+    +  R   V N  ++E   +       W D+  P   D    F +L+  +   I      PIL+HCSAGVGRTGTFI +DR+I + ++    + +   + ++R +R +MVQ   Q++F+   V
Sbjct: 1032 KLIRVENFEAYFKKQQADSNCGFAEEYEDLKLIGISLPK------YTAEIAENRGKNRYNNVLPYDISRVKLSVQTHSTDDYINANYMP--GYHSKKDFIATQGPLPNTLKDFWRMVWEKNVYAIVMLTKCVEQGRTKCEEYWPSKQAQ--DYG---DITVAMTSEVVLPEWTIRDFVVKNMQNSESHPLRQFHFTSWPDHGVPDTTDLLINFRYLVRDYMKQIPPES--PILVHCSAGVGRTGTFIAIDRLIYQ-IENENTVDVYGIVYDLRMHRPLMVQTEDQYVFLNQCV 1308          
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Ensembl Mouse
Match: Ptpn20 (protein tyrosine phosphatase, non-receptor type 20 [Source:MGI Symbol;Acc:MGI:1196295])

HSP 1 Score: 155.606 bits (392), Expect = 3.058e-40
Identity = 88/242 (36.36%), Postives = 137/242 (56.61%), Query Frame = 2
Query: 2102 GESEKNKSKNRFVNILPYDQTRVVLQNNSKKNDYINANYIPFVEKRDKYEFIASQGPIQNSISDFWDMIWENNVTMIVMLTRTYEEDKFKCLQYWPESKGKTVKFGENQEYEVSMEEELKENSFLERKLEVLNKNSNEQRSIIHLQMIEWYDYSAPKFEDFEFLLFRFQDIILRADF-HPILIHCSAGVGRTGTFIVLDRIIRKMMQGXXXXXXXXXXXXXRKYRKMMVQRVVQFIFIRDFV 2824
            G + +N+ KNR+ +ILPYD TRV L    K  DYINA+YI  V   ++Y +IA+QGP+  +I DFW M+ ENN  +I M+TR  E    KC  YWP S  + ++F   + + V +E       F  R  +++ K++ + + + HLQ  +W D+  P   DF     R+   + ++    P+L+HCSAGVGRTG FI +D ++   ++ N    I + + ++RK R  M+Q   Q+ F  + V
Sbjct:  184 GNTLQNRDKNRYRDILPYDSTRVPL---GKNKDYINASYIRIVNHEEEYFYIATQGPLPETIEDFWQMVLENNCNVIAMITREIECGVIKCYSYWPISLKEPLEF---EHFSVFLETFHVTQYFTVRVFQIVKKSTGKSQCVKHLQFTKWPDHGTPASADFFIKYVRY---VRKSHITGPLLVHCSAGVGRTGVFICVD-VVFSAIEKNYSFDIMNIVTQMRKQRCGMIQTKEQYQFCYEIV 415          
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Ensembl Mouse
Match: Ptprh (protein tyrosine phosphatase, receptor type, H [Source:MGI Symbol;Acc:MGI:3026877])

HSP 1 Score: 159.844 bits (403), Expect = 1.726e-39
Identity = 104/315 (33.02%), Postives = 162/315 (51.43%), Query Frame = 2
Query: 1997 KKNESKNLEQFTKEFKDLALRARKYEKLNNYTTFVGESEKNKSKNRFVNILPYDQTRVVLQ--NNSKKNDYINANYIPFVEKRDKYEFIASQGPIQNSISDFWDMIWENNVTMIVMLTRTYEEDKFKCLQYWPESKGKTVKFGENQEYEVSMEEELKENSFLERKLEVLNKNSNEQRSIIHLQMIEWYDYSAPKFEDFEFLLFR---FQDIILRADFHPILIHCSAGVGRTGTFIVLDRIIRKMMQGXXXXXXXXXXXXXRKYRKMMVQRVVQFIFIRDFVSYFLHKYSQQDENNNEENLYFN--S*KYENKHLI 2920
            ++NE  +   F +E++ LAL  +   ++         + +N+SKNR+ N+LPYD +RV LQ       +DYINA+++P +      EFIA+QGP+ N++ DFW M+WE     +VMLT   E  + KC  YWP      +  G+ Q   +S  EE  EN +  R L++ +    +  S+     + W D+  P   D   L FR    Q +    D  P ++HCSAGVGRTGT I LD ++R+ ++    +     + ++R+ R +MVQ   Q++F+   +   L K +       EE +Y N  S  YEN   I
Sbjct:  661 RENEKDSNCGFAEEYQQLALEGQGQSQI------TASALENRSKNRYRNVLPYDWSRVPLQPLQEEPGSDYINASFMPGL--WSPKEFIATQGPLPNTVGDFWRMVWEQQSHTLVMLTNCMESGRVKCEHYWPLDAQPCI-HGQLQVMLIS--EEASEN-WTVRHLQLFHMKEQQTLSLRQFHYLAWPDHGVPYSPD-PLLAFRKMLRQWMDQTTDGGPPIVHCSAGVGRTGTLIALDVLLRQ-LECEGLVGPFSFVKKMRESRPLMVQTEAQYVFLHQCILKSLQKPAPALV--PEEAMYENVASLVYENASAI 959          
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. UniProt/SwissProt
Match: sp|Q9W6V5|PTPRJ_CHICK (Receptor-type tyrosine-protein phosphatase eta OS=Gallus gallus OX=9031 GN=PTPRJ PE=2 SV=2)

HSP 1 Score: 174.481 bits (441), Expect = 5.565e-43
Identity = 102/282 (36.17%), Postives = 157/282 (55.67%), Query Frame = 2
Query: 1997 KKNESKNLEQFTKEFKDLALRARKYEKLNNYTTFVGESEKNKSKNRFVNILPYDQTRVVLQNNS-KKNDYINANYIPFVEKRDKYEFIASQGPIQNSISDFWDMIWENNVTMIVMLTRTYEEDKFKCLQYWPESKGKTVKFGENQEYEVSMEEELKENSFLERKLEVLNKNSNEQRSIIHLQMIEWYDYSAPKFEDFEFLLFRFQDIILRADFH-----PILIHCSAGVGRTGTFIVLDRIIRKMMQGXXXXXXXXXXXXXRKYRKMMVQRVVQFIFIRDFV 2824
            KK ++ +   F +E+++L        K      F  E  +N+ KNR+ N+LPYD +RV L N S   +DYINANY+P      K  FIA+QGP+ N+I DFW MIWE N+  IVMLT+  E+ + KC QYWP+ + K+  +G   +  V+M  E+    +  R   V N ++ E  ++       W D+  P+  D   LL  F+ ++           PIL+HCSAGVGRTGTFI +DR+I++ ++    + +   + ++R +R +MVQ   Q++F+   V
Sbjct: 1100 KKQQADSNCGFAEEYEELKSAGVHQPK------FAAEIAENRGKNRYNNVLPYDISRVKLSNPSCTTDDYINANYMPGYSS--KKAFIAAQGPLPNTIEDFWRMIWEKNIYSIVMLTKCVEQARTKCEQYWPDKQSKS--YG---DIIVTMVSEVVLPEWTIRDFNVENADTMESHTVRQFHFTSWPDHGVPETTD---LLINFRHLVHEYSSQNPIDSPILVHCSAGVGRTGTFIAIDRLIQQ-IEMENTVDVYGVVYDLRMHRPLMVQTEDQYVFLNQCV 1364          
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. UniProt/SwissProt
Match: sp|Q12913|PTPRJ_HUMAN (Receptor-type tyrosine-protein phosphatase eta OS=Homo sapiens OX=9606 GN=PTPRJ PE=1 SV=3)

HSP 1 Score: 167.548 bits (423), Expect = 7.197e-41
Identity = 101/292 (34.59%), Postives = 161/292 (55.14%), Query Frame = 2
Query: 1967 KYSRVDSIEN--KKNESKNLEQFTKEFKDLALRARKYEKLNNYTTFVGESEKNKSKNRFVNILPYDQTRVVLQ-NNSKKNDYINANYIPFVEKRDKYEFIASQGPIQNSISDFWDMIWENNVTMIVMLTRTYEEDKFKCLQYWPESKGKTVKFGENQEYEVSMEEELKENSFLERKLEVLNKNSNEQRSIIHLQMIEWYDYSAPKFEDFEFLLFRF--QDIILRADFH-PILIHCSAGVGRTGTFIVLDRIIRKMMQGXXXXXXXXXXXXXRKYRKMMVQRVVQFIFIRDFV 2824
            K  RV++ E   KK ++ +   F +E++DL L      K      +  E  +N+ KNR+ N+LPYD +RV L       +DYINANY+P      K +FIA+QGP+ N++ DFW M+WE NV  I+MLT+  E+ + KC +YWP  + +   +G   +  V+M  E+    +  R   V N  ++E   +       W D+  P   D   + FR+  +D + ++    PIL+HCSAGVGRTGTFI +DR+I + ++    + +   + ++R +R +MVQ   Q++F+   V
Sbjct: 1019 KLIRVENFEAYFKKQQADSNCGFAEEYEDLKLVGISQPK------YAAELAENRGKNRYNNVLPYDISRVKLSVQTHSTDDYINANYMPGYHS--KKDFIATQGPLPNTLKDFWRMVWEKNVYAIIMLTKCVEQGRTKCEEYWPSKQAQ--DYG---DITVAMTSEIVLPEWTIRDFTVKNIQTSESHPLRQFHFTSWPDHGVPDTTDL-LINFRYLVRDYMKQSPPESPILVHCSAGVGRTGTFIAIDRLIYQ-IENENTVDVYGIVYDLRMHRPLMVQTEDQYVFLNQCV 1295          
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. UniProt/SwissProt
Match: sp|Q64455|PTPRJ_MOUSE (Receptor-type tyrosine-protein phosphatase eta OS=Mus musculus OX=10090 GN=Ptprj PE=1 SV=2)

HSP 1 Score: 167.162 bits (422), Expect = 9.970e-41
Identity = 102/293 (34.81%), Postives = 158/293 (53.92%), Query Frame = 2
Query: 1967 KYSRVDSIEN--KKNESKNLEQFTKEFKDLALRARKYEKLNNYTTFVGESEKNKSKNRFVNILPYDQTRVVLQ-NNSKKNDYINANYIPFVEKRDKYEFIASQGPIQNSISDFWDMIWENNVTMIVMLTRTYEEDKFKCLQYWPESKGKTVKFGENQEYEVSMEEELKENSFLERKLEVLNKNSNEQRSIIHLQMIEWYDYSAPKFED----FEFLLFRFQDIILRADFHPILIHCSAGVGRTGTFIVLDRIIRKMMQGXXXXXXXXXXXXXRKYRKMMVQRVVQFIFIRDFV 2824
            K  RV++ E   KK ++ +   F +E++DL L      K      +  E  +N+ KNR+ N+LPYD +RV L       +DYINANY+P      K +FIA+QGP+ N++ DFW M+WE NV  IVMLT+  E+ + KC +YWP  + +   +G   +  V+M  E+    +  R   V N  ++E   +       W D+  P   D    F +L+  +   I      PIL+HCSAGVGRTGTFI +DR+I + ++    + +   + ++R +R +MVQ   Q++F+   V
Sbjct:  920 KLIRVENFEAYFKKQQADSNCGFAEEYEDLKLIGISLPK------YTAEIAENRGKNRYNNVLPYDISRVKLSVQTHSTDDYINANYMP--GYHSKKDFIATQGPLPNTLKDFWRMVWEKNVYAIVMLTKCVEQGRTKCEEYWPSKQAQ--DYG---DITVAMTSEVVLPEWTIRDFVVKNMQNSESHPLRQFHFTSWPDHGVPDTTDLLINFRYLVRDYMKQIPPES--PILVHCSAGVGRTGTFIAIDRLIYQ-IENENTVDVYGIVYDLRMHRPLMVQTEDQYVFLNQCV 1196          
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. UniProt/SwissProt
Match: sp|A1L1L3|PTN20_RAT (Tyrosine-protein phosphatase non-receptor type 20 OS=Rattus norvegicus OX=10116 GN=Ptpn20 PE=1 SV=1)

HSP 1 Score: 157.532 bits (397), Expect = 3.892e-40
Identity = 90/242 (37.19%), Postives = 139/242 (57.44%), Query Frame = 2
Query: 2102 GESEKNKSKNRFVNILPYDQTRVVLQNNSKKNDYINANYIPFVEKRDKYEFIASQGPIQNSISDFWDMIWENNVTMIVMLTRTYEEDKFKCLQYWPESKGKTVKFGENQEYEVSMEEELKENSFLERKLEVLNKNSNEQRSIIHLQMIEWYDYSAPKFEDFEFLLFRFQDIILRADF-HPILIHCSAGVGRTGTFIVLDRIIRKMMQGXXXXXXXXXXXXXRKYRKMMVQRVVQFIFIRDFV 2824
            G   +N+ KNR+ +ILPYD TRV L    K  DYINA+YI  V   ++Y +IA+QGP+ ++I DFW M+ ENN  +I M+TR  E    KC  YWP S  + ++F   + + V +E       F+ R  +++ K++ +  S+ HLQ I+W D+  P   DF     R+   + ++    P+L+HCSAGVGRTG FI +D ++   ++ N    I + + ++RK R  M+Q   Q+ F  + V
Sbjct:  179 GYELQNRDKNRYRDILPYDSTRVPL---GKNKDYINASYIRIVNHEEEYFYIATQGPLPDTIEDFWQMVLENNCNVIAMITREIEGGVIKCCSYWPVSLKEPLEF---KHFHVLLENFQITQYFVIRIFQIVKKSTGKSHSVKHLQFIKWPDHGTPASADFFIKYVRY---VRKSHITGPLLVHCSAGVGRTGVFICVD-VVFCTIEKNYSFNIMNIVTQMRKQRFGMIQTKEQYQFCYEIV 410          
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. UniProt/SwissProt
Match: sp|O55082|PTN20_MOUSE (Tyrosine-protein phosphatase non-receptor type 20 OS=Mus musculus OX=10090 GN=Ptpn20 PE=1 SV=1)

HSP 1 Score: 155.606 bits (392), Expect = 2.139e-39
Identity = 88/242 (36.36%), Postives = 137/242 (56.61%), Query Frame = 2
Query: 2102 GESEKNKSKNRFVNILPYDQTRVVLQNNSKKNDYINANYIPFVEKRDKYEFIASQGPIQNSISDFWDMIWENNVTMIVMLTRTYEEDKFKCLQYWPESKGKTVKFGENQEYEVSMEEELKENSFLERKLEVLNKNSNEQRSIIHLQMIEWYDYSAPKFEDFEFLLFRFQDIILRADF-HPILIHCSAGVGRTGTFIVLDRIIRKMMQGXXXXXXXXXXXXXRKYRKMMVQRVVQFIFIRDFV 2824
            G + +N+ KNR+ +ILPYD TRV L    K  DYINA+YI  V   ++Y +IA+QGP+  +I DFW M+ ENN  +I M+TR  E    KC  YWP S  + ++F   + + V +E       F  R  +++ K++ + + + HLQ  +W D+  P   DF     R+   + ++    P+L+HCSAGVGRTG FI +D ++   ++ N    I + + ++RK R  M+Q   Q+ F  + V
Sbjct:  184 GNTLQNRDKNRYRDILPYDSTRVPL---GKNKDYINASYIRIVNHEEEYFYIATQGPLPETIEDFWQMVLENNCNVIAMITREIECGVIKCYSYWPISLKEPLEF---EHFSVFLETFHVTQYFTVRVFQIVKKSTGKSQCVKHLQFTKWPDHGTPASADFFIKYVRY---VRKSHITGPLLVHCSAGVGRTGVFICVD-VVFSAIEKNYSFDIMNIVTQMRKQRCGMIQTKEQYQFCYEIV 415          
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. TrEMBL
Match: A0A2G9S8P2 (Uncharacterized protein (Fragment) OS=Lithobates catesbeianus OX=8400 GN=AB205_0123010 PE=4 SV=1)

HSP 1 Score: 174.866 bits (442), Expect = 6.657e-45
Identity = 105/272 (38.60%), Postives = 151/272 (55.51%), Query Frame = 2
Query: 2099 VGESEKNKSKNRFVNILPYDQTRVVLQNNS-KKNDYINANYIP-FVEKRDKYEFIASQGPIQNSISDFWDMIWENNVTMIVMLTRTYEEDKFKCLQYWPESKGKTVKFGENQEYEVSMEEELKENSFLERKLEVLNKNSNEQRSIIHLQMIEWYDYSAPKF--EDFEFL-LFRFQDIILRADFHPILIHCSAGVGRTGTFIVLDRIIRKMMQGXXXXXXXXXXXXXRKYRKMMVQRVVQFIFIRDFVSYFLHKYSQQDEN--NNEENLYFNS 2893
            VG+  +N+ KNR+ N+LPYD +RV L  N    +DYINAN+IP F+ K+   EFIA+QGP+  +++DFW M+WE +V  I MLTR  E  K KC +YWP    +  KFG N     S E  L + +   R   V N  + + + + H     W D+  PK   +  EF  L R       +   PIL+HCSAGVGRTGT I LDRII K ++    + +   + ++R +R +MVQ   Q++F+      F++     D +   N E++Y NS
Sbjct:   13 VGDHPENREKNRYTNVLPYDISRVTLSTNGNSSDDYINANFIPGFIMKK---EFIAAQGPLPRTLNDFWRMVWEKDVRAIAMLTRCVELGKVKCEEYWPTRSSR--KFG-NLSVAASNETVLPDWTI--RDFIVTNTPTKQSKQVRHFHFTAWPDHGVPKATKDLVEFRNLIREYTSCYSSPSSPILVHCSAGVGRTGTLIALDRII-KQIEAEDKVDVYGVVHDLRMHRDLMVQTESQYVFLNQCALDFINSRKAPDYDIYQNSESIYQNS 275          
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. TrEMBL
Match: R7TPU0 (Uncharacterized protein (Fragment) OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_120303 PE=4 SV=1)

HSP 1 Score: 168.703 bits (426), Expect = 8.790e-43
Identity = 109/292 (37.33%), Postives = 170/292 (58.22%), Query Frame = 2
Query: 2024 QFTKEFKDLALRARKYEKLNNYTTFVGESEKNKSKNRFVNILPYDQTRV---VLQNNSKKNDYINANYIPFVEKRDKYEFIASQGPIQNSISDFWDMIWENNVTMIVMLTRTYEEDKFKCLQYWPESKGKTVKFGENQEYEVSMEEELKENSFLERKLEV-LNKNSNEQRSIIHLQMIEWYDYSAPKFEDFEFLLFRFQDII---LRADFH-PILIHCSAGVGRTGTFIVLDRIIRKMMQGXXXXXXXXXXXXXRKYRKMMVQRVVQFIFIRDFVSYFLHKYSQQDENNNEE 2875
            +F++E++ +  RA +     N  T V E + N++KNRF NILP+D +RV    L ++ + +DYINANY+P      K EFIA QGP++++I  FW M+WE NV +IVM+T+  E  K KC QYWP  +     +G+ Q   V M  E   +S+  R  +V L K +   R+I     ++W D+  P   D   +L  F D++   +R     P+++HCSAGVGRTGTFI +DR+++  ++ +  I +   +LE+R YR  M+Q  VQ+IF+ D +   +   S+ D+  +E 
Sbjct:   17 KFSEEYEAIKRRAPR-----NACT-VAELQCNRTKNRFTNILPFDHSRVKLLPLDDDDEGSDYINANYMPGYNS--KREFIACQGPMKSTIDHFWRMVWEQNVVIIVMVTKLEERGKEKCAQYWPADQDCHF-YGDLQ---VQMRSESILDSYAIRIFDVGLVKTT---RTIQQFHFLKWPDFDCP---DNTQMLLNFVDVVRGNIRPSMSGPVIVHCSAGVGRTGTFICVDRLLQH-VKDHNTIDVFGTVLEMRNYRCNMIQTEVQYIFVHDCMRDSMDDTSEVDDQTDEH 289          
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. TrEMBL
Match: M4A245 (Protein tyrosine phosphatase receptor type H OS=Xiphophorus maculatus OX=8083 PE=4 SV=2)

HSP 1 Score: 179.104 bits (453), Expect = 1.859e-42
Identity = 104/298 (34.90%), Postives = 165/298 (55.37%), Query Frame = 2
Query: 2027 FTKEFKDLALRARKYEKLNNYTTFVGESEKNKSKNRFVNILPYDQTRVVLQNNSKKN--DYINANYIPFVEKRDKYEFIASQGPIQNSISDFWDMIWENNVTMIVMLTRTYEEDKFKCLQYWPESKGKTVKFGENQEYEVSMEEELKENSFLERKLEVLNKNSNEQRSIIHLQMIEWYDYSAPKFEDFEFLLFRFQDIILR-----ADFHPILIHCSAGVGRTGTFIVLDRIIRKMMQGXXXXXXXXXXXXXRKYRKMMVQRVVQFIFIRDFVSYFLHKYSQQDEN--NNEENLYFNS 2893
            F++E++ LA          + T       +NK KNRF NILPYD +RV L  ++  N  DYINANY+P        E+IA QGP+ N++ DFW M+WE  V  IVM+T   E  + KC QYWPE +      G + E  VS   E +E++++ R+ +V +   +E+R++ H     W D+  P+  +   +L RF+ ++ +         P ++HCSAGVGRTGT I LD ++++ +Q    + IN  + ++R++R  MVQ   Q++F+   +   L     Q+EN   N++ +Y N+
Sbjct:  552 FSQEYESLAPAG------THQTQKAATLPENKGKNRFTNILPYDWSRVKLNTSNPNNTMDYINANYLPGYSSSK--EYIACQGPLPNTVGDFWRMVWEQKVKRIVMVTNCVEAGRTKCEQYWPEDRSP----GSHGELIVSKTSEERESNWVLREFKVKHMKDSEERTVNHFHFTAWPDHGVPQGTE---VLIRFRGLVRKHIDSEGSKAPTVVHCSAGVGRTGTIIALDVLLQQ-LQHEQAVGINSFVYKMRQHRSHMVQTESQYVFLHQCIMDSLQPPGGQEENVYENDDLIYVNA 833          
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. TrEMBL
Match: A0A3B5Q6E7 (Protein tyrosine phosphatase receptor type H OS=Xiphophorus maculatus OX=8083 PE=4 SV=1)

HSP 1 Score: 178.718 bits (452), Expect = 2.071e-42
Identity = 104/298 (34.90%), Postives = 165/298 (55.37%), Query Frame = 2
Query: 2027 FTKEFKDLALRARKYEKLNNYTTFVGESEKNKSKNRFVNILPYDQTRVVLQNNSKKN--DYINANYIPFVEKRDKYEFIASQGPIQNSISDFWDMIWENNVTMIVMLTRTYEEDKFKCLQYWPESKGKTVKFGENQEYEVSMEEELKENSFLERKLEVLNKNSNEQRSIIHLQMIEWYDYSAPKFEDFEFLLFRFQDIILR-----ADFHPILIHCSAGVGRTGTFIVLDRIIRKMMQGXXXXXXXXXXXXXRKYRKMMVQRVVQFIFIRDFVSYFLHKYSQQDEN--NNEENLYFNS 2893
            F++E++ LA          + T       +NK KNRF NILPYD +RV L  ++  N  DYINANY+P        E+IA QGP+ N++ DFW M+WE  V  IVM+T   E  + KC QYWPE +      G + E  VS   E +E++++ R+ +V +   +E+R++ H     W D+  P+  +   +L RF+ ++ +         P ++HCSAGVGRTGT I LD ++++ +Q    + IN  + ++R++R  MVQ   Q++F+   +   L     Q+EN   N++ +Y N+
Sbjct:  552 FSQEYESLAPAG------THQTQKAATLPENKGKNRFTNILPYDWSRVKLNTSNPNNTMDYINANYLPGYSSSK--EYIACQGPLPNTVGDFWRMVWEQKVKRIVMVTNCVEAGRTKCEQYWPEDRSP----GSHGELIVSKTSEERESNWVLREFKVKHMKDSEERTVNHFHFTAWPDHGVPQGTE---VLIRFRGLVRKHIDSEGSKAPTVVHCSAGVGRTGTIIALDVLLQQ-LQHEQAVGINSFVYKMRQHRSHMVQTESQYVFLHQCIMDSLQPPGGQEENVYENDDLIYVNA 833          
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. TrEMBL
Match: A7SDC7 (Predicted protein (Fragment) OS=Nematostella vectensis OX=45351 GN=v1g114126 PE=4 SV=1)

HSP 1 Score: 167.162 bits (422), Expect = 2.917e-42
Identity = 94/259 (36.29%), Postives = 151/259 (58.30%), Query Frame = 2
Query: 2033 KEFKDLALRARKYEKLNNYTTFVGESEKNKSKNRFVNILPYDQTRVVLQNNSKKNDYINANYIPFVEKRDKYEFIASQGPIQNSISDFWDMIWENNVTMIVMLTRTYEEDKFKCLQYWPESKGKTVKFGENQEYEVSMEEELKENSFLERKLEVLNKNSNEQRSIIHLQMIEWYDYSAPKFEDFEFLLFRFQDIILRADFHPILIHCSAGVGRTGTFIVLDRIIRKMMQGXXXXXXXXXXXXXRKYRKMMVQRVVQFIF 2809
            +EFKDL    R+ +  +   +  G+++ N  KNR+ N+LPY+ TRV L  +S + DYINAN+I  +   D Y +IA+QGP+ N+  DFW MIWE  V ++ M+T   E  K KC +YWP++  + +K G    +EVS+ ++   +SF++R + V +  S +   I HL  ++W D+  P+    E + F      L     P+++HCSAG+GRTG  I +D +   +M+ +    IN  I ++R+ R+ M+Q   Q+IF
Sbjct:   34 EEFKDL----REIKPTDGCDS--GKNQANTDKNRYRNVLPYEATRVRLSGSSGE-DYINANHIRVLVDDDTYHYIATQGPLPNTTKDFWQMIWEQGVEVVAMVTLDKEGGKVKCHRYWPDNTNQPLKLG--GRFEVSLLKQTNYDSFVQRDIAVKHLQSGKSIEIAHLNFVKWPDHGVPR-SPVEMVQFVAYMRSLATSQAPVVVHCSAGIGRTGALIAVD-VALGLMERDKPFDINQTIRDLREQRQGMIQTKDQYIF 281          
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Ensembl Cavefish
Match: ENSAMXT00000051337.1 (pep primary_assembly:Astyanax_mexicanus-2.0:3:8950295:8973829:1 gene:ENSAMXG00000005893.2 transcript:ENSAMXT00000051337.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 170.629 bits (431), Expect = 3.383e-43
Identity = 95/241 (39.42%), Postives = 143/241 (59.34%), Query Frame = 2
Query: 2114 KNKSKNRFVNILPYDQTRVVL-QNNSKKNDYINANYIPFVEKRDKYEFIASQGPIQNSISDFWDMIWENNVTMIVMLTRTYEEDKFKCLQYWPESKGKTVKFGENQEYEVSMEEELKENSFLERKLEVLNKNSNEQRSIIHLQMIEWYDYSAPKFEDFEFLLFR--FQDIILR-ADFHPILIHCSAGVGRTGTFIVLDRIIRKMMQGXXXXXXXXXXXXXRKYRKMMVQRVVQFIFIRDFV 2824
            +NKSKNRF N+L YD +RV L Q +   +DYINANY+P    R+  ++IA+QGP+  +ISDFW M+WE   T IVMLT   E  + KC QYWP      + +G      V+++ E KE S+  R+  V NK+++E+R+++H     W D+  P   D E + FR   +  I R     P ++HCSAGVGRTGT I LD +++++++    + I   +  +R  R +MVQ   Q++F+   +
Sbjct:  551 ENKSKNRFTNVLAYDLSRVKLTQQDGPDSDYINANYMPGY-NRNSRQYIAAQGPLPCTISDFWRMVWEQKSTAIVMLTNCVENGRPKCEQYWPLDYTPCI-YG---NLLVTIQSEHKEKSWTLREFVVRNKDTSEERTVMHFHFTAWPDHGVPAGTD-ELIQFRELVRHHIERFPTSGPTVVHCSAGVGRTGTLIALDTLLQQLVK-EEAVNIAACVHHMRLNRPLMVQTESQYVFLHQCI 784          
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Ensembl Cavefish
Match: ENSAMXT00000043527.1 (pep primary_assembly:Astyanax_mexicanus-2.0:3:8946729:8973829:1 gene:ENSAMXG00000005893.2 transcript:ENSAMXT00000043527.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 170.629 bits (431), Expect = 4.518e-43
Identity = 95/241 (39.42%), Postives = 143/241 (59.34%), Query Frame = 2
Query: 2114 KNKSKNRFVNILPYDQTRVVL-QNNSKKNDYINANYIPFVEKRDKYEFIASQGPIQNSISDFWDMIWENNVTMIVMLTRTYEEDKFKCLQYWPESKGKTVKFGENQEYEVSMEEELKENSFLERKLEVLNKNSNEQRSIIHLQMIEWYDYSAPKFEDFEFLLFR--FQDIILR-ADFHPILIHCSAGVGRTGTFIVLDRIIRKMMQGXXXXXXXXXXXXXRKYRKMMVQRVVQFIFIRDFV 2824
            +NKSKNRF N+L YD +RV L Q +   +DYINANY+P    R+  ++IA+QGP+  +ISDFW M+WE   T IVMLT   E  + KC QYWP      + +G      V+++ E KE S+  R+  V NK+++E+R+++H     W D+  P   D E + FR   +  I R     P ++HCSAGVGRTGT I LD +++++++    + I   +  +R  R +MVQ   Q++F+   +
Sbjct:  655 ENKSKNRFTNVLAYDLSRVKLTQQDGPDSDYINANYMPGY-NRNSRQYIAAQGPLPCTISDFWRMVWEQKSTAIVMLTNCVENGRPKCEQYWPLDYTPCI-YG---NLLVTIQSEHKEKSWTLREFVVRNKDTSEERTVMHFHFTAWPDHGVPAGTD-ELIQFRELVRHHIERFPTSGPTVVHCSAGVGRTGTLIALDTLLQQLVK-EEAVNIAACVHHMRLNRPLMVQTESQYVFLHQCI 888          
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Ensembl Cavefish
Match: ENSAMXT00000055644.1 (pep primary_assembly:Astyanax_mexicanus-2.0:3:8906845:8973829:1 gene:ENSAMXG00000005893.2 transcript:ENSAMXT00000055644.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 169.859 bits (429), Expect = 5.865e-43
Identity = 95/241 (39.42%), Postives = 143/241 (59.34%), Query Frame = 2
Query: 2114 KNKSKNRFVNILPYDQTRVVL-QNNSKKNDYINANYIPFVEKRDKYEFIASQGPIQNSISDFWDMIWENNVTMIVMLTRTYEEDKFKCLQYWPESKGKTVKFGENQEYEVSMEEELKENSFLERKLEVLNKNSNEQRSIIHLQMIEWYDYSAPKFEDFEFLLFR--FQDIILR-ADFHPILIHCSAGVGRTGTFIVLDRIIRKMMQGXXXXXXXXXXXXXRKYRKMMVQRVVQFIFIRDFV 2824
            +NKSKNRF N+L YD +RV L Q +   +DYINANY+P    R+  ++IA+QGP+  +ISDFW M+WE   T IVMLT   E  + KC QYWP      + +G      V+++ E KE S+  R+  V NK+++E+R+++H     W D+  P   D E + FR   +  I R     P ++HCSAGVGRTGT I LD +++++++    + I   +  +R  R +MVQ   Q++F+   +
Sbjct:  546 ENKSKNRFTNVLAYDLSRVKLTQQDGPDSDYINANYMPGY-NRNSRQYIAAQGPLPCTISDFWRMVWEQKSTAIVMLTNCVENGRPKCEQYWPLDYTPCI-YG---NLLVTIQSEHKEKSWTLREFVVRNKDTSEERTVMHFHFTAWPDHGVPAGTD-ELIQFRELVRHHIERFPTSGPTVVHCSAGVGRTGTLIALDTLLQQLVK-EEAVNIAACVHHMRLNRPLMVQTESQYVFLHQCI 779          
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Ensembl Cavefish
Match: ENSAMXT00000006060.2 (pep primary_assembly:Astyanax_mexicanus-2.0:3:8913797:8973829:1 gene:ENSAMXG00000005893.2 transcript:ENSAMXT00000006060.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 170.244 bits (430), Expect = 7.567e-43
Identity = 95/241 (39.42%), Postives = 143/241 (59.34%), Query Frame = 2
Query: 2114 KNKSKNRFVNILPYDQTRVVL-QNNSKKNDYINANYIPFVEKRDKYEFIASQGPIQNSISDFWDMIWENNVTMIVMLTRTYEEDKFKCLQYWPESKGKTVKFGENQEYEVSMEEELKENSFLERKLEVLNKNSNEQRSIIHLQMIEWYDYSAPKFEDFEFLLFR--FQDIILR-ADFHPILIHCSAGVGRTGTFIVLDRIIRKMMQGXXXXXXXXXXXXXRKYRKMMVQRVVQFIFIRDFV 2824
            +NKSKNRF N+L YD +RV L Q +   +DYINANY+P    R+  ++IA+QGP+  +ISDFW M+WE   T IVMLT   E  + KC QYWP      + +G      V+++ E KE S+  R+  V NK+++E+R+++H     W D+  P   D E + FR   +  I R     P ++HCSAGVGRTGT I LD +++++++    + I   +  +R  R +MVQ   Q++F+   +
Sbjct:  759 ENKSKNRFTNVLAYDLSRVKLTQQDGPDSDYINANYMPGY-NRNSRQYIAAQGPLPCTISDFWRMVWEQKSTAIVMLTNCVENGRPKCEQYWPLDYTPCI-YG---NLLVTIQSEHKEKSWTLREFVVRNKDTSEERTVMHFHFTAWPDHGVPAGTD-ELIQFRELVRHHIERFPTSGPTVVHCSAGVGRTGTLIALDTLLQQLVK-EEAVNIAACVHHMRLNRPLMVQTESQYVFLHQCI 992          
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Ensembl Cavefish
Match: ENSAMXT00000034956.1 (pep primary_assembly:Astyanax_mexicanus-2.0:3:8911212:8973829:1 gene:ENSAMXG00000005893.2 transcript:ENSAMXT00000034956.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 170.244 bits (430), Expect = 8.758e-43
Identity = 95/241 (39.42%), Postives = 143/241 (59.34%), Query Frame = 2
Query: 2114 KNKSKNRFVNILPYDQTRVVL-QNNSKKNDYINANYIPFVEKRDKYEFIASQGPIQNSISDFWDMIWENNVTMIVMLTRTYEEDKFKCLQYWPESKGKTVKFGENQEYEVSMEEELKENSFLERKLEVLNKNSNEQRSIIHLQMIEWYDYSAPKFEDFEFLLFR--FQDIILR-ADFHPILIHCSAGVGRTGTFIVLDRIIRKMMQGXXXXXXXXXXXXXRKYRKMMVQRVVQFIFIRDFV 2824
            +NKSKNRF N+L YD +RV L Q +   +DYINANY+P    R+  ++IA+QGP+  +ISDFW M+WE   T IVMLT   E  + KC QYWP      + +G      V+++ E KE S+  R+  V NK+++E+R+++H     W D+  P   D E + FR   +  I R     P ++HCSAGVGRTGT I LD +++++++    + I   +  +R  R +MVQ   Q++F+   +
Sbjct:  779 ENKSKNRFTNVLAYDLSRVKLTQQDGPDSDYINANYMPGY-NRNSRQYIAAQGPLPCTISDFWRMVWEQKSTAIVMLTNCVENGRPKCEQYWPLDYTPCI-YG---NLLVTIQSEHKEKSWTLREFVVRNKDTSEERTVMHFHFTAWPDHGVPAGTD-ELIQFRELVRHHIERFPTSGPTVVHCSAGVGRTGTLIALDTLLQQLVK-EEAVNIAACVHHMRLNRPLMVQTESQYVFLHQCI 1012          
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009934.1 (pep scaffold:Pmarinus_7.0:GL479331:74:24469:1 gene:ENSPMAG00000008984.1 transcript:ENSPMAT00000009934.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 151.369 bits (381), Expect = 1.471e-37
Identity = 84/278 (30.22%), Postives = 145/278 (52.16%), Query Frame = 2
Query: 2063 RKYEKLNNYT----TFVGESEKNKSKNRFVNILPYDQTRVVLQNNSKKNDYINANYIPFVEKRDKYEFIASQGPIQNSISDFWDMIWENNVTMIVMLTRTYEEDKFKCLQYWPESKGKTVKFGENQEYEVSMEEELKENSFLERKLEVLNKNSNEQRSIIHLQMIEWYDYSAPKFEDFEFLLFRFQDIILRADFHPILIHCSAGVGRTGTFIVLDRIIRKMMQGXXXXXXXXXXXXXRKYRKMMVQRVVQFIFIRDFVSYFLHKYSQQDENNNEENLY 2884
            +++++L N T      V  + +N+ +NR+ N+LP+D TRV L  + +++DYINA+++          ++A QGP+ ++ + FW M+WE    ++ MLT   E  + KC +YWPES+ +  + G    Y + +E++    SF  R + +    +  ++ +  LQ  +W D+ AP          RF   +   +  P++ HCSAGVGR+G  I LD ++  +  G L+  I D + E+R  R  MVQ + Q+IF        L    Q+++      LY
Sbjct:  791 KEFQRLCNLTPRDGCLVASAVENRDRNRYRNVLPFDATRVAL--SGREDDYINASHVALRAGDAALAYVACQGPLPHTAAHFWQMVWEQRARVLAMLTLETELGRAKCHRYWPESRSRATEVG---PYRLVLEQQQTLKSFCIRVIMITKLETGIRQRVTQLQFTQWPDHGAPASAGPLVRFLRFARRL--QEPGPLVTHCSAGVGRSGALICLDAVLAHIDHG-LEFNIADIVREMRTQRYGMVQTLEQYIFCYKAALETLQYLKQREKQRRVRALY 1060          
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001312.1 (pep scaffold:Pmarinus_7.0:GL477231:34421:73675:-1 gene:ENSPMAG00000001156.1 transcript:ENSPMAT00000001312.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 149.828 bits (377), Expect = 3.525e-37
Identity = 85/243 (34.98%), Postives = 131/243 (53.91%), Query Frame = 2
Query: 2069 YEKLNNYTTFVGESEKNKSKNRFVNILPYDQTRVVLQNNSKKNDYINANYI--PFVEKRDKYEFIASQGPIQNSISDFWDMIWENNVTMIVMLTRTYEEDKFKCLQYWPESKGKTVKFGENQEYEVSMEEELKENSFLERKLEVLNKNSNEQRSIIHLQMIEWYDYSAPKFEDFEFLLFRFQDIILRADF-HPILIHCSAGVGRTGTFIVLDRIIRKMMQGXXXXXXXXXXXXXRKYRKMMVQ 2788
            Y K    +  + +   N S+NR+ ++LPYD TRVVL  N    DYINANYI            +IA QGP+ ++ + FW M+WE   ++++MLT   E  + KC QYWP+  G     G    + V  + E +  + +ERKL + N  +NE+R +  LQ + W D+  P  +D    L   +D+  R D   P+++HCSAG+GRTG  I ++  +  +M+ N  +   D +  +R  R MM+Q
Sbjct:  682 YRKKPGMSLGMAKMSCNSSRNRYRDVLPYDATRVVLSGN---EDYINANYINMEITSSSTINRYIACQGPLPSTCAHFWQMVWEQGCSLVIMLTTLTERGRPKCHQYWPDLPGSETYGG----FFVLCDSEEESEASIERKLTLRNVENNEERGVTQLQYVAWPDHGVP--DDSSHFLGFVRDVRTRRDHAQPVVVHCSAGIGRTGVLITMETAL-CLMECNESVYPLDIVRTMRDQRAMMIQ 914          
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003525.1 (pep scaffold:Pmarinus_7.0:GL477320:686:22463:-1 gene:ENSPMAG00000003196.1 transcript:ENSPMAT00000003525.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 146.747 bits (369), Expect = 8.631e-37
Identity = 82/250 (32.80%), Postives = 136/250 (54.40%), Query Frame = 2
Query: 2075 KLNNYTTFVGESEKNKSKNRFVNILPYDQTRVVLQNNSKKNDYINANYIPFVEKRDKYEFIASQGPIQNSISDFWDMIWENNVTMIVMLTRTYEEDKFKCLQYWPESKGKTVKFGENQEYEVSMEEELKENSFLERKLEVLNKNSNEQRS-----IIHLQMIEWYDYSAPKFEDFEFLLFRFQDIILRADFHPILIHCSAGVGRTGTFIVLDRIIRKMMQGXXXXXXXXXXXXXRKYRKMMVQRVVQFIF 2809
            K+N Y+      E N  KNR+ +ILPYD  RV L    + +DYINA+Y+   +   +Y  IA+QGP++N+  DFW MIWE   ++IVM+T+  E  K KC QYWP        +G   +  V++   + E  + +  +  L+ + ++ R      + H+Q++ W D+  P+  +    L R  +    A    +++HCSAGVGR+GT+I LD ++R+ ++    + +   +  +R  R +MVQ  V+F  
Sbjct:  415 KINKYSQQEATQEYNTKKNRYSDILPYDHNRVKLSGEGE-SDYINASYVDGYKSSIRY--IAAQGPLENTAGDFWQMIWEKKSSVIVMVTKCEEMGKVKCFQYWPHPDEDKRAYG---DVTVTI---MDEKPYADIVIRTLSISHSKHRGFGAHWVTHVQLVSWPDHGVPEDPNLLLKLRRRVNSFNGAGCTAVVVHCSAGVGRSGTYIGLDCLVRQ-LENEGHVDVYGCVFRLRHQRPLMVQVEVRFAI 654          
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008162.1 (pep scaffold:Pmarinus_7.0:GL477877:143952:159832:-1 gene:ENSPMAG00000007379.1 transcript:ENSPMAT00000008162.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 140.584 bits (353), Expect = 2.989e-36
Identity = 92/241 (38.17%), Postives = 128/241 (53.11%), Query Frame = 2
Query: 2099 VGESEKNKSKNRFVNILPYDQTRVVLQ--NNSKKNDYINANYIPFVEKRDKYEFIASQGPIQNSISDFWDMIWENNVTMIVMLTRTYEEDKFKCLQYWPESKGKTVKFGENQEYEVSMEEELKENSFLERKLEVL----NKNSNEQRSIIHLQMIEWYDYSAPKFEDFEFLLFRFQDIILRADFH-PILIHCSAGVGRTGTFIVLDRIIRKMMQGXXXXXXXXXXXXXRKYRKMMVQRVVQ 2800
                E+NK KNR++NILPYDQ+RV L    +   +DYINA+YI     R+K +FIA+QGP + +I+DFW MIWE N + IVM+T   E    KC QYWP+    T  +G      VS+E+      +  RK  V         ++ R +       W D+  P F     L F  +       +  PI++HCSAGVGRTGTFIV+D ++  M+Q    + +   +  IR  R  MVQ  +Q
Sbjct:   53 AASQEENKDKNRYINILPYDQSRVQLSPIESVPGSDYINASYIN--GYREKNKFIAAQGPKEETINDFWRMIWEQNTSTIVMVTNLQERKHTKCSQYWPDKGCWT--YG---SVRVSVEDITVLVDYTIRKFCVQLVGEGPGKHQARLVTQFHFTSWPDFGVP-FTPIGMLKFLKKVKTSNPSYSGPIVVHCSAGVGRTGTFIVIDAML-DMIQAEQRVDVFGFVSRIRAQRCQMVQTDLQ 284          
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006037.1 (pep scaffold:Pmarinus_7.0:GL477253:2:79428:1 gene:ENSPMAG00000005380.1 transcript:ENSPMAT00000006037.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 143.665 bits (361), Expect = 4.479e-35
Identity = 85/259 (32.82%), Postives = 140/259 (54.05%), Query Frame = 2
Query: 2102 GESEKNKSKNRFVNILPYDQTRV-VLQNNSKKNDYINANYIPFVEKRDKYEFIASQGPIQNSISDFWDMIWENNVTMIVMLTRTYEEDKFKCLQYWPE--SKGKTVKFGENQEYEVSMEEELKENSFLERKLEVLNKNSNEQRSIIHLQMIEWYDYSAPKFEDFE-FLLF--------RFQDIIL--RADFHPILIHCSAGVGRTGTFIVLDRIIRKMMQGXXXXXXXXXXXXXRKYRKMMVQRVVQFIFIRDFVSYFL 2836
             E   N+ +NRF ++LPY+QTRV +L +      YINA+++      +++ +IA+QGP+ N+  DFW MIWE  V++I M+T   E  + KC +YWP+  SK  +  +G   +Y V+ +      S+    L+V +  S ++R+  HL   +W D+  P  ED + FL F        R  + +L       P+++HCSAGVGR+G  I L  I    ++ N+ + +   +  +R  R +MVQ + Q+ F+   +  FL
Sbjct:  890 AELPDNQERNRFGDVLPYEQTRVELLPSKDNPTGYINASHVRVRVGGEQWHYIATQGPLPNTCQDFWQMIWEQGVSVIAMVTPEQESGRQKCHRYWPKLGSKRNSANYG---DYRVTTKFRTDSGSYATTGLKVKHLPSGQERTAWHLHYPDWPDHGCP--EDVQRFLAFLEEVQSVRRHTNSMLPPHTASPPVVVHCSAGVGRSGVLI-LTEITIAGLEHNVQLDVPQALGVLRGQRMLMVQTLAQYQFVYQALIQFL 1142          
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Ensembl Yeast
Match: PTP1 (Phosphotyrosine-specific protein phosphatase; dephosphorylates a broad range of substrates in vivo, including Fpr3p; localized to the cytoplasm and the mitochondria; proposed to be a negative regulator of filamentation [Source:SGD;Acc:S000002389])

HSP 1 Score: 106.301 bits (264), Expect = 3.087e-25
Identity = 77/256 (30.08%), Postives = 126/256 (49.22%), Query Frame = 2
Query: 2024 QFTKEFKDLALRARKYEKLNN-YTTFVGESEKNKSKNRFVNILPYDQTRVVLQNNSKKNDYINANYIPFVEKRDKYE---FIASQGPIQNSISDFWDMIWEN---NVTMIVMLTRTYEEDKFKCLQYWP--------------ESKGKT---VKFGENQEYEVSMEEELKEN-SFLERKLEVLNKNSNEQRSIIHLQMIEWYDYSAPKFEDFEFLLFRFQDIILRADFHPILIHCSAGVGRTGTFIVLDRIIRKMM 2716
            +F +  +D  LR      +N+ ++  V    +N ++NR+VNI+PY++ RV L+  S  NDYINA+Y+         E   +IA+QGP + +   FW M + N   +  +IVM+T   E ++ KC QYWP              ES G      +F  + + E     ++K+  +  + KL   +      +++ H     W D + P+ E    +        L +  +PI++HCSAGVGRTGTFI LD ++   +
Sbjct:   20 KFIQNQEDGRLREATNGTVNSRWSLGVSIEPRNDARNRYVNIMPYERNRVHLKTLSG-NDYINASYVKVNVPGQSIEPGYYIATQGPTRKTWDQFWQMCYHNCPLDNIVIVMVTPLVEYNREKCYQYWPRGGVDDTVRIASKWESPGGANDMTQFPSDLKIEFVNVHKVKDYYTVTDIKLTPTDPLVGPVKTVHHFYFDLWKDMNKPE-EVVPIMELCAHSHSLNSRGNPIIVHCSAGVGRTGTFIALDHLMHDTL 273          
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Ensembl Yeast
Match: PTP2 (Nuclear phosphotyrosine-specific phosphatase involved in osmosensing; involved in the inactivation of mitogen-activated protein kinase (MAPK) during osmolarity sensing; dephosporylates Hog1p MAPK and regulates its localization; with Msg5p co-regulates the calcium signaling pathway [Source:SGD;Acc:S000005734])

HSP 1 Score: 78.1814 bits (191), Expect = 3.691e-15
Identity = 83/333 (24.92%), Postives = 124/333 (37.24%), Query Frame = 2
Query: 2123 SKNRFVNILPYDQTRVVL-------------------------------QNNSKKNDYINANYIPFVEKRDKYEFIASQGPIQNSISDFWDMIWENNVTMIVMLTRTYEEDKFKCLQYWP--ESKGKTVKFG---EN-------------------QEYEVSMEEELKENSFLERKLEVLNKNSNEQRSIIHLQMIEWYDYSAPKFEDF-------EFLLFRFQDIILR----------------------ADFHPILIHCSAGVGRTGTFIVLDRIIRKMMQGXXXXXXXXX-----------XXXXRKYRKMMVQRVVQFIFIRD-FVSYF 2833
            +KNR+ NILPY+ +RV L                                ++ K NDYINANY+   +    +++IA+Q P+ +++ DFW +I  N V +I+ L    E +  K   YW        T+K     EN                   Q   +S + +L  N      L  +    +E   +  LQ   W D       D          LLF  Q  I                        A+  P+L+HCSAG GRTG F+ LD ++  +          D            + E+RK R  MVQ + Q+I   +  ++YF
Sbjct:  410 TKNRYSNILPYEHSRVKLPHSPKPPAVSEASTTETKTDKSYPMCPVDAKNHSCKPNDYINANYLKLTQINPDFKYIATQAPLPSTMDDFWKVITLNKVKVIISLNSDDELNLRKWDIYWNNLSYSNHTIKLQNTWENICNINGCVLRVFQVKKTAPQNDNISQDCDLPHNG----DLTSITMAVSEPFIVYQLQYKNWLDSCGVDMNDIIKLHKVKNSLLFNPQSFITSLEKDVCKPDLIDDNNSELHLDTANSSPLLVHCSAGCGRTGVFVTLDFLLSILSPTTNHSNKIDVWNMTQDLIFIIVNELRKQRISMVQNLTQYIACYEALLNYF 738          
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Ensembl Yeast
Match: PTP3 (Phosphotyrosine-specific protein phosphatase; involved in the inactivation of mitogen-activated protein kinase (MAPK) during osmolarity sensing; dephosporylates Hog1p MAPK and regulates its localization; localized to the cytoplasm [Source:SGD;Acc:S000000877])

HSP 1 Score: 62.3882 bits (150), Expect = 2.732e-10
Identity = 39/149 (26.17%), Postives = 72/149 (48.32%), Query Frame = 2
Query: 2123 SKNRFVNILPYDQTRVVLQNNSKK----------------NDYINANYIPF----VEKRDKYE----------FIASQGPIQNSISDFWDMIWENNVTMIVMLTRTYEEDKFKCLQYWPES--KGKTVKFGENQEYEVSMEEELKENSF 2473
            +KNR+ +I PY+ +RV+L+   +                 ++YINANY+      VE+   ++          +IA+Q P+ +++ DF+  I  N V +++ LT  +E    KC +YW E    G  VK  E +  ++     +++N+ 
Sbjct:  529 AKNRYKDIFPYEHSRVILKKGLQSSKGIKHSHSTSDGGILDNYINANYLSLPRFSVEQNSSFQTTTTTTRRVRYIATQAPMPSTVHDFYTCILNNGVPLVLSLTNDFENGIEKCYRYWQEGNYNGIHVKLLEKKILKMPSTTSMRKNTM 677          
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Ensembl Nematostella
Match: EDO38304 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDC7])

HSP 1 Score: 167.162 bits (422), Expect = 4.617e-46
Identity = 94/259 (36.29%), Postives = 151/259 (58.30%), Query Frame = 2
Query: 2033 KEFKDLALRARKYEKLNNYTTFVGESEKNKSKNRFVNILPYDQTRVVLQNNSKKNDYINANYIPFVEKRDKYEFIASQGPIQNSISDFWDMIWENNVTMIVMLTRTYEEDKFKCLQYWPESKGKTVKFGENQEYEVSMEEELKENSFLERKLEVLNKNSNEQRSIIHLQMIEWYDYSAPKFEDFEFLLFRFQDIILRADFHPILIHCSAGVGRTGTFIVLDRIIRKMMQGXXXXXXXXXXXXXRKYRKMMVQRVVQFIF 2809
            +EFKDL    R+ +  +   +  G+++ N  KNR+ N+LPY+ TRV L  +S + DYINAN+I  +   D Y +IA+QGP+ N+  DFW MIWE  V ++ M+T   E  K KC +YWP++  + +K G    +EVS+ ++   +SF++R + V +  S +   I HL  ++W D+  P+    E + F      L     P+++HCSAG+GRTG  I +D +   +M+ +    IN  I ++R+ R+ M+Q   Q+IF
Sbjct:   34 EEFKDL----REIKPTDGCDS--GKNQANTDKNRYRNVLPYEATRVRLSGSSGE-DYINANHIRVLVDDDTYHYIATQGPLPNTTKDFWQMIWEQGVEVVAMVTLDKEGGKVKCHRYWPDNTNQPLKLG--GRFEVSLLKQTNYDSFVQRDIAVKHLQSGKSIEIAHLNFVKWPDHGVPR-SPVEMVQFVAYMRSLATSQAPVVVHCSAGIGRTGALIAVD-VALGLMERDKPFDINQTIRDLREQRQGMIQTKDQYIF 281          
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Ensembl Nematostella
Match: EDO41632 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S419])

HSP 1 Score: 158.688 bits (400), Expect = 9.213e-44
Identity = 84/237 (35.44%), Postives = 137/237 (57.81%), Query Frame = 2
Query: 2114 KNKSKNRFVNILPYDQTRVVLQNNSKKNDYINANYIPFVEKRDKYEFIASQGPIQNSISDFWDMIWENNVTMIVMLTRTYEEDKFKCLQYWPES-KGKTVKFGENQEYEVSMEEELKENSFLERKLEVLNKNSNEQRSIIHLQMIEWYDYSAPKFEDFEFLLFRFQ---DIILRADFHPILIHCSAGVGRTGTFIVLDRIIRKMMQGXXXXX-XXXXXXXXRKYRKMMVQRVVQFIF 2809
             N+  NR+ ++LPYD +R++L++     DYINAN + F E   +Y  I +QGP+ ++   FW M+WENN   ++ML +  E+++ KC QYWP   +   V   E   +++    E +   F  R LE+ NK + E R + H   + W D+  PK   + FL F F+     +L +D  P +IHCSAG+GR+GTF+++D I+ ++  GNL+ + + + +L  R+YR  ++Q   Q  F
Sbjct:    5 ANRPLNRYRDVLPYDHSRIILESTQNGTDYINANLVEFPELGKRY--ILAQGPLPHTADHFWQMVWENNSKAVIMLNKVMEKNQIKCFQYWPCGERYAHVNCLELDSFQIKYITENRSEEFTVRILELENKKTKETRVVYHYHYLTWPDFGVPKAPGY-FLSFLFECRNAGVLSSDVGPAVIHCSAGIGRSGTFVMIDSILAEVSTGNLNAVDLGERLLAARQYRVGLIQTPDQLRF 238          
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Ensembl Nematostella
Match: EDO48949 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RI09])

HSP 1 Score: 157.918 bits (398), Expect = 7.084e-43
Identity = 90/263 (34.22%), Postives = 143/263 (54.37%), Query Frame = 2
Query: 2063 RKYEKLNNY-----TTFVGESEKNKSKNRFVNILPYDQTRVVLQN--NSKKNDYINANYIPFVEKRDKYEFIASQGPIQNSISDFWDMIWENNVTMIVMLTRTYEEDKFKCLQYWPESKGKTVKFGENQEYEVSM-EEELKENSFLERKLEVLNKNSNEQRSIIHLQMIEWYDYSAPKFEDFEFLLFRFQDIILRADFHPILIHCSAGVGRTGTFIVLDRIIRKMMQGXXXXXXXXXXXXXRKYRKMMVQRVVQFIFIRDFVS 2827
            +++E L NY        +G+ +KN  KNR+ ++LPYD  RV L+   N+  +DYINA++I   + R+   +IA+QGP+ +++SDFW M+WE  V +IV LTR  +    +C +YWPE   +T        YEV +  E +  + +L R   + N  ++E R++     + W D + P          R  +   R    PI++HCS GVGRTG +I++D ++ KMM+G  +I I   +  +R  R  MV+   QF F    V+
Sbjct:   33 KEWEALCNYEAEPSVADLGKQDKNVRKNRYSDVLPYDHNRVSLRETANATGSDYINASFITDHDPRNP-AYIATQGPLAHTVSDFWQMVWEQGVVVIVNLTRLSDLGLPQCHRYWPEDGHETYHI-----YEVHLVSEHIWCDDYLVRSFYLKNLQTSETRTVTQFHFLSWPDLNVPTTPKPLLEFRRKVNKCFRGRSCPIVVHCSGGVGRTGCYILIDLVLNKMMRGAKEIDIAATVEHLRDQRPHMVKTKAQFEFALTAVA 289          
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Ensembl Nematostella
Match: EDO48358 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJD7])

HSP 1 Score: 148.673 bits (374), Expect = 4.691e-39
Identity = 100/314 (31.85%), Postives = 155/314 (49.36%), Query Frame = 2
Query: 2000 KNESKNLEQFTKEFKDLALRARKYEKLNNYTTFVGESEKNKSKNRFVNILPYDQTRVVLQ--NNSKKNDYINANYIPFVEKRDKYEFIASQGPIQNSISDFWDMIWENNVTMIVMLTRTYEEDKFKCLQYWPESKGKTVKFGENQEYEVSME-EELKENSFLERKLEVLNKNSNEQRSIIHLQMIEWYDYSAPKFEDFEFLLFRFQDIILRADFHPILIHCSAGVGRTGTFIVLDRIIRKMMQGXXXXXXXX--XXXXXRKYRKMMVQRVVQFIFIRDFVSYFL--------HKY---SQQDENNNEENLYFNS 2893
            +N  +    F KEF++L   + + ++   ++T  GE E N++KNR+ +ILPYD +R+VL        +DYIN NYI    K   Y  +A+QGP+  ++ DFW M+  +N+ ++VM  R YE  K KC +YWPES  +T+ F      ++S+E EE   + F  R L V  +    + ++       W D+  P+       L R     + +   P+L+HCSAG GRTGT   LD   R ++Q      ++    +  +R+ R  MVQ   Q+  +   V   +        H Y   S  D+   EE  Y NS
Sbjct:   14 RNNPQGENGFAKEFQELKNISSRQKRDKAFSTNHGEKEYNRTKNRYKDILPYDYSRIVLPEIKGVDGSDYINGNYIKGPTKNIMY--LAAQGPLPKTVDDFWRMMISHNIQVVVMACREYELGKLKCKRYWPESMEETLTFA---GMKISLESEEAMGDGFTVRTLAV--QAGKTKHNVTQFHYTAWPDHDVPRSATPLIELTRSFRTFVGSQDTPVLVHCSAGCGRTGTICALD-YARTLLQTGRTEELSVFDIVANLRRQRVAMVQTKEQYTLVYKAVEELVNEELRKQNHLYVNVSVGDQQGGEEQNYENS 319          
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Ensembl Nematostella
Match: EDO46961 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNP0])

HSP 1 Score: 157.147 bits (396), Expect = 6.684e-39
Identity = 95/275 (34.55%), Postives = 142/275 (51.64%), Query Frame = 2
Query: 2006 ESKNLEQFTKEFKDLALRARKYEKLNNYTTFVGESEKNKSKNRFVNILPYDQTRVVLQ--NNSKKNDYINANYIPFVEKRDKYEFIASQGPIQNSISDFWDMIWENNVTMIVMLTRTYEEDKFKCLQYWPESKGKTVKFGENQEYEVSMEEELKENSFLERKLEVLNKNSNEQRSIIHLQMIEWYDYSAPKFEDFEFLLFRFQDIILRADFHPILIHCSAGVGRTGTFIVLDRIIRKMMQGXXXXXXXXXXXXXRKYRKMMVQRVVQFIFIRDFV 2824
            ++ N  QFT+E++ +       E    +T    + E NK KNR+ NI  YD +RV L   N  + +DYINAN+     K   Y  IA+QGP+Q++ +DFW M+WE     IVMLTR  E  + KC QYWP + G  V  G     EVS+ + ++  ++    L++  + +++ R + H Q   W D+  P          R        D  PI++HCSAGVGRTG FIV+D ++ ++      + I   +  +R  R  MVQ   Q+IF  D +
Sbjct: 1313 KADNNSQFTQEYESI-------EPGQTFTADSSQMECNKGKNRYPNIHAYDHSRVRLSYINGIEGSDYINANFCDGYRKERAY--IATQGPMQHTAADFWRMVWEQRTFTIVMLTREEERGRVKCDQYWP-TDGTDVYEG----IEVSLVDWVELANYTISTLQICKEGASQPREVKHFQFTGWPDHGVPAHPTPFLAFLRRVKFYNPPDAGPIVVHCSAGVGRTGCFIVIDSMLERLRH-EETVDIYGHVTVLRTQRNYMVQTQEQYIFSHDAI 1572          

HSP 2 Score: 128.257 bits (321), Expect = 5.893e-30
Identity = 100/306 (32.68%), Postives = 152/306 (49.67%), Query Frame = 2
Query: 1904 EIMNLKRTEVNERIFDIKNSIKYSRVDSIENKKNESKNLEQFTKEFKDLALRARKYEKLNNYTTFVGESEKNKSKNRFVNILPYDQTRVVLQ--NNSKKNDYINANYIPFVEKRDKYEFIASQGPIQNSISDFWDMIWENNVTMIVMLTRTYEEDKFKCLQYWPESKGKTVKFGENQEYEVSMEEELKENSFLERKLEVLNKNSNEQRSIIHLQMIEWYDYSAPK-FEDFEFLLFRFQDII-LRADFHPILIHCSAGVGRTGTFIVLDRIIRKMMQGXXXXXXXXXXXXXRKYRKMMVQRVVQFIF 2809
            E ++   TEV+ R  ++ + IK       E  K E   LE+   EFK +     K  K    T  +     N+ KNR  NILPY+ TRV +      + +DYINA++I    +R    FIA+QGP+Q+++ DFW M+ E N  +IVMLT+ +E +  KC +YWP     T +   +Q Y V    E +   F+ R  +V +  S+  R+I     + W +   PK  E    L+ + Q     + +  PI +HCS GVGRTG F  L  I+ + M+    + +   +  +R  R  MVQ   Q++F
Sbjct: 1574 EAVSCGNTEVHAR--NLLHHIK----KLTELGKGEVTGLEE---EFKVVDPSQAKKHKYGAATLAI-----NRPKNRLANILPYETTRVHISPVRGVEGSDYINASFIDGYRQRGL--FIATQGPLQDTVDDFWRMLMEQNSNIIVMLTQLHEGEWEKCYKYWP-----TDRSARHQYYIVDPIAEHEYPQFVIRDFKVKDARSDTVRNIKQFHFLGWPETGVPKSGEGIIDLIGQVQRAYEQQEEEGPITVHCSDGVGRTGVFTAL-FIVLERMRSEGVVDLFQTVKLLRTQRPAMVQSQEQYLF 1857          
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Ensembl Medaka
Match: ptprfb (receptor-type tyrosine-protein phosphatase F [Source:NCBI gene;Acc:101168742])

HSP 1 Score: 157.532 bits (397), Expect = 1.469e-38
Identity = 92/260 (35.38%), Postives = 146/260 (56.15%), Query Frame = 2
Query: 2060 ARKYEKLNNYTTFVGES---EKNKSKNRFVNILPYDQTRVVLQNNSKK----NDYINANYIPFVEKRDKYEFIASQGPIQNSISDFWDMIWENNVTMIVMLTRTYEEDKFKCLQYWPESKGKTVKFGENQEYEVSMEEELKENSFLERKLEVLNKNSNEQRSIIHLQMIEWYDYSAPKFEDFEFLLFRFQDIILRADFHPILIHCSAGVGRTGTFIVLDRIIRKMMQGXXXXXXXXXXXXXRKYRKMMVQRVVQFIFIRD 2818
            +++YE ++    F  E    E NK KNR+ N++ YD +RVVL +   +    +DYINANYI    K++ Y  IA+QGP+  ++SDFW M+WE   + ++M+TR  E+ + KC QYWP S+G T  +G  Q   V+M + ++  ++  R   +    S+E+R +   Q + W D+  P++        R        D  P+++HCSAGVGRTG FIV+D ++ + M+    + I   +  +R  R  MVQ   Q+IFI +
Sbjct:  931 SQEYESIDPGQQFTWEHSNMEVNKPKNRYANVIAYDHSRVVLTSIDGRTVPGSDYINANYIDGYRKQNAY--IATQGPLPETLSDFWRMVWEQRSSTVIMMTRLEEKSRVKCDQYWP-SRG-TETYGMIQ---VTMLDTVELATYSVRTFALYKNGSSEKREVRQFQFMAWPDHGVPEYPTPILAFLRRVKACNPLDAGPMVVHCSAGVGRTGCFIVIDAMLER-MKHEKTVDIYGHVTCMRAQRNYMVQTEDQYIFIHE 1182          

HSP 2 Score: 132.494 bits (332), Expect = 7.351e-31
Identity = 75/204 (36.76%), Postives = 111/204 (54.41%), Query Frame = 2
Query: 2117 NKSKNRFVNILPYDQTRVVLQ--NNSKKNDYINANYIPFVEKRDKYEFIASQGPIQNSISDFWDMIWENNVTMIVMLTRTYEEDKFKCLQYWPESKGKTVKFGENQEYEVSMEEELKENSFLERKLEVLNKNSNEQRSIIHLQMIEWYDYSAPKFEDFEFLLFRFQDIILRADF---HPILIHCSAGVGRTGTFIVLDRIIRKM 2713
            NK KNR VNI+P++ TRV LQ     + +DYINA+ I    ++  Y  +A+QGP+  +  DFW M+WE+N T++VMLT+  E  + KC QYWP  +         Q + V    E     ++ R+ +V +    + R+I   Q  +W +   PK  +  F+ F  Q    +  F    PI +HCSAGVGRTG FI L  ++ +M
Sbjct: 1244 NKFKNRLVNIMPFESTRVCLQPIRGVEGSDYINASCIDGYRQQKAY--LATQGPLAETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWPAERS-----ARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTIRQFQFTDWPEQGVPKTGE-GFIDFIGQVHKTKEQFGQDGPITVHCSAGVGRTGVFITLSIVLERM 1439          
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Ensembl Medaka
Match: ptprsa (receptor-type tyrosine-protein phosphatase S [Source:NCBI gene;Acc:101174175])

HSP 1 Score: 156.377 bits (394), Expect = 3.208e-38
Identity = 90/258 (34.88%), Postives = 137/258 (53.10%), Query Frame = 2
Query: 2060 ARKYEKLNNYTTFVGES---EKNKSKNRFVNILPYDQTRVVLQ--NNSKKNDYINANYIPFVEKRDKYEFIASQGPIQNSISDFWDMIWENNVTMIVMLTRTYEEDKFKCLQYWPESKGKTVKFGENQEYEVSMEEELKENSFLERKLEVLNKNSNEQRSIIHLQMIEWYDYSAPKFEDFEFLLFRFQDIILRADFHPILIHCSAGVGRTGTFIVLDRIIRKMMQGXXXXXXXXXXXXXRKYRKMMVQRVVQFIFIRD 2818
            +++YE ++    F  E    E NK KNR+ N++ YD +RV+L        +DYINANYI    K++ Y  IA+QGP+  +  DFW M+WE     +VM+T+  E+ + KC QYWP S+G T  +G  Q   V++ + ++  +F  R   +    S+E+R +   Q   W D+  P++        R        D  PI+ HCSAGVGRTG FIV+D ++ ++      + I   +  +R  R  MVQ   Q+ FI D
Sbjct:  942 SQEYESIDPGQQFTWEHSNLEVNKPKNRYANVIAYDHSRVILAPIEGITGSDYINANYIDGYRKQNAY--IATQGPLPETFGDFWRMVWEQRAATVVMMTKLEEKSRIKCDQYWP-SRG-TETYGMTQ---VTLLDTIELATFCVRTFSLHKNGSSEKREVRQFQFTAWPDHGVPEYPTPFLAFLRRVKTCNPPDAGPIIAHCSAGVGRTGCFIVIDAMLERIKH-EKTVDIYGHVTLMRSQRNYMVQTEDQYSFIHD 1191          

HSP 2 Score: 137.117 bits (344), Expect = 2.730e-32
Identity = 75/204 (36.76%), Postives = 113/204 (55.39%), Query Frame = 2
Query: 2117 NKSKNRFVNILPYDQTRVVLQ--NNSKKNDYINANYIPFVEKRDKYEFIASQGPIQNSISDFWDMIWENNVTMIVMLTRTYEEDKFKCLQYWPESKGKTVKFGENQEYEVSMEEELKENSFLERKLEVLNKNSNEQRSIIHLQMIEWYDYSAPKFEDFEFLLFRFQDIILRADF---HPILIHCSAGVGRTGTFIVLDRIIRKM 2713
            NK KNR VNI+PY+ TRV LQ     + +DYINA++I     R +  +I++QGP+  +  DFW M+WENN T++VMLT+  E  + KC QYWP  +    ++     + V    E     ++ R+ +V +    + R++   Q  +W +   PK  +  F+ F  Q    +  F    PI +HCSAGVGRTG FI L  ++ +M
Sbjct: 1253 NKFKNRLVNIMPYETTRVCLQPIRGLEGSDYINASFIDGY--RQQRAYISTQGPLAETTEDFWRMLWENNSTIVVMLTKLREMGREKCHQYWPAERSARYQY-----FVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPEQGVPKSGE-GFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERM 1448          
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Ensembl Medaka
Match: ptprsa (receptor-type tyrosine-protein phosphatase S [Source:NCBI gene;Acc:101174175])

HSP 1 Score: 156.377 bits (394), Expect = 3.208e-38
Identity = 90/258 (34.88%), Postives = 137/258 (53.10%), Query Frame = 2
Query: 2060 ARKYEKLNNYTTFVGES---EKNKSKNRFVNILPYDQTRVVLQ--NNSKKNDYINANYIPFVEKRDKYEFIASQGPIQNSISDFWDMIWENNVTMIVMLTRTYEEDKFKCLQYWPESKGKTVKFGENQEYEVSMEEELKENSFLERKLEVLNKNSNEQRSIIHLQMIEWYDYSAPKFEDFEFLLFRFQDIILRADFHPILIHCSAGVGRTGTFIVLDRIIRKMMQGXXXXXXXXXXXXXRKYRKMMVQRVVQFIFIRD 2818
            +++YE ++    F  E    E NK KNR+ N++ YD +RV+L        +DYINANYI    K++ Y  IA+QGP+  +  DFW M+WE     +VM+T+  E+ + KC QYWP S+G T  +G  Q   V++ + ++  +F  R   +    S+E+R +   Q   W D+  P++        R        D  PI+ HCSAGVGRTG FIV+D ++ ++      + I   +  +R  R  MVQ   Q+ FI D
Sbjct:  942 SQEYESIDPGQQFTWEHSNLEVNKPKNRYANVIAYDHSRVILAPIEGITGSDYINANYIDGYRKQNAY--IATQGPLPETFGDFWRMVWEQRAATVVMMTKLEEKSRIKCDQYWP-SRG-TETYGMTQ---VTLLDTIELATFCVRTFSLHKNGSSEKREVRQFQFTAWPDHGVPEYPTPFLAFLRRVKTCNPPDAGPIIAHCSAGVGRTGCFIVIDAMLERIKH-EKTVDIYGHVTLMRSQRNYMVQTEDQYSFIHD 1191          

HSP 2 Score: 137.117 bits (344), Expect = 2.730e-32
Identity = 75/204 (36.76%), Postives = 113/204 (55.39%), Query Frame = 2
Query: 2117 NKSKNRFVNILPYDQTRVVLQ--NNSKKNDYINANYIPFVEKRDKYEFIASQGPIQNSISDFWDMIWENNVTMIVMLTRTYEEDKFKCLQYWPESKGKTVKFGENQEYEVSMEEELKENSFLERKLEVLNKNSNEQRSIIHLQMIEWYDYSAPKFEDFEFLLFRFQDIILRADF---HPILIHCSAGVGRTGTFIVLDRIIRKM 2713
            NK KNR VNI+PY+ TRV LQ     + +DYINA++I     R +  +I++QGP+  +  DFW M+WENN T++VMLT+  E  + KC QYWP  +    ++     + V    E     ++ R+ +V +    + R++   Q  +W +   PK  +  F+ F  Q    +  F    PI +HCSAGVGRTG FI L  ++ +M
Sbjct: 1253 NKFKNRLVNIMPYETTRVCLQPIRGLEGSDYINASFIDGY--RQQRAYISTQGPLAETTEDFWRMLWENNSTIVVMLTKLREMGREKCHQYWPAERSARYQY-----FVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPEQGVPKSGE-GFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERM 1448          
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Ensembl Medaka
Match: ENSORLT00000008644.2 (protein tyrosine phosphatase receptor type H [Source:NCBI gene;Acc:101159389])

HSP 1 Score: 154.066 bits (388), Expect = 8.706e-38
Identity = 107/326 (32.82%), Postives = 166/326 (50.92%), Query Frame = 2
Query: 1964 IKYSRVDSIENKKNESKNLEQFTKEFKDLALR-----ARKYEKLNNYTTFVGESEK----NKSKNRFVNILPYDQTRVVLQNN--SKKNDYINANYIP-FVEKRDKYEFIASQGPIQNSISDFWDMIWENNVTMIVMLTRTYEEDKFKCLQYWPESKGKTVKFGENQEYEVSMEEELKENSFLERKLEVLNKNSNEQRSIIHLQMIEWYDYSAPK--FEDFEFLLFRFQDIILRADFHPILIHCSAGVGRTGTFIVLDRIIRKMMQGXXXXXXXXXXXXXRKYRKMMVQRVVQFIFIRDFVSYFLHKYSQQDEN--NNEENLYFNS 2893
            I  S+  S + KK  + N   F   F  L+L      +++YE L+   T           NK KNRF N+LPYD  RV L  +  S+  DYINA+Y+P +   R   E+IA+QGP+  ++ DFW MIWE  V  I M+T   E  + KC +YWPE+ G    +G   E  V++  E ++ S+  R   V +  ++E+R++ H     W D+  P+      +F     Q I   +   P ++HCSAGVGRTGT I LD +++++ +    + I   + ++R  R  MVQ   Q++F+   +   L   +  D+N   N   +Y N+
Sbjct:  567 IGGSKQHSAKGKKISAAN---FPDHFHQLSLDENRGLSQEYEDLSAVGTDQARRAALLPDNKVKNRFTNVLPYDWCRVKLSTSGPSETLDYINASYMPGYTTNR---EYIATQGPLPGTVKDFWRMIWEQQVKRIAMVTNCVEGGRTKCERYWPEN-GNPGIYG---EISVTVTSEKRDTSWTLRDFTVKHMKTSEERTVKHFHFTAWPDHGVPENTVVLIQFRGLMRQHIDSESSNAPTVVHCSAGVGRTGTLIALDVLLQQLGK-EQAVDIKYFVRKMRLNRPYMVQTESQYVFLHQCIMDSLTPNTNLDDNFYENVGAVYVNA 881          
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Ensembl Medaka
Match: ptprsa (receptor-type tyrosine-protein phosphatase S [Source:NCBI gene;Acc:101174175])

HSP 1 Score: 154.066 bits (388), Expect = 1.892e-37
Identity = 90/258 (34.88%), Postives = 138/258 (53.49%), Query Frame = 2
Query: 2060 ARKYEKLNNYTTFVGES---EKNKSKNRFVNILPYDQTRVVLQ--NNSKKNDYINANYIPFVEKRDKYEFIASQGPIQNSISDFWDMIWENNVTMIVMLTRTYEEDKFKCLQYWPESKGKTVKFGENQEYEVSMEEELKENSFLERKLEVLNKNSNEQRSIIHLQMIEWYDYSAPKFEDFEFLLFRFQDIILRADFHPILIHCSAGVGRTGTFIVLDRIIRKMMQGXXXXXXXXXXXXXRKYRKMMVQRVVQFIFIRD 2818
            +++YE ++    F  E    E NK KNR+ N++ YD +RV+L        +DYINANYI    K++ Y  IA+QGP+  +  DFW M+WE     +VM+T+  E+ + KC QYWP S+G T  +G  Q   V++ + ++  +F  R   +    S+E+R +   Q   W D+  P++        R        D  PI+ HCSAGVGRTG FIV+D ++ + ++    + I   +  +R  R  MVQ   Q+ FI D
Sbjct: 1212 SQEYESIDPGQQFTWEHSNLEVNKPKNRYANVIAYDHSRVILAPIEGITGSDYINANYIDGYRKQNAY--IATQGPLPETFGDFWRMVWEQRAATVVMMTKLEEKSRIKCDQYWP-SRG-TETYGMTQ---VTLLDTIELATFCVRTFSLHKNGSSEKREVRQFQFTAWPDHGVPEYPTPFLAFLRRVKTCNPPDAGPIIAHCSAGVGRTGCFIVIDAMLER-IKHEKTVDIYGHVTLMRSQRNYMVQTEDQYSFIHD 1461          

HSP 2 Score: 137.502 bits (345), Expect = 2.381e-32
Identity = 76/204 (37.25%), Postives = 112/204 (54.90%), Query Frame = 2
Query: 2117 NKSKNRFVNILPYDQTRVVLQ--NNSKKNDYINANYIPFVEKRDKYEFIASQGPIQNSISDFWDMIWENNVTMIVMLTRTYEEDKFKCLQYWPESKGKTVKFGENQEYEVSMEEELKENSFLERKLEVLNKNSNEQRSIIHLQMIEWYDYSAPKFEDFEFLLFRFQDIILRADF---HPILIHCSAGVGRTGTFIVLDRIIRKM 2713
            NK KNR VNI+PY+ TRV LQ     + +DYINA++I     R +  +I++QGP+  +  DFW M+WENN T++VMLT+  E  + KC QYWP  +         Q + V    E     ++ R+ +V +    + R++   Q  +W +   PK  +  F+ F  Q    +  F    PI +HCSAGVGRTG FI L  ++ +M
Sbjct: 1523 NKFKNRLVNIMPYETTRVCLQPIRGLEGSDYINASFID--GYRQQRAYISTQGPLAETTEDFWRMLWENNSTIVVMLTKLREMGREKCHQYWPAERS-----ARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPEQGVPKSGE-GFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERM 1718          
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Planmine SMEST
Match: SMESG000032456.1 (SMESG000032456.1)

HSP 1 Score: 1160.98 bits (3002), Expect = 0.000e+0
Identity = 551/577 (95.49%), Postives = 564/577 (97.75%), Query Frame = 2
Query:   29 MGNEIRFNLIAGIIMILFGCLKVDSECVHEQAYCINGESSRKNPCIPWAQSTKYKSVNIFLNTTLCEKGNNDYWCATSFRWNYCQPSRCELSYNLCEDGISWETFEKSVKLKIPNKFDTVTILQKSESECAISAQCRMCRSVEQMIGNLFNGCQLLEVSRDHTRSISFPNLRHSTKYHFYILPIQEGRLMGFVFKLNLLTKISKPCLPYSIKSVKQEVNFILFKWIECKENATFGRTSGYSLAVSGHSTKSFNTTETSWEMNQLSPCKQYCIRISAYNDAGYSHQSETICTFTRPSFDEVKAVRITKTLPLIRMIEWDYENKHMCPVTFQVRLFMDKAESHIGYFITVDKFIKFDNLIRSKIYFVQITPEFQNETGPHSPLLRFHTFQKPSHPGKITVKEKQQTSFRIEWERPLSNDLFGEPDGYQITIDNLFDQIFNTTKTNYYITDLDTCTKYCISIHAYNLAGKSHQPQKTCIYTKIERFDHIIMKPLEMNQTLPVTVKWTYENSLKCEDISFEVTYYKENDYGSLQRVTTRTHSASLDYIEPLKRYKCTVRPKYQGEFGDYSNDVEIYINDGK 1759
            MGNEIRFNLIAGIIMILFGCL+VDSECVH++AYCINGESS K+PCIPWAQSTKYKSVNIFL TTLC+K NNDYWCATS  WNYCQPSRCELSYNLCEDGISWETFEKSVKLKIPNKFDTVTILQKSESECAISAQCRMCRSVEQMIGNLFNGCQLLEVSRDHTRSISFPNL HSTKYHFYILPIQEGRLMGFVFKL LLTKISKPCLPYSIKSVK+EVN ILF+WIECKENATFGRTSGYSLAVSGHSTKSFNT+ETSWEMNQLSPCKQYCIRISAYNDAGYSHQSE+ICTFTRPSFDEVKAVRITKTLPLIRMIEWDYEN H+CPVTFQVRLFMDKAESHI YF TVDKFIKFDNLIRSKIYFVQITP+FQNETGPHSPLLRFHTFQKPSHPGKITVKEKQQTSFRIEWERPLSNDLFGEPDGYQITIDNLFDQIFNTTKTNYYI DL TCTKYCISIHAYNLAGKSHQPQKTCIYTKIERFDHIIMKPLEMNQTLPVTVKWTYENSLKCEDISFEVTYYKENDYGSL+RVTTR+HSASLDYIEPLKRYKCTVRPKYQGEFGDYSNDVEIYINDGK
Sbjct:    1 MGNEIRFNLIAGIIMILFGCLQVDSECVHDKAYCINGESSWKSPCIPWAQSTKYKSVNIFLKTTLCKKENNDYWCATSVSWNYCQPSRCELSYNLCEDGISWETFEKSVKLKIPNKFDTVTILQKSESECAISAQCRMCRSVEQMIGNLFNGCQLLEVSRDHTRSISFPNLLHSTKYHFYILPIQEGRLMGFVFKLYLLTKISKPCLPYSIKSVKREVNSILFEWIECKENATFGRTSGYSLAVSGHSTKSFNTSETSWEMNQLSPCKQYCIRISAYNDAGYSHQSESICTFTRPSFDEVKAVRITKTLPLIRMIEWDYENMHICPVTFQVRLFMDKAESHIKYFTTVDKFIKFDNLIRSKIYFVQITPKFQNETGPHSPLLRFHTFQKPSHPGKITVKEKQQTSFRIEWERPLSNDLFGEPDGYQITIDNLFDQIFNTTKTNYYIIDLATCTKYCISIHAYNLAGKSHQPQKTCIYTKIERFDHIIMKPLEMNQTLPVTVKWTYENSLKCEDISFEVTYYKENDYGSLRRVTTRSHSASLDYIEPLKRYKCTVRPKYQGEFGDYSNDVEIYINDGK 577          
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Planmine SMEST
Match: SMESG000032456.1 (SMESG000032456.1)

HSP 1 Score: 1131.32 bits (2925), Expect = 0.000e+0
Identity = 537/563 (95.38%), Postives = 550/563 (97.69%), Query Frame = 2
Query:   71 MILFGCLKVDSECVHEQAYCINGESSRKNPCIPWAQSTKYKSVNIFLNTTLCEKGNNDYWCATSFRWNYCQPSRCELSYNLCEDGISWETFEKSVKLKIPNKFDTVTILQKSESECAISAQCRMCRSVEQMIGNLFNGCQLLEVSRDHTRSISFPNLRHSTKYHFYILPIQEGRLMGFVFKLNLLTKISKPCLPYSIKSVKQEVNFILFKWIECKENATFGRTSGYSLAVSGHSTKSFNTTETSWEMNQLSPCKQYCIRISAYNDAGYSHQSETICTFTRPSFDEVKAVRITKTLPLIRMIEWDYENKHMCPVTFQVRLFMDKAESHIGYFITVDKFIKFDNLIRSKIYFVQITPEFQNETGPHSPLLRFHTFQKPSHPGKITVKEKQQTSFRIEWERPLSNDLFGEPDGYQITIDNLFDQIFNTTKTNYYITDLDTCTKYCISIHAYNLAGKSHQPQKTCIYTKIERFDHIIMKPLEMNQTLPVTVKWTYENSLKCEDISFEVTYYKENDYGSLQRVTTRTHSASLDYIEPLKRYKCTVRPKYQGEFGDYSNDVEIYINDGK 1759
            MILFGCL+VDSECVH++AYCINGESS K+PCIPWAQSTKYKSVNIFL TTLC+K NNDYWCATS  WNYCQPSRCELSYNLCEDGISWETFEKSVKLKIPNKFDTVTILQKSESECAISAQCRMCRSVEQMIGNLFNGCQLLEVSRDHTRSISFPNL HSTKYHFYILPIQEGRLMGFVFKL LLTKISKPCLPYSIKSVK+EVN ILF+WIECKENATFGRTSGYSLAVSGHSTKSFNT+ETSWEMNQLSPCKQYCIRISAYNDAGYSHQSE+ICTFTRPSFDEVKAVRITKTLPLIRMIEWDYEN H+CPVTFQVRLFMDKAESHI YF TVDKFIKFDNLIRSKIYFVQITP+FQNETGPHSPLLRFHTFQKPSHPGKITVKEKQQTSFRIEWERPLSNDLFGEPDGYQITIDNLFDQIFNTTKTNYYI DL TCTKYCISIHAYNLAGKSHQPQKTCIYTKIERFDHIIMKPLEMNQTLPVTVKWTYENSLKCEDISFEVTYYKENDYGSL+RVTTR+HSASLDYIEPLKRYKCTVRPKYQGEFGDYSNDVEIYINDGK
Sbjct:    1 MILFGCLQVDSECVHDKAYCINGESSWKSPCIPWAQSTKYKSVNIFLKTTLCKKENNDYWCATSVSWNYCQPSRCELSYNLCEDGISWETFEKSVKLKIPNKFDTVTILQKSESECAISAQCRMCRSVEQMIGNLFNGCQLLEVSRDHTRSISFPNLLHSTKYHFYILPIQEGRLMGFVFKLYLLTKISKPCLPYSIKSVKREVNSILFEWIECKENATFGRTSGYSLAVSGHSTKSFNTSETSWEMNQLSPCKQYCIRISAYNDAGYSHQSESICTFTRPSFDEVKAVRITKTLPLIRMIEWDYENMHICPVTFQVRLFMDKAESHIKYFTTVDKFIKFDNLIRSKIYFVQITPKFQNETGPHSPLLRFHTFQKPSHPGKITVKEKQQTSFRIEWERPLSNDLFGEPDGYQITIDNLFDQIFNTTKTNYYIIDLATCTKYCISIHAYNLAGKSHQPQKTCIYTKIERFDHIIMKPLEMNQTLPVTVKWTYENSLKCEDISFEVTYYKENDYGSLRRVTTRSHSASLDYIEPLKRYKCTVRPKYQGEFGDYSNDVEIYINDGK 563          
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Planmine SMEST
Match: SMESG000032456.1 (SMESG000032456.1)

HSP 1 Score: 1115.52 bits (2884), Expect = 0.000e+0
Identity = 527/554 (95.13%), Postives = 541/554 (97.65%), Query Frame = 2
Query:   29 MGNEIRFNLIAGIIMILFGCLKVDSECVHEQAYCINGESSRKNPCIPWAQSTKYKSVNIFLNTTLCEKGNNDYWCATSFRWNYCQPSRCELSYNLCEDGISWETFEKSVKLKIPNKFDTVTILQKSESECAISAQCRMCRSVEQMIGNLFNGCQLLEVSRDHTRSISFPNLRHSTKYHFYILPIQEGRLMGFVFKLNLLTKISKPCLPYSIKSVKQEVNFILFKWIECKENATFGRTSGYSLAVSGHSTKSFNTTETSWEMNQLSPCKQYCIRISAYNDAGYSHQSETICTFTRPSFDEVKAVRITKTLPLIRMIEWDYENKHMCPVTFQVRLFMDKAESHIGYFITVDKFIKFDNLIRSKIYFVQITPEFQNETGPHSPLLRFHTFQKPSHPGKITVKEKQQTSFRIEWERPLSNDLFGEPDGYQITIDNLFDQIFNTTKTNYYITDLDTCTKYCISIHAYNLAGKSHQPQKTCIYTKIERFDHIIMKPLEMNQTLPVTVKWTYENSLKCEDISFEVTYYKENDYGSLQRVTTRTHSASLDYIEPLKRYKCTV 1690
            MGNEIRFNLIAGIIMILFGCL+VDSECVH++AYCINGESS K+PCIPWAQSTKYKSVNIFL TTLC+K NNDYWCATS  WNYCQPSRCELSYNLCEDGISWETFEKSVKLKIPNKFDTVTILQKSESECAISAQCRMCRSVEQMIGNLFNGCQLLEVSRDHTRSISFPNL HSTKYHFYILPIQEGRLMGFVFKL LLTKISKPCLPYSIKSVK+EVN ILF+WIECKENATFGRTSGYSLAVSGHSTKSFNT+ETSWEMNQLSPCKQYCIRISAYNDAGYSHQSE+ICTFTRPSFDEVKAVRITKTLPLIRMIEWDYEN H+CPVTFQVRLFMDKAESHI YF TVDKFIKFDNLIRSKIYFVQITP+FQNETGPHSPLLRFHTFQKPSHPGKITVKEKQQTSFRIEWERPLSNDLFGEPDGYQITIDNLFDQIFNTTKTNYYI DL TCTKYCISIHAYNLAGKSHQPQKTCIYTKIERFDHIIMKPLEMNQTLPVTVKWTYENSLKCEDISFEVTYYKENDYGSL+RVTTR+HSASLDYIEPLKRYKCT+
Sbjct:    1 MGNEIRFNLIAGIIMILFGCLQVDSECVHDKAYCINGESSWKSPCIPWAQSTKYKSVNIFLKTTLCKKENNDYWCATSVSWNYCQPSRCELSYNLCEDGISWETFEKSVKLKIPNKFDTVTILQKSESECAISAQCRMCRSVEQMIGNLFNGCQLLEVSRDHTRSISFPNLLHSTKYHFYILPIQEGRLMGFVFKLYLLTKISKPCLPYSIKSVKREVNSILFEWIECKENATFGRTSGYSLAVSGHSTKSFNTSETSWEMNQLSPCKQYCIRISAYNDAGYSHQSESICTFTRPSFDEVKAVRITKTLPLIRMIEWDYENMHICPVTFQVRLFMDKAESHIKYFTTVDKFIKFDNLIRSKIYFVQITPKFQNETGPHSPLLRFHTFQKPSHPGKITVKEKQQTSFRIEWERPLSNDLFGEPDGYQITIDNLFDQIFNTTKTNYYIIDLATCTKYCISIHAYNLAGKSHQPQKTCIYTKIERFDHIIMKPLEMNQTLPVTVKWTYENSLKCEDISFEVTYYKENDYGSLRRVTTRSHSASLDYIEPLKRYKCTL 554          
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Planmine SMEST
Match: SMESG000032456.1 (SMESG000032456.1)

HSP 1 Score: 1085.48 bits (2806), Expect = 0.000e+0
Identity = 513/540 (95.00%), Postives = 527/540 (97.59%), Query Frame = 2
Query:   71 MILFGCLKVDSECVHEQAYCINGESSRKNPCIPWAQSTKYKSVNIFLNTTLCEKGNNDYWCATSFRWNYCQPSRCELSYNLCEDGISWETFEKSVKLKIPNKFDTVTILQKSESECAISAQCRMCRSVEQMIGNLFNGCQLLEVSRDHTRSISFPNLRHSTKYHFYILPIQEGRLMGFVFKLNLLTKISKPCLPYSIKSVKQEVNFILFKWIECKENATFGRTSGYSLAVSGHSTKSFNTTETSWEMNQLSPCKQYCIRISAYNDAGYSHQSETICTFTRPSFDEVKAVRITKTLPLIRMIEWDYENKHMCPVTFQVRLFMDKAESHIGYFITVDKFIKFDNLIRSKIYFVQITPEFQNETGPHSPLLRFHTFQKPSHPGKITVKEKQQTSFRIEWERPLSNDLFGEPDGYQITIDNLFDQIFNTTKTNYYITDLDTCTKYCISIHAYNLAGKSHQPQKTCIYTKIERFDHIIMKPLEMNQTLPVTVKWTYENSLKCEDISFEVTYYKENDYGSLQRVTTRTHSASLDYIEPLKRYKCTV 1690
            MILFGCL+VDSECVH++AYCINGESS K+PCIPWAQSTKYKSVNIFL TTLC+K NNDYWCATS  WNYCQPSRCELSYNLCEDGISWETFEKSVKLKIPNKFDTVTILQKSESECAISAQCRMCRSVEQMIGNLFNGCQLLEVSRDHTRSISFPNL HSTKYHFYILPIQEGRLMGFVFKL LLTKISKPCLPYSIKSVK+EVN ILF+WIECKENATFGRTSGYSLAVSGHSTKSFNT+ETSWEMNQLSPCKQYCIRISAYNDAGYSHQSE+ICTFTRPSFDEVKAVRITKTLPLIRMIEWDYEN H+CPVTFQVRLFMDKAESHI YF TVDKFIKFDNLIRSKIYFVQITP+FQNETGPHSPLLRFHTFQKPSHPGKITVKEKQQTSFRIEWERPLSNDLFGEPDGYQITIDNLFDQIFNTTKTNYYI DL TCTKYCISIHAYNLAGKSHQPQKTCIYTKIERFDHIIMKPLEMNQTLPVTVKWTYENSLKCEDISFEVTYYKENDYGSL+RVTTR+HSASLDYIEPLKRYKCT+
Sbjct:    1 MILFGCLQVDSECVHDKAYCINGESSWKSPCIPWAQSTKYKSVNIFLKTTLCKKENNDYWCATSVSWNYCQPSRCELSYNLCEDGISWETFEKSVKLKIPNKFDTVTILQKSESECAISAQCRMCRSVEQMIGNLFNGCQLLEVSRDHTRSISFPNLLHSTKYHFYILPIQEGRLMGFVFKLYLLTKISKPCLPYSIKSVKREVNSILFEWIECKENATFGRTSGYSLAVSGHSTKSFNTSETSWEMNQLSPCKQYCIRISAYNDAGYSHQSESICTFTRPSFDEVKAVRITKTLPLIRMIEWDYENMHICPVTFQVRLFMDKAESHIKYFTTVDKFIKFDNLIRSKIYFVQITPKFQNETGPHSPLLRFHTFQKPSHPGKITVKEKQQTSFRIEWERPLSNDLFGEPDGYQITIDNLFDQIFNTTKTNYYIIDLATCTKYCISIHAYNLAGKSHQPQKTCIYTKIERFDHIIMKPLEMNQTLPVTVKWTYENSLKCEDISFEVTYYKENDYGSLRRVTTRSHSASLDYIEPLKRYKCTL 540          
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Planmine SMEST
Match: SMESG000032456.1 (SMESG000032456.1)

HSP 1 Score: 1013.83 bits (2620), Expect = 0.000e+0
Identity = 479/504 (95.04%), Postives = 491/504 (97.42%), Query Frame = 2
Query:   71 MILFGCLKVDSECVHEQAYCINGESSRKNPCIPWAQSTKYKSVNIFLNTTLCEKGNNDYWCATSFRWNYCQPSRCELSYNLCEDGISWETFEKSVKLKIPNKFDTVTILQKSESECAISAQCRMCRSVEQMIGNLFNGCQLLEVSRDHTRSISFPNLRHSTKYHFYILPIQEGRLMGFVFKLNLLTKISKPCLPYSIKSVKQEVNFILFKWIECKENATFGRTSGYSLAVSGHSTKSFNTTETSWEMNQLSPCKQYCIRISAYNDAGYSHQSETICTFTRPSFDEVKAVRITKTLPLIRMIEWDYENKHMCPVTFQVRLFMDKAESHIGYFITVDKFIKFDNLIRSKIYFVQITPEFQNETGPHSPLLRFHTFQKPSHPGKITVKEKQQTSFRIEWERPLSNDLFGEPDGYQITIDNLFDQIFNTTKTNYYITDLDTCTKYCISIHAYNLAGKSHQPQKTCIYTKIERFDHIIMKPLEMNQTLPVTVKWTYENSLKCEDISFEV 1582
            MILFGCL+VDSECVH++AYCINGESS K+PCIPWAQSTKYKSVNIFL TTLC+K NNDYWCATS  WNYCQPSRCELSYNLCEDGISWETFEKSVKLKIPNKFDTVTILQKSESECAISAQCRMCRSVEQMIGNLFNGCQLLEVSRDHTRSISFPNL HSTKYHFYILPIQEGRLMGFVFKL LLTKISKPCLPYSIKSVK+EVN ILF+WIECKENATFGRTSGYSLAVSGHSTKSFNT+ETSWEMNQLSPCKQYCIRISAYNDAGYSHQSE+ICTFTRPSFDEVKAVRITKTLPLIRMIEWDYEN H+CPVTFQVRLFMDKAESHI YF TVDKFIKFDNLIRSKIYFVQITP+FQNETGPHSPLLRFHTFQKPSHPGKITVKEKQQTSFRIEWERPLSNDLFGEPDGYQITIDNLFDQIFNTTKTNYYI DL TCTKYCISIHAYNLAGKSHQPQKTCIYTKIERFDHIIMKPLEMNQTLPVTVKWTYENSLKCEDISFE+
Sbjct:    1 MILFGCLQVDSECVHDKAYCINGESSWKSPCIPWAQSTKYKSVNIFLKTTLCKKENNDYWCATSVSWNYCQPSRCELSYNLCEDGISWETFEKSVKLKIPNKFDTVTILQKSESECAISAQCRMCRSVEQMIGNLFNGCQLLEVSRDHTRSISFPNLLHSTKYHFYILPIQEGRLMGFVFKLYLLTKISKPCLPYSIKSVKREVNSILFEWIECKENATFGRTSGYSLAVSGHSTKSFNTSETSWEMNQLSPCKQYCIRISAYNDAGYSHQSESICTFTRPSFDEVKAVRITKTLPLIRMIEWDYENMHICPVTFQVRLFMDKAESHIKYFTTVDKFIKFDNLIRSKIYFVQITPKFQNETGPHSPLLRFHTFQKPSHPGKITVKEKQQTSFRIEWERPLSNDLFGEPDGYQITIDNLFDQIFNTTKTNYYIIDLATCTKYCISIHAYNLAGKSHQPQKTCIYTKIERFDHIIMKPLEMNQTLPVTVKWTYENSLKCEDISFEL 504          
The following BLAST results are available for this feature:
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PTPRJ6.528e-4334.31protein tyrosine phosphatase receptor type J [Sour... [more]
PTPRJ6.840e-4334.31protein tyrosine phosphatase receptor type J [Sour... [more]
PTPRJ1.499e-4134.59protein tyrosine phosphatase receptor type J [Sour... [more]
PTPRN25.715e-4033.09protein tyrosine phosphatase receptor type N2 [Sou... [more]
PTPN137.557e-4034.35protein tyrosine phosphatase non-receptor type 13 ... [more]
back to top
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Y41D4A.53.325e-3931.51Tyrosine-protein phosphatase [Source:UniProtKB/Tr... [more]
ptp-34.248e-3834.00Tyrosine-protein phosphatase Lar-like [Source:Uni... [more]
ptp-35.047e-3834.00Tyrosine-protein phosphatase Lar-like [Source:Uni... [more]
ptp-35.221e-3834.00Tyrosine-protein phosphatase Lar-like [Source:Uni... [more]
ptp-35.372e-3834.00Tyrosine-protein phosphatase Lar-like [Source:Uni... [more]
back to top
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ptp69D7.081e-3937.16gene:FBgn0014007 transcript:FBtr0075913[more]
Ptp69D7.917e-3937.16gene:FBgn0014007 transcript:FBtr0075914[more]
Ptp10D3.769e-3637.45gene:FBgn0004370 transcript:FBtr0330393[more]
Ptp10D3.769e-3637.45gene:FBgn0004370 transcript:FBtr0330392[more]
Ptp10D4.118e-3637.45gene:FBgn0004370 transcript:FBtr0330394[more]
back to top
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ptprh2.283e-4134.23protein tyrosine phosphatase receptor type H [Sour... [more]
ptprsa3.820e-4136.05protein tyrosine phosphatase receptor type Sa [Sou... [more]
ptprfa1.629e-4036.43protein tyrosine phosphatase receptor type Fa [Sou... [more]
ptprz1b1.202e-3933.81protein tyrosine phosphatase receptor type Z1b [So... [more]
ptprz1b1.472e-3933.81protein tyrosine phosphatase receptor type Z1b [So... [more]
back to top
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rasgrf13.969e-4235.74Ras protein specific guanine nucleotide releasing ... [more]
ENSXETT00000033793.11.351e-4134.84protein tyrosine phosphatase, receptor type H [Sou... [more]
rasgrf15.876e-4035.74Ras protein specific guanine nucleotide releasing ... [more]
rasgrf18.969e-4035.74Ras protein specific guanine nucleotide releasing ... [more]
ptpn64.276e-3935.36protein tyrosine phosphatase non-receptor type 6 [... [more]
back to top
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ptprj1.180e-4134.81protein tyrosine phosphatase, receptor type, J [So... [more]
Ptprj1.691e-4134.81protein tyrosine phosphatase, receptor type, J [So... [more]
Ptprj1.795e-4134.81protein tyrosine phosphatase, receptor type, J [So... [more]
Ptpn203.058e-4036.36protein tyrosine phosphatase, non-receptor type 20... [more]
Ptprh1.726e-3933.02protein tyrosine phosphatase, receptor type, H [So... [more]
back to top
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9W6V5|PTPRJ_CHICK5.565e-4336.17Receptor-type tyrosine-protein phosphatase eta OS=... [more]
sp|Q12913|PTPRJ_HUMAN7.197e-4134.59Receptor-type tyrosine-protein phosphatase eta OS=... [more]
sp|Q64455|PTPRJ_MOUSE9.970e-4134.81Receptor-type tyrosine-protein phosphatase eta OS=... [more]
sp|A1L1L3|PTN20_RAT3.892e-4037.19Tyrosine-protein phosphatase non-receptor type 20 ... [more]
sp|O55082|PTN20_MOUSE2.139e-3936.36Tyrosine-protein phosphatase non-receptor type 20 ... [more]
back to top
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2G9S8P26.657e-4538.60Uncharacterized protein (Fragment) OS=Lithobates c... [more]
R7TPU08.790e-4337.33Uncharacterized protein (Fragment) OS=Capitella te... [more]
M4A2451.859e-4234.90Protein tyrosine phosphatase receptor type H OS=Xi... [more]
A0A3B5Q6E72.071e-4234.90Protein tyrosine phosphatase receptor type H OS=Xi... [more]
A7SDC72.917e-4236.29Predicted protein (Fragment) OS=Nematostella vecte... [more]
back to top
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000051337.13.383e-4339.42pep primary_assembly:Astyanax_mexicanus-2.0:3:8950... [more]
ENSAMXT00000043527.14.518e-4339.42pep primary_assembly:Astyanax_mexicanus-2.0:3:8946... [more]
ENSAMXT00000055644.15.865e-4339.42pep primary_assembly:Astyanax_mexicanus-2.0:3:8906... [more]
ENSAMXT00000006060.27.567e-4339.42pep primary_assembly:Astyanax_mexicanus-2.0:3:8913... [more]
ENSAMXT00000034956.18.758e-4339.42pep primary_assembly:Astyanax_mexicanus-2.0:3:8911... [more]
back to top
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000009934.11.471e-3730.22pep scaffold:Pmarinus_7.0:GL479331:74:24469:1 gene... [more]
ENSPMAT00000001312.13.525e-3734.98pep scaffold:Pmarinus_7.0:GL477231:34421:73675:-1 ... [more]
ENSPMAT00000003525.18.631e-3732.80pep scaffold:Pmarinus_7.0:GL477320:686:22463:-1 ge... [more]
ENSPMAT00000008162.12.989e-3638.17pep scaffold:Pmarinus_7.0:GL477877:143952:159832:-... [more]
ENSPMAT00000006037.14.479e-3532.82pep scaffold:Pmarinus_7.0:GL477253:2:79428:1 gene:... [more]
back to top
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
PTP13.087e-2530.08Phosphotyrosine-specific protein phosphatase; deph... [more]
PTP23.691e-1524.92Nuclear phosphotyrosine-specific phosphatase invol... [more]
PTP32.732e-1026.17Phosphotyrosine-specific protein phosphatase; invo... [more]
back to top
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO383044.617e-4636.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO416329.213e-4435.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO489497.084e-4334.22Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO483584.691e-3931.85Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO469616.684e-3934.55Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ptprfb1.469e-3835.38receptor-type tyrosine-protein phosphatase F [Sour... [more]
ptprsa3.208e-3834.88receptor-type tyrosine-protein phosphatase S [Sour... [more]
ptprsa3.208e-3834.88receptor-type tyrosine-protein phosphatase S [Sour... [more]
ENSORLT00000008644.28.706e-3832.82protein tyrosine phosphatase receptor type H [Sour... [more]
ptprsa1.892e-3734.88receptor-type tyrosine-protein phosphatase S [Sour... [more]
back to top
BLAST of Receptor-type tyrosine-protein phosphatase eta vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000032456.10.000e+095.49SMESG000032456.1[more]
SMESG000032456.10.000e+095.38SMESG000032456.1[more]
SMESG000032456.10.000e+095.13SMESG000032456.1[more]
SMESG000032456.10.000e+095.00SMESG000032456.1[more]
SMESG000032456.10.000e+095.04SMESG000032456.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30028362 ID=SMED30028362|Name=Receptor-type tyrosine-protein phosphatase eta|organism=Schmidtea mediterranea sexual|type=transcript|length=2924bp
TTAATATTAAGATATTGCACAATAATTCATGGGAAATGAAATAAGGTTTA
ATTTGATTGCGGGGATAATAATGATACTATTCGGATGTTTAAAAGTCGAT
TCCGAATGTGTTCATGAACAAGCTTATTGCATAAATGGAGAGAGCTCTAG
GAAAAATCCCTGCATTCCGTGGGCCCAATCAACTAAATATAAATCAGTCA
ATATATTCCTAAATACAACCCTTTGCGAGAAAGGGAACAATGATTATTGG
TGTGCAACATCATTCAGATGGAATTATTGCCAACCAAGTCGTTGTGAACT
ATCATACAATTTATGCGAGGATGGAATAAGTTGGGAAACATTTGAGAAAT
CTGTCAAACTGAAAATTCCAAATAAATTTGATACGGTGACTATTTTGCAG
AAATCCGAATCTGAATGCGCAATATCTGCCCAATGCCGAATGTGCCGATC
GGTCGAACAAATGATTGGAAACCTATTCAACGGGTGCCAGTTACTGGAGG
TCAGCCGAGATCATACAAGATCCATTTCATTTCCCAATCTCCGACACAGT
ACAAAATATCATTTCTATATTTTACCTATCCAGGAAGGACGGCTGATGGG
ATTTGTATTCAAATTAAATTTGCTCACAAAGATTTCAAAACCCTGCTTGC
CATATTCCATTAAATCAGTGAAGCAGGAGGTCAATTTTATCTTATTCAAA
TGGATTGAGTGCAAGGAAAATGCAACATTCGGTCGGACCAGCGGATATTC
ACTAGCAGTATCGGGACATTCCACAAAATCCTTCAATACAACTGAAACCT
CTTGGGAAATGAATCAACTGAGCCCATGCAAACAATATTGCATTCGAATT
TCTGCTTATAATGATGCTGGATATTCTCATCAATCAGAAACCATTTGCAC
ATTCACTAGGCCTTCCTTTGATGAAGTAAAAGCGGTGAGAATTACAAAAA
CGTTGCCTTTGATCAGAATGATTGAATGGGATTATGAGAACAAGCATATG
TGCCCAGTGACATTTCAGGTCCGACTGTTCATGGATAAAGCTGAAAGTCA
CATAGGATATTTTATCACAGTAGACAAATTTATAAAATTTGACAATCTGA
TTCGAAGCAAAATATATTTTGTCCAAATCACACCGGAATTCCAAAATGAA
ACAGGTCCACATTCGCCTCTCCTCAGATTTCATACTTTTCAAAAGCCTTC
TCATCCAGGAAAGATAACTGTAAAAGAAAAACAACAAACGAGTTTTCGGA
TAGAGTGGGAGAGACCTCTTTCAAATGATTTGTTTGGTGAGCCAGATGGA
TACCAAATCACCATTGATAATTTATTTGATCAAATATTCAACACAACTAA
AACAAATTATTACATCACCGACTTAGACACTTGTACAAAATATTGCATTA
GCATTCATGCGTATAACCTTGCGGGTAAATCTCACCAACCTCAAAAGACT
TGCATTTATACGAAAATTGAAAGGTTTGACCATATAATAATGAAACCTTT
AGAAATGAATCAAACCTTGCCAGTAACTGTGAAATGGACGTATGAAAACA
GCCTAAAATGTGAAGATATTTCATTTGAAGTAACGTATTACAAGGAGAAT
GATTACGGATCCTTGCAACGGGTCACCACAAGAACTCACTCGGCATCTCT
TGACTATATCGAACCTCTTAAACGGTATAAATGCACGGTTAGGCCTAAAT
ATCAAGGGGAATTCGGAGATTATTCCAATGATGTGGAAATATATATAAAT
GATGGAAAAACATCGAAAACCAAATTTTTATTTTTATTGATTATTTTACC
TTGTTTGATATTCGCGCTGATTGCGGGATGGTTTTTAAAAACAAGAGTAA
TTAATAAACCGAGTCTAACAAAAAACCTAACCTCAAATTTATTGCCAAAA
ACTGAAATTATGAATTTGAAGAGAACAGAAGTCAATGAAAGAATATTTGA
CATAAAAAATTCCATCAAATATTCACGCGTTGATAGCATTGAAAACAAGA
AAAACGAATCTAAAAACTTAGAGCAATTTACAAAAGAATTTAAAGATCTC
GCATTAAGAGCTCGGAAGTATGAAAAGCTGAACAATTACACAACTTTCGT
TGGGGAGTCAGAAAAGAATAAATCTAAAAATCGTTTTGTTAATATTTTAC
CTTATGATCAAACAAGAGTTGTTTTACAAAACAATTCCAAAAAAAATGAT
TATATAAATGCTAATTATATTCCATTTGTTGAGAAAAGAGATAAATATGA
ATTTATTGCTAGCCAGGGCCCCATTCAAAATAGTATTTCTGATTTTTGGG
ACATGATTTGGGAAAATAATGTTACAATGATCGTGATGTTAACAAGAACT
TATGAAGAAGATAAATTTAAATGTTTACAATATTGGCCGGAGAGCAAGGG
TAAAACGGTCAAATTCGGTGAAAATCAGGAATATGAAGTATCAATGGAGG
AAGAATTGAAAGAAAATTCATTTCTAGAAAGAAAACTAGAAGTTCTGAAT
AAAAATTCAAATGAGCAAAGAAGTATTATCCATTTACAAATGATTGAATG
GTATGACTATTCGGCGCCGAAATTTGAAGATTTTGAATTTCTTTTATTTC
GTTTTCAAGATATCATTCTACGCGCAGATTTCCATCCTATTTTGATTCAT
TGCAGTGCTGGTGTCGGCAGAACCGGGACATTTATCGTTCTTGACAGAAT
TATTAGAAAAATGATGCAAGGCAATTTGGACATTATAATAAATGATGAAA
TTTTAGAAATTCGAAAATATCGTAAAATGATGGTACAAAGAGTCGTTCAA
TTCATTTTCATACGAGATTTTGTTTCGTATTTTCTTCACAAATATAGCCA
GCAAGATGAGAATAATAATGAGGAAAATTTATATTTCAATTCCTAGAAAT
ATGAAAATAAACATTTGATAAATT
back to top

protein sequence of SMED30028362-orf-1

>SMED30028362-orf-1 ID=SMED30028362-orf-1|Name=SMED30028362-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=956bp
MGNEIRFNLIAGIIMILFGCLKVDSECVHEQAYCINGESSRKNPCIPWAQ
STKYKSVNIFLNTTLCEKGNNDYWCATSFRWNYCQPSRCELSYNLCEDGI
SWETFEKSVKLKIPNKFDTVTILQKSESECAISAQCRMCRSVEQMIGNLF
NGCQLLEVSRDHTRSISFPNLRHSTKYHFYILPIQEGRLMGFVFKLNLLT
KISKPCLPYSIKSVKQEVNFILFKWIECKENATFGRTSGYSLAVSGHSTK
SFNTTETSWEMNQLSPCKQYCIRISAYNDAGYSHQSETICTFTRPSFDEV
KAVRITKTLPLIRMIEWDYENKHMCPVTFQVRLFMDKAESHIGYFITVDK
FIKFDNLIRSKIYFVQITPEFQNETGPHSPLLRFHTFQKPSHPGKITVKE
KQQTSFRIEWERPLSNDLFGEPDGYQITIDNLFDQIFNTTKTNYYITDLD
TCTKYCISIHAYNLAGKSHQPQKTCIYTKIERFDHIIMKPLEMNQTLPVT
VKWTYENSLKCEDISFEVTYYKENDYGSLQRVTTRTHSASLDYIEPLKRY
KCTVRPKYQGEFGDYSNDVEIYINDGKTSKTKFLFLLIILPCLIFALIAG
WFLKTRVINKPSLTKNLTSNLLPKTEIMNLKRTEVNERIFDIKNSIKYSR
VDSIENKKNESKNLEQFTKEFKDLALRARKYEKLNNYTTFVGESEKNKSK
NRFVNILPYDQTRVVLQNNSKKNDYINANYIPFVEKRDKYEFIASQGPIQ
NSISDFWDMIWENNVTMIVMLTRTYEEDKFKCLQYWPESKGKTVKFGENQ
EYEVSMEEELKENSFLERKLEVLNKNSNEQRSIIHLQMIEWYDYSAPKFE
DFEFLLFRFQDIILRADFHPILIHCSAGVGRTGTFIVLDRIIRKMMQGNL
DIIINDEILEIRKYRKMMVQRVVQFIFIRDFVSYFLHKYSQQDENNNEEN
LYFNS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
PLANA:0002142parenchyma
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036116FN3_sf
IPR000242PTPase_domain
IPR003595Tyr_Pase_cat
IPR003961FN3_dom
IPR029021Prot-tyrosine_phosphatase-like
IPR013783Ig-like_fold
IPR016130Tyr_Pase_AS
IPR000387TYR_PHOSPHATASE_dom
Vocabulary: biological process
TermDefinition
GO:0006470protein dephosphorylation
GO:0016311dephosphorylation
GO:0035335peptidyl-tyrosine dephosphorylation
Vocabulary: molecular function
TermDefinition
GO:0004725protein tyrosine phosphatase activity
GO:0005515protein binding
GO:0016791phosphatase activity
GO:0004721phosphoprotein phosphatase activity
GO:0005001transmembrane receptor protein tyrosine phosphatase activity
GO:0016787hydrolase activity
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 799..826
NoneNo IPR availableCOILSCoilCoilcoord: 657..684
NoneNo IPR availablePANTHERPTHR19134:SF483PROTEIN TYROSINE PHOSPHATASE 4E, ISOFORM A-RELATEDcoord: 417..936
NoneNo IPR availablePANTHERPTHR19134PROTEIN-TYROSINE PHOSPHATASEcoord: 417..936
NoneNo IPR availablePROSITEPS51257PROKAR_LIPOPROTEINcoord: 1..20
score: 5.0
NoneNo IPR availableCDDcd00047PTPccoord: 725..928
e-value: 1.60971E-65
score: 216.768
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..25
score: 0.757
NoneNo IPR availableTMHMMTMhelixcoord: 583..605
IPR000242PTP type protein phosphatasePRINTSPR00700PRTYPHPHTASEcoord: 724..731
score: 79.71
coord: 918..928
score: 46.42
coord: 831..848
score: 28.92
coord: 870..888
score: 70.25
coord: 742..762
score: 51.9
IPR000242PTP type protein phosphataseSMARTSM00194PTPc_3coord: 666..937
e-value: 2.4E-78
score: 276.3
IPR000242PTP type protein phosphatasePFAMPF00102Y_phosphatasecoord: 697..932
e-value: 4.8E-64
score: 216.1
IPR000242PTP type protein phosphatasePROSITEPS50055TYR_PHOSPHATASE_PTPcoord: 667..935
score: 43.128
IPR003595Protein-tyrosine phosphatase, catalyticSMARTSM00404ptp_7coord: 832..934
e-value: 1.2E-19
score: 81.2
IPR003961Fibronectin type IIISMARTSM00060FN3_2coord: 390..468
e-value: 4.7E-5
score: 32.8
coord: 202..283
e-value: 14.0
score: 10.3
IPR003961Fibronectin type IIIPROSITEPS50853FN3coord: 392..481
score: 13.846
IPR003961Fibronectin type IIIPROSITEPS50853FN3coord: 482..576
score: 6.856
IPR003961Fibronectin type IIIPROSITEPS50853FN3coord: 207..296
score: 11.716
IPR003961Fibronectin type IIICDDcd00063FN3coord: 499..572
e-value: 0.00205975
score: 36.3203
IPR003961Fibronectin type IIICDDcd00063FN3coord: 390..478
e-value: 6.29613E-7
score: 46.3355
IPR003961Fibronectin type IIICDDcd00063FN3coord: 219..293
e-value: 0.00602809
score: 35.1647
IPR029021Protein-tyrosine phosphatase-likeGENE3DG3DSA:3.90.190.10coord: 647..954
e-value: 5.9E-82
score: 277.3
IPR029021Protein-tyrosine phosphatase-likeSUPERFAMILYSSF52799(Phosphotyrosine protein) phosphatases IIcoord: 649..939
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 384..480
e-value: 4.8E-11
score: 44.8
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 196..304
e-value: 8.9E-9
score: 37.2
IPR016130Protein-tyrosine phosphatase, active sitePROSITEPS00383TYR_PHOSPHATASE_1coord: 873..883
IPR000387Tyrosine specific protein phosphatases domainPROSITEPS50056TYR_PHOSPHATASE_2coord: 850..926
score: 16.306
IPR036116Fibronectin type III superfamilySUPERFAMILYSSF49265Fibronectin type IIIcoord: 389..573
IPR036116Fibronectin type III superfamilySUPERFAMILYSSF49265Fibronectin type IIIcoord: 161..295