Si:ch211-193k19.1

Overview
NameSi:ch211-193k19.1
Smed IDSMED30028358
Length (bp)1066
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Si:ch211-193k19.1 (SMED30028358) t-SNE clustered cells

Violin plots show distribution of expression levels for Si:ch211-193k19.1 (SMED30028358) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Si:ch211-193k19.1 (SMED30028358) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Si:ch211-193k19.1 (SMED30028358) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30028358

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30028358h1SMcG0009391 Contig38931uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30028358h1SMcG0009391 Contig38931newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30028358h1SMcG0009391 Contig16481uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30028358h1SMcG0009391 Contig16481newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
epidermisSMED30028358h1SMcG0009391 dd_Smed_v4_5457_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30028358h1SMcG0009391 dd_Smed_v4_5457_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30028358h1SMcG0009391 dd_Smed_v4_5457_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Si:ch211-193k19.1 vs. Ensembl Human
Match: KIAA0319L (KIAA0319 like [Source:HGNC Symbol;Acc:HGNC:30071])

HSP 1 Score: 63.929 bits (154), Expect = 1.297e-10
Identity = 25/55 (45.45%), Postives = 33/55 (60.00%), Query Frame = 2
Query:  419 LTFPLIRVETYICQNNCSGHGKCNTITRLCECDTFWTNSLIRGRFGDGRPNCDWS 583
            L F  + V T  CQ NCS HG C++ T+ C CD FW  + I+ +  DG  NC+WS
Sbjct:  312 LIFRALEVNTVTCQLNCSDHGHCDSFTKRCICDPFWMENFIKVQLRDGDSNCEWS 366          
BLAST of Si:ch211-193k19.1 vs. Ensembl Human
Match: KIAA0319L (KIAA0319 like [Source:HGNC Symbol;Acc:HGNC:30071])

HSP 1 Score: 63.5438 bits (153), Expect = 2.917e-10
Identity = 25/55 (45.45%), Postives = 33/55 (60.00%), Query Frame = 2
Query:  419 LTFPLIRVETYICQNNCSGHGKCNTITRLCECDTFWTNSLIRGRFGDGRPNCDWS 583
            L F  + V T  CQ NCS HG C++ T+ C CD FW  + I+ +  DG  NC+WS
Sbjct:  875 LIFRALEVNTVTCQLNCSDHGHCDSFTKRCICDPFWMENFIKVQLRDGDSNCEWS 929          
BLAST of Si:ch211-193k19.1 vs. Ensembl Human
Match: KIAA0319L (KIAA0319 like [Source:HGNC Symbol;Acc:HGNC:30071])

HSP 1 Score: 63.1586 bits (152), Expect = 3.087e-10
Identity = 25/55 (45.45%), Postives = 33/55 (60.00%), Query Frame = 2
Query:  419 LTFPLIRVETYICQNNCSGHGKCNTITRLCECDTFWTNSLIRGRFGDGRPNCDWS 583
            L F  + V T  CQ NCS HG C++ T+ C CD FW  + I+ +  DG  NC+WS
Sbjct:  875 LIFRALEVNTVTCQLNCSDHGHCDSFTKRCICDPFWMENFIKVQLRDGDSNCEWS 929          
BLAST of Si:ch211-193k19.1 vs. Ensembl Human
Match: KIAA0319 (KIAA0319 [Source:HGNC Symbol;Acc:HGNC:21580])

HSP 1 Score: 60.077 bits (144), Expect = 2.537e-9
Identity = 24/55 (43.64%), Postives = 33/55 (60.00%), Query Frame = 2
Query:  419 LTFPLIRVETYICQNNCSGHGKCNTITRLCECDTFWTNSLIRGRFGDGRPNCDWS 583
            L F ++RV+T  C   CSGHG C+ +T+ C C   W  +LI+    DG  NC+WS
Sbjct:  312 LLFKVLRVDTAGCLLKCSGHGHCDPLTKRCICSHLWMENLIQRYIWDGESNCEWS 366          
BLAST of Si:ch211-193k19.1 vs. Ensembl Human
Match: KIAA0319 (KIAA0319 [Source:HGNC Symbol;Acc:HGNC:21580])

HSP 1 Score: 60.077 bits (144), Expect = 3.091e-9
Identity = 24/55 (43.64%), Postives = 33/55 (60.00%), Query Frame = 2
Query:  419 LTFPLIRVETYICQNNCSGHGKCNTITRLCECDTFWTNSLIRGRFGDGRPNCDWS 583
            L F ++RV+T  C   CSGHG C+ +T+ C C   W  +LI+    DG  NC+WS
Sbjct:  856 LLFKVLRVDTAGCLLKCSGHGHCDPLTKRCICSHLWMENLIQRYIWDGESNCEWS 910          
BLAST of Si:ch211-193k19.1 vs. Ensembl Fly
Match: CG7565 (gene:FBgn0035833 transcript:FBtr0076738)

HSP 1 Score: 61.6178 bits (148), Expect = 5.678e-10
Identity = 30/75 (40.00%), Postives = 44/75 (58.67%), Query Frame = 2
Query:  362 MDALKVLEAL-NEVRHDSLVLTFPLIRVETYICQNNCSGHGKCNTITRLCECDTFWTNSLIRGRFGDGRPNCDWS 583
            +D L+V   L  +++ D+ +L    + + T +CQ++CSGHG CN ITR C C+ FW  S     F +   NCDWS
Sbjct:  876 LDGLQVERQLRTQLQKDASILGAFAVDIRTSVCQSDCSGHGSCNPITRACICEAFWMPS-AGYFFNNQEANCDWS 949          
BLAST of Si:ch211-193k19.1 vs. Ensembl Zebrafish
Match: si:ch211-193k19.1 (si:ch211-193k19.1 [Source:ZFIN;Acc:ZDB-GENE-060503-110])

HSP 1 Score: 71.2478 bits (173), Expect = 4.849e-13
Identity = 29/55 (52.73%), Postives = 35/55 (63.64%), Query Frame = 2
Query:  419 LTFPLIRVETYICQNNCSGHGKCNTITRLCECDTFWTNSLIRGRFGDGRPNCDWS 583
            L F   RV+T ICQ NCSGHG+C++ TR C C  FW  +L    FGD   NC+WS
Sbjct:  791 LIFKARRVDTVICQLNCSGHGECDSFTRRCVCHLFWMENLFSTYFGDAESNCEWS 845          
BLAST of Si:ch211-193k19.1 vs. Ensembl Zebrafish
Match: si:ch211-193k19.1 (si:ch211-193k19.1 [Source:ZFIN;Acc:ZDB-GENE-060503-110])

HSP 1 Score: 67.3958 bits (163), Expect = 9.489e-12
Identity = 28/55 (50.91%), Postives = 34/55 (61.82%), Query Frame = 2
Query:  419 LTFPLIRVETYICQNNCSGHGKCNTITRLCECDTFWTNSLIRGRFGDGRPNCDWS 583
            L F   RV+T ICQ NCSGHG+C++ TR C C  FW  +L    FGD   NC+ S
Sbjct:  642 LIFKARRVDTVICQLNCSGHGECDSFTRRCVCHLFWMENLFSTYFGDAESNCEGS 696          
BLAST of Si:ch211-193k19.1 vs. Ensembl Zebrafish
Match: CT485618.1 (pep chromosome:GRCz11:CHR_ALT_CTG16_1_18:36918990:36930839:1 gene:ENSDARG00000110313.1 transcript:ENSDART00000187692.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CT485618.1)

HSP 1 Score: 65.4698 bits (158), Expect = 2.796e-11
Identity = 28/62 (45.16%), Postives = 37/62 (59.68%), Query Frame = 2
Query:  398 VRHDSLVLTFPLIRVETYICQNNCSGHGKCNTITRLCECDTFWTNSLIRGRFGDGRPNCDWS 583
            +R  S  L F ++RV+T +C   CSG G+C+ IT+ C CD  W  + IR    DG  NCDWS
Sbjct:  302 LREKSDFLLFRVLRVDTVMCLLLCSGRGQCDPITKSCSCDPLWMENPIRLFLDDGESNCDWS 363          
BLAST of Si:ch211-193k19.1 vs. Ensembl Zebrafish
Match: si:ch73-215d9.1 (si:ch73-215d9.1 [Source:ZFIN;Acc:ZDB-GENE-100922-40])

HSP 1 Score: 65.4698 bits (158), Expect = 4.436e-11
Identity = 28/62 (45.16%), Postives = 37/62 (59.68%), Query Frame = 2
Query:  398 VRHDSLVLTFPLIRVETYICQNNCSGHGKCNTITRLCECDTFWTNSLIRGRFGDGRPNCDWS 583
            +R  S  L F ++RV+T +C   CSG G+C+ IT+ C CD  W  + IR    DG  NCDWS
Sbjct:  865 LREKSDFLLFRVLRVDTVMCLLLCSGRGQCDPITKSCSCDPLWMENPIRLFIDDGESNCDWS 926          
BLAST of Si:ch211-193k19.1 vs. Ensembl Zebrafish
Match: si:ch73-215d9.1 (si:ch73-215d9.1 [Source:ZFIN;Acc:ZDB-GENE-100922-40])

HSP 1 Score: 65.0846 bits (157), Expect = 4.658e-11
Identity = 28/62 (45.16%), Postives = 37/62 (59.68%), Query Frame = 2
Query:  398 VRHDSLVLTFPLIRVETYICQNNCSGHGKCNTITRLCECDTFWTNSLIRGRFGDGRPNCDWS 583
            +R  S  L F ++RV+T +C   CSG G+C+ IT+ C CD  W  + IR    DG  NCDWS
Sbjct:  865 LREKSDFLLFRVLRVDTVMCLLLCSGRGQCDPITKSCSCDPLWMENPIRLFIDDGESNCDWS 926          
BLAST of Si:ch211-193k19.1 vs. Ensembl Xenopus
Match: KIAA0319L (kiaa0319 like [Source:NCBI gene;Acc:100494286])

HSP 1 Score: 80.4925 bits (197), Expect = 5.860e-16
Identity = 31/61 (50.82%), Postives = 41/61 (67.21%), Query Frame = 2
Query:  401 RHDSLVLTFPLIRVETYICQNNCSGHGKCNTITRLCECDTFWTNSLIRGRFGDGRPNCDWS 583
            +  S  L F  + ++T+ CQ NCS HG CN++T+ C CD FW  +LIR +FGDG  NCDWS
Sbjct:  597 KQQSDFLIFKAMEIDTFTCQLNCSFHGHCNSLTKRCICDPFWMENLIRRQFGDGESNCDWS 657          
BLAST of Si:ch211-193k19.1 vs. Ensembl Xenopus
Match: KIAA0319L (kiaa0319 like [Source:NCBI gene;Acc:100494286])

HSP 1 Score: 80.1073 bits (196), Expect = 8.828e-16
Identity = 31/61 (50.82%), Postives = 41/61 (67.21%), Query Frame = 2
Query:  401 RHDSLVLTFPLIRVETYICQNNCSGHGKCNTITRLCECDTFWTNSLIRGRFGDGRPNCDWS 583
            +  S  L F  + ++T+ CQ NCS HG CN++T+ C CD FW  +LIR +FGDG  NCDWS
Sbjct:  774 KQQSDFLIFKAMEIDTFTCQLNCSFHGHCNSLTKRCICDPFWMENLIRRQFGDGESNCDWS 834          
BLAST of Si:ch211-193k19.1 vs. Ensembl Xenopus
Match: KIAA0319L (kiaa0319 like [Source:NCBI gene;Acc:100494286])

HSP 1 Score: 80.1073 bits (196), Expect = 9.187e-16
Identity = 31/61 (50.82%), Postives = 41/61 (67.21%), Query Frame = 2
Query:  401 RHDSLVLTFPLIRVETYICQNNCSGHGKCNTITRLCECDTFWTNSLIRGRFGDGRPNCDWS 583
            +  S  L F  + ++T+ CQ NCS HG CN++T+ C CD FW  +LIR +FGDG  NCDWS
Sbjct:  763 KQQSDFLIFKAMEIDTFTCQLNCSFHGHCNSLTKRCICDPFWMENLIRRQFGDGESNCDWS 823          
BLAST of Si:ch211-193k19.1 vs. Ensembl Xenopus
Match: KIAA0319L (kiaa0319 like [Source:NCBI gene;Acc:100494286])

HSP 1 Score: 80.1073 bits (196), Expect = 9.432e-16
Identity = 31/61 (50.82%), Postives = 41/61 (67.21%), Query Frame = 2
Query:  401 RHDSLVLTFPLIRVETYICQNNCSGHGKCNTITRLCECDTFWTNSLIRGRFGDGRPNCDWS 583
            +  S  L F  + ++T+ CQ NCS HG CN++T+ C CD FW  +LIR +FGDG  NCDWS
Sbjct:  736 KQQSDFLIFKAMEIDTFTCQLNCSFHGHCNSLTKRCICDPFWMENLIRRQFGDGESNCDWS 796          
BLAST of Si:ch211-193k19.1 vs. Ensembl Xenopus
Match: KIAA0319L (kiaa0319 like [Source:NCBI gene;Acc:100494286])

HSP 1 Score: 80.1073 bits (196), Expect = 9.639e-16
Identity = 31/61 (50.82%), Postives = 41/61 (67.21%), Query Frame = 2
Query:  401 RHDSLVLTFPLIRVETYICQNNCSGHGKCNTITRLCECDTFWTNSLIRGRFGDGRPNCDWS 583
            +  S  L F  + ++T+ CQ NCS HG CN++T+ C CD FW  +LIR +FGDG  NCDWS
Sbjct:  770 KQQSDFLIFKAMEIDTFTCQLNCSFHGHCNSLTKRCICDPFWMENLIRRQFGDGESNCDWS 830          
BLAST of Si:ch211-193k19.1 vs. Ensembl Mouse
Match: AU040320 (expressed sequence AU040320 [Source:MGI Symbol;Acc:MGI:2140475])

HSP 1 Score: 63.929 bits (154), Expect = 1.574e-10
Identity = 24/55 (43.64%), Postives = 33/55 (60.00%), Query Frame = 2
Query:  419 LTFPLIRVETYICQNNCSGHGKCNTITRLCECDTFWTNSLIRGRFGDGRPNCDWS 583
            L F  + + T  CQ NCS HG C++ T+ C CD FW  + I+ +  DG  NC+WS
Sbjct:  874 LIFRALEISTVTCQLNCSDHGHCDSFTKRCVCDPFWMENFIKVQLRDGDSNCEWS 928          
BLAST of Si:ch211-193k19.1 vs. Ensembl Mouse
Match: AU040320 (expressed sequence AU040320 [Source:MGI Symbol;Acc:MGI:2140475])

HSP 1 Score: 63.1586 bits (152), Expect = 2.149e-10
Identity = 24/55 (43.64%), Postives = 33/55 (60.00%), Query Frame = 2
Query:  419 LTFPLIRVETYICQNNCSGHGKCNTITRLCECDTFWTNSLIRGRFGDGRPNCDWS 583
            L F  + + T  CQ NCS HG C++ T+ C CD FW  + I+ +  DG  NC+WS
Sbjct:  874 LIFRALEISTVTCQLNCSDHGHCDSFTKRCVCDPFWMENFIKVQLRDGDSNCEWS 928          
BLAST of Si:ch211-193k19.1 vs. Ensembl Mouse
Match: AU040320 (expressed sequence AU040320 [Source:MGI Symbol;Acc:MGI:2140475])

HSP 1 Score: 63.1586 bits (152), Expect = 2.149e-10
Identity = 24/55 (43.64%), Postives = 33/55 (60.00%), Query Frame = 2
Query:  419 LTFPLIRVETYICQNNCSGHGKCNTITRLCECDTFWTNSLIRGRFGDGRPNCDWS 583
            L F  + + T  CQ NCS HG C++ T+ C CD FW  + I+ +  DG  NC+WS
Sbjct:  874 LIFRALEISTVTCQLNCSDHGHCDSFTKRCVCDPFWMENFIKVQLRDGDSNCEWS 928          
BLAST of Si:ch211-193k19.1 vs. Ensembl Mouse
Match: D130043K22Rik (RIKEN cDNA D130043K22 gene [Source:MGI Symbol;Acc:MGI:3036268])

HSP 1 Score: 60.4622 bits (145), Expect = 2.037e-9
Identity = 25/55 (45.45%), Postives = 33/55 (60.00%), Query Frame = 2
Query:  419 LTFPLIRVETYICQNNCSGHGKCNTITRLCECDTFWTNSLIRGRFGDGRPNCDWS 583
            L F ++RV+T  C   CSGHG C+ IT+ C C   W  +LI+    DG  NC+WS
Sbjct:  910 LLFKVLRVDTAGCLLKCSGHGHCDPITKRCICSQLWMENLIQRYMWDGESNCEWS 964          
BLAST of Si:ch211-193k19.1 vs. UniProt/SwissProt
Match: sp|Q8K135|K319L_MOUSE (Dyslexia-associated protein KIAA0319-like protein OS=Mus musculus OX=10090 GN=Kiaa0319l PE=1 SV=1)

HSP 1 Score: 63.929 bits (154), Expect = 1.101e-9
Identity = 24/55 (43.64%), Postives = 33/55 (60.00%), Query Frame = 2
Query:  419 LTFPLIRVETYICQNNCSGHGKCNTITRLCECDTFWTNSLIRGRFGDGRPNCDWS 583
            L F  + + T  CQ NCS HG C++ T+ C CD FW  + I+ +  DG  NC+WS
Sbjct:  874 LIFRALEISTVTCQLNCSDHGHCDSFTKRCVCDPFWMENFIKVQLRDGDSNCEWS 928          
BLAST of Si:ch211-193k19.1 vs. UniProt/SwissProt
Match: sp|Q8IZA0|K319L_HUMAN (Dyslexia-associated protein KIAA0319-like protein OS=Homo sapiens OX=9606 GN=KIAA0319L PE=1 SV=2)

HSP 1 Score: 63.5438 bits (153), Expect = 1.401e-9
Identity = 25/55 (45.45%), Postives = 33/55 (60.00%), Query Frame = 2
Query:  419 LTFPLIRVETYICQNNCSGHGKCNTITRLCECDTFWTNSLIRGRFGDGRPNCDWS 583
            L F  + V T  CQ NCS HG C++ T+ C CD FW  + I+ +  DG  NC+WS
Sbjct:  875 LIFRALEVNTVTCQLNCSDHGHCDSFTKRCICDPFWMENFIKVQLRDGDSNCEWS 929          
BLAST of Si:ch211-193k19.1 vs. UniProt/SwissProt
Match: sp|Q5RFR6|K319L_PONAB (Dyslexia-associated protein KIAA0319-like protein OS=Pongo abelii OX=9601 GN=Kiaa0319l PE=2 SV=1)

HSP 1 Score: 63.5438 bits (153), Expect = 1.413e-9
Identity = 24/55 (43.64%), Postives = 33/55 (60.00%), Query Frame = 2
Query:  419 LTFPLIRVETYICQNNCSGHGKCNTITRLCECDTFWTNSLIRGRFGDGRPNCDWS 583
            L F  + + T  CQ NCS HG C++ T+ C CD FW  + I+ +  DG  NC+WS
Sbjct:  875 LIFRALEINTVTCQLNCSDHGHCDSFTKRCICDPFWMENFIKVQLRDGESNCEWS 929          
BLAST of Si:ch211-193k19.1 vs. UniProt/SwissProt
Match: sp|Q5SZV5|K0319_MOUSE (Dyslexia-associated protein KIAA0319 homolog OS=Mus musculus OX=10090 GN=Kiaa0319 PE=1 SV=1)

HSP 1 Score: 60.4622 bits (145), Expect = 1.425e-8
Identity = 25/55 (45.45%), Postives = 33/55 (60.00%), Query Frame = 2
Query:  419 LTFPLIRVETYICQNNCSGHGKCNTITRLCECDTFWTNSLIRGRFGDGRPNCDWS 583
            L F ++RV+T  C   CSGHG C+ IT+ C C   W  +LI+    DG  NC+WS
Sbjct:  910 LLFKVLRVDTAGCLLKCSGHGHCDPITKRCICSQLWMENLIQRYMWDGESNCEWS 964          
BLAST of Si:ch211-193k19.1 vs. UniProt/SwissProt
Match: sp|Q5VV43|K0319_HUMAN (Dyslexia-associated protein KIAA0319 OS=Homo sapiens OX=9606 GN=KIAA0319 PE=1 SV=1)

HSP 1 Score: 60.077 bits (144), Expect = 1.744e-8
Identity = 24/55 (43.64%), Postives = 33/55 (60.00%), Query Frame = 2
Query:  419 LTFPLIRVETYICQNNCSGHGKCNTITRLCECDTFWTNSLIRGRFGDGRPNCDWS 583
            L F ++RV+T  C   CSGHG C+ +T+ C C   W  +LI+    DG  NC+WS
Sbjct:  901 LLFKVLRVDTAGCLLKCSGHGHCDPLTKRCICSHLWMENLIQRYIWDGESNCEWS 955          
BLAST of Si:ch211-193k19.1 vs. TrEMBL
Match: A0A482XM17 (Uncharacterized protein OS=Laodelphax striatellus OX=195883 GN=LSTR_LSTR012002 PE=4 SV=1)

HSP 1 Score: 85.5001 bits (210), Expect = 2.686e-14
Identity = 45/128 (35.16%), Postives = 66/128 (51.56%), Query Frame = 2
Query:  200 TNSISILFYVTLHERSSSSFPTVTKNQVTNENPLSKSVVETKMNDKTTLPKLTNMDALKVLEALNEVRHDSLVLTFPLIRVETYICQNNCSGHGKCNTITRLCECDTFWTNSLIRGRFGDGRPNCDWS 583
            ++S+ +   + LH+ +S    T+  +  T    L   V   + +   + P L     L V    +++  DS++L   +  ++T ICQNNCSGHG C   TRLC C+ FW   L R  FGDG  NCDWS
Sbjct:  696 SDSVIMKLGLLLHDAASLVVRTLRADLATGRAVL---VFFVRASASASAPPLAG--PLVVTTLKHKLAQDSVLLQLSVANIQTAICQNNCSGHGVCEQETRLCLCEAFWMQDLFRKYFGDGDSNCDWS 818          
BLAST of Si:ch211-193k19.1 vs. TrEMBL
Match: A0A1B6MA64 (PKD domain-containing protein (Fragment) OS=Graphocephala atropunctata OX=36148 GN=g.31924 PE=4 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 2.927e-14
Identity = 40/90 (44.44%), Postives = 53/90 (58.89%), Query Frame = 2
Query:  314 VETKMNDKTTLPKLTNMDALKVLEALNEVRHDSLVLTFPLIRVETYICQNNCSGHGKCNTITRLCECDTFWTNSLIRGRFGDGRPNCDWS 583
            VET  N    LP  T +  LK     +++  DS++L   +  ++T +CQNNCSGHG C+  TR C C+ FW   L+R  FGDG  NCDWS
Sbjct:  576 VETARN---ALPGPTVVRTLK-----HKLAQDSVLLQLSVTNIQTTVCQNNCSGHGVCDQATRQCMCEAFWMQDLLRKHFGDGDSNCDWS 657          
BLAST of Si:ch211-193k19.1 vs. TrEMBL
Match: A0A1W3JLY7 (dyslexia-associated protein KIAA0319-like protein OS=Ciona intestinalis OX=7719 GN=LOC100175717 PE=4 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 4.041e-14
Identity = 36/80 (45.00%), Postives = 51/80 (63.75%), Query Frame = 2
Query:  347 PKLTNMDALKVLEALN-EVRHDSLVLTFPLIRVETYICQNNCSGHGKCNTITRLCECDTFWTNSLIRGRFGDGRPNCDWS 583
            P  T + A+ V+E LN +    S V    ++ V+TYIC+N CS HGKC++ ++ C+CD FW    +R  FGDG+ NCDWS
Sbjct:  650 PDRTFLSAINVVETLNSKFGSSSTVSDVEVLLVDTYICENKCSNHGKCHSGSKQCQCDVFWMQDFLRVYFGDGKRNCDWS 729          
BLAST of Si:ch211-193k19.1 vs. TrEMBL
Match: F6U144 (Uncharacterized protein OS=Ciona intestinalis OX=7719 PE=4 SV=2)

HSP 1 Score: 84.7297 bits (208), Expect = 4.175e-14
Identity = 36/80 (45.00%), Postives = 51/80 (63.75%), Query Frame = 2
Query:  347 PKLTNMDALKVLEALN-EVRHDSLVLTFPLIRVETYICQNNCSGHGKCNTITRLCECDTFWTNSLIRGRFGDGRPNCDWS 583
            P  T + A+ V+E LN +    S V    ++ V+TYIC+N CS HGKC++ ++ C+CD FW    +R  FGDG+ NCDWS
Sbjct:  553 PDRTFLSAINVVETLNSKFGSSSTVSDVEVLLVDTYICENKCSNHGKCHSGSKQCQCDVFWMQDFLRVYFGDGKRNCDWS 632          
BLAST of Si:ch211-193k19.1 vs. TrEMBL
Match: A0A2A3EKI6 (Dyslexia-associated protein OS=Apis cerana cerana OX=94128 GN=APICC_09549 PE=4 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 4.777e-14
Identity = 37/75 (49.33%), Postives = 50/75 (66.67%), Query Frame = 2
Query:  362 MDALKVLEALNE-VRHDSLVLTFPLIRVETYICQNNCSGHGKCNTITRLCECDTFWTNSLIRGRFGDGRPNCDWS 583
            M   +V++ L E +R DS +L   +  ++T ICQNNCSGHG C+  TRLC C+ FW  +LI+  FG+G  NCDWS
Sbjct:  770 MHGPEVVKRLKEKLRQDSGLLQLSVANIDTAICQNNCSGHGVCDQETRLCMCEAFWMQNLIQKYFGNGDSNCDWS 844          
BLAST of Si:ch211-193k19.1 vs. Ensembl Cavefish
Match: si:ch211-193k19.1 (KIAA0319 like [Source:NCBI gene;Acc:103041131])

HSP 1 Score: 68.9366 bits (167), Expect = 2.474e-12
Identity = 27/53 (50.94%), Postives = 34/53 (64.15%), Query Frame = 2
Query:  425 FPLIRVETYICQNNCSGHGKCNTITRLCECDTFWTNSLIRGRFGDGRPNCDWS 583
            F   RV+T ICQ NCSGHG+C++ TR C C  FW  + IR +  D   NC+WS
Sbjct:  806 FKAQRVDTVICQLNCSGHGECDSFTRRCVCHPFWMENFIRTQLQDAESNCEWS 858          
BLAST of Si:ch211-193k19.1 vs. Ensembl Cavefish
Match: si:ch73-215d9.1 (dyslexia-associated protein KIAA0319 [Source:NCBI gene;Acc:103036464])

HSP 1 Score: 58.9214 bits (141), Expect = 3.890e-9
Identity = 23/55 (41.82%), Postives = 32/55 (58.18%), Query Frame = 2
Query:  419 LTFPLIRVETYICQNNCSGHGKCNTITRLCECDTFWTNSLIRGRFGDGRPNCDWS 583
            L F ++RV+T +C   CSG G+C+ ++R C CD  W  +  R    D   NCDWS
Sbjct:  884 LLFKVLRVDTVMCLLLCSGRGQCDPVSRSCSCDPLWMENPFRRFLDDNESNCDWS 938          
BLAST of Si:ch211-193k19.1 vs. Ensembl Cavefish
Match: si:ch73-215d9.1 (dyslexia-associated protein KIAA0319 [Source:NCBI gene;Acc:103036464])

HSP 1 Score: 58.9214 bits (141), Expect = 3.890e-9
Identity = 23/55 (41.82%), Postives = 32/55 (58.18%), Query Frame = 2
Query:  419 LTFPLIRVETYICQNNCSGHGKCNTITRLCECDTFWTNSLIRGRFGDGRPNCDWS 583
            L F ++RV+T +C   CSG G+C+ ++R C CD  W  +  R    D   NCDWS
Sbjct:  884 LLFKVLRVDTVMCLLLCSGRGQCDPVSRSCSCDPLWMENPFRRFLDDNESNCDWS 938          
BLAST of Si:ch211-193k19.1 vs. Ensembl Sea Lamprey
Match: si:ch211-193k19.1 (si:ch211-193k19.1 [Source:ZFIN;Acc:ZDB-GENE-060503-110])

HSP 1 Score: 79.337 bits (194), Expect = 2.038e-16
Identity = 32/75 (42.67%), Postives = 49/75 (65.33%), Query Frame = 2
Query:  359 NMDALKVLEALNEVRHDSLVLTFPLIRVETYICQNNCSGHGKCNTITRLCECDTFWTNSLIRGRFGDGRPNCDWS 583
             +D  ++L  L + R  + +L F  +RV+T++CQ  CSGHG+C++ T+ C C  FW  ++IR + GDG  NCDWS
Sbjct:  553 GVDVARMLRRLLQ-REKTNLLAFRTLRVDTFVCQLACSGHGRCDSFTKRCTCFPFWMENVIRTQLGDGESNCDWS 626          
BLAST of Si:ch211-193k19.1 vs. Ensembl Nematostella
Match: EDO42871 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0H0])

HSP 1 Score: 75.8702 bits (185), Expect = 4.860e-15
Identity = 31/74 (41.89%), Postives = 44/74 (59.46%), Query Frame = 2
Query:  365 DALKVLEALNE-VRHDSLVLTFPLIRVETYICQNNCSGHGKCNTITRLCECDTFWTNSLIRGRFGDGRPNCDWS 583
            D   V E L E + ++     F +++VE YIC+NNCS HG C+  T+LC C++FW   + +  FG    NCDWS
Sbjct:  551 DGQAVAETLKEKIENEEGFFEFRMLKVEPYICRNNCSFHGYCDRSTKLCVCESFWMQDIFKSSFGAKESNCDWS 624          
BLAST of Si:ch211-193k19.1 vs. Ensembl Medaka
Match: si:ch73-215d9.1 (dyslexia-associated protein KIAA0319 homolog [Source:NCBI gene;Acc:101173681])

HSP 1 Score: 67.3958 bits (163), Expect = 7.106e-12
Identity = 28/59 (47.46%), Postives = 37/59 (62.71%), Query Frame = 2
Query:  398 VRHDSLVLTFPLIRVETYICQNNCSGHGKCNTITRLCECDTFWTNSLIRGRFGDGRPNC 574
            +R  S  L F  +RV+  +C  +CSG G+C+ ITR C CD FWT +L+R   GDG  NC
Sbjct:  579 LRQRSSYLLFRALRVDAVVCFLSCSGRGQCDPITRQCGCDPFWTENLVRRYLGDGESNC 637          
BLAST of Si:ch211-193k19.1 vs. Ensembl Medaka
Match: si:ch73-215d9.1 (dyslexia-associated protein KIAA0319 homolog [Source:NCBI gene;Acc:101173681])

HSP 1 Score: 67.0106 bits (162), Expect = 9.300e-12
Identity = 28/59 (47.46%), Postives = 37/59 (62.71%), Query Frame = 2
Query:  398 VRHDSLVLTFPLIRVETYICQNNCSGHGKCNTITRLCECDTFWTNSLIRGRFGDGRPNC 574
            +R  S  L F  +RV+  +C  +CSG G+C+ ITR C CD FWT +L+R   GDG  NC
Sbjct:  562 LRQRSSYLLFRALRVDAVVCFLSCSGRGQCDPITRQCGCDPFWTENLVRRYLGDGESNC 620          
BLAST of Si:ch211-193k19.1 vs. Ensembl Medaka
Match: si:ch211-193k19.1 (KIAA0319 like [Source:NCBI gene;Acc:101168634])

HSP 1 Score: 65.855 bits (159), Expect = 2.344e-11
Identity = 29/72 (40.28%), Postives = 42/72 (58.33%), Query Frame = 2
Query:  368 ALKVLEALNEVRHDSLVLTFPLIRVETYICQNNCSGHGKCNTITRLCECDTFWTNSLIRGRFGDGRPNCDWS 583
            AL +   L + ++D L+  F   RV+T +CQ NCSGHG+C+  +R C C  FW  +  R +  D   NC+WS
Sbjct:  770 ALGLRNKLRKQKNDFLI--FKARRVDTIVCQLNCSGHGECDPFSRRCVCHPFWMENFFRVQLEDAESNCEWS 839          
BLAST of Si:ch211-193k19.1 vs. Ensembl Medaka
Match: si:ch73-215d9.1 (dyslexia-associated protein KIAA0319 homolog [Source:NCBI gene;Acc:101173681])

HSP 1 Score: 57.3806 bits (137), Expect = 8.137e-9
Identity = 22/41 (53.66%), Postives = 28/41 (68.29%), Query Frame = 2
Query:  452 ICQNNCSGHGKCNTITRLCECDTFWTNSLIRGRFGDGRPNC 574
            +C  +CSG G+C+ ITR C CD FWT +L+R   GDG  NC
Sbjct:  288 VCFLSCSGRGQCDPITRQCGCDPFWTENLVRRYLGDGESNC 328          
BLAST of Si:ch211-193k19.1 vs. Planmine SMEST
Match: SMESG000079575.1 (SMESG000079575.1)

HSP 1 Score: 406.371 bits (1043), Expect = 2.078e-135
Identity = 272/273 (99.63%), Postives = 272/273 (99.63%), Query Frame = 2
Query:  137 HVESDSSRVKIHLLKLETVPFTNSISILFYVTLHERSSSSFPTVTKNQVTNENPLSKSVVETKMNDKTTLPKLTNMDALKVLEALNEVRHDSLVLTFPLIRVETYICQNNCSGHGKCNTITRLCECDTFWTNSLIRGRFGDGRPNCDWSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHKYIRLNEYDPKYKIDPSLKFPKSLTNGIKSRLAPDKEIXXXXXXXXXXXXEGEETVFINNRNXXXXXXXXXXXXXNGQTQKNL 955
            HVESDSSRVKIHLLKLETVPFTNSISILFYVTLHERSSSSFPTVTKNQVTNEN LSKSVVETKMNDKTTLPKLTNMDALKVLEALNEVRHDSLVLTFPLIRVETYICQNNCSGHGKCNTITRLCECDTFWTNSLIRGRFGDGRPNCDWSIIYLVLFFIFIFLLLLGFIWIIIIIRKRKCKNKKVIKARKHKYIRLNEYDPKYKIDPSLKFPKSLTNGIKSRLAPDKEISNCDDSDSNLSSEGEETVFINNRNSAASSSLLSPPSANGQTQKNL
Sbjct:  574 HVESDSSRVKIHLLKLETVPFTNSISILFYVTLHERSSSSFPTVTKNQVTNENSLSKSVVETKMNDKTTLPKLTNMDALKVLEALNEVRHDSLVLTFPLIRVETYICQNNCSGHGKCNTITRLCECDTFWTNSLIRGRFGDGRPNCDWSIIYLVLFFIFIFLLLLGFIWIIIIIRKRKCKNKKVIKARKHKYIRLNEYDPKYKIDPSLKFPKSLTNGIKSRLAPDKEISNCDDSDSNLSSEGEETVFINNRNSAASSSLLSPPSANGQTQKNL 846          
BLAST of Si:ch211-193k19.1 vs. Planmine SMEST
Match: SMESG000079575.1 (SMESG000079575.1)

HSP 1 Score: 404.445 bits (1038), Expect = 8.874e-134
Identity = 272/273 (99.63%), Postives = 272/273 (99.63%), Query Frame = 2
Query:  137 HVESDSSRVKIHLLKLETVPFTNSISILFYVTLHERSSSSFPTVTKNQVTNENPLSKSVVETKMNDKTTLPKLTNMDALKVLEALNEVRHDSLVLTFPLIRVETYICQNNCSGHGKCNTITRLCECDTFWTNSLIRGRFGDGRPNCDWSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHKYIRLNEYDPKYKIDPSLKFPKSLTNGIKSRLAPDKEIXXXXXXXXXXXXEGEETVFINNRNXXXXXXXXXXXXXNGQTQKNL 955
            HVESDSSRVKIHLLKLETVPFTNSISILFYVTLHERSSSSFPTVTKNQVTNEN LSKSVVETKMNDKTTLPKLTNMDALKVLEALNEVRHDSLVLTFPLIRVETYICQNNCSGHGKCNTITRLCECDTFWTNSLIRGRFGDGRPNCDWSIIYLVLFFIFIFLLLLGFIWIIIIIRKRKCKNKKVIKARKHKYIRLNEYDPKYKIDPSLKFPKSLTNGIKSRLAPDKEISNCDDSDSNLSSEGEETVFINNRNSAASSSLLSPPSANGQTQKNL
Sbjct:  655 HVESDSSRVKIHLLKLETVPFTNSISILFYVTLHERSSSSFPTVTKNQVTNENSLSKSVVETKMNDKTTLPKLTNMDALKVLEALNEVRHDSLVLTFPLIRVETYICQNNCSGHGKCNTITRLCECDTFWTNSLIRGRFGDGRPNCDWSIIYLVLFFIFIFLLLLGFIWIIIIIRKRKCKNKKVIKARKHKYIRLNEYDPKYKIDPSLKFPKSLTNGIKSRLAPDKEISNCDDSDSNLSSEGEETVFINNRNSAASSSLLSPPSANGQTQKNL 927          
The following BLAST results are available for this feature:
BLAST of Si:ch211-193k19.1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KIAA0319L1.297e-1045.45KIAA0319 like [Source:HGNC Symbol;Acc:HGNC:30071][more]
KIAA0319L2.917e-1045.45KIAA0319 like [Source:HGNC Symbol;Acc:HGNC:30071][more]
KIAA0319L3.087e-1045.45KIAA0319 like [Source:HGNC Symbol;Acc:HGNC:30071][more]
KIAA03192.537e-943.64KIAA0319 [Source:HGNC Symbol;Acc:HGNC:21580][more]
KIAA03193.091e-943.64KIAA0319 [Source:HGNC Symbol;Acc:HGNC:21580][more]
back to top
BLAST of Si:ch211-193k19.1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Si:ch211-193k19.1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CG75655.678e-1040.00gene:FBgn0035833 transcript:FBtr0076738[more]
back to top
BLAST of Si:ch211-193k19.1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch211-193k19.14.849e-1352.73si:ch211-193k19.1 [Source:ZFIN;Acc:ZDB-GENE-060503... [more]
si:ch211-193k19.19.489e-1250.91si:ch211-193k19.1 [Source:ZFIN;Acc:ZDB-GENE-060503... [more]
CT485618.12.796e-1145.16pep chromosome:GRCz11:CHR_ALT_CTG16_1_18:36918990:... [more]
si:ch73-215d9.14.436e-1145.16si:ch73-215d9.1 [Source:ZFIN;Acc:ZDB-GENE-100922-4... [more]
si:ch73-215d9.14.658e-1145.16si:ch73-215d9.1 [Source:ZFIN;Acc:ZDB-GENE-100922-4... [more]
back to top
BLAST of Si:ch211-193k19.1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KIAA0319L5.860e-1650.82kiaa0319 like [Source:NCBI gene;Acc:100494286][more]
KIAA0319L8.828e-1650.82kiaa0319 like [Source:NCBI gene;Acc:100494286][more]
KIAA0319L9.187e-1650.82kiaa0319 like [Source:NCBI gene;Acc:100494286][more]
KIAA0319L9.432e-1650.82kiaa0319 like [Source:NCBI gene;Acc:100494286][more]
KIAA0319L9.639e-1650.82kiaa0319 like [Source:NCBI gene;Acc:100494286][more]
back to top
BLAST of Si:ch211-193k19.1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
AU0403201.574e-1043.64expressed sequence AU040320 [Source:MGI Symbol;Acc... [more]
AU0403202.149e-1043.64expressed sequence AU040320 [Source:MGI Symbol;Acc... [more]
AU0403202.149e-1043.64expressed sequence AU040320 [Source:MGI Symbol;Acc... [more]
D130043K22Rik2.037e-945.45RIKEN cDNA D130043K22 gene [Source:MGI Symbol;Acc:... [more]
back to top
BLAST of Si:ch211-193k19.1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8K135|K319L_MOUSE1.101e-943.64Dyslexia-associated protein KIAA0319-like protein ... [more]
sp|Q8IZA0|K319L_HUMAN1.401e-945.45Dyslexia-associated protein KIAA0319-like protein ... [more]
sp|Q5RFR6|K319L_PONAB1.413e-943.64Dyslexia-associated protein KIAA0319-like protein ... [more]
sp|Q5SZV5|K0319_MOUSE1.425e-845.45Dyslexia-associated protein KIAA0319 homolog OS=Mu... [more]
sp|Q5VV43|K0319_HUMAN1.744e-843.64Dyslexia-associated protein KIAA0319 OS=Homo sapie... [more]
back to top
BLAST of Si:ch211-193k19.1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A482XM172.686e-1435.16Uncharacterized protein OS=Laodelphax striatellus ... [more]
A0A1B6MA642.927e-1444.44PKD domain-containing protein (Fragment) OS=Grapho... [more]
A0A1W3JLY74.041e-1445.00dyslexia-associated protein KIAA0319-like protein ... [more]
F6U1444.175e-1445.00Uncharacterized protein OS=Ciona intestinalis OX=7... [more]
A0A2A3EKI64.777e-1449.33Dyslexia-associated protein OS=Apis cerana cerana ... [more]
back to top
BLAST of Si:ch211-193k19.1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
si:ch211-193k19.12.474e-1250.94KIAA0319 like [Source:NCBI gene;Acc:103041131][more]
si:ch73-215d9.13.890e-941.82dyslexia-associated protein KIAA0319 [Source:NCBI ... [more]
si:ch73-215d9.13.890e-941.82dyslexia-associated protein KIAA0319 [Source:NCBI ... [more]
back to top
BLAST of Si:ch211-193k19.1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
si:ch211-193k19.12.038e-1642.67si:ch211-193k19.1 [Source:ZFIN;Acc:ZDB-GENE-060503... [more]
back to top
BLAST of Si:ch211-193k19.1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Si:ch211-193k19.1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO428714.860e-1541.89Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Si:ch211-193k19.1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
si:ch73-215d9.17.106e-1247.46dyslexia-associated protein KIAA0319 homolog [Sour... [more]
si:ch73-215d9.19.300e-1247.46dyslexia-associated protein KIAA0319 homolog [Sour... [more]
si:ch211-193k19.12.344e-1140.28KIAA0319 like [Source:NCBI gene;Acc:101168634][more]
si:ch73-215d9.18.137e-953.66dyslexia-associated protein KIAA0319 homolog [Sour... [more]
back to top
BLAST of Si:ch211-193k19.1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000079575.12.078e-13599.63SMESG000079575.1[more]
SMESG000079575.18.874e-13499.63SMESG000079575.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30028358 ID=SMED30028358|Name=Si:ch211-193k19.1|organism=Schmidtea mediterranea sexual|type=transcript|length=1066bp
AATGCAAATTCAACGGACATGCGGGCCGCGCTTCATAGACAATTGAATAT
TTTGTTGTATTTTATGCTAATAAATTGTTTTACTGAATCCAAAAAAAAAT
ATCTTCATTAATAATCTCCAACTTATTATCCAGAAACATGTCGAGTCCGA
CTCATCTCGAGTCAAGATCCATTTATTAAAATTGGAAACAGTTCCTTTTA
CTAATAGTATCTCAATTCTTTTTTATGTGACTCTTCACGAGAGATCTTCG
TCTTCCTTTCCTACTGTAACAAAAAATCAAGTGACAAACGAAAATCCTTT
ATCCAAATCTGTAGTTGAAACTAAGATGAATGACAAAACTACTCTTCCCA
AACTCACTAATATGGATGCCTTAAAAGTGCTTGAAGCACTCAATGAAGTG
CGACATGATTCATTAGTATTAACATTTCCTCTTATACGAGTTGAAACTTA
CATCTGTCAAAACAATTGTTCTGGTCATGGTAAATGCAATACGATTACGA
GATTATGTGAATGTGATACCTTTTGGACAAATAGTCTCATCCGAGGCAGA
TTTGGTGATGGCCGACCGAATTGTGATTGGAGTATCATCTATTTGGTTTT
GTTTTTTATATTCATATTTCTCTTGCTACTTGGCTTTATTTGGATAATTA
TTATTATTCGAAAAAGAAAATGTAAAAACAAGAAAGTTATCAAAGCTCGG
AAGCATAAATATATCAGATTGAATGAATATGATCCGAAATATAAGATCGA
TCCTTCATTGAAGTTCCCAAAATCCTTGACAAACGGTATCAAATCGCGTC
TGGCACCGGACAAGGAAATCAGCAATTGTGATGATAGTGATTCCAATTTG
TCATCGGAGGGCGAGGAGACTGTGTTCATCAATAATCGCAACAGTGCTGC
CTCATCATCATTGCTCTCTCCTCCCAGTGCTAATGGACAAACTCAGAAAA
ATCTTTAACGAACATTATAAGATTATTTGTGATAATATTTTTTTGTAAAA
ATTTGTCTTTCGTGTTTTTGCTGAGGTTTATTTGGTATTTATCGATTCAT
TTCTGGTTTCATTTGA
back to top

protein sequence of SMED30028358-orf-1

>SMED30028358-orf-1 ID=SMED30028358-orf-1|Name=SMED30028358-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=211bp
MNDKTTLPKLTNMDALKVLEALNEVRHDSLVLTFPLIRVETYICQNNCSG
HGKCNTITRLCECDTFWTNSLIRGRFGDGRPNCDWSIIYLVLFFIFIFLL
LLGFIWIIIIIRKRKCKNKKVIKARKHKYIRLNEYDPKYKIDPSLKFPKS
LTNGIKSRLAPDKEISNCDDSDSNLSSEGEETVFINNRNSAASSSLLSPP
SANGQTQKNL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002032epidermal cell
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane