Eukaryotic translation initiation factor 4 gamma 3

Overview
NameEukaryotic translation initiation factor 4 gamma 3
Smed IDSMED30028354
Length (bp)2588
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Eukaryotic translation initiation factor 4 gamma 3 (SMED30028354) t-SNE clustered cells

Violin plots show distribution of expression levels for Eukaryotic translation initiation factor 4 gamma 3 (SMED30028354) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Eukaryotic translation initiation factor 4 gamma 3 (SMED30028354) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Eukaryotic translation initiation factor 4 gamma 3 (SMED30028354) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30028354

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30028354h1SMcG0004203 dd_Smed_v4_15446_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30028354h1SMcG0004203 dd_Smed_v4_15446_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Eukaryotic translation initiation factor 4 gamma 3 vs. Ensembl Human
Match: EIF4G3 (eukaryotic translation initiation factor 4 gamma 3 [Source:HGNC Symbol;Acc:HGNC:3298])

HSP 1 Score: 111.309 bits (277), Expect = 4.152e-24
Identity = 80/278 (28.78%), Postives = 142/278 (51.08%), Query Frame = 1
Query:  880 LAHHENGYLPPQLRQSEKDDLE----ANLKRNIKATLNKMTPENFDLCFNEISGYKLASKEEMAILTDIIFDKAIQEESYSQIYSTFSARMV--------KPGEKTSDYKSMLLQKCKAMFDKPLKTQTEEARIRWIEKIDNET-DERMKSLYAS-----------DTEEQVCKAKDKYFGNIRFISELFLQGVLMGRIVLHCVNGLLNQSDDQISMEGVCKILQVTGKKLE-EQHAVEVKKALDKMSILSKSDNLDLKTKFKLKDILDMKNRDWEMR 1638
            L   EN + P Q R S+ DD E      L R +++ LNK+TP+ F+    ++SG  + ++E +  + D++F+KAI E S+S  Y+     +V        KPG  T +++ +LL +C+  F+K              +K D++  +++ K L A+           + EE   KA+ +  GNI+FI ELF   +L   I+  CV  LL   D++ S+E +C++L   GK L+ E+    + +  ++M  + K      + +F L+D++D++  +W  R
Sbjct:  726 LKKAENAWKPSQKRDSQADDPENIKTQELFRKVRSILNKLTPQMFNQLMKQVSGLTVDTEERLKGVIDLVFEKAIDEPSFSVAYANMCRCLVTLKVPMADKPG-NTVNFRKLLLNRCQKEFEK--------------DKADDDVFEKKQKELEAASAPEERTRLHDELEEAKDKARRRSIGNIKFIGELFKLKMLTEAIMHDCVVKLLKNHDEE-SLECLCRLLTTIGKDLDFEKAKPRMDQYFNQMEKIVKERKTSSRIRFMLQDVIDLRLCNWVSR 987          
BLAST of Eukaryotic translation initiation factor 4 gamma 3 vs. Ensembl Human
Match: EIF4G3 (eukaryotic translation initiation factor 4 gamma 3 [Source:HGNC Symbol;Acc:HGNC:3298])

HSP 1 Score: 111.309 bits (277), Expect = 4.375e-24
Identity = 79/278 (28.42%), Postives = 141/278 (50.72%), Query Frame = 1
Query:  880 LAHHENGYLPPQLRQSEKDDLE----ANLKRNIKATLNKMTPENFDLCFNEISGYKLASKEEMAILTDIIFDKAIQEESYSQIYSTFSARMV--------KPGEKTSDYKSMLLQKCKAMFDKPLKTQTEEARIRWIEKIDNET-DERMKSLYASDTEEQVC-----------KAKDKYFGNIRFISELFLQGVLMGRIVLHCVNGLLNQSDDQISMEGVCKILQVTGKKLE-EQHAVEVKKALDKMSILSKSDNLDLKTKFKLKDILDMKNRDWEMR 1638
            L   EN + P Q R S+ DD E      L R +++ LNK+TP+ F+    ++SG  + ++E +  + D++F+KAI E S+S  Y+     +V        KPG  T +++ +LL +C+  F+K              +K D++  +++ K L A+   E+             KA+ +  GNI+FI ELF   +L   I+  CV  LL   D++ S+E +C++L   GK L+ E+    + +  ++M  + K      + +F L+D++D++  +W  R
Sbjct:  915 LKKAENAWKPSQKRDSQADDPENIKTQELFRKVRSILNKLTPQMFNQLMKQVSGLTVDTEERLKGVIDLVFEKAIDEPSFSVAYANMCRCLVTLKVPMADKPG-NTVNFRKLLLNRCQKEFEK--------------DKADDDVFEKKQKELEAASAPEERTRLHDELEEAKDKARRRSIGNIKFIGELFKLKMLTEAIMHDCVVKLLKNHDEE-SLECLCRLLTTIGKDLDFEKAKPRMDQYFNQMEKIVKERKTSSRIRFMLQDVIDLRLCNWVSR 1176          
BLAST of Eukaryotic translation initiation factor 4 gamma 3 vs. Ensembl Human
Match: EIF4G3 (eukaryotic translation initiation factor 4 gamma 3 [Source:HGNC Symbol;Acc:HGNC:3298])

HSP 1 Score: 110.923 bits (276), Expect = 4.565e-24
Identity = 79/278 (28.42%), Postives = 141/278 (50.72%), Query Frame = 1
Query:  880 LAHHENGYLPPQLRQSEKDDLE----ANLKRNIKATLNKMTPENFDLCFNEISGYKLASKEEMAILTDIIFDKAIQEESYSQIYSTFSARMV--------KPGEKTSDYKSMLLQKCKAMFDKPLKTQTEEARIRWIEKIDNET-DERMKSLYASDTEEQVC-----------KAKDKYFGNIRFISELFLQGVLMGRIVLHCVNGLLNQSDDQISMEGVCKILQVTGKKLE-EQHAVEVKKALDKMSILSKSDNLDLKTKFKLKDILDMKNRDWEMR 1638
            L   EN + P Q R S+ DD E      L R +++ LNK+TP+ F+    ++SG  + ++E +  + D++F+KAI E S+S  Y+     +V        KPG  T +++ +LL +C+  F+K              +K D++  +++ K L A+   E+             KA+ +  GNI+FI ELF   +L   I+  CV  LL   D++ S+E +C++L   GK L+ E+    + +  ++M  + K      + +F L+D++D++  +W  R
Sbjct:  762 LKKAENAWKPSQKRDSQADDPENIKTQELFRKVRSILNKLTPQMFNQLMKQVSGLTVDTEERLKGVIDLVFEKAIDEPSFSVAYANMCRCLVTLKVPMADKPG-NTVNFRKLLLNRCQKEFEK--------------DKADDDVFEKKQKELEAASAPEERTRLHDELEEAKDKARRRSIGNIKFIGELFKLKMLTEAIMHDCVVKLLKNHDEE-SLECLCRLLTTIGKDLDFEKAKPRMDQYFNQMEKIVKERKTSSRIRFMLQDVIDLRLCNWVSR 1023          
BLAST of Eukaryotic translation initiation factor 4 gamma 3 vs. Ensembl Human
Match: EIF4G3 (eukaryotic translation initiation factor 4 gamma 3 [Source:HGNC Symbol;Acc:HGNC:3298])

HSP 1 Score: 110.923 bits (276), Expect = 4.608e-24
Identity = 80/278 (28.78%), Postives = 142/278 (51.08%), Query Frame = 1
Query:  880 LAHHENGYLPPQLRQSEKDDLE----ANLKRNIKATLNKMTPENFDLCFNEISGYKLASKEEMAILTDIIFDKAIQEESYSQIYSTFSARMV--------KPGEKTSDYKSMLLQKCKAMFDKPLKTQTEEARIRWIEKIDNET-DERMKSLYAS-----------DTEEQVCKAKDKYFGNIRFISELFLQGVLMGRIVLHCVNGLLNQSDDQISMEGVCKILQVTGKKLE-EQHAVEVKKALDKMSILSKSDNLDLKTKFKLKDILDMKNRDWEMR 1638
            L   EN + P Q R S+ DD E      L R +++ LNK+TP+ F+    ++SG  + ++E +  + D++F+KAI E S+S  Y+     +V        KPG  T +++ +LL +C+  F+K              +K D++  +++ K L A+           + EE   KA+ +  GNI+FI ELF   +L   I+  CV  LL   D++ S+E +C++L   GK L+ E+    + +  ++M  + K      + +F L+D++D++  +W  R
Sbjct:  732 LKKAENAWKPSQKRDSQADDPENIKTQELFRKVRSILNKLTPQMFNQLMKQVSGLTVDTEERLKGVIDLVFEKAIDEPSFSVAYANMCRCLVTLKVPMADKPG-NTVNFRKLLLNRCQKEFEK--------------DKADDDVFEKKQKELEAASAPEERTRLHDELEEAKDKARRRSIGNIKFIGELFKLKMLTEAIMHDCVVKLLKNHDEE-SLECLCRLLTTIGKDLDFEKAKPRMDQYFNQMEKIVKERKTSSRIRFMLQDVIDLRLCNWVSR 993          
BLAST of Eukaryotic translation initiation factor 4 gamma 3 vs. Ensembl Human
Match: EIF4G3 (eukaryotic translation initiation factor 4 gamma 3 [Source:HGNC Symbol;Acc:HGNC:3298])

HSP 1 Score: 110.153 bits (274), Expect = 8.099e-24
Identity = 80/278 (28.78%), Postives = 142/278 (51.08%), Query Frame = 1
Query:  880 LAHHENGYLPPQLRQSEKDDLE----ANLKRNIKATLNKMTPENFDLCFNEISGYKLASKEEMAILTDIIFDKAIQEESYSQIYSTFSARMV--------KPGEKTSDYKSMLLQKCKAMFDKPLKTQTEEARIRWIEKIDNET-DERMKSLYAS-----------DTEEQVCKAKDKYFGNIRFISELFLQGVLMGRIVLHCVNGLLNQSDDQISMEGVCKILQVTGKKLE-EQHAVEVKKALDKMSILSKSDNLDLKTKFKLKDILDMKNRDWEMR 1638
            L   EN + P Q R S+ DD E      L R +++ LNK+TP+ F+    ++SG  + ++E +  + D++F+KAI E S+S  Y+     +V        KPG  T +++ +LL +C+  F+K              +K D++  +++ K L A+           + EE   KA+ +  GNI+FI ELF   +L   I+  CV  LL   D++ S+E +C++L   GK L+ E+    + +  ++M  + K      + +F L+D++D++  +W  R
Sbjct:  446 LKKAENAWKPSQKRDSQADDPENIKTQELFRKVRSILNKLTPQMFNQLMKQVSGLTVDTEERLKGVIDLVFEKAIDEPSFSVAYANMCRCLVTLKVPMADKPG-NTVNFRKLLLNRCQKEFEK--------------DKADDDVFEKKQKELEAASAPEERTRLHDELEEAKDKARRRSIGNIKFIGELFKLKMLTEAIMHDCVVKLLKNHDEE-SLECLCRLLTTIGKDLDFEKAKPRMDQYFNQMEKIVKERKTSSRIRFMLQDVIDLRLCNWVSR 707          
BLAST of Eukaryotic translation initiation factor 4 gamma 3 vs. Ensembl Fly
Match: eIF4G1 (gene:FBgn0023213 transcript:FBtr0112904)

HSP 1 Score: 98.2117 bits (243), Expect = 2.211e-20
Identity = 80/306 (26.14%), Postives = 155/306 (50.65%), Query Frame = 1
Query:  814 YINISCEEEIEMDWKRGSKIQKLAHHENGYLPPQLRQSEKDD-----LEAN-LKRNIKATLNKMTPENFDLCFNEISGYKLASKEEMAILTDIIFDKAIQEESYSQIYSTFSARMV------------KPGEKTSDYKSMLLQKCKAMFDKPLKTQT-EEARIRWI-EKIDNETDERMKSLYASDTEEQVCKAKDKYFGNIRFISELFLQGVLMGRIVLHCVNGLLNQSDDQISMEGVCKILQVTGKKLEE--------QHAVEVKKALDKM-SILSKSD----NLDLKTKFKLKDILDMKNRDWE 1632
            ++N+S  +++           KL+ +EN + P  L +S+ D      LE + L R ++  LNK+TPE FD    EI   K+ + +++  +  ++F+KAI E ++S  Y+    R+             +    ++ +++ LL K +  F + +   T +E +++ I +KI   TD   K+   +  EE+  K + +  G +RFI ELF   +L G+I+  C++ LLN   + + +E +CK+L   G K E+             ++K++ +M +I SK+D     +  + +F L+D++D++   W+
Sbjct:  961 HVNLSLNQDV-----------KLSENENAWRPRVLNKSDGDSDAKSALEKDELVRRVRGILNKLTPERFDTLVEEIIKLKIDTPDKVDEVIVLVFEKAIDEPNFSVSYARLCQRLAAEVKVIDERMESETKSNSAHFRNALLDKTEQEFTQNVSQSTAKEKKLQPIVDKIKKCTDANEKAELEAFLEEEERKIRRRSGGTVRFIGELFKISMLTGKIIYSCIDTLLNPHSEDM-LECLCKLLTTVGAKFEKTPVNSKDPSRCYSLEKSITRMQAIASKTDKDGARVSSRVRFMLQDVIDLRKNKWQ 1254          
BLAST of Eukaryotic translation initiation factor 4 gamma 3 vs. Ensembl Fly
Match: eIF4G1 (gene:FBgn0023213 transcript:FBtr0289951)

HSP 1 Score: 98.2117 bits (243), Expect = 2.250e-20
Identity = 80/306 (26.14%), Postives = 155/306 (50.65%), Query Frame = 1
Query:  814 YINISCEEEIEMDWKRGSKIQKLAHHENGYLPPQLRQSEKDD-----LEAN-LKRNIKATLNKMTPENFDLCFNEISGYKLASKEEMAILTDIIFDKAIQEESYSQIYSTFSARMV------------KPGEKTSDYKSMLLQKCKAMFDKPLKTQT-EEARIRWI-EKIDNETDERMKSLYASDTEEQVCKAKDKYFGNIRFISELFLQGVLMGRIVLHCVNGLLNQSDDQISMEGVCKILQVTGKKLEE--------QHAVEVKKALDKM-SILSKSD----NLDLKTKFKLKDILDMKNRDWE 1632
            ++N+S  +++           KL+ +EN + P  L +S+ D      LE + L R ++  LNK+TPE FD    EI   K+ + +++  +  ++F+KAI E ++S  Y+    R+             +    ++ +++ LL K +  F + +   T +E +++ I +KI   TD   K+   +  EE+  K + +  G +RFI ELF   +L G+I+  C++ LLN   + + +E +CK+L   G K E+             ++K++ +M +I SK+D     +  + +F L+D++D++   W+
Sbjct:  708 HVNLSLNQDV-----------KLSENENAWRPRVLNKSDGDSDAKSALEKDELVRRVRGILNKLTPERFDTLVEEIIKLKIDTPDKVDEVIVLVFEKAIDEPNFSVSYARLCQRLAAEVKVIDERMESETKSNSAHFRNALLDKTEQEFTQNVSQSTAKEKKLQPIVDKIKKCTDANEKAELEAFLEEEERKIRRRSGGTVRFIGELFKISMLTGKIIYSCIDTLLNPHSEDM-LECLCKLLTTVGAKFEKTPVNSKDPSRCYSLEKSITRMQAIASKTDKDGARVSSRVRFMLQDVIDLRKNKWQ 1001          
BLAST of Eukaryotic translation initiation factor 4 gamma 3 vs. Ensembl Fly
Match: eIF4G1 (gene:FBgn0023213 transcript:FBtr0089243)

HSP 1 Score: 98.2117 bits (243), Expect = 2.250e-20
Identity = 80/306 (26.14%), Postives = 155/306 (50.65%), Query Frame = 1
Query:  814 YINISCEEEIEMDWKRGSKIQKLAHHENGYLPPQLRQSEKDD-----LEAN-LKRNIKATLNKMTPENFDLCFNEISGYKLASKEEMAILTDIIFDKAIQEESYSQIYSTFSARMV------------KPGEKTSDYKSMLLQKCKAMFDKPLKTQT-EEARIRWI-EKIDNETDERMKSLYASDTEEQVCKAKDKYFGNIRFISELFLQGVLMGRIVLHCVNGLLNQSDDQISMEGVCKILQVTGKKLEE--------QHAVEVKKALDKM-SILSKSD----NLDLKTKFKLKDILDMKNRDWE 1632
            ++N+S  +++           KL+ +EN + P  L +S+ D      LE + L R ++  LNK+TPE FD    EI   K+ + +++  +  ++F+KAI E ++S  Y+    R+             +    ++ +++ LL K +  F + +   T +E +++ I +KI   TD   K+   +  EE+  K + +  G +RFI ELF   +L G+I+  C++ LLN   + + +E +CK+L   G K E+             ++K++ +M +I SK+D     +  + +F L+D++D++   W+
Sbjct:  708 HVNLSLNQDV-----------KLSENENAWRPRVLNKSDGDSDAKSALEKDELVRRVRGILNKLTPERFDTLVEEIIKLKIDTPDKVDEVIVLVFEKAIDEPNFSVSYARLCQRLAAEVKVIDERMESETKSNSAHFRNALLDKTEQEFTQNVSQSTAKEKKLQPIVDKIKKCTDANEKAELEAFLEEEERKIRRRSGGTVRFIGELFKISMLTGKIIYSCIDTLLNPHSEDM-LECLCKLLTTVGAKFEKTPVNSKDPSRCYSLEKSITRMQAIASKTDKDGARVSSRVRFMLQDVIDLRKNKWQ 1001          
BLAST of Eukaryotic translation initiation factor 4 gamma 3 vs. Ensembl Fly
Match: eIF4G2 (gene:FBgn0260634 transcript:FBtr0089623)

HSP 1 Score: 95.9005 bits (237), Expect = 1.127e-19
Identity = 76/300 (25.33%), Postives = 149/300 (49.67%), Query Frame = 1
Query:  817 INISCEEEIEMDWKRGSKIQKLAHHENGYLPPQLR-------QSEKDDLEANLKRNIKATLNKMTPENFDLCFNEISGYKLASKEEMAILTDIIFDKAIQEESYSQIYSTFSARMVK--PGEKTSDYKSMLLQKCKAMFDKPLKTQTEEAR--IRWIEKIDNETDERMKSLYASDTEEQVCKAKDKYFGNIRFISELFLQGVLMGRIVLHCVNGLLNQSDDQISMEGVCKILQVTGKKLEEQ--HAVEVKKALDKM-----SILSKSDN----------LDLKTKFKLKDILDMKNRDWE 1632
            + +S +EEI           KL+  EN + P  LR       Q E DD+E  LK+ ++  LNK+TP+NF++   E+S  K+ ++ +M  +  +IF+K I E +++  Y+ F   +      E  S + S L+ + +  F+  +     +++     +E+I+  +D   K+   ++ E+   + + + +G +RFI ELF    L    VL+CV  LL    ++  +E +CK+L   G  LE       +++  ++K+      I+++S            +  + +F ++D+LD++ R+W+
Sbjct: 1233 VQLSLKEEI-----------KLSECENAWQPGTLRRVSMAGGQDEDDDVEGVLKK-VRGILNKLTPDNFEVLLKEMSSIKMDNEAKMTNVMLLIFEKTISEPNFAPTYARFCKVLFHEIKAENKSLFTSSLITRIQHEFESNVNDANAKSKKLQPTMERINQCSDPAKKAELRAEMEDLEYQFRRRAWGTVRFIGELFKLQSLTNDRVLNCVESLLEHGCEE-KLEYMCKLLTTVGHLLESSLPEHYQLRDRIEKIFRRIQDIINRSRGTSHRQQVHIKISSRVRFMMQDVLDLRLRNWD 1519          
BLAST of Eukaryotic translation initiation factor 4 gamma 3 vs. Ensembl Fly
Match: eIF4G2 (gene:FBgn0260634 transcript:FBtr0344335)

HSP 1 Score: 95.9005 bits (237), Expect = 1.127e-19
Identity = 76/300 (25.33%), Postives = 149/300 (49.67%), Query Frame = 1
Query:  817 INISCEEEIEMDWKRGSKIQKLAHHENGYLPPQLR-------QSEKDDLEANLKRNIKATLNKMTPENFDLCFNEISGYKLASKEEMAILTDIIFDKAIQEESYSQIYSTFSARMVK--PGEKTSDYKSMLLQKCKAMFDKPLKTQTEEAR--IRWIEKIDNETDERMKSLYASDTEEQVCKAKDKYFGNIRFISELFLQGVLMGRIVLHCVNGLLNQSDDQISMEGVCKILQVTGKKLEEQ--HAVEVKKALDKM-----SILSKSDN----------LDLKTKFKLKDILDMKNRDWE 1632
            + +S +EEI           KL+  EN + P  LR       Q E DD+E  LK+ ++  LNK+TP+NF++   E+S  K+ ++ +M  +  +IF+K I E +++  Y+ F   +      E  S + S L+ + +  F+  +     +++     +E+I+  +D   K+   ++ E+   + + + +G +RFI ELF    L    VL+CV  LL    ++  +E +CK+L   G  LE       +++  ++K+      I+++S            +  + +F ++D+LD++ R+W+
Sbjct: 1233 VQLSLKEEI-----------KLSECENAWQPGTLRRVSMAGGQDEDDDVEGVLKK-VRGILNKLTPDNFEVLLKEMSSIKMDNEAKMTNVMLLIFEKTISEPNFAPTYARFCKVLFHEIKAENKSLFTSSLITRIQHEFESNVNDANAKSKKLQPTMERINQCSDPAKKAELRAEMEDLEYQFRRRAWGTVRFIGELFKLQSLTNDRVLNCVESLLEHGCEE-KLEYMCKLLTTVGHLLESSLPEHYQLRDRIEKIFRRIQDIINRSRGTSHRQQVHIKISSRVRFMMQDVLDLRLRNWD 1519          
BLAST of Eukaryotic translation initiation factor 4 gamma 3 vs. Ensembl Zebrafish
Match: eif4g3a (eukaryotic translation initiation factor 4 gamma, 3a [Source:ZFIN;Acc:ZDB-GENE-120810-2])

HSP 1 Score: 103.219 bits (256), Expect = 7.901e-22
Identity = 75/288 (26.04%), Postives = 144/288 (50.00%), Query Frame = 1
Query:  817 INISCEEEIEMD-----WKRGSKIQKLAHHENGYLPPQLRQSEKDDLEANLKRNIKATLNKMTPENFDLCFNEISGYKLASKEEMAILTDIIFDKAIQEESYSQIY-------STFSARMVKPGEKTSDYKSMLLQKCKAMFDKPLKTQTEEARI-RWIEKIDNETDERMKSLYASDTEEQVCKAKDKYFGNIRFISELFLQGVLMGRIVLHCVNGLLNQSDDQISMEGVCKILQVTGKKLE-EQHAVEVKKALDKMSILSKSDNLDLKTKFKLKDILDMKNRDWEMR 1638
            +N+S  +++++      WK G K + +A       P  +R  E       L R +++ LNK+TP+ F     +++   + ++E +  + D++F+KAI E S+S  Y       +T           T +++ +LL +C+  F+   + + ++  + R  ++ID+ T    K     + EE   KA+ +  GNI+FI ELF   +L   I+  CV  LL   DD+ S+E +C++L   GK L+ E+    + +  ++M  + K      + +F L+D++D++  +W  R
Sbjct:  837 VNLSVSDDVQLKKAENAWKPGMKREGVAED-----PETIRTQE-------LFRKVRSILNKLTPQMFHQLMKQVTDLTINTEERLKGVIDLVFEKAIDEPSFSVAYANMCRCLATLKVPTADKPNTTVNFRKLLLNRCQKEFE---RDKVDDVVLERKQKEIDSATSPTEKERLQEELEEAKDKARRRSTGNIKFIGELFKLKMLTEPIMHDCVVKLLKNHDDE-SLECLCRLLTTIGKDLDFEKAKPRMDQYFNQMEKIVKERKTSSRIRFMLQDVIDLRLHNWVSR 1108          
BLAST of Eukaryotic translation initiation factor 4 gamma 3 vs. Ensembl Zebrafish
Match: eif4g3a (eukaryotic translation initiation factor 4 gamma, 3a [Source:ZFIN;Acc:ZDB-GENE-120810-2])

HSP 1 Score: 102.064 bits (253), Expect = 1.612e-21
Identity = 72/267 (26.97%), Postives = 136/267 (50.94%), Query Frame = 1
Query:  877 KLAHHENGYLPPQLRQSEKDDLEA----NLKRNIKATLNKMTPENFDLCFNEISGYKLASKEEMAILTDIIFDKAIQEESYSQIYSTFSARMVKPGEKTSD-------YKSMLLQKCKAMFDKPLKTQTEEARI-RWIEKIDNETDERMKSLYASDTEEQVCKAKDKYFGNIRFISELFLQGVLMGRIVLHCVNGLLNQSDDQISMEGVCKILQVTGKKLE-EQHAVEVKKALDKMSILSKSDNLDLKTKFKLKDILDMKNRDWEMR 1638
            +L   EN + P   R+   +D E      L R +++ LNK+TP+ F     +++   + ++E +  + D++F+KAI E S+S  Y+     +      T+D       ++ +LL +C+  F+   + + ++  + R  ++ID+ T    K     + EE   KA+ +  GNI+FI ELF   +L   I+  CV  LL   DD+ S+E +C++L   GK L+ E+    + +  ++M  + K      + +F L+D++D++  +W  R
Sbjct:  451 QLKKAENAWKPGMKREGVAEDPETIRTQELFRKVRSILNKLTPQMFHQLMKQVTDLTINTEERLKGVIDLVFEKAIDEPSFSVAYANMCRCLATLKVPTADKPNTTVNFRKLLLNRCQKEFE---RDKVDDVVLERKQKEIDSATSPTEKERLQEELEEAKDKARRRSTGNIKFIGELFKLKMLTEPIMHDCVVKLLKNHDDE-SLECLCRLLTTIGKDLDFEKAKPRMDQYFNQMEKIVKERKTSSRIRFMLQDVIDLRLHNWVSR 713          
BLAST of Eukaryotic translation initiation factor 4 gamma 3 vs. Ensembl Zebrafish
Match: eif4g3a (eukaryotic translation initiation factor 4 gamma, 3a [Source:ZFIN;Acc:ZDB-GENE-120810-2])

HSP 1 Score: 102.064 bits (253), Expect = 1.728e-21
Identity = 72/267 (26.97%), Postives = 136/267 (50.94%), Query Frame = 1
Query:  877 KLAHHENGYLPPQLRQSEKDDLEA----NLKRNIKATLNKMTPENFDLCFNEISGYKLASKEEMAILTDIIFDKAIQEESYSQIYSTFSARMVKPGEKTSD-------YKSMLLQKCKAMFDKPLKTQTEEARI-RWIEKIDNETDERMKSLYASDTEEQVCKAKDKYFGNIRFISELFLQGVLMGRIVLHCVNGLLNQSDDQISMEGVCKILQVTGKKLE-EQHAVEVKKALDKMSILSKSDNLDLKTKFKLKDILDMKNRDWEMR 1638
            +L   EN + P   R+   +D E      L R +++ LNK+TP+ F     +++   + ++E +  + D++F+KAI E S+S  Y+     +      T+D       ++ +LL +C+  F+   + + ++  + R  ++ID+ T    K     + EE   KA+ +  GNI+FI ELF   +L   I+  CV  LL   DD+ S+E +C++L   GK L+ E+    + +  ++M  + K      + +F L+D++D++  +W  R
Sbjct:  454 QLKKAENAWKPGMKREGVAEDPETIRTQELFRKVRSILNKLTPQMFHQLMKQVTDLTINTEERLKGVIDLVFEKAIDEPSFSVAYANMCRCLATLKVPTADKPNTTVNFRKLLLNRCQKEFE---RDKVDDVVLERKQKEIDSATSPTEKERLQEELEEAKDKARRRSTGNIKFIGELFKLKMLTEPIMHDCVVKLLKNHDDE-SLECLCRLLTTIGKDLDFEKAKPRMDQYFNQMEKIVKERKTSSRIRFMLQDVIDLRLHNWVSR 716          
BLAST of Eukaryotic translation initiation factor 4 gamma 3 vs. Ensembl Zebrafish
Match: eif4g1a (eukaryotic translation initiation factor 4 gamma, 1a [Source:ZFIN;Acc:ZDB-GENE-070112-702])

HSP 1 Score: 98.9821 bits (245), Expect = 1.663e-20
Identity = 64/238 (26.89%), Postives = 125/238 (52.52%), Query Frame = 1
Query:  952 LKRNIKATLNKMTPENFDLCFNEISGYKLASKEEMAILTDIIFDKAIQEESYSQIYSTFSARMV--------KPGEKTSDYKSMLLQKCKAMFDKPLKTQTEEARIRWIEKIDNETDERMKSLYASDTEEQVCKAKDKYFGNIRFISELFLQGVLMGRIVLHCVNGLLNQSDDQISMEGVCKILQVTGKKLE-EQHAVEVKKALDKMSILSKSDNLDLKTKFKLKDILDMKNRDWEMR 1638
            L R +++ LNK+TP+ F     +++   + ++E +  + D+IF+KAI E ++S  Y+     ++        KPG  T +++ +LL +C+  F+K      +E   +  +++D  T+E  +     + ++   KA+ +  GNI+FI ELF   +L   I+  C+  LL   D+  S+E +C++L   GK L+ E+    + +   +M  + K      + +F L+D+LD++  +W  R
Sbjct:  779 LFRRVRSVLNKLTPQMFQQLMKQVTELAIDTEERLKGVIDLIFEKAISEPNFSVAYANMCRCLMGLKVPTSDKPG-VTVNFRKLLLNRCQKEFEK--DKDDDEIFEQKQKELDAATEEEERQRLNDELQDAKDKARKRSLGNIKFIGELFKLKMLTEPIMHDCIVKLLKNHDED-SLECLCRLLSTIGKDLDFEKAKPRMDQYFHQMEKIIKEKKTSSRIRFMLQDVLDLRKNNWVPR 1012          
BLAST of Eukaryotic translation initiation factor 4 gamma 3 vs. Ensembl Zebrafish
Match: eif4g1a (eukaryotic translation initiation factor 4 gamma, 1a [Source:ZFIN;Acc:ZDB-GENE-070112-702])

HSP 1 Score: 98.5969 bits (244), Expect = 1.811e-20
Identity = 64/238 (26.89%), Postives = 125/238 (52.52%), Query Frame = 1
Query:  952 LKRNIKATLNKMTPENFDLCFNEISGYKLASKEEMAILTDIIFDKAIQEESYSQIYSTFSARMV--------KPGEKTSDYKSMLLQKCKAMFDKPLKTQTEEARIRWIEKIDNETDERMKSLYASDTEEQVCKAKDKYFGNIRFISELFLQGVLMGRIVLHCVNGLLNQSDDQISMEGVCKILQVTGKKLE-EQHAVEVKKALDKMSILSKSDNLDLKTKFKLKDILDMKNRDWEMR 1638
            L R +++ LNK+TP+ F     +++   + ++E +  + D+IF+KAI E ++S  Y+     ++        KPG  T +++ +LL +C+  F+K      +E   +  +++D  T+E  +     + ++   KA+ +  GNI+FI ELF   +L   I+  C+  LL   D+  S+E +C++L   GK L+ E+    + +   +M  + K      + +F L+D+LD++  +W  R
Sbjct:  738 LFRRVRSVLNKLTPQMFQQLMKQVTELAIDTEERLKGVIDLIFEKAISEPNFSVAYANMCRCLMGLKVPTSDKPG-VTVNFRKLLLNRCQKEFEK--DKDDDEIFEQKQKELDAATEEEERQRLNDELQDAKDKARKRSLGNIKFIGELFKLKMLTEPIMHDCIVKLLKNHDED-SLECLCRLLSTIGKDLDFEKAKPRMDQYFHQMEKIIKEKKTSSRIRFMLQDVLDLRKNNWVPR 971          
BLAST of Eukaryotic translation initiation factor 4 gamma 3 vs. Ensembl Xenopus
Match: eif4g3 (eukaryotic translation initiation factor 4 gamma, 3 [Source:NCBI gene;Acc:100216088])

HSP 1 Score: 100.138 bits (248), Expect = 8.374e-21
Identity = 77/270 (28.52%), Postives = 138/270 (51.11%), Query Frame = 1
Query:  880 LAHHENGYLPPQLRQSEKDDLEA----NLKRNIKATLNKMTPENFDLCFNEISGYKLASKEEMAILTDIIFDKAIQEESYSQIY-------STFSARMV-KPGEKTSDYKSMLLQKCKAMFDKPLKTQTEEARIRWIEK----IDNETDERMKSLYASDTEEQVCKAKDKYFGNIRFISELFLQGVLMGRIVLHCVNGLLNQSDDQISMEGVCKILQVTGKKLE-EQHAVEVKKALDKMSILSKSDNLDLKTKFKLKDILDMKNRDWEMR 1638
            L   EN + P   R S  +D ++     L R +++ LNK+TP+ F+    +++   + ++E +  + D++F+KAI E S+S  Y       +T    M  KPG  T +++ +LL +C+  F+K      ++A     EK    ++  T    KS    + EE   KA+ +  GNI+FI ELF   +L   I+  CV  LL   D++ S+E +C++L   GK L+ E+    + +  ++M  + K      + +F L+D++D++  +W  R
Sbjct:  671 LKKSENAWKPSVKRDSLPEDPDSIRTQALFRKVRSILNKLTPQMFNQLMKQVTDLTVDTEERLKGVIDLVFEKAIDEPSFSVAYANMCRCLATLKVPMADKPG-STVNFRKLLLNRCQKEFEK------DKADDDVFEKKQKDLELATTPEEKSRLQDELEESKDKARRRSIGNIKFIGELFKLKMLTEAIMHDCVVKLLKNHDEE-SLECLCRLLTTIGKDLDFEKAKPRMDQYFNQMEKIVKERKTSSRIRFMLQDVIDLRLSNWVSR 932          
BLAST of Eukaryotic translation initiation factor 4 gamma 3 vs. Ensembl Xenopus
Match: eif4g3 (eukaryotic translation initiation factor 4 gamma, 3 [Source:NCBI gene;Acc:100216088])

HSP 1 Score: 100.138 bits (248), Expect = 8.745e-21
Identity = 77/270 (28.52%), Postives = 138/270 (51.11%), Query Frame = 1
Query:  880 LAHHENGYLPPQLRQSEKDDLEA----NLKRNIKATLNKMTPENFDLCFNEISGYKLASKEEMAILTDIIFDKAIQEESYSQIY-------STFSARMV-KPGEKTSDYKSMLLQKCKAMFDKPLKTQTEEARIRWIEK----IDNETDERMKSLYASDTEEQVCKAKDKYFGNIRFISELFLQGVLMGRIVLHCVNGLLNQSDDQISMEGVCKILQVTGKKLE-EQHAVEVKKALDKMSILSKSDNLDLKTKFKLKDILDMKNRDWEMR 1638
            L   EN + P   R S  +D ++     L R +++ LNK+TP+ F+    +++   + ++E +  + D++F+KAI E S+S  Y       +T    M  KPG  T +++ +LL +C+  F+K      ++A     EK    ++  T    KS    + EE   KA+ +  GNI+FI ELF   +L   I+  CV  LL   D++ S+E +C++L   GK L+ E+    + +  ++M  + K      + +F L+D++D++  +W  R
Sbjct:  743 LKKSENAWKPSVKRDSLPEDPDSIRTQALFRKVRSILNKLTPQMFNQLMKQVTDLTVDTEERLKGVIDLVFEKAIDEPSFSVAYANMCRCLATLKVPMADKPG-STVNFRKLLLNRCQKEFEK------DKADDDVFEKKQKDLELATTPEEKSRLQDELEESKDKARRRSIGNIKFIGELFKLKMLTEAIMHDCVVKLLKNHDEE-SLECLCRLLTTIGKDLDFEKAKPRMDQYFNQMEKIVKERKTSSRIRFMLQDVIDLRLSNWVSR 1004          
BLAST of Eukaryotic translation initiation factor 4 gamma 3 vs. Ensembl Xenopus
Match: eif4g3 (eukaryotic translation initiation factor 4 gamma, 3 [Source:NCBI gene;Acc:100216088])

HSP 1 Score: 100.138 bits (248), Expect = 8.962e-21
Identity = 77/270 (28.52%), Postives = 138/270 (51.11%), Query Frame = 1
Query:  880 LAHHENGYLPPQLRQSEKDDLEA----NLKRNIKATLNKMTPENFDLCFNEISGYKLASKEEMAILTDIIFDKAIQEESYSQIY-------STFSARMV-KPGEKTSDYKSMLLQKCKAMFDKPLKTQTEEARIRWIEK----IDNETDERMKSLYASDTEEQVCKAKDKYFGNIRFISELFLQGVLMGRIVLHCVNGLLNQSDDQISMEGVCKILQVTGKKLE-EQHAVEVKKALDKMSILSKSDNLDLKTKFKLKDILDMKNRDWEMR 1638
            L   EN + P   R S  +D ++     L R +++ LNK+TP+ F+    +++   + ++E +  + D++F+KAI E S+S  Y       +T    M  KPG  T +++ +LL +C+  F+K      ++A     EK    ++  T    KS    + EE   KA+ +  GNI+FI ELF   +L   I+  CV  LL   D++ S+E +C++L   GK L+ E+    + +  ++M  + K      + +F L+D++D++  +W  R
Sbjct:  662 LKKSENAWKPSVKRDSLPEDPDSIRTQALFRKVRSILNKLTPQMFNQLMKQVTDLTVDTEERLKGVIDLVFEKAIDEPSFSVAYANMCRCLATLKVPMADKPG-STVNFRKLLLNRCQKEFEK------DKADDDVFEKKQKDLELATTPEEKSRLQDELEESKDKARRRSIGNIKFIGELFKLKMLTEAIMHDCVVKLLKNHDEE-SLECLCRLLTTIGKDLDFEKAKPRMDQYFNQMEKIVKERKTSSRIRFMLQDVIDLRLSNWVSR 923          
BLAST of Eukaryotic translation initiation factor 4 gamma 3 vs. Ensembl Xenopus
Match: eif4g3 (eukaryotic translation initiation factor 4 gamma, 3 [Source:NCBI gene;Acc:100216088])

HSP 1 Score: 100.138 bits (248), Expect = 9.966e-21
Identity = 77/270 (28.52%), Postives = 138/270 (51.11%), Query Frame = 1
Query:  880 LAHHENGYLPPQLRQSEKDDLEA----NLKRNIKATLNKMTPENFDLCFNEISGYKLASKEEMAILTDIIFDKAIQEESYSQIY-------STFSARMV-KPGEKTSDYKSMLLQKCKAMFDKPLKTQTEEARIRWIEK----IDNETDERMKSLYASDTEEQVCKAKDKYFGNIRFISELFLQGVLMGRIVLHCVNGLLNQSDDQISMEGVCKILQVTGKKLE-EQHAVEVKKALDKMSILSKSDNLDLKTKFKLKDILDMKNRDWEMR 1638
            L   EN + P   R S  +D ++     L R +++ LNK+TP+ F+    +++   + ++E +  + D++F+KAI E S+S  Y       +T    M  KPG  T +++ +LL +C+  F+K      ++A     EK    ++  T    KS    + EE   KA+ +  GNI+FI ELF   +L   I+  CV  LL   D++ S+E +C++L   GK L+ E+    + +  ++M  + K      + +F L+D++D++  +W  R
Sbjct:  625 LKKSENAWKPSVKRDSLPEDPDSIRTQALFRKVRSILNKLTPQMFNQLMKQVTDLTVDTEERLKGVIDLVFEKAIDEPSFSVAYANMCRCLATLKVPMADKPG-STVNFRKLLLNRCQKEFEK------DKADDDVFEKKQKDLELATTPEEKSRLQDELEESKDKARRRSIGNIKFIGELFKLKMLTEAIMHDCVVKLLKNHDEE-SLECLCRLLTTIGKDLDFEKAKPRMDQYFNQMEKIVKERKTSSRIRFMLQDVIDLRLSNWVSR 886          
BLAST of Eukaryotic translation initiation factor 4 gamma 3 vs. Ensembl Xenopus
Match: eif4g3 (eukaryotic translation initiation factor 4 gamma, 3 [Source:NCBI gene;Acc:100216088])

HSP 1 Score: 100.138 bits (248), Expect = 1.018e-20
Identity = 77/270 (28.52%), Postives = 138/270 (51.11%), Query Frame = 1
Query:  880 LAHHENGYLPPQLRQSEKDDLEA----NLKRNIKATLNKMTPENFDLCFNEISGYKLASKEEMAILTDIIFDKAIQEESYSQIY-------STFSARMV-KPGEKTSDYKSMLLQKCKAMFDKPLKTQTEEARIRWIEK----IDNETDERMKSLYASDTEEQVCKAKDKYFGNIRFISELFLQGVLMGRIVLHCVNGLLNQSDDQISMEGVCKILQVTGKKLE-EQHAVEVKKALDKMSILSKSDNLDLKTKFKLKDILDMKNRDWEMR 1638
            L   EN + P   R S  +D ++     L R +++ LNK+TP+ F+    +++   + ++E +  + D++F+KAI E S+S  Y       +T    M  KPG  T +++ +LL +C+  F+K      ++A     EK    ++  T    KS    + EE   KA+ +  GNI+FI ELF   +L   I+  CV  LL   D++ S+E +C++L   GK L+ E+    + +  ++M  + K      + +F L+D++D++  +W  R
Sbjct:  661 LKKSENAWKPSVKRDSLPEDPDSIRTQALFRKVRSILNKLTPQMFNQLMKQVTDLTVDTEERLKGVIDLVFEKAIDEPSFSVAYANMCRCLATLKVPMADKPG-STVNFRKLLLNRCQKEFEK------DKADDDVFEKKQKDLELATTPEEKSRLQDELEESKDKARRRSIGNIKFIGELFKLKMLTEAIMHDCVVKLLKNHDEE-SLECLCRLLTTIGKDLDFEKAKPRMDQYFNQMEKIVKERKTSSRIRFMLQDVIDLRLSNWVSR 922          
BLAST of Eukaryotic translation initiation factor 4 gamma 3 vs. Ensembl Mouse
Match: Eif4g3 (eukaryotic translation initiation factor 4 gamma, 3 [Source:MGI Symbol;Acc:MGI:1923935])

HSP 1 Score: 107.457 bits (267), Expect = 3.484e-23
Identity = 78/278 (28.06%), Postives = 140/278 (50.36%), Query Frame = 1
Query:  880 LAHHENGYLPPQLRQSEKDDLEA----NLKRNIKATLNKMTPENFDLCFNEISGYKLASKEEMAILTDIIFDKAIQEESYSQIYSTFSARMV--------KPGEKTSDYKSMLLQKCKAMFDKPLKTQTEEARIRWIEKIDNET-DERMKSLYASDTEEQVC-----------KAKDKYFGNIRFISELFLQGVLMGRIVLHCVNGLLNQSDDQISMEGVCKILQVTGKKLE-EQHAVEVKKALDKMSILSKSDNLDLKTKFKLKDILDMKNRDWEMR 1638
            L   EN + P Q R S  DD E+     L R +++ LNK+TP+ F+    ++S   + ++E +  + D++F+KAI E S+S  Y+     +V        KPG  T +++ +LL +C+  F+K              +K D++  +++ K L A+   E+             KA+ +  GNI+FI ELF   +L   I+  CV  LL   D++ S+E +C++L   GK L+ E+    + +  ++M  + K      + +F L+D++D++  +W  R
Sbjct:  721 LRKAENAWKPSQKRDSHADDPESIKTQELFRKVRSILNKLTPQMFNQLMKQVSALTVDTEERLKGVIDLVFEKAIDEPSFSVAYANMCRCLVTLKVPMADKPG-NTVNFRKLLLNRCQKEFEK--------------DKADDDVFEKKQKELEAASAPEERTRLHDELEEAKDKARRRSIGNIKFIGELFKLKMLTEAIMHDCVVKLLKNHDEE-SLECLCRLLTTIGKDLDFEKAKPRMDQYFNQMEKIVKERKTSSRIRFMLQDVIDLRLCNWVSR 982          
BLAST of Eukaryotic translation initiation factor 4 gamma 3 vs. Ensembl Mouse
Match: Eif4g3 (eukaryotic translation initiation factor 4 gamma, 3 [Source:MGI Symbol;Acc:MGI:1923935])

HSP 1 Score: 107.457 bits (267), Expect = 3.594e-23
Identity = 78/278 (28.06%), Postives = 140/278 (50.36%), Query Frame = 1
Query:  880 LAHHENGYLPPQLRQSEKDDLEA----NLKRNIKATLNKMTPENFDLCFNEISGYKLASKEEMAILTDIIFDKAIQEESYSQIYSTFSARMV--------KPGEKTSDYKSMLLQKCKAMFDKPLKTQTEEARIRWIEKIDNET-DERMKSLYASDTEEQVC-----------KAKDKYFGNIRFISELFLQGVLMGRIVLHCVNGLLNQSDDQISMEGVCKILQVTGKKLE-EQHAVEVKKALDKMSILSKSDNLDLKTKFKLKDILDMKNRDWEMR 1638
            L   EN + P Q R S  DD E+     L R +++ LNK+TP+ F+    ++S   + ++E +  + D++F+KAI E S+S  Y+     +V        KPG  T +++ +LL +C+  F+K              +K D++  +++ K L A+   E+             KA+ +  GNI+FI ELF   +L   I+  CV  LL   D++ S+E +C++L   GK L+ E+    + +  ++M  + K      + +F L+D++D++  +W  R
Sbjct:  728 LRKAENAWKPSQKRDSHADDPESIKTQELFRKVRSILNKLTPQMFNQLMKQVSALTVDTEERLKGVIDLVFEKAIDEPSFSVAYANMCRCLVTLKVPMADKPG-NTVNFRKLLLNRCQKEFEK--------------DKADDDVFEKKQKELEAASAPEERTRLHDELEEAKDKARRRSIGNIKFIGELFKLKMLTEAIMHDCVVKLLKNHDEE-SLECLCRLLTTIGKDLDFEKAKPRMDQYFNQMEKIVKERKTSSRIRFMLQDVIDLRLCNWVSR 989          
BLAST of Eukaryotic translation initiation factor 4 gamma 3 vs. Ensembl Mouse
Match: Eif4g3 (eukaryotic translation initiation factor 4 gamma, 3 [Source:MGI Symbol;Acc:MGI:1923935])

HSP 1 Score: 107.457 bits (267), Expect = 3.820e-23
Identity = 78/278 (28.06%), Postives = 140/278 (50.36%), Query Frame = 1
Query:  880 LAHHENGYLPPQLRQSEKDDLEA----NLKRNIKATLNKMTPENFDLCFNEISGYKLASKEEMAILTDIIFDKAIQEESYSQIYSTFSARMV--------KPGEKTSDYKSMLLQKCKAMFDKPLKTQTEEARIRWIEKIDNET-DERMKSLYASDTEEQVC-----------KAKDKYFGNIRFISELFLQGVLMGRIVLHCVNGLLNQSDDQISMEGVCKILQVTGKKLE-EQHAVEVKKALDKMSILSKSDNLDLKTKFKLKDILDMKNRDWEMR 1638
            L   EN + P Q R S  DD E+     L R +++ LNK+TP+ F+    ++S   + ++E +  + D++F+KAI E S+S  Y+     +V        KPG  T +++ +LL +C+  F+K              +K D++  +++ K L A+   E+             KA+ +  GNI+FI ELF   +L   I+  CV  LL   D++ S+E +C++L   GK L+ E+    + +  ++M  + K      + +F L+D++D++  +W  R
Sbjct:  904 LRKAENAWKPSQKRDSHADDPESIKTQELFRKVRSILNKLTPQMFNQLMKQVSALTVDTEERLKGVIDLVFEKAIDEPSFSVAYANMCRCLVTLKVPMADKPG-NTVNFRKLLLNRCQKEFEK--------------DKADDDVFEKKQKELEAASAPEERTRLHDELEEAKDKARRRSIGNIKFIGELFKLKMLTEAIMHDCVVKLLKNHDEE-SLECLCRLLTTIGKDLDFEKAKPRMDQYFNQMEKIVKERKTSSRIRFMLQDVIDLRLCNWVSR 1165          
BLAST of Eukaryotic translation initiation factor 4 gamma 3 vs. Ensembl Mouse
Match: Eif4g3 (eukaryotic translation initiation factor 4 gamma, 3 [Source:MGI Symbol;Acc:MGI:1923935])

HSP 1 Score: 107.457 bits (267), Expect = 3.959e-23
Identity = 78/278 (28.06%), Postives = 140/278 (50.36%), Query Frame = 1
Query:  880 LAHHENGYLPPQLRQSEKDDLEA----NLKRNIKATLNKMTPENFDLCFNEISGYKLASKEEMAILTDIIFDKAIQEESYSQIYSTFSARMV--------KPGEKTSDYKSMLLQKCKAMFDKPLKTQTEEARIRWIEKIDNET-DERMKSLYASDTEEQVC-----------KAKDKYFGNIRFISELFLQGVLMGRIVLHCVNGLLNQSDDQISMEGVCKILQVTGKKLE-EQHAVEVKKALDKMSILSKSDNLDLKTKFKLKDILDMKNRDWEMR 1638
            L   EN + P Q R S  DD E+     L R +++ LNK+TP+ F+    ++S   + ++E +  + D++F+KAI E S+S  Y+     +V        KPG  T +++ +LL +C+  F+K              +K D++  +++ K L A+   E+             KA+ +  GNI+FI ELF   +L   I+  CV  LL   D++ S+E +C++L   GK L+ E+    + +  ++M  + K      + +F L+D++D++  +W  R
Sbjct:  739 LRKAENAWKPSQKRDSHADDPESIKTQELFRKVRSILNKLTPQMFNQLMKQVSALTVDTEERLKGVIDLVFEKAIDEPSFSVAYANMCRCLVTLKVPMADKPG-NTVNFRKLLLNRCQKEFEK--------------DKADDDVFEKKQKELEAASAPEERTRLHDELEEAKDKARRRSIGNIKFIGELFKLKMLTEAIMHDCVVKLLKNHDEE-SLECLCRLLTTIGKDLDFEKAKPRMDQYFNQMEKIVKERKTSSRIRFMLQDVIDLRLCNWVSR 1000          
BLAST of Eukaryotic translation initiation factor 4 gamma 3 vs. Ensembl Mouse
Match: Eif4g3 (eukaryotic translation initiation factor 4 gamma, 3 [Source:MGI Symbol;Acc:MGI:1923935])

HSP 1 Score: 106.301 bits (264), Expect = 6.484e-23
Identity = 79/278 (28.42%), Postives = 141/278 (50.72%), Query Frame = 1
Query:  880 LAHHENGYLPPQLRQSEKDDLEA----NLKRNIKATLNKMTPENFDLCFNEISGYKLASKEEMAILTDIIFDKAIQEESYSQIYSTFSARMV--------KPGEKTSDYKSMLLQKCKAMFDKPLKTQTEEARIRWIEKIDNET-DERMKSLYAS-----------DTEEQVCKAKDKYFGNIRFISELFLQGVLMGRIVLHCVNGLLNQSDDQISMEGVCKILQVTGKKLE-EQHAVEVKKALDKMSILSKSDNLDLKTKFKLKDILDMKNRDWEMR 1638
            L   EN + P Q R S  DD E+     L R +++ LNK+TP+ F+    ++S   + ++E +  + D++F+KAI E S+S  Y+     +V        KPG  T +++ +LL +C+  F+K              +K D++  +++ K L A+           + EE   KA+ +  GNI+FI ELF   +L   I+  CV  LL   D++ S+E +C++L   GK L+ E+    + +  ++M  + K      + +F L+D++D++  +W  R
Sbjct:  163 LRKAENAWKPSQKRDSHADDPESIKTQELFRKVRSILNKLTPQMFNQLMKQVSALTVDTEERLKGVIDLVFEKAIDEPSFSVAYANMCRCLVTLKVPMADKPG-NTVNFRKLLLNRCQKEFEK--------------DKADDDVFEKKQKELEAASAPEERTRLHDELEEAKDKARRRSIGNIKFIGELFKLKMLTEAIMHDCVVKLLKNHDEE-SLECLCRLLTTIGKDLDFEKAKPRMDQYFNQMEKIVKERKTSSRIRFMLQDVIDLRLCNWVSR 424          
BLAST of Eukaryotic translation initiation factor 4 gamma 3 vs. UniProt/SwissProt
Match: sp|O43432|IF4G3_HUMAN (Eukaryotic translation initiation factor 4 gamma 3 OS=Homo sapiens OX=9606 GN=EIF4G3 PE=1 SV=2)

HSP 1 Score: 111.309 bits (277), Expect = 1.994e-23
Identity = 80/278 (28.78%), Postives = 142/278 (51.08%), Query Frame = 1
Query:  880 LAHHENGYLPPQLRQSEKDDLE----ANLKRNIKATLNKMTPENFDLCFNEISGYKLASKEEMAILTDIIFDKAIQEESYSQIYSTFSARMV--------KPGEKTSDYKSMLLQKCKAMFDKPLKTQTEEARIRWIEKIDNET-DERMKSLYAS-----------DTEEQVCKAKDKYFGNIRFISELFLQGVLMGRIVLHCVNGLLNQSDDQISMEGVCKILQVTGKKLE-EQHAVEVKKALDKMSILSKSDNLDLKTKFKLKDILDMKNRDWEMR 1638
            L   EN + P Q R S+ DD E      L R +++ LNK+TP+ F+    ++SG  + ++E +  + D++F+KAI E S+S  Y+     +V        KPG  T +++ +LL +C+  F+K              +K D++  +++ K L A+           + EE   KA+ +  GNI+FI ELF   +L   I+  CV  LL   D++ S+E +C++L   GK L+ E+    + +  ++M  + K      + +F L+D++D++  +W  R
Sbjct:  726 LKKAENAWKPSQKRDSQADDPENIKTQELFRKVRSILNKLTPQMFNQLMKQVSGLTVDTEERLKGVIDLVFEKAIDEPSFSVAYANMCRCLVTLKVPMADKPG-NTVNFRKLLLNRCQKEFEK--------------DKADDDVFEKKQKELEAASAPEERTRLHDELEEAKDKARRRSIGNIKFIGELFKLKMLTEAIMHDCVVKLLKNHDEE-SLECLCRLLTTIGKDLDFEKAKPRMDQYFNQMEKIVKERKTSSRIRFMLQDVIDLRLCNWVSR 987          
BLAST of Eukaryotic translation initiation factor 4 gamma 3 vs. UniProt/SwissProt
Match: sp|Q80XI3|IF4G3_MOUSE (Eukaryotic translation initiation factor 4 gamma 3 OS=Mus musculus OX=10090 GN=Eif4g3 PE=1 SV=2)

HSP 1 Score: 107.457 bits (267), Expect = 2.479e-22
Identity = 78/278 (28.06%), Postives = 140/278 (50.36%), Query Frame = 1
Query:  880 LAHHENGYLPPQLRQSEKDDLEA----NLKRNIKATLNKMTPENFDLCFNEISGYKLASKEEMAILTDIIFDKAIQEESYSQIYSTFSARMV--------KPGEKTSDYKSMLLQKCKAMFDKPLKTQTEEARIRWIEKIDNET-DERMKSLYASDTEEQVC-----------KAKDKYFGNIRFISELFLQGVLMGRIVLHCVNGLLNQSDDQISMEGVCKILQVTGKKLE-EQHAVEVKKALDKMSILSKSDNLDLKTKFKLKDILDMKNRDWEMR 1638
            L   EN + P Q R S  DD E+     L R +++ LNK+TP+ F+    ++S   + ++E +  + D++F+KAI E S+S  Y+     +V        KPG  T +++ +LL +C+  F+K              +K D++  +++ K L A+   E+             KA+ +  GNI+FI ELF   +L   I+  CV  LL   D++ S+E +C++L   GK L+ E+    + +  ++M  + K      + +F L+D++D++  +W  R
Sbjct:  721 LRKAENAWKPSQKRDSHADDPESIKTQELFRKVRSILNKLTPQMFNQLMKQVSALTVDTEERLKGVIDLVFEKAIDEPSFSVAYANMCRCLVTLKVPMADKPG-NTVNFRKLLLNRCQKEFEK--------------DKADDDVFEKKQKELEAASAPEERTRLHDELEEAKDKARRRSIGNIKFIGELFKLKMLTEAIMHDCVVKLLKNHDEE-SLECLCRLLTTIGKDLDFEKAKPRMDQYFNQMEKIVKERKTSSRIRFMLQDVIDLRLCNWVSR 982          
BLAST of Eukaryotic translation initiation factor 4 gamma 3 vs. UniProt/SwissProt
Match: sp|G5CEW6|IF4G_WHEAT (Eukaryotic translation initiation factor 4G OS=Triticum aestivum OX=4565 PE=1 SV=1)

HSP 1 Score: 105.531 bits (262), Expect = 1.034e-21
Identity = 70/243 (28.81%), Postives = 126/243 (51.85%), Query Frame = 1
Query:  937 DLEANLKRNIKATLNKMTPENFDLCFNEISGYKLASKEEMAILTDIIFDKAIQEESYSQIYSTFSARMVKPGEKTSD------YKSMLLQKCKAMFDKPLKTQTEEARIRWIEKIDNETDERMKSLYASDTEEQVCKAKDKYFGNIRFISELFLQGVLMGRIVLHCVNGLLN--QSDDQISMEGVCKILQVTGKKLEEQHAVEVKKA-LDKMSILSKSDNLDLKTKFKLKDILDMKNRDWEMR 1638
            D E   +R +KA LNK+TP+NFD  F ++    + +   +  +   IFDKA+ E ++ ++Y+ F + +       S+      +K +LL KC+  F++  + + E  +     +I    +ER         EE+  KA+ +  GNIR I EL+ + +L  RI+  C+  LL   Q+ D+ ++E +CK++   G+ ++   A E   A  D+M  LS S  +  + +F L+D +D++   W+ R
Sbjct:  877 DEEQAKQRQLKAILNKLTPQNFDKLFEQVKEVNIDNVSTLTGVISQIFDKALMEPTFCEMYANFCSHLAGALPDFSEDNEKITFKRLLLNKCQEEFERGEREEAEADKTEEEGEIKQTKEER---------EEKRVKARRRMLGNIRLIGELYKKRMLTERIMHECIKKLLGNYQNPDEENIEALCKLMSTIGEMIDHPKAKEHMDAYFDRMRNLSTSQLISSRVRFLLRDSIDLRKNKWQQR 1110          
BLAST of Eukaryotic translation initiation factor 4 gamma 3 vs. UniProt/SwissProt
Match: sp|B9FXV5|IF4G_ORYSJ (Eukaryotic translation initiation factor 4G OS=Oryza sativa subsp. japonica OX=39947 GN=Os07g0555200 PE=2 SV=2)

HSP 1 Score: 101.679 bits (252), Expect = 1.981e-20
Identity = 73/246 (29.67%), Postives = 128/246 (52.03%), Query Frame = 1
Query:  937 DLEANLKRNIKATLNKMTPENFDLCFNEISGYKLASKEEMAILTDI---IFDKAIQEESYSQIYSTFSARMVKPGEKTSD------YKSMLLQKCKAMFDKPLKTQTEEARIRWIEKIDNETDERMKSLYASDTEEQVCKAKDKYFGNIRFISELFLQGVLMGRIVLHCVNGLLN--QSDDQISMEGVCKILQVTGKKLEEQHAVEVKKA-LDKMSILSKSDNLDLKTKFKLKDILDMKNRDWEMR 1638
            D E   +R +KA LNK+TP+NF+  F ++   K  + + +A LT +   IFDKA+ E ++ ++Y+ F   +       S+      +K +LL KC+  F++  + + E  +     +I    +ER         EE+  +A+ +  GNIR I EL+ + +L  RI+  C+  LL   Q+ D+ ++E +CK++   G+ ++   A E   A  D M  LS S  L  + +F L+D +D++   W+ R
Sbjct: 1177 DEEEAKQRQLKAILNKLTPQNFEKLFEKV---KEVNIDNVATLTGVISQIFDKALMEPTFCEMYANFCFHLAGALPDFSEDNEKITFKRLLLNKCQEEFERGEREEAEADKTEEEGEIKQTKEER---------EEKRIRARRRMLGNIRLIGELYKKRMLTERIMHECIKKLLGNYQNPDEENIEALCKLMSTIGEMIDHAKAKEHMDAYFDIMLKLSTSQQLSSRVRFMLRDSIDLRKNKWQQR 1410          
BLAST of Eukaryotic translation initiation factor 4 gamma 3 vs. UniProt/SwissProt
Match: sp|Q76E23|IF4G_ARATH (Eukaryotic translation initiation factor 4G OS=Arabidopsis thaliana OX=3702 GN=EIF4G PE=1 SV=2)

HSP 1 Score: 95.9005 bits (237), Expect = 1.022e-18
Identity = 72/280 (25.71%), Postives = 140/280 (50.00%), Query Frame = 1
Query:  853 WKRGSKIQKLAHHENGYLPPQ-LRQSEKD-------DLEANLKRNIKATLNKMTPENFDLCFNEISGYKLASKEEMAILTDIIFDKAIQEESYSQIYSTFSARMVKP-------GEKTSDYKSMLLQKCKAMFDKPLKTQTEEARIRWIEKIDNETDERMKSLYASDTEEQVCKAKDKYFGNIRFISELFLQGVLMGRIVLHCVNGLL--NQSDDQISMEGVCKILQVTGKKLEEQHA-VEVKKALDKMSILSKSDNLDLKTKFKLKDILDMKNRDWEMR 1638
            W+RGS  Q+     + + P Q + ++E+        D E   +R +K+ LNK+TP+NF+  F ++    + +   ++ +   IFDKA+ E ++ ++Y+ F   +          GEK + +K +LL KC+  F++  K + E +R+          +E        + EE+  + + +  GNIR I EL+ + +L  +I+  C+  LL  NQ   + ++E +CK++   G  ++   A  ++    +KM +LS    L  + +F L + +D++   W+ R
Sbjct: 1054 WQRGSNFQQKGLFPSPHTPMQVMHKAERKYQVGTIADEEQAKQRQLKSILNKLTPQNFEKLFEQVKSVNIDNAVTLSGVISQIFDKALMEPTFCEMYADFCFHLSGALPDFNENGEKIT-FKRLLLNKCQEEFERGEKEEEEASRV---------AEEGQVEQTEEEREEKRLQVRRRMLGNIRLIGELYKKRMLTEKIMHACIQKLLGYNQDPHEENIEALCKLMSTIGVMIDHNKAKFQMDGYFEKMKMLSCKQELSSRVRFMLINAIDLRKNKWQER 1323          
BLAST of Eukaryotic translation initiation factor 4 gamma 3 vs. TrEMBL
Match: A0A1I8IB86 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 172.555 bits (436), Expect = 3.289e-40
Identity = 96/277 (34.66%), Postives = 162/277 (58.48%), Query Frame = 1
Query:  886 HHENGYLPPQLRQSEKDDLE----ANLKRNIKATLNKMTPENFDLCFNEISGY-KLASKEEMAILTDIIFDKAIQEESYSQIYSTFSARM----VKPGEKTSD------YKSMLLQKCKAMFDKPLKTQTEEARIRWIEKIDNETDERMKSLYASDTEEQVCKAKDKYFGNIRFISELFLQGVLMGRIVLHCVNGLLNQSDDQISM-----EGVCKILQVTGKKLEEQHAVEVK--KALDKMSILSKSDNLDLKTKFKLKDILDMKNRDWEMREVQI 1650
            H  +    P   Q + DD E      ++RNI++ LNK+ P+NF+ CF++++    + S + +    DIIFDKA +E+SYS +++    R+    V   E++ +      ++S+LL+KC+ MF+ PLK Q E+   +W EKID E  E  K     + +EQ+ KAKD+Y+GNIRFI ELF++ +L   I+  C+   L       SM     E +C++L+  GKKLE ++  + +  +  +++  L  S  ++ K +F+L+DI++M+ R+WE RE++I
Sbjct:  590 HKSDSAYVPGFLQKKPDDQEQLKKVEIERNIRSILNKIAPQNFESCFSQLTTTCDIGSIQGLNACVDIIFDKATREKSYSSVFAEICKRLAFLKVNFPEQSQENKQFIGFRSLLLKKCQEMFETPLKEQMEQKGAQWQEKIDAEEKEDKKKALEEERDEQMKKAKDQYYGNIRFIGELFMKDILTANIIHQCIVSQLKSDHSSKSMFTESLECLCELLKTVGKKLESENNAKARIDQYFERIKKLINSKEIESKVRFRLQDIVEMRQRNWERREMEI 866          
BLAST of Eukaryotic translation initiation factor 4 gamma 3 vs. TrEMBL
Match: A0A267GMY7 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig013413g2 PE=4 SV=1)

HSP 1 Score: 172.555 bits (436), Expect = 3.491e-40
Identity = 96/277 (34.66%), Postives = 162/277 (58.48%), Query Frame = 1
Query:  886 HHENGYLPPQLRQSEKDDLE----ANLKRNIKATLNKMTPENFDLCFNEISGY-KLASKEEMAILTDIIFDKAIQEESYSQIYSTFSARM----VKPGEKTSD------YKSMLLQKCKAMFDKPLKTQTEEARIRWIEKIDNETDERMKSLYASDTEEQVCKAKDKYFGNIRFISELFLQGVLMGRIVLHCVNGLLNQSDDQISM-----EGVCKILQVTGKKLEEQHAVEVK--KALDKMSILSKSDNLDLKTKFKLKDILDMKNRDWEMREVQI 1650
            H  +    P   Q + DD E      ++RNI++ LNK+ P+NF+ CF++++    + S + +    DIIFDKA +E+SYS +++    R+    V   E++ +      ++S+LL+KC+ MF+ PLK Q E+   +W EKID E  E  K     + +EQ+ KAKD+Y+GNIRFI ELF++ +L   I+  C+   L       SM     E +C++L+  GKKLE ++  + +  +  +++  L  S  ++ K +F+L+DI++M+ R+WE RE++I
Sbjct:  601 HKSDSAYVPGFLQKKPDDQEQLKKVEIERNIRSILNKIAPQNFESCFSQLTTTCDIGSIQGLNACVDIIFDKATREKSYSSVFAEICKRLAFLKVNFPEQSQENKQFIGFRSLLLKKCQEMFETPLKEQMEQKGAQWQEKIDAEEKEDKKKALEEERDEQMKKAKDQYYGNIRFIGELFMKDILTANIIHQCIVSQLKSDHSSKSMFTESLECLCELLKTVGKKLESENNAKARIDQYFERIKKLINSKEIESKVRFRLQDIVEMRQRNWERREMEI 877          
BLAST of Eukaryotic translation initiation factor 4 gamma 3 vs. TrEMBL
Match: A0A1I8G5C8 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 172.555 bits (436), Expect = 3.681e-40
Identity = 96/277 (34.66%), Postives = 162/277 (58.48%), Query Frame = 1
Query:  886 HHENGYLPPQLRQSEKDDLE----ANLKRNIKATLNKMTPENFDLCFNEISGY-KLASKEEMAILTDIIFDKAIQEESYSQIYSTFSARM----VKPGEKTSD------YKSMLLQKCKAMFDKPLKTQTEEARIRWIEKIDNETDERMKSLYASDTEEQVCKAKDKYFGNIRFISELFLQGVLMGRIVLHCVNGLLNQSDDQISM-----EGVCKILQVTGKKLEEQHAVEVK--KALDKMSILSKSDNLDLKTKFKLKDILDMKNRDWEMREVQI 1650
            H  +    P   Q + DD E      ++RNI++ LNK+ P+NF+ CF++++    + S + +    DIIFDKA +E+SYS +++    R+    V   E++ +      ++S+LL+KC+ MF+ PLK Q E+   +W EKID E  E  K     + +EQ+ KAKD+Y+GNIRFI ELF++ +L   I+  C+   L       SM     E +C++L+  GKKLE ++  + +  +  +++  L  S  ++ K +F+L+DI++M+ R+WE RE++I
Sbjct:  601 HKSDSAYVPGFLQKKPDDQEQLKKVEIERNIRSILNKIAPQNFESCFSQLTTTCDIGSIQGLNACVDIIFDKATREKSYSSVFAEICKRLAFLKVNFPEQSQENKQFIGFRSLLLKKCQEMFETPLKEQMEQKGAQWQEKIDAEEKEDKKKALEEERDEQMKKAKDQYYGNIRFIGELFMKDILTANIIHQCIVSQLKSDHSSKSMFTESLECLCELLKTVGKKLESENNAKARIDQYFERIKKLINSKEIESKVRFRLQDIVEMRQRNWERREMEI 877          
BLAST of Eukaryotic translation initiation factor 4 gamma 3 vs. TrEMBL
Match: A0A1I8GD32 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 172.555 bits (436), Expect = 3.713e-40
Identity = 96/277 (34.66%), Postives = 162/277 (58.48%), Query Frame = 1
Query:  886 HHENGYLPPQLRQSEKDDLE----ANLKRNIKATLNKMTPENFDLCFNEISGY-KLASKEEMAILTDIIFDKAIQEESYSQIYSTFSARM----VKPGEKTSD------YKSMLLQKCKAMFDKPLKTQTEEARIRWIEKIDNETDERMKSLYASDTEEQVCKAKDKYFGNIRFISELFLQGVLMGRIVLHCVNGLLNQSDDQISM-----EGVCKILQVTGKKLEEQHAVEVK--KALDKMSILSKSDNLDLKTKFKLKDILDMKNRDWEMREVQI 1650
            H  +    P   Q + DD E      ++RNI++ LNK+ P+NF+ CF++++    + S + +    DIIFDKA +E+SYS +++    R+    V   E++ +      ++S+LL+KC+ MF+ PLK Q E+   +W EKID E  E  K     + +EQ+ KAKD+Y+GNIRFI ELF++ +L   I+  C+   L       SM     E +C++L+  GKKLE ++  + +  +  +++  L  S  ++ K +F+L+DI++M+ R+WE RE++I
Sbjct:  601 HKSDSAYVPGFLQKKPDDQEQLKKVEIERNIRSILNKIAPQNFESCFSQLTTTCDIGSIQGLNACVDIIFDKATREKSYSSVFAEICKRLAFLKVNFPEQSQENKQFIGFRSLLLKKCQEMFETPLKEQMEQKGAQWQEKIDAEEKEDKKKALEEERDEQMKKAKDQYYGNIRFIGELFMKDILTANIIHQCIVSQLKSDHSSKSMFTESLECLCELLKTVGKKLESENNAKARIDQYFERIKKLINSKEIESKVRFRLQDIVEMRQRNWERREMEI 877          
BLAST of Eukaryotic translation initiation factor 4 gamma 3 vs. TrEMBL
Match: A0A267HB46 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig013413g3 PE=4 SV=1)

HSP 1 Score: 172.555 bits (436), Expect = 3.847e-40
Identity = 96/277 (34.66%), Postives = 162/277 (58.48%), Query Frame = 1
Query:  886 HHENGYLPPQLRQSEKDDLE----ANLKRNIKATLNKMTPENFDLCFNEISGY-KLASKEEMAILTDIIFDKAIQEESYSQIYSTFSARM----VKPGEKTSD------YKSMLLQKCKAMFDKPLKTQTEEARIRWIEKIDNETDERMKSLYASDTEEQVCKAKDKYFGNIRFISELFLQGVLMGRIVLHCVNGLLNQSDDQISM-----EGVCKILQVTGKKLEEQHAVEVK--KALDKMSILSKSDNLDLKTKFKLKDILDMKNRDWEMREVQI 1650
            H  +    P   Q + DD E      ++RNI++ LNK+ P+NF+ CF++++    + S + +    DIIFDKA +E+SYS +++    R+    V   E++ +      ++S+LL+KC+ MF+ PLK Q E+   +W EKID E  E  K     + +EQ+ KAKD+Y+GNIRFI ELF++ +L   I+  C+   L       SM     E +C++L+  GKKLE ++  + +  +  +++  L  S  ++ K +F+L+DI++M+ R+WE RE++I
Sbjct:  601 HKSDSAYVPGFLQKKPDDQEQLKKVEIERNIRSILNKIAPQNFESCFSQLTTTCDIGSIQGLNACVDIIFDKATREKSYSSVFAEICKRLAFLKVNFPEQSQENKQFIGFRSLLLKKCQEMFETPLKEQMEQKGAQWQEKIDAEEKEDKKKALEEERDEQMKKAKDQYYGNIRFIGELFMKDILTANIIHQCIVSQLKSDHSSKSMFTESLECLCELLKTVGKKLESENNAKARIDQYFERIKKLINSKEIESKVRFRLQDIVEMRQRNWERREMEI 877          
BLAST of Eukaryotic translation initiation factor 4 gamma 3 vs. Ensembl Cavefish
Match: ENSAMXT00000038712.1 (pep primary_assembly:Astyanax_mexicanus-2.0:2:2488911:2498960:1 gene:ENSAMXG00000032273.1 transcript:ENSAMXT00000038712.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 101.293 bits (251), Expect = 2.484e-22
Identity = 64/251 (25.50%), Postives = 129/251 (51.39%), Query Frame = 1
Query:  913 QLRQSEKDDLEAN-LKRNIKATLNKMTPENFDLCFNEISGYKLASKEEMAILTDIIFDKAIQEESYSQIYSTFSARMVKPGEKTS-------DYKSMLLQKCKAMFDKPLKTQTEEARIRWIEKIDNETDERMKSLYASDTEEQVCKAKDKYFGNIRFISELFLQGVLMGRIVLHCVNGLLNQSDDQISMEGVCKILQVTGKKLEEQHAVEVKKALDKMSILSKSDNLDLKTKFKLKDILDMKNRDWEMRE 1641
            ++++ E +DL+   + R  ++ LNK+TP+ FD     ++   + ++E +  +  ++F+KA++E  +S+IY+    R+V     TS       +++ +LL+ CK  F K    +  E + +   ++D  T+   +     + EE   KA+ +  GNI+F+ ELF   +L   I+ HCV  LL    ++ S+E + K+L   GK  +E+    +     ++  + ++     + +F L+D+LD++   W  R 
Sbjct:   79 EVQKDEAEDLKTQEMLRLFRSILNKLTPQTFDRLIQRVTELAIDTEERLRGVISLVFEKAVREPHFSEIYAKMCHRLVDLKVPTSKDPAVNVEFRVLLLRCCKEEFKKNKDEEIIEEKQK---QLDAATENEERQQLKEELEEAKNKARRRSLGNIKFVGELFKLRMLKDSIIHHCVAKLLKDEAEE-SLECLSKLLSTVGKDADEKDKTRMDHYFTEIEEIVRARKTSSRIRFMLQDLLDLRRNKWMGRH 325          
BLAST of Eukaryotic translation initiation factor 4 gamma 3 vs. Ensembl Cavefish
Match: eif4g3b (eukaryotic translation initiation factor 4 gamma 3 [Source:NCBI gene;Acc:103031287])

HSP 1 Score: 103.219 bits (256), Expect = 5.891e-22
Identity = 76/290 (26.21%), Postives = 143/290 (49.31%), Query Frame = 1
Query:  817 INISCEEEIEMDWKRGSKIQKLAHHENGYLPPQLRQSEKDDLEANLK-----RNIKATLNKMTPENFDLCFNEISGYKLASKEEMAILTDIIFDKAIQEESYSQIY-------STFSARMVKPGEKTSDYKSMLLQKCKAMFDK-PLKTQTEEARIRWIEKIDNETDERMKSLYASDTEEQVCKAKDKYFGNIRFISELFLQGVLMGRIVLHCVNGLLNQSDDQISMEGVCKILQVTGKKLE-EQHAVEVKKALDKMSILSKSDNLDLKTKFKLKDILDMKNRDWEMREV 1644
            +N+S  +E++           L   EN + P   R +  DD E NLK     R +++ LNK+TP+ F+    +++   + ++E +  + D++F+KAI E S+S  Y       +T    M      T +++ +LL +C+  F+K  +     E + R +E   + T+         + ++   KA+ +  GNI+FI ELF   +L   I+  CV  LL   D++ S+E +C++L   GK L+ E+    + +  ++M  + K      + +F L+D++D++  +W  R  
Sbjct:  843 MNVSVNDEVQ-----------LKKAENAWKPGMKRDAAIDDPE-NLKTQELFRKVRSILNKLTPQMFNQLMKQVTDLTIDTEERLKGVIDLVFEKAIDEPSFSVAYGNMCSCLATLKVPMADKPTSTVNFRKLLLNRCQKEFEKDKMDDDVFEKKQRELEAASSATERERLQEELEEAKD---KARRRSIGNIKFIGELFKLRMLTEAIMHDCVVKLLKNHDEE-SLECLCRLLTTIGKDLDFEKAKPRMDQYFNQMEKIVKERKTSSRIRFMLQDVIDLRLHNWVSRRA 1116          
BLAST of Eukaryotic translation initiation factor 4 gamma 3 vs. Ensembl Cavefish
Match: eif4g3b (eukaryotic translation initiation factor 4 gamma 3 [Source:NCBI gene;Acc:103031287])

HSP 1 Score: 103.219 bits (256), Expect = 6.126e-22
Identity = 76/290 (26.21%), Postives = 143/290 (49.31%), Query Frame = 1
Query:  817 INISCEEEIEMDWKRGSKIQKLAHHENGYLPPQLRQSEKDDLEANLK-----RNIKATLNKMTPENFDLCFNEISGYKLASKEEMAILTDIIFDKAIQEESYSQIY-------STFSARMVKPGEKTSDYKSMLLQKCKAMFDK-PLKTQTEEARIRWIEKIDNETDERMKSLYASDTEEQVCKAKDKYFGNIRFISELFLQGVLMGRIVLHCVNGLLNQSDDQISMEGVCKILQVTGKKLE-EQHAVEVKKALDKMSILSKSDNLDLKTKFKLKDILDMKNRDWEMREV 1644
            +N+S  +E++           L   EN + P   R +  DD E NLK     R +++ LNK+TP+ F+    +++   + ++E +  + D++F+KAI E S+S  Y       +T    M      T +++ +LL +C+  F+K  +     E + R +E   + T+         + ++   KA+ +  GNI+FI ELF   +L   I+  CV  LL   D++ S+E +C++L   GK L+ E+    + +  ++M  + K      + +F L+D++D++  +W  R  
Sbjct:  868 MNVSVNDEVQ-----------LKKAENAWKPGMKRDAAIDDPE-NLKTQELFRKVRSILNKLTPQMFNQLMKQVTDLTIDTEERLKGVIDLVFEKAIDEPSFSVAYGNMCSCLATLKVPMADKPTSTVNFRKLLLNRCQKEFEKDKMDDDVFEKKQRELEAASSATERERLQEELEEAKD---KARRRSIGNIKFIGELFKLRMLTEAIMHDCVVKLLKNHDEE-SLECLCRLLTTIGKDLDFEKAKPRMDQYFNQMEKIVKERKTSSRIRFMLQDVIDLRLHNWVSRRA 1141          
BLAST of Eukaryotic translation initiation factor 4 gamma 3 vs. Ensembl Cavefish
Match: ENSAMXT00000055942.1 (eukaryotic translation initiation factor 4 gamma 1-like [Source:NCBI gene;Acc:111191621])

HSP 1 Score: 102.449 bits (254), Expect = 6.739e-22
Identity = 70/252 (27.78%), Postives = 129/252 (51.19%), Query Frame = 1
Query:  931 KDDLEANLKRNI----KATLNKMTPENFDLCFNEISGYKLASKEEMAILTDIIFDKAIQEESYSQIYSTFSARMVKPGEKTSD-------YKSMLLQKCKAMFDKPLKTQTEEARIRWIEKIDNETDERMKSLYASDTEEQVCKAKDKYFGNIRFISELFLQGVLMGRIVLHCVNGLLNQSDDQISMEGVCKILQVTGKKLEEQHAVEVKKALDKMSILSKSDNLDLKTKFKLKDILDMKNRDWEMREVQIA 1653
            KDD EA   + +    ++ LNK+TP+ FD     ++   + S+E +  + D++F+KAI+E  +S+ Y+     +V+    TSD       ++++LL+ C+  F K        A  R       ET+ER +     + EE   KA+ +  GNI+ I ELF   +L   I+  C+  LLN + ++ S+E + K+L   GK ++E+H   + + + K+  + ++     + +F L+D+LD++   W  R   + 
Sbjct:  193 KDDPEAKKTQEMLGCFRSILNKLTPQMFDRLIQRVNELAIDSEERLKGVIDLVFEKAIREPHFSETYAKMCHCLVELKVPTSDNPAVTAEFRTLLLRCCQKEFQKNKDDDEIIAAKRKQLNAATETEERQR--LKEELEEAENKARRRSLGNIKLIGELFKLKMLSDSIIHKCIAKLLNDNAEE-SLECLSKLLSTIGKGIDERHKTLMDQYVIKIDDIIRARKSSTRIRFMLQDVLDLRRNKWVPRRADLG 441          
BLAST of Eukaryotic translation initiation factor 4 gamma 3 vs. Ensembl Cavefish
Match: eif4g3b (eukaryotic translation initiation factor 4 gamma 3 [Source:NCBI gene;Acc:103031287])

HSP 1 Score: 103.219 bits (256), Expect = 6.809e-22
Identity = 76/290 (26.21%), Postives = 143/290 (49.31%), Query Frame = 1
Query:  817 INISCEEEIEMDWKRGSKIQKLAHHENGYLPPQLRQSEKDDLEANLK-----RNIKATLNKMTPENFDLCFNEISGYKLASKEEMAILTDIIFDKAIQEESYSQIY-------STFSARMVKPGEKTSDYKSMLLQKCKAMFDK-PLKTQTEEARIRWIEKIDNETDERMKSLYASDTEEQVCKAKDKYFGNIRFISELFLQGVLMGRIVLHCVNGLLNQSDDQISMEGVCKILQVTGKKLE-EQHAVEVKKALDKMSILSKSDNLDLKTKFKLKDILDMKNRDWEMREV 1644
            +N+S  +E++           L   EN + P   R +  DD E NLK     R +++ LNK+TP+ F+    +++   + ++E +  + D++F+KAI E S+S  Y       +T    M      T +++ +LL +C+  F+K  +     E + R +E   + T+         + ++   KA+ +  GNI+FI ELF   +L   I+  CV  LL   D++ S+E +C++L   GK L+ E+    + +  ++M  + K      + +F L+D++D++  +W  R  
Sbjct:  886 MNVSVNDEVQ-----------LKKAENAWKPGMKRDAAIDDPE-NLKTQELFRKVRSILNKLTPQMFNQLMKQVTDLTIDTEERLKGVIDLVFEKAIDEPSFSVAYGNMCSCLATLKVPMADKPTSTVNFRKLLLNRCQKEFEKDKMDDDVFEKKQRELEAASSATERERLQEELEEAKD---KARRRSIGNIKFIGELFKLRMLTEAIMHDCVVKLLKNHDEE-SLECLCRLLTTIGKDLDFEKAKPRMDQYFNQMEKIVKERKTSSRIRFMLQDVIDLRLHNWVSRRA 1159          
BLAST of Eukaryotic translation initiation factor 4 gamma 3 vs. Ensembl Sea Lamprey
Match: eif4g2a (eukaryotic translation initiation factor 4, gamma 2a [Source:ZFIN;Acc:ZDB-GENE-030131-2173])

HSP 1 Score: 77.7962 bits (190), Expect = 6.601e-15
Identity = 68/251 (27.09%), Postives = 118/251 (47.01%), Query Frame = 1
Query:  958 RNIKATLNKMTPENFD-LCFNEISGYKLASKEEMAILTDIIFDKAIQEESYSQIYSTFSARMVK------------PG--EKTSDYKSMLLQKCKAMFDKPLKTQTEEARIRWIEKIDNETDERMKSLYASDTEEQVCKAKDKYFGNIRFISELFLQGVLMGRIVLHCVNGLLNQ------SDDQISMEGVCKILQVTGKKLEEQHAVEVK-KALDKMSILSKSDNLDLKTKFKLKDILDMKNRDWEMREV 1644
            R ++  LNK+TPE FD LC  E+    + SK  +  +  +IF+KA++E  YS +YS    R+ +            PG  +  S ++ +L+ K +  F         E R + +E  DN       S  + + +EQ   AK K  GNI+FI EL    +L   I+  C+  LL +       D    +E +C+I++  G +L+   A  +  +   +M  L  + +L  + +F L+D ++++   W  R+ 
Sbjct:   73 RKVRGILNKLTPEKFDKLCL-ELLNVGIDSKLILKGIILLIFEKALEEPKYSSLYSQLCQRLAEDAPNFDGPPLEGPGRHKHNSSFRRLLIAKLQDEF---------ENRTKKLEGFDNR-----DSPLSPEEDEQRTIAKLKMLGNIKFIGELGKLDLLHESILHRCIKTLLEKKKRVALKDMAEDLECLCQIMRTVGPRLDHDKARSLMDQYFLRMQSLMANKDLPARIRFLLQDTVELRLNKWVPRKA 308          
BLAST of Eukaryotic translation initiation factor 4 gamma 3 vs. Ensembl Nematostella
Match: EDO33172 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7ST03])

HSP 1 Score: 99.7525 bits (247), Expect = 1.711e-21
Identity = 71/236 (30.08%), Postives = 121/236 (51.27%), Query Frame = 1
Query:  958 RNIKATLNKMTPENFDLCFNEISGYKLASKEEMAILTDIIFDKAIQEESYSQIYSTFSARM----VKPGEKTSDYKSMLLQKCKAMFDKPLKTQTEEARIRWIEKIDNETDERMKS----LYASDTEEQVCKAKDKYFGNIRFISELFLQGVLMGRIVLHCVNGLLNQSDDQISMEGVCKILQVTGKKLEEQHA-VEVKKALDKMSILSKSDNLDLKTKFKLKDILDMKNRDWEMR 1638
            R  +  LNK+TP+ F     ++   ++ + E++  + DIIF+KAI E  +S  Y+     +    V  G K   ++++LL KC+  F+   K +T+E RI   EKID   +E +      +  ++ EE+    K +  GNIRFI ELF   +L   I+  CV  L+   D++ S+E  CK+L   GK L+ + A   + +   +M  +  S     + +F L+D+ D++  +W  R
Sbjct:    4 RKFRGILNKLTPQKFKKLTEQVMELEIDTSEKLEGIIDIIFEKAISEPGFSVAYANLCRCLLPIKVSTGNKELVFRTILLNKCQKEFE---KEKTDENRIH--EKIDQLVNEGLSEEDYKIKKAELEEEEMFGKRRTLGNIRFIGELFKLKILTENIMHTCVMKLIKSMDEE-SLECFCKLLSTIGKDLDHEVAKPRMDQYFSQMDKIIASKKTSSRVRFMLQDLRDLRLSNWVPR 233          
BLAST of Eukaryotic translation initiation factor 4 gamma 3 vs. Ensembl Nematostella
Match: EDO32341 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SVB3])

HSP 1 Score: 89.7373 bits (221), Expect = 4.238e-20
Identity = 67/237 (28.27%), Postives = 122/237 (51.48%), Query Frame = 1
Query:  958 RNIKATLNKMTPENFDLCFNEISGYKLASKEEMAILTDIIFDKAIQEESYSQIYSTFSARM----VKPGEKTSDYKSMLLQKCKAMFDKPLKTQTEEARIRWIEKIDNETDERM---KSLYASDTEEQVCKAKDKYFGNIRFISELF-LQGVLMGRIVLHCVNGLLNQSDDQISMEGVCKILQVTGKKLEEQHA-VEVKKALDKMSILSKSDNLDLKTKFKLKDILDMKNRDWEMRE 1641
            R  +  LNK+TP+NF     ++   ++ + E++  + DI+F+KAI+E  Y  +Y+     +    V    K   +K++LL KC+  FDK  + +T        +++ NE    M   K  + S+ EE     + +  GNI FI ELF L+ +L   I+  CV  L+N++DD+ S+E +C++L   GK L+   A   + +   + + +  S       +F ++D+ D++  +W  R+
Sbjct:    4 RKFRGILNKITPQNFKKLVEQVMNLEIDTAEKLEGIIDIVFEKAIREPRYCVVYANLCHCLLPIKVSFENKELVFKTILLNKCQKKFDKTYEHKTHNN----TDQLVNEGLSPMFSRKKKHPSEQEEYEMWERRRTLGNIIFIGELFILKKILTENIMHTCVWKLINRTDDE-SLECLCELLSTVGKDLDHDIAKPRMDQYFRQFNKIIDSKKTSSCVRFMIQDLRDLRLSNWVPRQ 235          
BLAST of Eukaryotic translation initiation factor 4 gamma 3 vs. Ensembl Nematostella
Match: EDO31711 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SX49])

HSP 1 Score: 83.9593 bits (206), Expect = 1.530e-16
Identity = 62/244 (25.41%), Postives = 121/244 (49.59%), Query Frame = 1
Query:  958 RNIKATLNKMTPENFDLCFNEISGYKLASKEEMAILTDIIFDKAIQEESYSQIYSTFSARMVK-------PGE-KTSDYKSMLLQKCKAMFDKPLKTQTEEARIRWIEKIDNETDERMKSLYASDTEEQVCKAKDKYFGNIRFISELFLQGVLMGRIVLHCVNGLLNQ------SDDQISMEGVCKILQVTGKKLEEQHAVE-VKKALDKMSILSKSDNLDLKTKFKLKDILDMKNRDWEMREV 1644
            R ++  LNK+TP+ FD  F E+    + +K  +  +  ++F+KA+ E +YS +Y+    R+ +       PG+   S ++ +LL++C+  F+   +++  +A     +K D+ T E          EE+    K K  GNIRFI EL    +L   I+  C+  LL++      +D    ME +C +++  G +++   A   V +  +++  +    +L  + +F L+ I +++   W  R+V
Sbjct:   70 RRVRGILNKLTPDKFDKLFYELLHVGVETKYILKGVILLVFEKALDEPAYSSMYAQLCLRLSEEAPNFDDPGKTGNSTFRRLLLKQCEEEFNN--RSKASQA----FDKKDDLTQEE---------EEERGSTKRKMLGNIRFIGELAKLDMLHETILHKCIKQLLDKKKRASVADTSEDMECLCHLMKTVGSRIDGPKAKPLVDQYFERIYQIRSRSDLPSRIRFMLEGIEELRTNKWIPRKV 298          
BLAST of Eukaryotic translation initiation factor 4 gamma 3 vs. Ensembl Nematostella
Match: EDO35333 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLX2])

HSP 1 Score: 57.3806 bits (137), Expect = 9.978e-9
Identity = 30/87 (34.48%), Postives = 43/87 (49.43%), Query Frame = 1
Query:  178 VPDQTCFSQDAPTFIPGSQIYQTPMTPKSTKFSPNAAPFTLKSTVLSPSATPFTPKFTGFSPMANSFTPKRERKA--LVIINPKNME 432
             P +T F+     +IP    Y    TPK T+++P    +T K T  +P  T +TPK TG++P    +TPKR R      I  PK  +
Sbjct:  235 TPKRTRFTPKRARYIPKRTRY----TPKRTRYTPKRTQYTPKRTRYTPKRTQYTPKRTGYTPKRTRYTPKRTRYTPKRTIYTPKRTQ 317          
BLAST of Eukaryotic translation initiation factor 4 gamma 3 vs. Ensembl Medaka
Match: eif4g3a (eukaryotic translation initiation factor 4 gamma 3 [Source:NCBI gene;Acc:105354159])

HSP 1 Score: 100.908 bits (250), Expect = 3.264e-21
Identity = 72/270 (26.67%), Postives = 136/270 (50.37%), Query Frame = 1
Query:  877 KLAHHENGYLPPQLRQSEKDDLEAN----LKRNIKATLNKMTPENFDLCFNEISGYKLASKEEMAILTDIIFDKAIQEESYSQIY-------STFSARMVKPGEKTSDYKSMLLQKCKAMFDKPLKTQTEEARIRWIEKIDNETDERMKSLYASDTEEQVCKAKDKY----FGNIRFISELFLQGVLMGRIVLHCVNGLLNQSDDQISMEGVCKILQVTGKKLE-EQHAVEVKKALDKMSILSKSDNLDLKTKFKLKDILDMKNRDWEMR 1638
            +L   EN + P   R++  +D EA     L R +++ LNK+TP+ F+    +++   + ++E +  + D++F+KAI E  +S  Y       +T   +M      T +++ +LL +C+  F+K      ++      E+   E D    +      +E++ +AKDK      GNI+FI ELF   +L   I+  CV  LL   D++ S+E +C++L   GK L+ E+    + +  ++M  + K      + +F L+D++D++  +W  R
Sbjct:  872 QLKKAENAWKPGMKRETLPEDPEAQRTQELFRRVRSILNKLTPQKFNQLMKQVTDLTIDTEERLKGVIDLVFEKAIDEPGFSVAYGNMCRCLATLKVQMTDKPNSTVNFRKLLLNRCQKEFEK------DKVDDVVFERKQKELDSAASTTERERLQEELEEAKDKARRRSIGNIKFIGELFKLKMLTEAIMHDCVVKLLKNHDEE-SLECLCRLLTTIGKDLDFEKAKPRMDQYFNQMEKIVKERKTSSRIRFMLQDVIDLRLHNWVSR 1134          
BLAST of Eukaryotic translation initiation factor 4 gamma 3 vs. Ensembl Medaka
Match: eif4g3a (eukaryotic translation initiation factor 4 gamma 3 [Source:NCBI gene;Acc:105354159])

HSP 1 Score: 100.908 bits (250), Expect = 3.431e-21
Identity = 72/270 (26.67%), Postives = 136/270 (50.37%), Query Frame = 1
Query:  877 KLAHHENGYLPPQLRQSEKDDLEAN----LKRNIKATLNKMTPENFDLCFNEISGYKLASKEEMAILTDIIFDKAIQEESYSQIY-------STFSARMVKPGEKTSDYKSMLLQKCKAMFDKPLKTQTEEARIRWIEKIDNETDERMKSLYASDTEEQVCKAKDKY----FGNIRFISELFLQGVLMGRIVLHCVNGLLNQSDDQISMEGVCKILQVTGKKLE-EQHAVEVKKALDKMSILSKSDNLDLKTKFKLKDILDMKNRDWEMR 1638
            +L   EN + P   R++  +D EA     L R +++ LNK+TP+ F+    +++   + ++E +  + D++F+KAI E  +S  Y       +T   +M      T +++ +LL +C+  F+K      ++      E+   E D    +      +E++ +AKDK      GNI+FI ELF   +L   I+  CV  LL   D++ S+E +C++L   GK L+ E+    + +  ++M  + K      + +F L+D++D++  +W  R
Sbjct:  865 QLKKAENAWKPGMKRETLPEDPEAQRTQELFRRVRSILNKLTPQKFNQLMKQVTDLTIDTEERLKGVIDLVFEKAIDEPGFSVAYGNMCRCLATLKVQMTDKPNSTVNFRKLLLNRCQKEFEK------DKVDDVVFERKQKELDSAASTTERERLQEELEEAKDKARRRSIGNIKFIGELFKLKMLTEAIMHDCVVKLLKNHDEE-SLECLCRLLTTIGKDLDFEKAKPRMDQYFNQMEKIVKERKTSSRIRFMLQDVIDLRLHNWVSR 1127          
BLAST of Eukaryotic translation initiation factor 4 gamma 3 vs. Ensembl Medaka
Match: eif4g3a (eukaryotic translation initiation factor 4 gamma 3 [Source:NCBI gene;Acc:105354159])

HSP 1 Score: 100.908 bits (250), Expect = 3.682e-21
Identity = 72/270 (26.67%), Postives = 136/270 (50.37%), Query Frame = 1
Query:  877 KLAHHENGYLPPQLRQSEKDDLEAN----LKRNIKATLNKMTPENFDLCFNEISGYKLASKEEMAILTDIIFDKAIQEESYSQIY-------STFSARMVKPGEKTSDYKSMLLQKCKAMFDKPLKTQTEEARIRWIEKIDNETDERMKSLYASDTEEQVCKAKDKY----FGNIRFISELFLQGVLMGRIVLHCVNGLLNQSDDQISMEGVCKILQVTGKKLE-EQHAVEVKKALDKMSILSKSDNLDLKTKFKLKDILDMKNRDWEMR 1638
            +L   EN + P   R++  +D EA     L R +++ LNK+TP+ F+    +++   + ++E +  + D++F+KAI E  +S  Y       +T   +M      T +++ +LL +C+  F+K      ++      E+   E D    +      +E++ +AKDK      GNI+FI ELF   +L   I+  CV  LL   D++ S+E +C++L   GK L+ E+    + +  ++M  + K      + +F L+D++D++  +W  R
Sbjct:  833 QLKKAENAWKPGMKRETLPEDPEAQRTQELFRRVRSILNKLTPQKFNQLMKQVTDLTIDTEERLKGVIDLVFEKAIDEPGFSVAYGNMCRCLATLKVQMTDKPNSTVNFRKLLLNRCQKEFEK------DKVDDVVFERKQKELDSAASTTERERLQEELEEAKDKARRRSIGNIKFIGELFKLKMLTEAIMHDCVVKLLKNHDEE-SLECLCRLLTTIGKDLDFEKAKPRMDQYFNQMEKIVKERKTSSRIRFMLQDVIDLRLHNWVSR 1095          
BLAST of Eukaryotic translation initiation factor 4 gamma 3 vs. Ensembl Medaka
Match: eif4g1a (eukaryotic translation initiation factor 4 gamma 1 [Source:NCBI gene;Acc:101158558])

HSP 1 Score: 98.5969 bits (244), Expect = 1.913e-20
Identity = 66/247 (26.72%), Postives = 126/247 (51.01%), Query Frame = 1
Query:  952 LKRNIKATLNKMTPENFDLCFNEISGYKLASKEEMAILTDIIFDKAIQEESYSQIYSTFSARMV--------KPGEKTSDYKSMLLQKCKAMFDKPLKTQTEEARIRWIEKIDNETDERMKSLYASDTEEQVCKAKDKYFGNIRFISELFLQGVLMGRIVLHCVNGLLNQSDDQISMEGVCKILQVTGKKLE-EQHAVEVKKALDKMSILSKSDNLDLKTKFKLKDILDMKNRDWEMREVQIAKSSV 1665
            L + +++ LNK+TP+ F     ++S   + ++E +    D+IF+KAI E ++S  Y+     ++        KPG    +++ +LL +C+  F+K      +E   R  +++D   D+  +     + EE   KA+ +  GNI+FI ELF   +L   I+  CV  LL   D++ S+E +C++L   GK L+ E+    + +   +M  + K      + +F L+D+LD++  +W  R   +   ++
Sbjct:  777 LFKRLRSILNKLTPQKFQELMKQVSELAIDTEERLKGAIDLIFEKAISEPNFSVAYANMCRCLMGLKVPTPDKPGNFV-NFRKLLLNRCQKEFEK--DQDDDEIFERKQKELDASKDDEERERLRVELEESKDKARRRSLGNIKFIGELFKLKMLTEAIMHDCVVKLLKNHDEE-SLECLCRLLSTIGKDLDFEKAKPRMDQYFTQMDKIIKEKKTSSRIRFMLQDVLDLRRNNWVPRRGDLGPKTI 1019          
BLAST of Eukaryotic translation initiation factor 4 gamma 3 vs. Ensembl Medaka
Match: eif4g1a (eukaryotic translation initiation factor 4 gamma 1 [Source:NCBI gene;Acc:101158558])

HSP 1 Score: 98.2117 bits (243), Expect = 1.967e-20
Identity = 66/247 (26.72%), Postives = 126/247 (51.01%), Query Frame = 1
Query:  952 LKRNIKATLNKMTPENFDLCFNEISGYKLASKEEMAILTDIIFDKAIQEESYSQIYSTFSARMV--------KPGEKTSDYKSMLLQKCKAMFDKPLKTQTEEARIRWIEKIDNETDERMKSLYASDTEEQVCKAKDKYFGNIRFISELFLQGVLMGRIVLHCVNGLLNQSDDQISMEGVCKILQVTGKKLE-EQHAVEVKKALDKMSILSKSDNLDLKTKFKLKDILDMKNRDWEMREVQIAKSSV 1665
            L + +++ LNK+TP+ F     ++S   + ++E +    D+IF+KAI E ++S  Y+     ++        KPG    +++ +LL +C+  F+K      +E   R  +++D   D+  +     + EE   KA+ +  GNI+FI ELF   +L   I+  CV  LL   D++ S+E +C++L   GK L+ E+    + +   +M  + K      + +F L+D+LD++  +W  R   +   ++
Sbjct:  832 LFKRLRSILNKLTPQKFQELMKQVSELAIDTEERLKGAIDLIFEKAISEPNFSVAYANMCRCLMGLKVPTPDKPGNFV-NFRKLLLNRCQKEFEK--DQDDDEIFERKQKELDASKDDEERERLRVELEESKDKARRRSLGNIKFIGELFKLKMLTEAIMHDCVVKLLKNHDEE-SLECLCRLLSTIGKDLDFEKAKPRMDQYFTQMDKIIKEKKTSSRIRFMLQDVLDLRRNNWVPRRGDLGPKTI 1074          
BLAST of Eukaryotic translation initiation factor 4 gamma 3 vs. Planmine SMEST
Match: SMESG000035786.1 (SMESG000035786.1)

HSP 1 Score: 1602.42 bits (4148), Expect = 0.000e+0
Identity = 815/816 (99.88%), Postives = 815/816 (99.88%), Query Frame = 1
Query:   70 MFQNQQVVFNESLPVKGFVNLSNAHKVTISSNVTLAVPDQTCFSQDAPTFIPGSQIYQTPMTPKSTKFSPNAAPFTLKSTVLSPSATPFTPKFTGFSPMANSFTPKRERKALVIINPKNMEQLKIDDIVKIAVDLNESVSSVKCTDSVTESILSVQESPICDELHSKENGSEENTDENTHEVVNFNEMKPDETEIVNEDIIVPATNKKKIFSRKELLKHINYEDAPKNLPLMSSWLQEIFTIKTNKLEYINISCEEEIEMDWKRGSKIQKLAHHENGYLPPQLRQSEKDDLEANLKRNIKATLNKMTPENFDLCFNEISGYKLASKEEMAILTDIIFDKAIQEESYSQIYSTFSARMVKPGEKTSDYKSMLLQKCKAMFDKPLKTQTEEARIRWIEKIDNETDERMKSLYASDTEEQVCKAKDKYFGNIRFISELFLQGVLMGRIVLHCVNGLLNQSDDQISMEGVCKILQVTGKKLEEQHAVEVKKALDKMSILSKSDNLDLKTKFKLKDILDMKNRDWEMREVQIAKSSVPXXXXXXXXXXXXXXXXXPAWRWNSFTNNQKGATNNSYKPDIKVQKSTGNTKPSNEKVPVQKIGGWNTIVKKTPKQDFVNKLAGADKSKALKTQNKFSLLAEEKETAEIPVCSIDKPVKVLTTISDNRNDEEISEELFKDIMKSEASPDRWRQISKPVEIIDKWLDKILERRSDSRALLGDYFNXXXXXXXXXXXXXIEGSKQILECSGDLISDIPKLWEFWAEFLERFIENGESNIGFFNLFFKNVENKSDITKCRNCIKAYASERVGSDVVESLFAKWKITS 2517
            MFQNQQVVFNESLPVKGFVNLSNAHKVTISSNVTLAVPDQTCFSQDAPTFIPGSQIYQTPMTPKSTKFSPNAAPFTLKSTVLSPSATPFTPKFTGFSPMANSFTPKRERKALVIINPKNMEQLKIDDIVKIAVDLNESVSSVKCTDSVTESILSVQESPICDELHSKENGSEENTDENTHEVVNFNEMKPDETEIVNEDIIVPATNKKKIFSRKELLKHINYEDAPKNLPLMSSWLQEIFTIKTNKLEYINISCEEEIEMDWKRGSKIQKLAHHENGYLPPQLRQSEKDDLEANLKRNIKATLNKMTPENFDLCFNEISGYKLASKEEMAILTDIIFDKAIQEESYSQIYSTFSARMVKPGEKTSDYKSMLLQKCKAMFDKPLKTQTEEARIRWIEKIDNETDERMKSLYASDTEEQVCKAKDKYFGNIRFISELFLQGVLMGRIVLHCVNGLLNQSDDQISMEGVCKILQVTGKKLEEQHAVEVKKALDKMSILSKSDNLDLKTKFKLKDILDMKNRDWEMREVQIAKSSVPKTLNELKKEKEVKTVLEPAWRWNSFTNNQKGATNNSYKPDIKVQKSTGNTKPSNEKVPVQKIGGWNTIVKKTPKQDFVNKLAGADKSKALKTQNKFSLLAEEKETAEIPVCSIDKPVKVLTTISDNRNDEEISEELFKDIMKSEASPDRWRQISKPVEIIDKWLDKILERRSDSRALLGDYFNKLFK KLLSKDDFIEGSKQILECSGDLISDIPKLWEFWAEFLERFIENGESNIGFFNLFFKNVENKSDITKCRNCIKAYASERVGSDVVESLFAKWKITS
Sbjct:    1 MFQNQQVVFNESLPVKGFVNLSNAHKVTISSNVTLAVPDQTCFSQDAPTFIPGSQIYQTPMTPKSTKFSPNAAPFTLKSTVLSPSATPFTPKFTGFSPMANSFTPKRERKALVIINPKNMEQLKIDDIVKIAVDLNESVSSVKCTDSVTESILSVQESPICDELHSKENGSEENTDENTHEVVNFNEMKPDETEIVNEDIIVPATNKKKIFSRKELLKHINYEDAPKNLPLMSSWLQEIFTIKTNKLEYINISCEEEIEMDWKRGSKIQKLAHHENGYLPPQLRQSEKDDLEANLKRNIKATLNKMTPENFDLCFNEISGYKLASKEEMAILTDIIFDKAIQEESYSQIYSTFSARMVKPGEKTSDYKSMLLQKCKAMFDKPLKTQTEEARIRWIEKIDNETDERMKSLYASDTEEQVCKAKDKYFGNIRFISELFLQGVLMGRIVLHCVNGLLNQSDDQISMEGVCKILQVTGKKLEEQHAVEVKKALDKMSILSKSDNLDLKTKFKLKDILDMKNRDWEMREVQIAKSSVPKTLNELKKEKEVKTVLEPAWRWNSFTNNQKGATNNSYKPDIKVQKSTGNTKPSNEKVPVQKIGGWNTIVKKTPKQDFVNKLAGADKSKALKTQNKFSLLAEEKETAEIPVCSIDKPVKVLTTISDNRNDEEISEELFKDIMKSEASPDRWRQISKPVEIIDKWLDKILERRSDSRALLGDYFNKLFKSKLLSKDDFIEGSKQILECSGDLISDIPKLWEFWAEFLERFIENGESNIGFFNLFFKNVENKSDITKCRNCIKAYASERVGSDVVESLFAKWKITS 816          
BLAST of Eukaryotic translation initiation factor 4 gamma 3 vs. Planmine SMEST
Match: SMESG000040439.1 (SMESG000040439.1)

HSP 1 Score: 1569.67 bits (4063), Expect = 0.000e+0
Identity = 803/816 (98.41%), Postives = 807/816 (98.90%), Query Frame = 1
Query:   70 MFQNQQVVFNESLPVKGFVNLSNAHKVTISSNVTLAVPDQTCFSQDAPTFIPGSQIYQTPMTPKSTKFSPNAAPFTLKSTVLSPSATPFTPKFTGFSPMANSFTPKRERKALVIINPKNMEQLKIDDIVKIAVDLNESVSSVKCTDSVTESILSVQESPICDELHSKENGSEENTDENTHEVVNFNEMKPDETEIVNEDIIVPATNKKKIFSRKELLKHINYEDAPKNLPLMSSWLQEIFTIKTNKLEYINISCEEEIEMDWKRGSKIQKLAHHENGYLPPQLRQSEKDDLEANLKRNIKATLNKMTPENFDLCFNEISGYKLASKEEMAILTDIIFDKAIQEESYSQIYSTFSARMVKPGEKTSDYKSMLLQKCKAMFDKPLKTQTEEARIRWIEKIDNETDERMKSLYASDTEEQVCKAKDKYFGNIRFISELFLQGVLMGRIVLHCVNGLLNQSDDQISMEGVCKILQVTGKKLEEQHAVEVKKALDKMSILSKSDNLDLKTKFKLKDILDMKNRDWEMREVQIAKSSVPXXXXXXXXXXXXXXXXXPAWRWNSFTNNQKGATNNSYKPDIKVQKSTGNTKPSNEKVPVQKIGGWNTIVKKTPKQDFVNKLAGADKSKALKTQNKFSLLAEEKETAEIPVCSIDKPVKVLTTISDNRNDEEISEELFKDIMKSEASPDRWRQISKPVEIIDKWLDKILERRSDSRALLGDYFNXXXXXXXXXXXXXIEGSKQILECSGDLISDIPKLWEFWAEFLERFIENGESNIGFFNLFFKNVENKSDITKCRNCIKAYASERVGSDVVESLFAKWKITS 2517
            MFQNQQVVFNESLPVKGFVNLSNAHKVTISSNVTLAVPDQTCFSQDAPTFIPGSQIYQTPMTPKSTKFSPNAAPFTLKSTVLSPSATPFTPKFTGFSPMANSFTPKRERKALVIINP NMEQLKIDDIVKIAVDLNESVSSVKCTDSVTESILSVQESPICDEL SKENGSEEN+DENTHEVVNFNEMKPDETEIVNEDIIVPAT KKKIFSRKELLKHINYEDAPKNLPLMSSWLQEIFTIKTNKLEYINISCEEEIEMDWKRGSKIQKLAHHENGYLPPQLRQSE DDLEANLKRNIKATLNKMTPENFDLCFNEISGYKLASKEEMAILTDIIFDKAIQEESYSQIYSTFSARMVKPGEKTSDYKSMLLQKCKAMFDKPLKTQ EEARIRWIEKIDNETDERMKSLYASDTEEQVCKAKDKYFGNIRFISELFLQGVLMGRIVLHCVNGLLNQSDDQISMEGVCKILQVTGKKLEEQHAVEVKKALDKMSILSKSDNLDLKTKFKLKDILDMKNRDWEMREVQIAKSSVPKTLNELKKEKEVKTVLEPAWR N+FTNNQKGATNNSYKPDIKVQK TGNTK SNEKVPVQKIGGWNTIVKKTPKQDFVNKLAGADKSKALKTQNKFSLLAEEKETAEIPVCSIDKPVKVLTTISDNRNDEEISEELFKDIMKSEASPDRW QISKPVEIIDKWLDKILERRSDSRALLGDYFNKLFKLKLLSKDDFIEGSKQILECSGDLISDIPKLWEFWAEFLERFIENGESNIGFFNLFFKNV+NKSDITKCRNCIKAYASERVGSDV+ESLFAKWKITS
Sbjct:    1 MFQNQQVVFNESLPVKGFVNLSNAHKVTISSNVTLAVPDQTCFSQDAPTFIPGSQIYQTPMTPKSTKFSPNAAPFTLKSTVLSPSATPFTPKFTGFSPMANSFTPKRERKALVIINPTNMEQLKIDDIVKIAVDLNESVSSVKCTDSVTESILSVQESPICDELDSKENGSEENSDENTHEVVNFNEMKPDETEIVNEDIIVPATTKKKIFSRKELLKHINYEDAPKNLPLMSSWLQEIFTIKTNKLEYINISCEEEIEMDWKRGSKIQKLAHHENGYLPPQLRQSENDDLEANLKRNIKATLNKMTPENFDLCFNEISGYKLASKEEMAILTDIIFDKAIQEESYSQIYSTFSARMVKPGEKTSDYKSMLLQKCKAMFDKPLKTQMEEARIRWIEKIDNETDERMKSLYASDTEEQVCKAKDKYFGNIRFISELFLQGVLMGRIVLHCVNGLLNQSDDQISMEGVCKILQVTGKKLEEQHAVEVKKALDKMSILSKSDNLDLKTKFKLKDILDMKNRDWEMREVQIAKSSVPKTLNELKKEKEVKTVLEPAWRCNNFTNNQKGATNNSYKPDIKVQKPTGNTKHSNEKVPVQKIGGWNTIVKKTPKQDFVNKLAGADKSKALKTQNKFSLLAEEKETAEIPVCSIDKPVKVLTTISDNRNDEEISEELFKDIMKSEASPDRWGQISKPVEIIDKWLDKILERRSDSRALLGDYFNKLFKLKLLSKDDFIEGSKQILECSGDLISDIPKLWEFWAEFLERFIENGESNIGFFNLFFKNVKNKSDITKCRNCIKAYASERVGSDVLESLFAKWKITS 816          
BLAST of Eukaryotic translation initiation factor 4 gamma 3 vs. Planmine SMEST
Match: SMESG000040422.1 (SMESG000040422.1)

HSP 1 Score: 1459.51 bits (3777), Expect = 0.000e+0
Identity = 764/822 (92.94%), Postives = 778/822 (94.65%), Query Frame = 1
Query:   55 MLPNHMFQNQQVVFNESLPVKGFVNLSNAHKVTISSNVTLAVPDQTCF-SQDAPTFIPGSQIYQTPMTPKSTKFSPNAAPFTLKSTVLSPSATPFTPKFTGFSPMANSFTPKRERKALVIINPKNMEQLKIDDIVKIAVDLNESVSSVKCTDSVTESILSVQESPICDELHSKENGSEENTDENTHEVVNFNEMKPDETEIVNEDIIVPATNKKKIFSRKELLKHINYEDAPKNLPLMSSWLQEIFTIKTNKLEYINISCEEEIEMDWKRGSKIQKLAHHENGYLPPQLRQSEKDDLEANLKRNIKATLNKMTPENFDLCFNEISGYKLASKEEMAILTDIIFDKAIQEESYSQIYSTFSARMVKPGEKTSDYKSMLLQKCKAMFDKPLKTQTEEARIRWIEKIDNETDERMKSLYASDTEEQVCKAKDKYFGNIRFISELFLQGVLMGRIVLHCVNGLLNQSDDQISMEGVCKILQVTGKKLEEQHAVEVKKALDKMSILSKSDNLDLKTKFKLKDILDMKNRDWEMREVQIAKSSVPXXXXXXXXXXXXXXXXXPAWRWNSFTNNQKGATNNSYKPDIKVQKSTGNTKPSNEKVPVQKIGGWNTIVKKTPKQDFVNKLAGADKSKALKTQNKFSLLAEEKETAEIPVCSIDKPVKVLTTISDNRNDEEISEELFKDIMKSEASPDRWRQISKPVEIIDKWLDKILERRSDSRALLGDYFNXXXXXXXXXXXXXIEGSKQILECSGDLISDIPKLWEFWAEFLERFIENGESNIGFFNLFFKNVENKSDITKCRNCIKAYASERVGSDVVESLFAKWKITS 2517
            M  N++ QNQ++  N ++   G    S +H +T         P++T F    A  FIPGSQIYQTP TPKSTKFS NAAPFT KSTVLSP ATPFTPKFTGFSPMANSFTPKRERKALVIINP NMEQLKIDDIVKIAVDLNESVSSVKCTDSVTESILSVQESPICDEL SKENGSEENTDENTH+VVN NEMKPDETEI NEDIIVPAT KKKIFSRKELLKHINYEDAPKNLPLMSSWLQEIFTIKTNKLEYINISCEEEIEMDWKRGSKIQKLAHHENGYLPPQLRQSEKDDLEANLKRNIKATLNKMTPENFDLCFNEISGYKLASKEEMAILTDIIFDKAIQEESYSQIYSTFS RMVKPGEKTSDYKSMLLQKCKAMFDKPLKTQ EEARIRWIEKIDNETDERMKSLYASDTEEQVCKAKDKYFGNIRFISELFLQGVLMGRIVLHCVNGLLNQSDDQISMEGVCKILQVTGKKLEEQHAVEVKKALDKMSILSKSDNLDLKTKFKLKDILDMKNRDWEMREVQIAKSSVPKTLNELKKEKEVKTVLEPAWR N+FTNNQKGATNNSYKPDIKVQKSTGNTKPSNEKVPVQKIGGWNTIVKKTPKQDFVNKLAGADKSKALKTQNKFSLLAEEKETAEIPVCSIDKPVKVLTTISDNRNDEEISEELFKDIMKSEASPDRWRQISKPVEIIDKWLDKILERRSDSRALLGDYF+KLFKLKLLSKDDFIEGSKQILECSGDLISDIPKLWEFWAEFLERFIENGESNIGFFNLFFKNV+NKSDITKCRNCIKA ASERVGSDVVESLFAKWKITS
Sbjct:    1 MQYNNINQNQKMYSNGNVRTNGN---SESHILT---------PNKTYFKGAAAAPFIPGSQIYQTPTTPKSTKFSLNAAPFTPKSTVLSPIATPFTPKFTGFSPMANSFTPKRERKALVIINPTNMEQLKIDDIVKIAVDLNESVSSVKCTDSVTESILSVQESPICDELDSKENGSEENTDENTHKVVNVNEMKPDETEIANEDIIVPATTKKKIFSRKELLKHINYEDAPKNLPLMSSWLQEIFTIKTNKLEYINISCEEEIEMDWKRGSKIQKLAHHENGYLPPQLRQSEKDDLEANLKRNIKATLNKMTPENFDLCFNEISGYKLASKEEMAILTDIIFDKAIQEESYSQIYSTFSVRMVKPGEKTSDYKSMLLQKCKAMFDKPLKTQMEEARIRWIEKIDNETDERMKSLYASDTEEQVCKAKDKYFGNIRFISELFLQGVLMGRIVLHCVNGLLNQSDDQISMEGVCKILQVTGKKLEEQHAVEVKKALDKMSILSKSDNLDLKTKFKLKDILDMKNRDWEMREVQIAKSSVPKTLNELKKEKEVKTVLEPAWRCNNFTNNQKGATNNSYKPDIKVQKSTGNTKPSNEKVPVQKIGGWNTIVKKTPKQDFVNKLAGADKSKALKTQNKFSLLAEEKETAEIPVCSIDKPVKVLTTISDNRNDEEISEELFKDIMKSEASPDRWRQISKPVEIIDKWLDKILERRSDSRALLGDYFDKLFKLKLLSKDDFIEGSKQILECSGDLISDIPKLWEFWAEFLERFIENGESNIGFFNLFFKNVKNKSDITKCRNCIKALASERVGSDVVESLFAKWKITS 810          
BLAST of Eukaryotic translation initiation factor 4 gamma 3 vs. Planmine SMEST
Match: SMESG000040405.1 (SMESG000040405.1)

HSP 1 Score: 1455.27 bits (3766), Expect = 0.000e+0
Identity = 751/783 (95.91%), Postives = 758/783 (96.81%), Query Frame = 1
Query:  172 LAVPDQTCF-SQDAPTFIPGSQIYQTPMTPKSTKFSPNAAPFTLKSTVLSPSATPFTPKFTGFSPMANSFTPKRERKALVIINPKNMEQLKIDDIVKIAVDLNESVSSVKCTDSVTESILSVQESPICDELHSKENGSEENTDENTHEVVNFNEMKPDETEIVNEDIIVPATNKKKIFSRKELLKHINYEDAPKNLPLMSSWLQEIFTIKTNKLEYINISCEEEIEMDWKRGSKIQKLAHHENGYLPPQLRQSEKDDLEANLKRNIKATLNKMTPENFDLCFNEISGYKLASKEEMAILTDIIFDKAIQEESYSQIYSTFSARMVKPGEKTSDYKSMLLQKCKAMFDKPLKTQTEEARIRWIEKIDNETDERMKSLYASDTEEQVCKAKDKYFGNIRFISELFLQGVLMGRIVLHCVNGLLNQSDDQISMEGVCKILQVTGKKLEEQHAVEVKKALDKMSILSKSDNLDLKTKFKLKDILDMKNRDWEMREVQIAKSSVPXXXXXXXXXXXXXXXXXPAWRWNSFTNNQKGATNNSYKPDIKVQKSTGNTKPSNEKVPVQKIGGWNTIVKKTPKQDFVNKLAGADKSKALKTQNKFSLLAEEKETAEIPVCSIDKPVKVLTTISDNRNDEEISEELFKDIMKSEASPDRWRQISKPVEIIDKWLDKILERRSDSRALLGDYFNXXXXXXXXXXXXXIEGSKQILECSGDLISDIPKLWEFWAEFLERFIENGESNIGFFNLFFKNVENKSDITKCRNCIKAYASERVGSDVVESLFAKWKITS 2517
            +  P++T F    A  FIPGSQIY+TP TPKSTKFS NAAPFT KSTVLSP ATPFTPKFTGFSPMANSFTPKRERKALVIINP NMEQLKIDDIVKIAVDLNESVSSVKCTDSVTESILSVQESPICDEL SKENGSEENTDENTHEVVNFNEMKPDETEI NEDIIVPAT KKKIFSRKELLKHINYEDAPKNLPLMSSWLQEIFTIKTNKLEYINISCEEEIEMDWKRGSKIQKLAHHENGYLPPQLRQSEKDDLEANLKRNIKATLNKMTPENFDLCFNEISGYKLASKEEMAILTDIIFDKAIQEESYSQIYSTFSARMVKPGEKTSDYKSMLLQKCKAMFDKPLKTQ EEARIRWIEKIDNETDERMKSLYASDTEEQVCKAKDKYFGNIRFISELFLQGVLMGRIVLHCVNGLLNQSDDQISMEGVCKILQVTGKKLEEQHAVEVKKALDKMSILSKSDNLDLKTKFKLKDILDMKNRDWEMREVQIAKSSVPKTLNELKKEKEVKTVLEPAWR N+FTNNQKGATNNSYKPDIKVQKSTGNTKPSNEKVPVQKIGGWNTIVKKTPKQDFVNKLAGADKSKALKTQNKFSLLAEEKETAEIPVCSIDKPVKVLTTISDNRNDEEISEELFKDIMKSEASPDRW QISKPVEIIDKWLDKILERRSDSRALLGDYFN LFKLKLL+KDDFIEGSKQILECS  +ISDIPKLWEFWAEFLERFIENGESNIGFFNLFFKNVENKSDI KCRNCIKA ASERVGSDVVESLFAKWKITS
Sbjct:   22 ILTPNKTYFKGASAAPFIPGSQIYETPTTPKSTKFSLNAAPFTPKSTVLSPIATPFTPKFTGFSPMANSFTPKRERKALVIINPTNMEQLKIDDIVKIAVDLNESVSSVKCTDSVTESILSVQESPICDELDSKENGSEENTDENTHEVVNFNEMKPDETEIANEDIIVPATTKKKIFSRKELLKHINYEDAPKNLPLMSSWLQEIFTIKTNKLEYINISCEEEIEMDWKRGSKIQKLAHHENGYLPPQLRQSEKDDLEANLKRNIKATLNKMTPENFDLCFNEISGYKLASKEEMAILTDIIFDKAIQEESYSQIYSTFSARMVKPGEKTSDYKSMLLQKCKAMFDKPLKTQMEEARIRWIEKIDNETDERMKSLYASDTEEQVCKAKDKYFGNIRFISELFLQGVLMGRIVLHCVNGLLNQSDDQISMEGVCKILQVTGKKLEEQHAVEVKKALDKMSILSKSDNLDLKTKFKLKDILDMKNRDWEMREVQIAKSSVPKTLNELKKEKEVKTVLEPAWRCNNFTNNQKGATNNSYKPDIKVQKSTGNTKPSNEKVPVQKIGGWNTIVKKTPKQDFVNKLAGADKSKALKTQNKFSLLAEEKETAEIPVCSIDKPVKVLTTISDNRNDEEISEELFKDIMKSEASPDRWGQISKPVEIIDKWLDKILERRSDSRALLGDYFNNLFKLKLLNKDDFIEGSKQILECSEYMISDIPKLWEFWAEFLERFIENGESNIGFFNLFFKNVENKSDIIKCRNCIKALASERVGSDVVESLFAKWKITS 804          
BLAST of Eukaryotic translation initiation factor 4 gamma 3 vs. Planmine SMEST
Match: SMESG000005574.1 (SMESG000005574.1)

HSP 1 Score: 1435.62 bits (3715), Expect = 0.000e+0
Identity = 741/783 (94.64%), Postives = 753/783 (96.17%), Query Frame = 1
Query:  172 LAVPDQTCFSQDAPT-FIPGSQIYQTPMTPKSTKFSPNAAPFTLKSTVLSPSATPFTPKFTGFSPMANSFTPKRERKALVIINPKNMEQLKIDDIVKIAVDLNESVSSVKCTDSVTESILSVQESPICDELHSKENGSEENTDENTHEVVNFNEMKPDETEIVNEDIIVPATNKKKIFSRKELLKHINYEDAPKNLPLMSSWLQEIFTIKTNKLEYINISCEEEIEMDWKRGSKIQKLAHHENGYLPPQLRQSEKDDLEANLKRNIKATLNKMTPENFDLCFNEISGYKLASKEEMAILTDIIFDKAIQEESYSQIYSTFSARMVKPGEKTSDYKSMLLQKCKAMFDKPLKTQTEEARIRWIEKIDNETDERMKSLYASDTEEQVCKAKDKYFGNIRFISELFLQGVLMGRIVLHCVNGLLNQSDDQISMEGVCKILQVTGKKLEEQHAVEVKKALDKMSILSKSDNLDLKTKFKLKDILDMKNRDWEMREVQIAKSSVPXXXXXXXXXXXXXXXXXPAWRWNSFTNNQKGATNNSYKPDIKVQKSTGNTKPSNEKVPVQKIGGWNTIVKKTPKQDFVNKLAGADKSKALKTQNKFSLLAEEKETAEIPVCSIDKPVKVLTTISDNRNDEEISEELFKDIMKSEASPDRWRQISKPVEIIDKWLDKILERRSDSRALLGDYFNXXXXXXXXXXXXXIEGSKQILECSGDLISDIPKLWEFWAEFLERFIENGESNIGFFNLFFKNVENKSDITKCRNCIKAYASERVGSDVVESLFAKWKITS 2517
            +  P++T F   A T FIPGSQIY+TP TPKSTKFS NAAPFT KSTVLSP A PFTPKFTGFSPMANSFTPKRERKALVIINP NMEQLKIDDIVKIAVDLNESVSSVKCTDSVT+SILSVQESPICDEL SKENGSEENTDENTHEVVN NEMKPDETEI NEDIIVPAT KKKIFS KELLKHINYEDAPKNLPLMSSWLQEIFTIKTNKLEYINISCEE+IEMDWKRGSKIQ L HHENGY+PPQLRQSEKDDLEANLKRNIKATLNKMTPENFDLCFNEIS YKLASKEEMAILTDIIFDKAIQEESYSQIYSTFSARMVKPGEKTSDYKSMLLQKCKAMFDKPLKTQ EEARIRWIEKIDNETDERMKSLYASDTEEQVCKAKDKYFGNIRFISELFLQGVLMGRIVLHCVNGLLNQSDDQISMEGVCKILQVTGKKLEEQHAVEVKKALDKMSILSKSDNLDLKTKFKLKDILDMKNRDWEMREVQIAKSSVPKTLNELKKEKEVKTVLEPAWR N+FTNNQKG TNNSYKPDIKVQKSTGNTKPSNEKVPV+KIGGWNTIVKKTPKQDFVNKLAGADKSKALKTQNKFSLLAEEKE+AEI VCSIDKPVKVLTTISDNRNDEEISEELFKDIMKSEAS DRW QISKPVEIIDKWLDKILERRSDSRALLGDYFNKLFKLKLLSKDDFIEGSKQILECSGD+ISDIPKLWEFWAEFLERFIENGESNIGFFN FFKNV+NKSDITKCRNCIKA ASERVGSDVVESLFAKWKITS
Sbjct:   22 ILTPNKTYFKGAAATPFIPGSQIYETPTTPKSTKFSLNAAPFTPKSTVLSPIAKPFTPKFTGFSPMANSFTPKRERKALVIINPTNMEQLKIDDIVKIAVDLNESVSSVKCTDSVTKSILSVQESPICDELDSKENGSEENTDENTHEVVNVNEMKPDETEIANEDIIVPATTKKKIFSVKELLKHINYEDAPKNLPLMSSWLQEIFTIKTNKLEYINISCEEDIEMDWKRGSKIQMLVHHENGYIPPQLRQSEKDDLEANLKRNIKATLNKMTPENFDLCFNEISSYKLASKEEMAILTDIIFDKAIQEESYSQIYSTFSARMVKPGEKTSDYKSMLLQKCKAMFDKPLKTQMEEARIRWIEKIDNETDERMKSLYASDTEEQVCKAKDKYFGNIRFISELFLQGVLMGRIVLHCVNGLLNQSDDQISMEGVCKILQVTGKKLEEQHAVEVKKALDKMSILSKSDNLDLKTKFKLKDILDMKNRDWEMREVQIAKSSVPKTLNELKKEKEVKTVLEPAWRCNNFTNNQKGVTNNSYKPDIKVQKSTGNTKPSNEKVPVRKIGGWNTIVKKTPKQDFVNKLAGADKSKALKTQNKFSLLAEEKESAEISVCSIDKPVKVLTTISDNRNDEEISEELFKDIMKSEASSDRWHQISKPVEIIDKWLDKILERRSDSRALLGDYFNKLFKLKLLSKDDFIEGSKQILECSGDMISDIPKLWEFWAEFLERFIENGESNIGFFNQFFKNVKNKSDITKCRNCIKALASERVGSDVVESLFAKWKITS 804          
The following BLAST results are available for this feature:
BLAST of Eukaryotic translation initiation factor 4 gamma 3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
EIF4G34.152e-2428.78eukaryotic translation initiation factor 4 gamma 3... [more]
EIF4G34.375e-2428.42eukaryotic translation initiation factor 4 gamma 3... [more]
EIF4G34.565e-2428.42eukaryotic translation initiation factor 4 gamma 3... [more]
EIF4G34.608e-2428.78eukaryotic translation initiation factor 4 gamma 3... [more]
EIF4G38.099e-2428.78eukaryotic translation initiation factor 4 gamma 3... [more]
back to top
BLAST of Eukaryotic translation initiation factor 4 gamma 3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Eukaryotic translation initiation factor 4 gamma 3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
eIF4G12.211e-2026.14gene:FBgn0023213 transcript:FBtr0112904[more]
eIF4G12.250e-2026.14gene:FBgn0023213 transcript:FBtr0289951[more]
eIF4G12.250e-2026.14gene:FBgn0023213 transcript:FBtr0089243[more]
eIF4G21.127e-1925.33gene:FBgn0260634 transcript:FBtr0089623[more]
eIF4G21.127e-1925.33gene:FBgn0260634 transcript:FBtr0344335[more]
back to top
BLAST of Eukaryotic translation initiation factor 4 gamma 3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
eif4g3a7.901e-2226.04eukaryotic translation initiation factor 4 gamma, ... [more]
eif4g3a1.612e-2126.97eukaryotic translation initiation factor 4 gamma, ... [more]
eif4g3a1.728e-2126.97eukaryotic translation initiation factor 4 gamma, ... [more]
eif4g1a1.663e-2026.89eukaryotic translation initiation factor 4 gamma, ... [more]
eif4g1a1.811e-2026.89eukaryotic translation initiation factor 4 gamma, ... [more]
back to top
BLAST of Eukaryotic translation initiation factor 4 gamma 3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
eif4g38.374e-2128.52eukaryotic translation initiation factor 4 gamma, ... [more]
eif4g38.745e-2128.52eukaryotic translation initiation factor 4 gamma, ... [more]
eif4g38.962e-2128.52eukaryotic translation initiation factor 4 gamma, ... [more]
eif4g39.966e-2128.52eukaryotic translation initiation factor 4 gamma, ... [more]
eif4g31.018e-2028.52eukaryotic translation initiation factor 4 gamma, ... [more]
back to top
BLAST of Eukaryotic translation initiation factor 4 gamma 3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Eif4g33.484e-2328.06eukaryotic translation initiation factor 4 gamma, ... [more]
Eif4g33.594e-2328.06eukaryotic translation initiation factor 4 gamma, ... [more]
Eif4g33.820e-2328.06eukaryotic translation initiation factor 4 gamma, ... [more]
Eif4g33.959e-2328.06eukaryotic translation initiation factor 4 gamma, ... [more]
Eif4g36.484e-2328.42eukaryotic translation initiation factor 4 gamma, ... [more]
back to top
BLAST of Eukaryotic translation initiation factor 4 gamma 3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O43432|IF4G3_HUMAN1.994e-2328.78Eukaryotic translation initiation factor 4 gamma 3... [more]
sp|Q80XI3|IF4G3_MOUSE2.479e-2228.06Eukaryotic translation initiation factor 4 gamma 3... [more]
sp|G5CEW6|IF4G_WHEAT1.034e-2128.81Eukaryotic translation initiation factor 4G OS=Tri... [more]
sp|B9FXV5|IF4G_ORYSJ1.981e-2029.67Eukaryotic translation initiation factor 4G OS=Ory... [more]
sp|Q76E23|IF4G_ARATH1.022e-1825.71Eukaryotic translation initiation factor 4G OS=Ara... [more]
back to top
BLAST of Eukaryotic translation initiation factor 4 gamma 3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8IB863.289e-4034.66Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267GMY73.491e-4034.66Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8G5C83.681e-4034.66Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8GD323.713e-4034.66Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267HB463.847e-4034.66Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of Eukaryotic translation initiation factor 4 gamma 3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000038712.12.484e-2225.50pep primary_assembly:Astyanax_mexicanus-2.0:2:2488... [more]
eif4g3b5.891e-2226.21eukaryotic translation initiation factor 4 gamma 3... [more]
eif4g3b6.126e-2226.21eukaryotic translation initiation factor 4 gamma 3... [more]
ENSAMXT00000055942.16.739e-2227.78eukaryotic translation initiation factor 4 gamma 1... [more]
eif4g3b6.809e-2226.21eukaryotic translation initiation factor 4 gamma 3... [more]
back to top
BLAST of Eukaryotic translation initiation factor 4 gamma 3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
eif4g2a6.601e-1527.09eukaryotic translation initiation factor 4, gamma ... [more]
back to top
BLAST of Eukaryotic translation initiation factor 4 gamma 3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Eukaryotic translation initiation factor 4 gamma 3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO331721.711e-2130.08Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO323414.238e-2028.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO317111.530e-1625.41Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO353339.978e-934.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Eukaryotic translation initiation factor 4 gamma 3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
eif4g3a3.264e-2126.67eukaryotic translation initiation factor 4 gamma 3... [more]
eif4g3a3.431e-2126.67eukaryotic translation initiation factor 4 gamma 3... [more]
eif4g3a3.682e-2126.67eukaryotic translation initiation factor 4 gamma 3... [more]
eif4g1a1.913e-2026.72eukaryotic translation initiation factor 4 gamma 1... [more]
eif4g1a1.967e-2026.72eukaryotic translation initiation factor 4 gamma 1... [more]
back to top
BLAST of Eukaryotic translation initiation factor 4 gamma 3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000035786.10.000e+099.88SMESG000035786.1[more]
SMESG000040439.10.000e+098.41SMESG000040439.1[more]
SMESG000040422.10.000e+092.94SMESG000040422.1[more]
SMESG000040405.10.000e+095.91SMESG000040405.1[more]
SMESG000005574.10.000e+094.64SMESG000005574.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30028354 ID=SMED30028354|Name=Eukaryotic translation initiation factor 4 gamma 3|organism=Schmidtea mediterranea sexual|type=transcript|length=2588bp
TTTAATAATCAAATTATTTGTTTAAATAATACTAATTAAATAAAACATAA
TAAAATGTTACCTAATCATATGTTCCAAAACCAACAAGTAGTTTTCAATG
AATCCTTACCAGTAAAAGGGTTTGTAAATTTATCTAATGCTCATAAAGTT
ACCATTTCGTCAAACGTCACATTAGCTGTGCCAGATCAAACTTGTTTTTC
CCAAGATGCTCCTACATTCATACCTGGATCACAGATTTATCAAACTCCCA
TGACACCGAAGTCAACAAAGTTTTCACCAAACGCAGCCCCATTTACACTA
AAGTCAACAGTATTATCACCAAGCGCAACACCTTTTACTCCAAAGTTCAC
AGGTTTTTCTCCTATGGCTAATTCTTTTACACCGAAACGAGAAAGGAAGG
CATTAGTAATTATTAATCCAAAAAATATGGAACAACTCAAGATAGATGAT
ATTGTCAAAATTGCTGTTGATCTCAATGAATCAGTTTCGTCTGTAAAATG
TACTGATTCTGTAACCGAGAGCATATTATCAGTACAAGAATCACCAATTT
GCGATGAATTGCATTCAAAAGAAAACGGTTCAGAAGAAAATACTGACGAA
AATACACACGAGGTTGTAAATTTCAATGAAATGAAACCAGACGAAACTGA
AATCGTTAATGAAGATATAATAGTTCCAGCAACAAACAAAAAGAAAATTT
TTTCACGTAAAGAATTACTAAAGCATATCAATTATGAAGACGCTCCAAAA
AATTTGCCATTGATGAGCTCGTGGCTCCAAGAAATTTTCACAATTAAAAC
AAACAAACTTGAGTATATTAATATTTCATGCGAAGAAGAGATTGAAATGG
ATTGGAAGCGTGGATCAAAAATCCAAAAGCTTGCGCATCACGAAAATGGA
TATCTTCCTCCTCAATTGAGACAAAGTGAAAAGGACGATCTAGAGGCCAA
TTTAAAGAGAAATATTAAAGCAACACTTAATAAAATGACACCAGAGAATT
TCGATTTATGTTTTAACGAAATCTCTGGCTACAAGTTAGCTTCAAAAGAA
GAAATGGCCATTTTAACCGATATCATATTCGATAAAGCTATACAAGAGGA
ATCATATTCCCAAATTTACTCAACATTCTCAGCTAGAATGGTGAAACCAG
GTGAGAAAACGAGTGATTATAAGTCAATGTTGTTACAAAAATGCAAAGCG
ATGTTTGACAAGCCTCTAAAAACTCAAACGGAAGAGGCAAGGATTAGATG
GATAGAAAAAATAGACAATGAGACTGATGAGAGAATGAAAAGTCTTTACG
CTTCAGACACTGAAGAGCAAGTTTGCAAAGCGAAAGATAAATATTTTGGA
AATATCAGATTTATTTCTGAATTATTTTTGCAGGGGGTTTTGATGGGAAG
AATAGTATTGCATTGCGTAAATGGGTTATTGAATCAATCAGACGATCAAA
TTTCGATGGAAGGTGTGTGTAAGATACTTCAAGTAACGGGAAAGAAGCTA
GAAGAGCAACATGCGGTTGAGGTAAAGAAGGCACTTGATAAAATGTCCAT
ACTATCCAAATCTGATAATTTGGATCTGAAAACTAAATTTAAGCTAAAAG
ATATTTTGGATATGAAAAATCGGGATTGGGAAATGAGAGAAGTACAAATT
GCTAAATCTTCTGTTCCAAAAACACTTAACGAACTGAAAAAAGAAAAAGA
AGTTAAAACTGTTTTAGAACCAGCTTGGAGATGGAATAGTTTTACGAATA
ATCAGAAAGGAGCGACAAATAATTCATATAAACCAGATATCAAAGTACAA
AAATCCACTGGGAATACAAAGCCTTCAAATGAAAAAGTTCCTGTACAAAA
AATTGGAGGGTGGAATACAATTGTTAAGAAAACACCAAAACAAGATTTTG
TCAATAAATTGGCAGGTGCAGACAAGTCAAAAGCATTGAAAACTCAAAAT
AAGTTTTCATTATTAGCAGAGGAAAAAGAAACCGCTGAGATTCCAGTTTG
CTCAATTGATAAGCCTGTGAAAGTTTTGACTACCATATCTGACAATAGGA
ATGATGAAGAGATTTCGGAAGAATTGTTCAAAGATATAATGAAAAGTGAA
GCTTCACCGGATCGTTGGCGTCAGATATCGAAACCGGTTGAAATAATTGA
CAAGTGGCTTGATAAAATATTGGAGAGGAGATCAGACAGTCGGGCACTGC
TTGGTGACTACTTCAATAAGTTATTCAAATTGAAATTGTTGAGTAAAGAC
GATTTCATTGAAGGTTCAAAACAAATATTGGAATGTTCAGGGGATCTGAT
ATCAGACATTCCTAAATTGTGGGAATTCTGGGCTGAATTTCTCGAGAGGT
TCATCGAAAATGGAGAGTCGAACATAGGATTTTTCAACCTATTTTTCAAA
AATGTCGAAAATAAAAGTGACATTACAAAGTGTCGCAATTGTATTAAAGC
TTATGCGAGTGAAAGGGTTGGCAGTGATGTCGTAGAGTCTTTATTTGCCA
AATGGAAAATCACGTCTTGATTCTTTGATCACGGCGATAGAAAATTGTTT
ATTTGCTAAAGATTTTAAATTTATTAGAGTTCCTGTAT
back to top

protein sequence of SMED30028354-orf-1

>SMED30028354-orf-1 ID=SMED30028354-orf-1|Name=SMED30028354-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=822bp
MLPNHMFQNQQVVFNESLPVKGFVNLSNAHKVTISSNVTLAVPDQTCFSQ
DAPTFIPGSQIYQTPMTPKSTKFSPNAAPFTLKSTVLSPSATPFTPKFTG
FSPMANSFTPKRERKALVIINPKNMEQLKIDDIVKIAVDLNESVSSVKCT
DSVTESILSVQESPICDELHSKENGSEENTDENTHEVVNFNEMKPDETEI
VNEDIIVPATNKKKIFSRKELLKHINYEDAPKNLPLMSSWLQEIFTIKTN
KLEYINISCEEEIEMDWKRGSKIQKLAHHENGYLPPQLRQSEKDDLEANL
KRNIKATLNKMTPENFDLCFNEISGYKLASKEEMAILTDIIFDKAIQEES
YSQIYSTFSARMVKPGEKTSDYKSMLLQKCKAMFDKPLKTQTEEARIRWI
EKIDNETDERMKSLYASDTEEQVCKAKDKYFGNIRFISELFLQGVLMGRI
VLHCVNGLLNQSDDQISMEGVCKILQVTGKKLEEQHAVEVKKALDKMSIL
SKSDNLDLKTKFKLKDILDMKNRDWEMREVQIAKSSVPKTLNELKKEKEV
KTVLEPAWRWNSFTNNQKGATNNSYKPDIKVQKSTGNTKPSNEKVPVQKI
GGWNTIVKKTPKQDFVNKLAGADKSKALKTQNKFSLLAEEKETAEIPVCS
IDKPVKVLTTISDNRNDEEISEELFKDIMKSEASPDRWRQISKPVEIIDK
WLDKILERRSDSRALLGDYFNKLFKLKLLSKDDFIEGSKQILECSGDLIS
DIPKLWEFWAEFLERFIENGESNIGFFNLFFKNVENKSDITKCRNCIKAY
ASERVGSDVVESLFAKWKITS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003729mRNA binding
GO:0003723RNA binding
GO:0005515protein binding
GO:0005488binding
GO:0003743translation initiation factor activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
Vocabulary: INTERPRO
TermDefinition
IPR003890MIF4G-like_typ-3
IPR016021MIF4-like_sf
IPR003891Initiation_fac_eIF4g_MI
IPR016024ARM-type_fold
Vocabulary: biological process
TermDefinition
GO:0006413translational initiation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003890MIF4G-like, type 3SMARTSM00543if4_15coord: 301..524
e-value: 1.3E-13
score: 61.2
IPR003890MIF4G-like, type 3PFAMPF02854MIF4Gcoord: 304..523
e-value: 7.1E-21
score: 74.8
IPR016021MIF4G-like domain superfamilyGENE3DG3DSA:1.25.40.180coord: 688..820
e-value: 8.9E-18
score: 66.5
IPR016021MIF4G-like domain superfamilyGENE3DG3DSA:1.25.40.180coord: 290..526
e-value: 8.0E-47
score: 161.5
IPR003891Initiation factor eIF-4 gamma, MA3PFAMPF02847MA3coord: 695..770
e-value: 4.0E-6
score: 26.8
IPR003891Initiation factor eIF-4 gamma, MA3PROSITEPS51366MIcoord: 652..782
score: 10.258
NoneNo IPR availablePANTHERPTHR23253EUKARYOTIC TRANSLATION INITIATION FACTOR 4 GAMMAcoord: 170..771
IPR016024Armadillo-type foldSUPERFAMILYSSF48371ARM repeatcoord: 696..782
IPR016024Armadillo-type foldSUPERFAMILYSSF48371ARM repeatcoord: 299..525