Histone-lysine N-methyltransferase SETMAR

Overview
NameHistone-lysine N-methyltransferase SETMAR
Smed IDSMED30028345
Length (bp)697
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Histone-lysine N-methyltransferase SETMAR (SMED30028345) t-SNE clustered cells

Violin plots show distribution of expression levels for Histone-lysine N-methyltransferase SETMAR (SMED30028345) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Histone-lysine N-methyltransferase SETMAR (SMED30028345) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Histone-lysine N-methyltransferase SETMAR (SMED30028345) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30028345

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30028345h1SMcG0003558 SmedASXL_018479SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X1 cellSMED30028345h1SMcG0003558 SmedASXL_018480SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Histone-lysine N-methyltransferase SETMAR vs. Ensembl Human
Match: SETMAR (SET domain and mariner transposase fusion gene [Source:HGNC Symbol;Acc:HGNC:10762])

HSP 1 Score: 82.0333 bits (201), Expect = 2.723e-25
Identity = 49/140 (35.00%), Postives = 76/140 (54.29%), Query Frame = 3
Query:   54 RVEICQQVLKNPTDDRFWRRIVTLDEKWIYFVNNNRLKQ*VKQENEPEPVIRQDRFGKKVMLSARWNYQGVMHYEFIPDGHAVNAELYCEQLDRVYNILKVKYTALVNRNRILIQFDNDPCHCARIIQQKIDELSGVEVL 473
            R E+   ++    ++ F  RIVT DEKWI + N  R  Q + QE  P+   +     KKVM++  W+  G++HY F+  G  + +E Y +++D +   L+    ALVNR   ++  DN   H A+   QK++EL G EVL
Sbjct:  472 RFEVSSSLILRNHNEPFLDRIVTCDEKWILYDNRRRSAQWLDQEEAPKHFPKPILHPKKVMVTIWWSAAGLIHYSFLNPGETITSEKYAQEIDEMNQKLQRLQLALVNRKGPILLHDNARPHVAQPTLQKLNEL-GYEVL 610          

HSP 2 Score: 52.373 bits (124), Expect = 2.723e-25
Identity = 25/74 (33.78%), Postives = 41/74 (55.41%), Query Frame = 2
Query:  476 PHT-YSSEIAPSDCELFRSMQNFLRRRKFTTLYKVVQACQQFFASKDQNWYFNHIRLLVERWQLAIDNGGLYFD 694
            PH  YS ++ P++  +F+ + NFL+ ++F        A Q+F  S+  ++Y   I  L+ RWQ  +D  G YFD
Sbjct:  611 PHPPYSPDLLPTNYHVFKHLNNFLQGKRFHNQQDAENAFQEFVESQSTDFYATGINQLISRWQKCVDCNGSYFD 684          
BLAST of Histone-lysine N-methyltransferase SETMAR vs. Ensembl Human
Match: SETMAR (SET domain and mariner transposase fusion gene [Source:HGNC Symbol;Acc:HGNC:10762])

HSP 1 Score: 81.6481 bits (200), Expect = 3.676e-25
Identity = 49/140 (35.00%), Postives = 76/140 (54.29%), Query Frame = 3
Query:   54 RVEICQQVLKNPTDDRFWRRIVTLDEKWIYFVNNNRLKQ*VKQENEPEPVIRQDRFGKKVMLSARWNYQGVMHYEFIPDGHAVNAELYCEQLDRVYNILKVKYTALVNRNRILIQFDNDPCHCARIIQQKIDELSGVEVL 473
            R E+   ++    ++ F  RIVT DEKWI + N  R  Q + QE  P+   +     KKVM++  W+  G++HY F+  G  + +E Y +++D +   L+    ALVNR   ++  DN   H A+   QK++EL G EVL
Sbjct:  333 RFEVSSSLILRNHNEPFLDRIVTCDEKWILYDNRRRSAQWLDQEEAPKHFPKPILHPKKVMVTIWWSAAGLIHYSFLNPGETITSEKYAQEIDEMNQKLQRLQLALVNRKGPILLHDNARPHVAQPTLQKLNEL-GYEVL 471          

HSP 2 Score: 52.373 bits (124), Expect = 3.676e-25
Identity = 25/74 (33.78%), Postives = 41/74 (55.41%), Query Frame = 2
Query:  476 PHT-YSSEIAPSDCELFRSMQNFLRRRKFTTLYKVVQACQQFFASKDQNWYFNHIRLLVERWQLAIDNGGLYFD 694
            PH  YS ++ P++  +F+ + NFL+ ++F        A Q+F  S+  ++Y   I  L+ RWQ  +D  G YFD
Sbjct:  472 PHPPYSPDLLPTNYHVFKHLNNFLQGKRFHNQQDAENAFQEFVESQSTDFYATGINQLISRWQKCVDCNGSYFD 545          
BLAST of Histone-lysine N-methyltransferase SETMAR vs. UniProt/SwissProt
Match: sp|Q53H47|SETMR_HUMAN (Histone-lysine N-methyltransferase SETMAR OS=Homo sapiens OX=9606 GN=SETMAR PE=1 SV=2)

HSP 1 Score: 82.0333 bits (201), Expect = 1.135e-24
Identity = 49/140 (35.00%), Postives = 76/140 (54.29%), Query Frame = 3
Query:   54 RVEICQQVLKNPTDDRFWRRIVTLDEKWIYFVNNNRLKQ*VKQENEPEPVIRQDRFGKKVMLSARWNYQGVMHYEFIPDGHAVNAELYCEQLDRVYNILKVKYTALVNRNRILIQFDNDPCHCARIIQQKIDELSGVEVL 473
            R E+   ++    ++ F  RIVT DEKWI + N  R  Q + QE  P+   +     KKVM++  W+  G++HY F+  G  + +E Y +++D +   L+    ALVNR   ++  DN   H A+   QK++EL G EVL
Sbjct:  472 RFEVSSSLILRNHNEPFLDRIVTCDEKWILYDNRRRSAQWLDQEEAPKHFPKPILHPKKVMVTIWWSAAGLIHYSFLNPGETITSEKYAQEIDEMNQKLQRLQLALVNRKGPILLHDNARPHVAQPTLQKLNEL-GYEVL 610          

HSP 2 Score: 52.373 bits (124), Expect = 1.135e-24
Identity = 25/74 (33.78%), Postives = 41/74 (55.41%), Query Frame = 2
Query:  476 PHT-YSSEIAPSDCELFRSMQNFLRRRKFTTLYKVVQACQQFFASKDQNWYFNHIRLLVERWQLAIDNGGLYFD 694
            PH  YS ++ P++  +F+ + NFL+ ++F        A Q+F  S+  ++Y   I  L+ RWQ  +D  G YFD
Sbjct:  611 PHPPYSPDLLPTNYHVFKHLNNFLQGKRFHNQQDAENAFQEFVESQSTDFYATGINQLISRWQKCVDCNGSYFD 684          
BLAST of Histone-lysine N-methyltransferase SETMAR vs. UniProt/SwissProt
Match: sp|Q7JQ07|MOS1T_DROMA (Mariner Mos1 transposase OS=Drosophila mauritiana OX=7226 GN=mariner\T PE=1 SV=1)

HSP 1 Score: 83.5741 bits (205), Expect = 1.445e-17
Identity = 53/161 (32.92%), Postives = 77/161 (47.83%), Query Frame = 3
Query:   54 RVEICQQVLKNPTDDRFWRRIVTLDEKWIYFVNNNRLKQ*VKQENEPEPVIRQDRFGKKVMLSARWNYQGVMHYEFIPDGHAVNAELYCEQLDRVYNILKVKYTALVNR-NRILIQFDNDPCHCARIIQQKIDELSGVEVLHLIHT---AQKLLHLIANCS 524
            R   C+ +L       F  RIVT DEKWI+FV+  R K  V          R +RFGKK ML   W+  GV++YE +  G  VN   Y +QL  +   L+ K      R +R++   DN P H AR ++  ++ L+   + H  ++   A    HL A+  
Sbjct:  132 RKNTCEILLSRYKRKSFLHRIVTGDEKWIFFVSPKRKKSYVDPGQPATSTARPNRFGKKTMLCVWWDQSGVIYYELLKRGETVNTARYQQQLINLNRALQRKRPEYQKRQHRVIFLHDNAPSHTARAVRDTLETLNWEVLPHAAYSPDLAPSDYHLFASMG 292          

HSP 2 Score: 52.7582 bits (125), Expect = 7.179e-7
Identity = 27/74 (36.49%), Postives = 43/74 (58.11%), Query Frame = 2
Query:  476 PHT-YSSEIAPSDCELFRSMQNFLRRRKFTTLYKVVQACQQFFASKDQNWYFNHIRLLVERWQLAIDNGGLYFD 694
            PH  YS ++APSD  LF SM + L  ++F +   V +   ++FA+KD  +Y+  I  L ERW+  + + G Y +
Sbjct:  272 PHAAYSPDLAPSDYHLFASMGHALAEQRFDSYESVKKWLDEWFAAKDDEFYWRGIHKLPERWEKCVASDGKYLE 345          
BLAST of Histone-lysine N-methyltransferase SETMAR vs. TrEMBL
Match: O02473 (Transposase (Fragment) OS=Stylochus zebra OX=46768 PE=4 SV=1)

HSP 1 Score: 166.777 bits (421), Expect = 6.482e-49
Identity = 77/140 (55.00%), Postives = 104/140 (74.29%), Query Frame = 3
Query:   54 RVEICQQVLKNPTDDRFWRRIVTLDEKWIYFVNNNRLKQ*VKQENEPEPVIRQDRFGKKVMLSARWNYQGVMHYEFIPDGHAVNAELYCEQLDRVYNILKVKYTALVNRNRILIQFDNDPCHCARIIQQKIDELSGVEVL 473
            RVEIC+Q+L NP  D+FW+RIVT DEKWI+ +N++R K+ V  +  P PV  Q+RFGKKVML   WN+Q ++HYEF+P+G A++AELYCEQ++RVY  LK KY AL+ R   L+Q DN   H A+  ++K +EL GVE+L
Sbjct:    8 RVEICEQLLDNPHSDQFWKRIVTSDEKWIHLINHSRQKRWVPYDQAPPPVPCQERFGKKVMLCVWWNFQAIIHYEFVPNGRAIDAELYCEQVERVYEKLKEKYPALIRRKCALLQQDNAKPHTAKKTKKKFEELDGVEIL 147          
BLAST of Histone-lysine N-methyltransferase SETMAR vs. TrEMBL
Match: A0A023F551 (Putative transposase (Fragment) OS=Triatoma infestans OX=30076 PE=2 SV=1)

HSP 1 Score: 143.665 bits (361), Expect = 2.012e-48
Identity = 69/140 (49.29%), Postives = 94/140 (67.14%), Query Frame = 3
Query:   54 RVEICQQVLKNPTDDRFWRRIVTLDEKWIYFVNNNRLKQ*VKQENEPEPVIRQDRFGKKVMLSARWNYQGVMHYEFIPDGHAVNAELYCEQLDRVYNILKVKYTALVNRNRILIQFDNDPCHCARIIQQKIDELSGVEVL 473
            RVEIC+ +L  PTD RF+++IVT DEKW+Y+ N +   Q + Q     PV  + +F KK ML   WNY+GV+H+EF+PDG  +N++LYCEQLDRVY  L  +Y ALVNR  +L Q DN   H +R  ++K   L G+E+L
Sbjct:  128 RVEICKNLLMYPTDLRFYKKIVTCDEKWVYWRNPDTSGQWLSQGQTAFPVAVRGQFEKKSMLCVFWNYEGVIHHEFVPDGTTINSDLYCEQLDRVYAKLSQRYPALVNRKGVLFQQDNARPHTSRQTKEKFKNLDGIELL 267          

HSP 2 Score: 77.7962 bits (190), Expect = 2.012e-48
Identity = 38/74 (51.35%), Postives = 49/74 (66.22%), Query Frame = 2
Query:  476 PHT-YSSEIAPSDCELFRSMQNFLRRRKFTTLYKVVQACQQFFASKDQNWYFNHIRLLVERWQLAIDNGGLYFD 694
            PH  YS ++APSD  LFRSM +FL+ ++F T  +V  A Q+FF S  + WY   I+ L ERWQ  IDN GLYF+
Sbjct:  268 PHPPYSPDLAPSDFYLFRSMAHFLKGKRFDTFQEVETAVQEFFDSHPKEWYQQGIKQLAERWQATIDNNGLYFE 341          
BLAST of Histone-lysine N-methyltransferase SETMAR vs. TrEMBL
Match: A0A023F643 (Putative transposase (Fragment) OS=Triatoma infestans OX=30076 PE=2 SV=1)

HSP 1 Score: 143.665 bits (361), Expect = 2.757e-48
Identity = 69/140 (49.29%), Postives = 94/140 (67.14%), Query Frame = 3
Query:   54 RVEICQQVLKNPTDDRFWRRIVTLDEKWIYFVNNNRLKQ*VKQENEPEPVIRQDRFGKKVMLSARWNYQGVMHYEFIPDGHAVNAELYCEQLDRVYNILKVKYTALVNRNRILIQFDNDPCHCARIIQQKIDELSGVEVL 473
            RVEIC+ +L  PTD RF+++IVT DEKW+Y+ N +   Q + Q     PV  + +F KK ML   WNY+GV+H+EF+PDG  +N++LYCEQLDRVY  L  +Y ALVNR  +L Q DN   H +R  ++K   L G+E+L
Sbjct:  123 RVEICKNLLMYPTDLRFYKKIVTCDEKWVYWRNPDTSGQWLSQGQTAFPVAVRGQFEKKSMLCVFWNYEGVIHHEFVPDGTTINSDLYCEQLDRVYAKLSQRYPALVNRKGVLFQQDNARPHTSRQTKEKFKNLDGIELL 262          

HSP 2 Score: 77.411 bits (189), Expect = 2.757e-48
Identity = 38/74 (51.35%), Postives = 49/74 (66.22%), Query Frame = 2
Query:  476 PHT-YSSEIAPSDCELFRSMQNFLRRRKFTTLYKVVQACQQFFASKDQNWYFNHIRLLVERWQLAIDNGGLYFD 694
            PH  YS ++APSD  LFRSM +FL+ ++F T  +V  A Q+FF S  + WY   I+ L ERWQ  IDN GLYF+
Sbjct:  263 PHPPYSPDLAPSDFYLFRSMAHFLKGKRFDTFQEVETAVQEFFDSHPKEWYQQGIKQLAERWQATIDNNGLYFE 336          
BLAST of Histone-lysine N-methyltransferase SETMAR vs. TrEMBL
Match: Q23702 (Transposase (Fragment) OS=Ctenolepisma lineata OX=27553 GN=mariner transposase PE=4 SV=1)

HSP 1 Score: 155.606 bits (392), Expect = 1.548e-44
Identity = 78/141 (55.32%), Postives = 100/141 (70.92%), Query Frame = 3
Query:   54 RVEICQQVLKNPTDDRFWRRIVTLDEKWIYFVNNNRLKQ*VKQENE-PEPVIRQDRFGKKVMLSARWNYQGVMHYEFIPDGHAVNAELYCEQLDRVYNILKVKYTALVNRNRILIQFDNDPCHCARIIQQKIDELSGVEVL 473
            RVEIC+Q+L NP DDR W+ IVT D KW+Y V +NR K+ VK+  E P  V +QDRF KKVM    WN++G++H+E +P+G AVNAELYC+QL+RVY+ LK  Y  L+NR R L+Q DN   H AR  + K  E+ GVEVL
Sbjct:    8 RVEICRQLLSNPLDDRLWKHIVTSDYKWVYLVQHNRDKRWVKKGQETPPSVPKQDRFDKKVMC-LWWNFEGIVHFELVPNGRAVNAELYCQQLERVYDKLKKMYPTLINRKRALMQQDNAKPHTARKTKDKFAEVDGVEVL 147          
BLAST of Histone-lysine N-methyltransferase SETMAR vs. TrEMBL
Match: P91717 (Transposase (Fragment) OS=Girardia tigrina OX=6162 PE=4 SV=1)

HSP 1 Score: 142.124 bits (357), Expect = 3.107e-39
Identity = 63/140 (45.00%), Postives = 98/140 (70.00%), Query Frame = 3
Query:   54 RVEICQQVLKNPTDDRFWRRIVTLDEKWIYFVNNNRLKQ*VKQENEPEPVIRQDRFGKKVMLSARWNYQGVMHYEFIPDGHAVNAELYCEQLDRVYNILKVKYTALVNRNRILIQFDNDPCHCARIIQQKIDELSGVEVL 473
            R++ C+++L+N  ++R+ +R+VT DEKW YF N N+  Q +    E  PV ++DRF KKVML   WN++GV+H+E + +  A+NAELY +QLDR+Y  L  KY AL+NR ++++Q DN   H A + ++KI+EL  +E+L
Sbjct:    8 RIDTCKKLLQNSMNERWMKRVVTCDEKWTYFSNPNKENQWLDPGQEAYPVAKRDRFSKKVMLCVWWNFEGVIHFELVANNRAINAELYTDQLDRMYTALGKKYPALINRKQVILQQDNASPHTAALTRRKIEELEAIELL 147          
BLAST of Histone-lysine N-methyltransferase SETMAR vs. Planmine SMEST
Match: SMESG000005372.1 (SMESG000005372.1)

HSP 1 Score: 172.17 bits (435), Expect = 8.038e-55
Identity = 90/136 (66.18%), Postives = 102/136 (75.00%), Query Frame = 3
Query:  261 GVMHYEFIPDGHAVNAELYCEQLDRVYNILKVKYTALVNRNRILIQFDNDPCHCARIIQQKIDELSGVEVLHLIHTAQKLLHLIANCSVQCKISYDDENLQLYIKLYRLVSNSLLVKIKIGILITFGCLWKDGNLL 668
             +++  F  DGHAVN ELYCEQLDRVYNILKVKY ALVNRNR+LI+FDN PCH +R+ QQKIDELSGVEVL   H                 ISY+DENLQLY++L RLVSNS  VKIKIGILITFGCLW+D +LL
Sbjct:    6 NMINQPFYFDGHAVNGELYCEQLDRVYNILKVKYPALVNRNRVLIKFDNSPCHRSRLTQQKIDELSGVEVLP--HPPYSPFDY---------ISYEDENLQLYLRLNRLVSNSFPVKIKIGILITFGCLWRDCSLL 130          
BLAST of Histone-lysine N-methyltransferase SETMAR vs. Planmine SMEST
Match: SMESG000070487.1 (SMESG000070487.1)

HSP 1 Score: 177.563 bits (449), Expect = 2.937e-51
Identity = 83/104 (79.81%), Postives = 87/104 (83.65%), Query Frame = 3
Query:  117 VTLDEKWIYFVNNNRLKQ*VKQENEPEPVIRQDRFGKKVMLSARWNYQGVMHYEFIPDGHAVNAELYCEQLDRVYNILKVKYTALVNRNRILIQFDNDPCHCAR 428
            VT D+KWI FVNNNRLKQ VK   EPEPVI QDRFGKKVMLSA WNYQGV+HY FIP  HAVN ELYCEQLDR YNILKVKY ALVNRNR+L+QFDN PCH  R
Sbjct:  633 VTCDDKWISFVNNNRLKQWVKHGEEPEPVIHQDRFGKKVMLSAWWNYQGVLHYGFIPGDHAVNVELYCEQLDRAYNILKVKYPALVNRNRVLMQFDNAPCHHTR 736          

HSP 2 Score: 58.5362 bits (140), Expect = 1.038e-9
Identity = 24/28 (85.71%), Postives = 25/28 (89.29%), Query Frame = 2
Query:  614 QNWYFNHIRLLVERWQLAIDNGGLYFDE 697
            QNWYF+ IRLLVE WQL IDNGGLYFDE
Sbjct:  737 QNWYFSQIRLLVESWQLVIDNGGLYFDE 764          
BLAST of Histone-lysine N-methyltransferase SETMAR vs. Planmine SMEST
Match: SMESG000049199.1 (SMESG000049199.1)

HSP 1 Score: 41.2022 bits (95), Expect = 1.799e-6
Identity = 21/71 (29.58%), Postives = 39/71 (54.93%), Query Frame = 2
Query:  485 YSSEIAPSDCELFRSMQNFLRRRKFTTLYKVVQACQQFFASKDQNWYFNHIRLLVERWQLAIDNGGLYFDE 697
            YS ++A SD  LF  +++ +R R F    ++       F SK ++++ + IR L +RW+  + + G YF+ 
Sbjct:   73 YSPDLATSDFYLFSPLKSSIRGRDFNGDNEIQVVLDAGFNSKPRSFFADGIRKLPDRWRRCVLHSGAYFEH 143          

HSP 2 Score: 28.4906 bits (62), Expect = 1.799e-6
Identity = 17/59 (28.81%), Postives = 32/59 (54.24%), Query Frame = 3
Query:  282 IPDGHAVNAELYCEQLDRVYNILKVKYTALVNRN--RI-LIQFDNDPCHCARIIQQKID 449
            +P G  + A++Y EQL R+   ++ K   L+     +I  +Q++  P   A+ +Q+ ID
Sbjct:    4 LPQGTTITADVYYEQLSRLVTAIQHKRRRLLGGGFHKIHYLQYNARPHTAAKSVQKLID 62          
The following BLAST results are available for this feature:
BLAST of Histone-lysine N-methyltransferase SETMAR vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
SETMAR2.723e-2535.00SET domain and mariner transposase fusion gene [So... [more]
SETMAR3.676e-2535.00SET domain and mariner transposase fusion gene [So... [more]
back to top
BLAST of Histone-lysine N-methyltransferase SETMAR vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Histone-lysine N-methyltransferase SETMAR vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Histone-lysine N-methyltransferase SETMAR vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Histone-lysine N-methyltransferase SETMAR vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Histone-lysine N-methyltransferase SETMAR vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Histone-lysine N-methyltransferase SETMAR vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 2
Match NameE-valueIdentityDescription
sp|Q53H47|SETMR_HUMAN1.135e-2435.00Histone-lysine N-methyltransferase SETMAR OS=Homo ... [more]
sp|Q7JQ07|MOS1T_DROMA1.445e-1732.92Mariner Mos1 transposase OS=Drosophila mauritiana ... [more]
back to top
BLAST of Histone-lysine N-methyltransferase SETMAR vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
O024736.482e-4955.00Transposase (Fragment) OS=Stylochus zebra OX=46768... [more]
A0A023F5512.012e-4849.29Putative transposase (Fragment) OS=Triatoma infest... [more]
A0A023F6432.757e-4849.29Putative transposase (Fragment) OS=Triatoma infest... [more]
Q237021.548e-4455.32Transposase (Fragment) OS=Ctenolepisma lineata OX=... [more]
P917173.107e-3945.00Transposase (Fragment) OS=Girardia tigrina OX=6162... [more]
back to top
BLAST of Histone-lysine N-methyltransferase SETMAR vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Histone-lysine N-methyltransferase SETMAR vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Histone-lysine N-methyltransferase SETMAR vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Histone-lysine N-methyltransferase SETMAR vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Histone-lysine N-methyltransferase SETMAR vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Histone-lysine N-methyltransferase SETMAR vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000005372.18.038e-5566.18SMESG000005372.1[more]
SMESG000070487.12.937e-5179.81SMESG000070487.1[more]
SMESG000049199.11.799e-629.58SMESG000049199.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30028345 ID=SMED30028345|Name=Histone-lysine N-methyltransferase SETMAR|organism=Schmidtea mediterranea sexual|type=transcript|length=697bp
TCTGTTTTTTCGTCACCTTTGACATGTTTTCTTTTTTAATATTTCGTTTA
TTTCGAGTTGAGATATGTCAGCAGGTGCTTAAAAATCCTACAGATGATCG
TTTTTGGAGACGCATTGTTACCCTAGATGAAAAATGGATTTATTTTGTTA
ATAACAATCGATTAAAACAATAGGTTAAACAAGAAAACGAACCTGAACCA
GTGATCCGCCAAGACCGTTTTGGTAAGAAAGTGATGCTGTCAGCCCGATG
GAACTACCAAGGTGTCATGCATTACGAGTTTATTCCTGATGGTCATGCTG
TCAATGCGGAGCTTTACTGTGAACAGCTGGATCGTGTATACAACATTTTA
AAAGTTAAATACACAGCATTAGTCAATCGAAATCGAATTCTCATACAATT
TGACAATGACCCCTGCCATTGCGCTCGTATAATTCAGCAGAAGATTGATG
AATTGTCTGGTGTAGAAGTTTTACACCTCATACATACAGCTCAGAAATTG
CTCCATCTGATTGCGAATTGTTCCGTTCAATGCAAAATTTCTTACGACGA
CGAAAATTTACAACTTTATATAAAGTTGTACAGGCTTGTCAGCAATTCTT
TGCTAGTAAAGATCAAAATTGGTATTTTAATCACATTCGGTTGCTTGTGG
AAAGATGGCAACTTGCTATAGACAATGGAGGACTTTACTTTGACGAA
back to top

protein sequence of SMED30028345-orf-1

>SMED30028345-orf-1 ID=SMED30028345-orf-1|Name=SMED30028345-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=146bp
MLSARWNYQGVMHYEFIPDGHAVNAELYCEQLDRVYNILKVKYTALVNRN
RILIQFDNDPCHCARIIQQKIDELSGVEVLHLIHTAQKLLHLIANCSVQC
KISYDDENLQLYIKLYRLVSNSLLVKIKIGILITFGCLWKDGNLL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0008168methyltransferase activity
GO:0016740transferase activity
Vocabulary: biological process
TermDefinition
GO:0032259methylation
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR001888Transposase_1