Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1

Overview
NameDolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1
Smed IDSMED30028353
Length (bp)456
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 (SMED30028353) t-SNE clustered cells

Violin plots show distribution of expression levels for Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 (SMED30028353) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 (SMED30028353) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 (SMED30028353) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30028353

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30028353SMESG000050730.1 dd_Smed_v4_2109_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30028353SMESG000050730.1 dd_Smed_v4_2109_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30028353SMESG000050730.1 dd_Smed_v4_2109_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30028353SMESG000050730.1 dd_Smed_v4_2109_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30028353SMESG000050730.1 dd_Smed_v4_2109_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30028353SMESG000050730.1 dd_Smed_v4_2109_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30028353SMESG000050730.1 dd_Smed_v4_2109_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30028353SMESG000050730.1 Contig42205newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30028353SMESG000050730.1 Contig42205uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
epidermisSMED30028353SMESG000050730.1 dd_Smed_v6_2109_1dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 vs. Ensembl Human
Match: DAD1 (defender against cell death 1 [Source:HGNC Symbol;Acc:HGNC:2664])

HSP 1 Score: 175.252 bits (443), Expect = 4.761e-57
Identity = 80/110 (72.73%), Postives = 96/110 (87.27%), Query Frame = 3
Query:   87 SVLSILSNFASDYAKTTPRRLKLIDSYMLYVLLTGIVQFLYCCIVGTFPFNAFLSGFISCVASFVLASCLRMQINPQNKNDFNGISPERAFADFLFAHVILHLVVMNFIG 416
            SV+S++S F  +Y  +TP+RLKL+D+Y+LY+LLTG +QF YC +VGTFPFN+FLSGFISCV SF+LA CLR+QINPQNK DF GISPERAFADFLFA  ILHLVVMNF+G
Sbjct:    4 SVVSVISRFLEEYLSSTPQRLKLLDAYLLYILLTGALQFGYCLLVGTFPFNSFLSGFISCVGSFILAVCLRIQINPQNKADFQGISPERAFADFLFASTILHLVVMNFVG 113          
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 vs. Ensembl Human
Match: DAD1 (defender against cell death 1 [Source:HGNC Symbol;Acc:HGNC:2664])

HSP 1 Score: 116.316 bits (290), Expect = 2.753e-34
Identity = 58/110 (52.73%), Postives = 72/110 (65.45%), Query Frame = 3
Query:   87 SVLSILSNFASDYAKTTPRRLKLIDSYMLYVLLTGIVQFLYCCIVGTFPFNAFLSGFISCVASFVLASCLRMQINPQNKNDFNGISPERAFADFLFAHVILHLVVMNFIG 416
            SV+S++S F  +Y  +TP+RLKL+D+Y+LY+LLTG +QF+                            CLR+QINPQNK DF GISPERAFADFLFA  ILHLVVMNF+G
Sbjct:    4 SVVSVISRFLEEYLSSTPQRLKLLDAYLLYILLTGALQFV----------------------------CLRIQINPQNKADFQGISPERAFADFLFASTILHLVVMNFVG 85          
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 vs. Ensembl Human
Match: DAD1 (defender against cell death 1 [Source:HGNC Symbol;Acc:HGNC:2664])

HSP 1 Score: 99.3673 bits (246), Expect = 1.436e-27
Identity = 45/70 (64.29%), Postives = 59/70 (84.29%), Query Frame = 3
Query:   87 SVLSILSNFASDYAKTTPRRLKLIDSYMLYVLLTGIVQFLYCCIVGTFPFNAFLSGFISCVASFVLASCL 296
            SV+S++S F  +Y  +TP+RLKL+D+Y+LY+LLTG +QF YC +VGTFPFN+FLSGFISCV SF+LA  L
Sbjct:    4 SVVSVISRFLEEYLSSTPQRLKLLDAYLLYILLTGALQFGYCLLVGTFPFNSFLSGFISCVGSFILAGSL 73          
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 vs. Ensembl Human
Match: DAD1 (defender against cell death 1 [Source:HGNC Symbol;Acc:HGNC:2664])

HSP 1 Score: 49.2914 bits (116), Expect = 2.778e-8
Identity = 20/39 (51.28%), Postives = 31/39 (79.49%), Query Frame = 3
Query:   87 SVLSILSNFASDYAKTTPRRLKLIDSYMLYVLLTGIVQF 203
            SV+S++S F  +Y  +TP+RLKL+D+Y+LY+LLTG +  
Sbjct:    4 SVVSVISRFLEEYLSSTPQRLKLLDAYLLYILLTGALHL 42          
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 vs. Ensembl Celegans
Match: dad-1 (Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit dad-1 [Source:UniProtKB/Swiss-Prot;Acc:P52872])

HSP 1 Score: 158.303 bits (399), Expect = 8.637e-51
Identity = 71/110 (64.55%), Postives = 91/110 (82.73%), Query Frame = 3
Query:   87 SVLSILSNFASDYAKTTPRRLKLIDSYMLYVLLTGIVQFLYCCIVGTFPFNAFLSGFISCVASFVLASCLRMQINPQNKNDFNGISPERAFADFLFAHVILHLVVMNFIG 416
             V+ +LS    DY KTT  +LK+ID+YM Y+L TGI QF+YC +VGTFPFN+FLSGFIS V SFVLASCLRMQ+N +N+++F  +S ERAFADF+FA++ILHLVV+NF+G
Sbjct:    4 QVVPVLSKLFDDYQKTTSSKLKIIDAYMTYILFTGIFQFIYCLLVGTFPFNSFLSGFISTVTSFVLASCLRMQVNQENRSEFTAVSTERAFADFIFANLILHLVVVNFLG 113          
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 vs. Ensembl Fly
Match: Dad1 (gene:FBgn0263852 transcript:FBtr0079719)

HSP 1 Score: 169.474 bits (428), Expect = 3.447e-55
Identity = 77/107 (71.96%), Postives = 94/107 (87.85%), Query Frame = 3
Query:   96 SILSNFASDYAKTTPRRLKLIDSYMLYVLLTGIVQFLYCCIVGTFPFNAFLSGFISCVASFVLASCLRMQINPQNKNDFNGISPERAFADFLFAHVILHLVVMNFIG 416
            S++S F +DY + TP++LKL+D Y+ Y+LLTGI+QF+YCC+VGTFPFN+FLSGFIS V+ FVLA CLR+Q NPQNK+ F GISPER FADF+FAHVILHLVVMNFIG
Sbjct:    6 SVISKFYNDYVQNTPKKLKLVDIYLGYILLTGIIQFVYCCLVGTFPFNSFLSGFISTVSCFVLAVCLRLQANPQNKSVFAGISPERGFADFIFAHVILHLVVMNFIG 112          
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 vs. Ensembl Zebrafish
Match: dad1 (defender against cell death 1 [Source:ZFIN;Acc:ZDB-GENE-060503-233])

HSP 1 Score: 168.703 bits (426), Expect = 1.074e-54
Identity = 76/110 (69.09%), Postives = 94/110 (85.45%), Query Frame = 3
Query:   87 SVLSILSNFASDYAKTTPRRLKLIDSYMLYVLLTGIVQFLYCCIVGTFPFNAFLSGFISCVASFVLASCLRMQINPQNKNDFNGISPERAFADFLFAHVILHLVVMNFIG 416
            SV S++S F  +Y  +T  +LK+ID+Y+LY+LLTG+ QFLYC +VGTFPFN+FLSGFISCV SF+LA CLR+QINPQNK DF  +SPERAFADFLFAH +LHLVV+NF+G
Sbjct:    4 SVFSVISRFVEEYRSSTLTKLKVIDAYLLYILLTGVFQFLYCLLVGTFPFNSFLSGFISCVGSFILAVCLRIQINPQNKGDFLTVSPERAFADFLFAHTVLHLVVVNFVG 113          
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 vs. Ensembl Xenopus
Match: ahi1 (Abelson helper integration site 1 [Source:Xenbase;Acc:XB-GENE-5879819])

HSP 1 Score: 165.236 bits (417), Expect = 3.283e-53
Identity = 75/103 (72.82%), Postives = 90/103 (87.38%), Query Frame = 3
Query:  108 NFASDYAKTTPRRLKLIDSYMLYVLLTGIVQFLYCCIVGTFPFNAFLSGFISCVASFVLASCLRMQINPQNKNDFNGISPERAFADFLFAHVILHLVVMNFIG 416
             F  +Y  +TP+RLKL+D+Y+LY+LLTG +QFLYC +VGTFPFN+FLSGFIS V SF+L  CLR+QINPQNK+DF GISPERAFADFLFA+ ILHLVV+NFIG
Sbjct:   11 RFLDEYVSSTPQRLKLLDAYLLYILLTGALQFLYCLLVGTFPFNSFLSGFISSVGSFILGVCLRIQINPQNKSDFQGISPERAFADFLFANTILHLVVINFIG 113          
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 vs. Ensembl Xenopus
Match: ahi1 (Abelson helper integration site 1 [Source:Xenbase;Acc:XB-GENE-5879819])

HSP 1 Score: 165.622 bits (418), Expect = 3.448e-53
Identity = 75/102 (73.53%), Postives = 90/102 (88.24%), Query Frame = 3
Query:  111 FASDYAKTTPRRLKLIDSYMLYVLLTGIVQFLYCCIVGTFPFNAFLSGFISCVASFVLASCLRMQINPQNKNDFNGISPERAFADFLFAHVILHLVVMNFIG 416
            F  +Y  +TP+RLKL+D+Y+LY+LLTG +QFLYC +VGTFPFN+FLSGFIS V SF+L  CLR+QINPQNK+DF GISPERAFADFLFA+ ILHLVV+NFIG
Sbjct:   24 FLDEYVSSTPQRLKLLDAYLLYILLTGALQFLYCLLVGTFPFNSFLSGFISSVGSFILGVCLRIQINPQNKSDFQGISPERAFADFLFANTILHLVVINFIG 125          
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 vs. Ensembl Mouse
Match: Dad1 (defender against cell death 1 [Source:MGI Symbol;Acc:MGI:101912])

HSP 1 Score: 175.252 bits (443), Expect = 3.268e-57
Identity = 80/110 (72.73%), Postives = 96/110 (87.27%), Query Frame = 3
Query:   87 SVLSILSNFASDYAKTTPRRLKLIDSYMLYVLLTGIVQFLYCCIVGTFPFNAFLSGFISCVASFVLASCLRMQINPQNKNDFNGISPERAFADFLFAHVILHLVVMNFIG 416
            SV+S++S F  +Y  +TP+RLKL+D+Y+LY+LLTG +QF YC +VGTFPFN+FLSGFISCV SF+LA CLR+QINPQNK DF GISPERAFADFLFA  ILHLVVMNF+G
Sbjct:    4 SVVSVISRFLEEYLSSTPQRLKLLDAYLLYILLTGALQFGYCLLVGTFPFNSFLSGFISCVGSFILAVCLRIQINPQNKADFQGISPERAFADFLFASTILHLVVMNFVG 113          
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 vs. Ensembl Mouse
Match: Dad1 (defender against cell death 1 [Source:MGI Symbol;Acc:MGI:101912])

HSP 1 Score: 175.252 bits (443), Expect = 3.268e-57
Identity = 80/110 (72.73%), Postives = 96/110 (87.27%), Query Frame = 3
Query:   87 SVLSILSNFASDYAKTTPRRLKLIDSYMLYVLLTGIVQFLYCCIVGTFPFNAFLSGFISCVASFVLASCLRMQINPQNKNDFNGISPERAFADFLFAHVILHLVVMNFIG 416
            SV+S++S F  +Y  +TP+RLKL+D+Y+LY+LLTG +QF YC +VGTFPFN+FLSGFISCV SF+LA CLR+QINPQNK DF GISPERAFADFLFA  ILHLVVMNF+G
Sbjct:    4 SVVSVISRFLEEYLSSTPQRLKLLDAYLLYILLTGALQFGYCLLVGTFPFNSFLSGFISCVGSFILAVCLRIQINPQNKADFQGISPERAFADFLFASTILHLVVMNFVG 113          
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 vs. UniProt/SwissProt
Match: sp|Q29036|DAD1_PIG (Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 OS=Sus scrofa OX=9823 GN=DAD1 PE=3 SV=3)

HSP 1 Score: 176.407 bits (446), Expect = 7.900e-57
Identity = 81/110 (73.64%), Postives = 96/110 (87.27%), Query Frame = 3
Query:   87 SVLSILSNFASDYAKTTPRRLKLIDSYMLYVLLTGIVQFLYCCIVGTFPFNAFLSGFISCVASFVLASCLRMQINPQNKNDFNGISPERAFADFLFAHVILHLVVMNFIG 416
            SVLS++S F  +Y  +TP+RLKL+D+Y+LY+LLTG +QF YC +VGTFPFN+FLSGFISCV SF+LA CLR+QINPQNK DF GISPERAFADFLFA  ILHLVVMNF+G
Sbjct:    4 SVLSVISRFLEEYLSSTPQRLKLLDAYLLYILLTGALQFGYCLLVGTFPFNSFLSGFISCVGSFILAVCLRIQINPQNKADFQGISPERAFADFLFASTILHLVVMNFVG 113          
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 vs. UniProt/SwissProt
Match: sp|Q5E9C2|DAD1_BOVIN (Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 OS=Bos taurus OX=9913 GN=DAD1 PE=3 SV=3)

HSP 1 Score: 175.637 bits (444), Expect = 1.351e-56
Identity = 81/110 (73.64%), Postives = 95/110 (86.36%), Query Frame = 3
Query:   87 SVLSILSNFASDYAKTTPRRLKLIDSYMLYVLLTGIVQFLYCCIVGTFPFNAFLSGFISCVASFVLASCLRMQINPQNKNDFNGISPERAFADFLFAHVILHLVVMNFIG 416
            SVLS++S F  +Y   TP+RLKL+D+Y+LY+LLTG +QF YC +VGTFPFN+FLSGFISCV SF+LA CLR+QINPQNK DF GISPERAFADFLFA  ILHLVVMNF+G
Sbjct:    4 SVLSVISRFLEEYLSATPQRLKLLDAYLLYILLTGALQFGYCLLVGTFPFNSFLSGFISCVGSFILAVCLRIQINPQNKADFQGISPERAFADFLFASTILHLVVMNFVG 113          
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 vs. UniProt/SwissProt
Match: sp|P61805|DAD1_RAT (Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 OS=Rattus norvegicus OX=10116 GN=Dad1 PE=3 SV=3)

HSP 1 Score: 175.252 bits (443), Expect = 2.286e-56
Identity = 80/110 (72.73%), Postives = 96/110 (87.27%), Query Frame = 3
Query:   87 SVLSILSNFASDYAKTTPRRLKLIDSYMLYVLLTGIVQFLYCCIVGTFPFNAFLSGFISCVASFVLASCLRMQINPQNKNDFNGISPERAFADFLFAHVILHLVVMNFIG 416
            SV+S++S F  +Y  +TP+RLKL+D+Y+LY+LLTG +QF YC +VGTFPFN+FLSGFISCV SF+LA CLR+QINPQNK DF GISPERAFADFLFA  ILHLVVMNF+G
Sbjct:    4 SVVSVISRFLEEYLSSTPQRLKLLDAYLLYILLTGALQFGYCLLVGTFPFNSFLSGFISCVGSFILAVCLRIQINPQNKADFQGISPERAFADFLFASTILHLVVMNFVG 113          
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 vs. UniProt/SwissProt
Match: sp|P61804|DAD1_MOUSE (Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 OS=Mus musculus OX=10090 GN=Dad1 PE=1 SV=3)

HSP 1 Score: 175.252 bits (443), Expect = 2.286e-56
Identity = 80/110 (72.73%), Postives = 96/110 (87.27%), Query Frame = 3
Query:   87 SVLSILSNFASDYAKTTPRRLKLIDSYMLYVLLTGIVQFLYCCIVGTFPFNAFLSGFISCVASFVLASCLRMQINPQNKNDFNGISPERAFADFLFAHVILHLVVMNFIG 416
            SV+S++S F  +Y  +TP+RLKL+D+Y+LY+LLTG +QF YC +VGTFPFN+FLSGFISCV SF+LA CLR+QINPQNK DF GISPERAFADFLFA  ILHLVVMNF+G
Sbjct:    4 SVVSVISRFLEEYLSSTPQRLKLLDAYLLYILLTGALQFGYCLLVGTFPFNSFLSGFISCVGSFILAVCLRIQINPQNKADFQGISPERAFADFLFASTILHLVVMNFVG 113          
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 vs. UniProt/SwissProt
Match: sp|P61806|DAD1_MESAU (Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 OS=Mesocricetus auratus OX=10036 GN=DAD1 PE=3 SV=3)

HSP 1 Score: 175.252 bits (443), Expect = 2.286e-56
Identity = 80/110 (72.73%), Postives = 96/110 (87.27%), Query Frame = 3
Query:   87 SVLSILSNFASDYAKTTPRRLKLIDSYMLYVLLTGIVQFLYCCIVGTFPFNAFLSGFISCVASFVLASCLRMQINPQNKNDFNGISPERAFADFLFAHVILHLVVMNFIG 416
            SV+S++S F  +Y  +TP+RLKL+D+Y+LY+LLTG +QF YC +VGTFPFN+FLSGFISCV SF+LA CLR+QINPQNK DF GISPERAFADFLFA  ILHLVVMNF+G
Sbjct:    4 SVVSVISRFLEEYLSSTPQRLKLLDAYLLYILLTGALQFGYCLLVGTFPFNSFLSGFISCVGSFILAVCLRIQINPQNKADFQGISPERAFADFLFASTILHLVVMNFVG 113          
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 vs. TrEMBL
Match: A0A4Y7NL95 (Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 OS=Scapholeberis mucronata OX=202097 GN=EOG090X0KAT PE=2 SV=1)

HSP 1 Score: 184.882 bits (468), Expect = 8.402e-58
Identity = 82/110 (74.55%), Postives = 98/110 (89.09%), Query Frame = 3
Query:   87 SVLSILSNFASDYAKTTPRRLKLIDSYMLYVLLTGIVQFLYCCIVGTFPFNAFLSGFISCVASFVLASCLRMQINPQNKNDFNGISPERAFADFLFAHVILHLVVMNFIG 416
            S+ ++L+ F  +YAKTTP +LKLIDSY+LY+LLTGIVQFLYCC+VGTFPFN+FLSGFISCV SFVLA+CLR+Q+NP NK  F  ISPERAFADF+FAH++LHL VMNFIG
Sbjct:    4 SITTVLAKFYEEYAKTTPSKLKLIDSYLLYILLTGIVQFLYCCLVGTFPFNSFLSGFISCVGSFVLAACLRLQVNPANKGQFEQISPERAFADFIFAHIVLHLTVMNFIG 113          
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 vs. TrEMBL
Match: A0A4Y7N2S4 (Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 OS=Daphnia similis OX=35528 GN=EOG090X0KAT PE=2 SV=1)

HSP 1 Score: 184.496 bits (467), Expect = 1.233e-57
Identity = 81/110 (73.64%), Postives = 99/110 (90.00%), Query Frame = 3
Query:   87 SVLSILSNFASDYAKTTPRRLKLIDSYMLYVLLTGIVQFLYCCIVGTFPFNAFLSGFISCVASFVLASCLRMQINPQNKNDFNGISPERAFADFLFAHVILHLVVMNFIG 416
            SV+S+++ F  +YAKTTP +LKLID+Y+ Y+LLTGIVQFLYCC+VGTFPFN+FLSGFISCV SFVLA+CLR+Q+NP+NK  F  ISPERAFADF+FAH++LHL VMNFIG
Sbjct:    4 SVISVIAKFYEEYAKTTPSKLKLIDAYLFYILLTGIVQFLYCCLVGTFPFNSFLSGFISCVGSFVLAACLRLQVNPENKGQFEKISPERAFADFIFAHMVLHLTVMNFIG 113          
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 vs. TrEMBL
Match: A0A4Y7LZS2 (Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 OS=Ceriodaphnia reticulata OX=302197 GN=EOG090X0KAT PE=2 SV=1)

HSP 1 Score: 184.111 bits (466), Expect = 1.751e-57
Identity = 82/110 (74.55%), Postives = 98/110 (89.09%), Query Frame = 3
Query:   87 SVLSILSNFASDYAKTTPRRLKLIDSYMLYVLLTGIVQFLYCCIVGTFPFNAFLSGFISCVASFVLASCLRMQINPQNKNDFNGISPERAFADFLFAHVILHLVVMNFIG 416
            S+ S+++ F  +YAKTTP +LKLIDSY+LY+LLTG+VQFLYCC+VGTFPFN+FLSGFISCV SFVLA+CLR+Q+NP NK  F  ISPERAFADF+FAHV+LHL VMNFIG
Sbjct:    4 SLTSVVAKFYEEYAKTTPSKLKLIDSYLLYILLTGVVQFLYCCLVGTFPFNSFLSGFISCVGSFVLAACLRLQVNPANKGQFEQISPERAFADFIFAHVVLHLTVMNFIG 113          
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 vs. TrEMBL
Match: A0A4Y7NG56 (Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 OS=Daphnia sinensis OX=1820382 GN=EOG090X0KAT PE=2 SV=1)

HSP 1 Score: 184.111 bits (466), Expect = 2.180e-57
Identity = 81/110 (73.64%), Postives = 98/110 (89.09%), Query Frame = 3
Query:   87 SVLSILSNFASDYAKTTPRRLKLIDSYMLYVLLTGIVQFLYCCIVGTFPFNAFLSGFISCVASFVLASCLRMQINPQNKNDFNGISPERAFADFLFAHVILHLVVMNFIG 416
            SV S+++ F  +YAKTTP +LKLID+Y+ Y+LLTGIVQFLYCC+VGTFPFN+FLSGFISCV SFVLA+CLR+Q+NP+NK  F  ISPERAFADF+FAH++LHL VMNFIG
Sbjct:    4 SVTSVIAKFYEEYAKTTPSKLKLIDAYLFYILLTGIVQFLYCCLVGTFPFNSFLSGFISCVGSFVLAACLRLQVNPENKGQFEKISPERAFADFIFAHMVLHLTVMNFIG 113          
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 vs. TrEMBL
Match: A0A4Y7MB68 (Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 OS=Daphnia lumholtzi OX=42856 GN=EOG090X0KAT PE=2 SV=1)

HSP 1 Score: 183.726 bits (465), Expect = 2.774e-57
Identity = 81/110 (73.64%), Postives = 98/110 (89.09%), Query Frame = 3
Query:   87 SVLSILSNFASDYAKTTPRRLKLIDSYMLYVLLTGIVQFLYCCIVGTFPFNAFLSGFISCVASFVLASCLRMQINPQNKNDFNGISPERAFADFLFAHVILHLVVMNFIG 416
            SV S+++ F  +YAKTTP +LKLID+Y+ Y+LLTGIVQFLYCC+VGTFPFN+FLSGFISCV SFVLA+CLR+Q+NP+NK  F  ISPERAFADF+FAH++LHL VMNFIG
Sbjct:    4 SVTSVIAKFYEEYAKTTPSKLKLIDAYLFYILLTGIVQFLYCCLVGTFPFNSFLSGFISCVGSFVLAACLRLQVNPENKGQFEKISPERAFADFIFAHLVLHLTVMNFIG 113          
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 vs. Ensembl Cavefish
Match: dad1 (dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit dad1-like [Source:NCBI gene;Acc:103040403])

HSP 1 Score: 163.696 bits (413), Expect = 8.946e-53
Identity = 75/110 (68.18%), Postives = 91/110 (82.73%), Query Frame = 3
Query:   87 SVLSILSNFASDYAKTTPRRLKLIDSYMLYVLLTGIVQFLYCCIVGTFPFNAFLSGFISCVASFVLASCLRMQINPQNKNDFNGISPERAFADFLFAHVILHLVVMNFIG 416
            SV S+L+ F  +Y   T  +LK+ID+Y+LY+LLTG  QFLYC +VGTFPFN+FLSGFIS V SF+LA CLR+QINPQNK +F  +SPERAFADFLFAH +LHLVV+NFIG
Sbjct:    4 SVFSVLTRFVEEYRNRTSSKLKVIDAYLLYILLTGAFQFLYCLLVGTFPFNSFLSGFISSVGSFILAVCLRIQINPQNKGEFLSVSPERAFADFLFAHTVLHLVVVNFIG 113          
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 vs. Ensembl Cavefish
Match: dad1 (dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit dad1-like [Source:NCBI gene;Acc:103040403])

HSP 1 Score: 163.696 bits (413), Expect = 8.946e-53
Identity = 75/110 (68.18%), Postives = 91/110 (82.73%), Query Frame = 3
Query:   87 SVLSILSNFASDYAKTTPRRLKLIDSYMLYVLLTGIVQFLYCCIVGTFPFNAFLSGFISCVASFVLASCLRMQINPQNKNDFNGISPERAFADFLFAHVILHLVVMNFIG 416
            SV S+L+ F  +Y   T  +LK+ID+Y+LY+LLTG  QFLYC +VGTFPFN+FLSGFIS V SF+LA CLR+QINPQNK +F  +SPERAFADFLFAH +LHLVV+NFIG
Sbjct:    4 SVFSVLTRFVEEYRNRTSSKLKVIDAYLLYILLTGAFQFLYCLLVGTFPFNSFLSGFISSVGSFILAVCLRIQINPQNKGEFLSVSPERAFADFLFAHTVLHLVVVNFIG 113          
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 vs. Ensembl Cavefish
Match: DAD1 (dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 [Source:NCBI gene;Acc:103046192])

HSP 1 Score: 161.384 bits (407), Expect = 7.818e-52
Identity = 72/103 (69.90%), Postives = 88/103 (85.44%), Query Frame = 3
Query:  108 NFASDYAKTTPRRLKLIDSYMLYVLLTGIVQFLYCCIVGTFPFNAFLSGFISCVASFVLASCLRMQINPQNKNDFNGISPERAFADFLFAHVILHLVVMNFIG 416
             F  +Y  +T  RLK++D+Y+LY+LLTG +QFLYC +VGTFPFN+FLSGFISCV SF+LA CLR+QINPQNK +F  ISPERAFADFLFAH +LHLVV+NF+G
Sbjct:   11 RFLEEYRSSTSTRLKVVDAYLLYILLTGALQFLYCLLVGTFPFNSFLSGFISCVGSFILAVCLRIQINPQNKGEFLSISPERAFADFLFAHTVLHLVVINFVG 113          
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 vs. Ensembl Sea Lamprey
Match: dad1 (defender against cell death 1 [Source:ZFIN;Acc:ZDB-GENE-060503-233])

HSP 1 Score: 170.629 bits (431), Expect = 5.459e-56
Identity = 78/122 (63.93%), Postives = 99/122 (81.15%), Query Frame = 3
Query:   51 KLGNMTVSAPNLSVLSILSNFASDYAKTTPRRLKLIDSYMLYVLLTGIVQFLYCCIVGTFPFNAFLSGFISCVASFVLASCLRMQINPQNKNDFNGISPERAFADFLFAHVILHLVVMNFIG 416
            +  NMT       +L+++S F  +Y  TTP +LKL+DSY+ YVL+TG+ QF YCC+VGTFPFN+FLSGFISCV SF+LA CLR+Q+NP+NK +F  ISPERAFADFLFAH+ILH+VV+NFIG
Sbjct:   17 RKANMTSQ-----LLTVVSKFYDEYRSTTPSKLKLVDSYLAYVLVTGLAQFAYCCLVGTFPFNSFLSGFISCVGSFILAVCLRIQVNPRNKEEFVNISPERAFADFLFAHIILHIVVVNFIG 133          
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 vs. Ensembl Yeast
Match: OST2 (Epsilon subunit of the oligosaccharyltransferase complex; located in the ER lumen; catalyzes asparagine-linked glycosylation of newly synthesized proteins [Source:SGD;Acc:S000005629])

HSP 1 Score: 80.8777 bits (198), Expect = 5.716e-21
Identity = 48/118 (40.68%), Postives = 73/118 (61.86%), Query Frame = 3
Query:   96 SILSNFASDYAKTTPR----------RLKLIDSYMLYVLLTGIVQFLYCCIV-GTFPFNAFLSGFISCVASFVLASCLRMQINPQNKNDFNGISPERAFADFLFAHVILHLVVMNFIG 416
            ++L++F   + KT+ R          +LKLID++  +++L G++Q  +  ++   FPFNAFL+GFI CV  FVL   LR+Q+     N F GIS  RAFA+F+ A +ILH V ++FI 
Sbjct:   18 AVLTDFQETF-KTSKRAYFAQIEKYPKLKLIDTFCFFLVLLGVIQCTFIILIRDNFPFNAFLAGFIICVGQFVLLMSLRLQLC----NSFPGISKNRAFAEFIVASLILHFVCLHFIN 130          
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 vs. Ensembl Nematostella
Match: EDO34913 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SMZ2])

HSP 1 Score: 159.844 bits (403), Expect = 9.079e-52
Identity = 71/107 (66.36%), Postives = 90/107 (84.11%), Query Frame = 3
Query:   96 SILSNFASDYAKTTPRRLKLIDSYMLYVLLTGIVQFLYCCIVGTFPFNAFLSGFISCVASFVLASCLRMQINPQNKNDFNGISPERAFADFLFAHVILHLVVMNFIG 416
             IL  F  +Y++TTP+RLK++D+Y+ Y++ TGI+QF YCC+VGTFPFN+FL+GFIS V SFVLA CLR+Q NP N ++F GISPERAF DF+FA +ILHLVVMNFIG
Sbjct:    9 DILVRFYDEYSQTTPQRLKIVDAYLGYIMFTGIIQFTYCCLVGTFPFNSFLAGFISSVGSFVLAVCLRVQSNPANYSEFKGISPERAFGDFIFASIILHLVVMNFIG 115          
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 vs. Ensembl Medaka
Match: dad1 (dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 [Source:NCBI gene;Acc:101167823])

HSP 1 Score: 175.252 bits (443), Expect = 2.337e-57
Identity = 79/110 (71.82%), Postives = 95/110 (86.36%), Query Frame = 3
Query:   87 SVLSILSNFASDYAKTTPRRLKLIDSYMLYVLLTGIVQFLYCCIVGTFPFNAFLSGFISCVASFVLASCLRMQINPQNKNDFNGISPERAFADFLFAHVILHLVVMNFIG 416
            SV+S++S F  +Y  TTP +LK++D+Y+LY+LLTG +QFLYC +VGTFPFN+FLSGFISCV SF+L  CLR+QINPQNK DF  ISPERAFADFLFAH +LHLVVMNFIG
Sbjct:    4 SVISVISRFLEEYTTTTPNKLKVVDAYLLYILLTGALQFLYCLLVGTFPFNSFLSGFISCVGSFILGVCLRIQINPQNKGDFLSISPERAFADFLFAHTVLHLVVMNFIG 113          
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 vs. Ensembl Medaka
Match: dad1 (dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 [Source:NCBI gene;Acc:101158164])

HSP 1 Score: 120.168 bits (300), Expect = 4.900e-36
Identity = 60/110 (54.55%), Postives = 72/110 (65.45%), Query Frame = 3
Query:   87 SVLSILSNFASDYAKTTPRRLKLIDSYMLYVLLTGIVQFLYCCIVGTFPFNAFLSGFISCVASFVLASCLRMQINPQNKNDFNGISPERAFADFLFAHVILHLVVMNFIG 416
            SVLS++S F  +Y  TTP +LK++D+Y+LY+LLTG +QFLY C                          LR+QINPQNK DF  ISPERAFADFLFAH +LHLVVMNFIG
Sbjct:    4 SVLSVISRFLEEYTTTTPNKLKVVDAYLLYILLTGALQFLYLC--------------------------LRIQINPQNKGDFLSISPERAFADFLFAHTVLHLVVMNFIG 87          
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 vs. Planmine SMEST
Match: SMESG000050730.1 (SMESG000050730.1)

HSP 1 Score: 239.965 bits (611), Expect = 4.779e-83
Identity = 118/118 (100.00%), Postives = 118/118 (100.00%), Query Frame = 3
Query:   63 MTVSAPNLSVLSILSNFASDYAKTTPRRLKLIDSYMLYVLLTGIVQFLYCCIVGTFPFNAFLSGFISCVASFVLASCLRMQINPQNKNDFNGISPERAFADFLFAHVILHLVVMNFIG 416
            MTVSAPNLSVLSILSNFASDYAKTTPRRLKLIDSYMLYVLLTGIVQFLYCCIVGTFPFNAFLSGFISCVASFVLASCLRMQINPQNKNDFNGISPERAFADFLFAHVILHLVVMNFIG
Sbjct:    1 MTVSAPNLSVLSILSNFASDYAKTTPRRLKLIDSYMLYVLLTGIVQFLYCCIVGTFPFNAFLSGFISCVASFVLASCLRMQINPQNKNDFNGISPERAFADFLFAHVILHLVVMNFIG 118          
The following BLAST results are available for this feature:
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
DAD14.761e-5772.73defender against cell death 1 [Source:HGNC Symbol;... [more]
DAD12.753e-3452.73defender against cell death 1 [Source:HGNC Symbol;... [more]
DAD11.436e-2764.29defender against cell death 1 [Source:HGNC Symbol;... [more]
DAD12.778e-851.28defender against cell death 1 [Source:HGNC Symbol;... [more]
back to top
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
dad-18.637e-5164.55Dolichyl-diphosphooligosaccharide--protein glycosy... [more]
back to top
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Dad13.447e-5571.96gene:FBgn0263852 transcript:FBtr0079719[more]
back to top
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
dad11.074e-5469.09defender against cell death 1 [Source:ZFIN;Acc:ZDB... [more]
back to top
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ahi13.283e-5372.82Abelson helper integration site 1 [Source:Xenbase;... [more]
ahi13.448e-5373.53Abelson helper integration site 1 [Source:Xenbase;... [more]
back to top
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Dad13.268e-5772.73defender against cell death 1 [Source:MGI Symbol;A... [more]
Dad13.268e-5772.73defender against cell death 1 [Source:MGI Symbol;A... [more]
back to top
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q29036|DAD1_PIG7.900e-5773.64Dolichyl-diphosphooligosaccharide--protein glycosy... [more]
sp|Q5E9C2|DAD1_BOVIN1.351e-5673.64Dolichyl-diphosphooligosaccharide--protein glycosy... [more]
sp|P61805|DAD1_RAT2.286e-5672.73Dolichyl-diphosphooligosaccharide--protein glycosy... [more]
sp|P61804|DAD1_MOUSE2.286e-5672.73Dolichyl-diphosphooligosaccharide--protein glycosy... [more]
sp|P61806|DAD1_MESAU2.286e-5672.73Dolichyl-diphosphooligosaccharide--protein glycosy... [more]
back to top
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4Y7NL958.402e-5874.55Dolichyl-diphosphooligosaccharide--protein glycosy... [more]
A0A4Y7N2S41.233e-5773.64Dolichyl-diphosphooligosaccharide--protein glycosy... [more]
A0A4Y7LZS21.751e-5774.55Dolichyl-diphosphooligosaccharide--protein glycosy... [more]
A0A4Y7NG562.180e-5773.64Dolichyl-diphosphooligosaccharide--protein glycosy... [more]
A0A4Y7MB682.774e-5773.64Dolichyl-diphosphooligosaccharide--protein glycosy... [more]
back to top
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
dad18.946e-5368.18dolichyl-diphosphooligosaccharide--protein glycosy... [more]
dad18.946e-5368.18dolichyl-diphosphooligosaccharide--protein glycosy... [more]
DAD17.818e-5269.90dolichyl-diphosphooligosaccharide--protein glycosy... [more]
back to top
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
dad15.459e-5663.93defender against cell death 1 [Source:ZFIN;Acc:ZDB... [more]
back to top
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
OST25.716e-2140.68Epsilon subunit of the oligosaccharyltransferase c... [more]
back to top
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO349139.079e-5266.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
dad12.337e-5771.82dolichyl-diphosphooligosaccharide--protein glycosy... [more]
dad14.900e-3654.55dolichyl-diphosphooligosaccharide--protein glycosy... [more]
back to top
BLAST of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000050730.14.779e-83100.00SMESG000050730.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30028353 ID=SMED30028353|Name=Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1|organism=Schmidtea mediterranea sexual|type=transcript|length=456bp
GTTTTAATTATAGTGACGTTTAAGTTCAATTTTCAAATTATTCTATTTCA
AAACTTGGAAATATGACTGTATCTGCTCCAAATTTATCAGTTTTAAGTAT
TTTATCGAATTTTGCATCGGATTATGCCAAAACTACTCCTAGAAGATTGA
AGTTAATTGATTCATATATGCTATATGTTTTATTAACTGGAATTGTCCAA
TTTCTGTATTGTTGTATTGTTGGAACATTTCCATTTAATGCTTTTTTATC
TGGATTTATTTCATGTGTAGCATCATTCGTTTTAGCCTCATGCTTAAGAA
TGCAAATCAATCCTCAAAATAAAAATGATTTTAATGGAATATCACCTGAA
AGAGCATTTGCTGATTTTCTCTTTGCTCATGTTATTTTGCATCTTGTTGT
AATGAATTTTATTGGGTAATTTAATTAATAAAAATTAATTGTGGTTTAAA
AAAAAA
back to top

protein sequence of SMED30028353-orf-1

>SMED30028353-orf-1 ID=SMED30028353-orf-1|Name=SMED30028353-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=119bp
MTVSAPNLSVLSILSNFASDYAKTTPRRLKLIDSYMLYVLLTGIVQFLYC
CIVGTFPFNAFLSGFISCVASFVLASCLRMQINPQNKNDFNGISPERAFA
DFLFAHVILHLVVMNFIG*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000101muscle cell
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR003038DAD/Ost2
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0008250oligosaccharyltransferase complex
GO:0005783endoplasmic reticulum
GO:0005789endoplasmic reticulum membrane
GO:0016020membrane
Vocabulary: molecular function
TermDefinition
GO:0004579dolichyl-diphosphooligosaccharide-protein glycotransferase activity
GO:0016740transferase activity
GO:0016757transferase activity, transferring glycosyl groups
Vocabulary: biological process
TermDefinition
GO:0006486protein glycosylation
GO:0006487protein N-linked glycosylation
GO:0006915apoptotic process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003038DAD/Ost2PIRSFPIRSF005588DAD1_Ost2coord: 2..118
e-value: 6.2E-50
score: 166.6
IPR003038DAD/Ost2PFAMPF02109DADcoord: 12..118
e-value: 3.5E-48
score: 162.4
IPR003038DAD/Ost2PANTHERPTHR10705DOLICHYL-DIPHOSPHOOLIGOSACCHARIDE--PROTEIN GLYCOSYLTRANSFERASE SUBUNIT DAD1coord: 9..118
NoneNo IPR availableTMHMMTMhelixcoord: 61..83
NoneNo IPR availableTMHMMTMhelixcoord: 34..56
NoneNo IPR availableTMHMMTMhelixcoord: 98..117