Cytosolic carboxypeptidase 2

Overview
NameCytosolic carboxypeptidase 2
Smed IDSMED30028343
Length (bp)3700
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Cytosolic carboxypeptidase 2 (SMED30028343) t-SNE clustered cells

Violin plots show distribution of expression levels for Cytosolic carboxypeptidase 2 (SMED30028343) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Cytosolic carboxypeptidase 2 (SMED30028343) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Cytosolic carboxypeptidase 2 (SMED30028343) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30028343

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 18

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30028343SMESG000006325.1 SmedASXL_016464SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30028343SMESG000006325.1 dd_Smed_v4_13454_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30028343SMESG000006325.1 dd_Smed_v4_13454_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30028343SMESG000006325.1 dd_Smed_v4_13454_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30028343SMESG000006325.1 dd_Smed_v4_13454_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30028343SMESG000006325.1 dd_Smed_v4_13454_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
cilated neuronSMED30028343SMESG000006325.1 dd_Smed_v4_13454_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30028343SMESG000006325.1 dd_Smed_v4_13454_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30028343SMESG000006325.1 Contig53495newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30028343SMESG000006325.1 Contig53495uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30028343SMESG000006325.1 Contig51372newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30028343SMESG000006325.1 Contig51372uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30028343SMESG000006325.1 Contig55268newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30028343SMESG000006325.1 Contig55268uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30028343SMESG000006325.1 dd_Smed_v6_13454_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30028343SMESG000006325.1 dd_Smed_v6_13454_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30028343SMESG000006325.1 dd_Smed_v4_13454_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30028343SMESG000006325.1 dd_Smed_v4_13454_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Cytosolic carboxypeptidase 2 vs. Ensembl Human
Match: AGBL3 (ATP/GTP binding protein like 3 [Source:HGNC Symbol;Acc:HGNC:27981])

HSP 1 Score: 374.4 bits (960), Expect = 2.687e-115
Identity = 220/546 (40.29%), Postives = 314/546 (57.51%), Query Frame = 2
Query:  632 EFRDKFGIVRSKDGPF----WPKDIGPLFPAPHHKIFQSSY-EPLFDPLKDKETSKQAPPNGSHPAGWKHMQIVYDSE--------TYSR---NQRP-HQHSECESSSLIFESRFETGNLRQSRRTGQXXXXXXXXXXXXTKRHTQWFYFRLQNMEKNVTYKFIIINLLKSKSLYEEGMRILMYSDKNATTNSIGWYRTGHHIRYTRNFTRLQCPLLNREMAYFQLEFQIEFQYSEDTCYLSHCYPYTFTDLKNDLRTFESNCNTKPLLKKDILCETNIGNSCFLLTITD--KSIPEKEKLGAVITARVHPGETNSSWMMKGLIQYLIGNSETAKTLRRRIVFKIVPMLNPDGVIVGNYRCSTVGRDLNRNYRNPKEERFPTIFHTKRLIEDLKKSCTVGVSVVIKYFYVIQAMALYCDLHGHSRKHNVFMYGCDSQYLHSENFNDINPVLNINTIEDYIKDRIFTFLMQKNGPETFSFNGCHFKIRKCKESTGRVVMWKQFNVNDSYTLEATFSGTDINDRR--HFNINDLENIGKIFSESLFSY 2206
            E RD +G+  S  GP     WP     +     H  +  S  EP++ P    ET    P +       K   +VY +E         YSR   N+ P  Q  +   ++L+FE+RFE+GNL++  +  +YEY+L +  DL+T +HTQW+YF++ NM   + Y+F I+N  K  SLY  GMR L YS+K A  + IGW R G  I+Y RN              YF L +  +F +++DTCY +HCYPYT+T+L+  L    ++       K  +LC T   N  ++LTIT   K+   +++   ++TARVHPGETNSSW+MKG + Y++GNS  A+ LR   VFK+VPMLNPDGVIVGNYRCS  GRDLNRNY +  +E FP++++T+ ++  L +                + + LYCDLHGHSRK N+FMYGCD         +D +  L       Y++ RIF  ++ KN P+ FSF+ C F ++K KE TGRVVMWK   + +S+T+EATF G+ + ++R  HF+  DLE++G  F +SL  Y
Sbjct:   71 EPRDLYGV--SSSGPLSPTRWPYHCEVIDEKVQHIDWTPSCPEPVYIP-TGLETEPLYPDS-------KEATVVYLAEDAYKEPCFVYSRVGGNRTPLKQPVDYRDNTLMFEARFESGNLQKVVKVAEYEYQLTVRPDLFTNKHTQWYYFQVTNMRAGIVYRFTIVNFTKPASLYSRGMRPLFYSEKEAKAHHIGWQRIGDQIKYYRNNPG------QDGRHYFSLTWTFQFPHNKDTCYFAHCYPYTYTNLQEYLSGINNDPVRSKFCKIRVLCHTLARNMVYILTITTPLKNSDSRKRKAVILTARVHPGETNSSWIMKGFLDYILGNSSDAQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDLNRNYTSLLKESFPSVWYTRNMVHRLMEK---------------REVILYCDLHGHSRKENIFMYGCDG--------SDRSKTL-------YLQQRIFPLMLSKNCPDKFSFSACKFNVQKSKEGTGRVVMWK-MGIRNSFTMEATFCGSTLGNKRGTHFSTKDLESMGYHFCDSLLDY 569          
BLAST of Cytosolic carboxypeptidase 2 vs. Ensembl Human
Match: AGBL2 (ATP/GTP binding protein like 2 [Source:HGNC Symbol;Acc:HGNC:26296])

HSP 1 Score: 379.793 bits (974), Expect = 7.124e-115
Identity = 204/471 (43.31%), Postives = 298/471 (63.27%), Query Frame = 2
Query:  893 ESSSLIFESRFETGNLRQSRRTGQXXXXXXXXXXXXTKRHTQWFYFRLQNMEKNVTYKFIIINLLKSKSLYEEGMRILMYSDKNATTNSIGWYRTGHHIRYTRNFTRLQCPLLNREMAYFQLEFQIEFQYSEDTCYLSHCYPYTFTDLKNDLRTFESNCNTKPLLKKDILCETNIGNSCFLLTITDKSIPEKE---KLGAVITARVHPGETNSSWMMKGLIQYLIGNSETAKTLRRRIVFKIVPMLNPDGVIVGNYRCSTVGRDLNRNYRNPKEERFPTIFHTKRLIEDLKKSCTVGVSVVIKYFYVIQAMALYCDLHGHSRKHNVFMYGCDSQYLHSENFNDINPVLNINTIEDYIKDRIFTFLMQKNGPETFSFNGCHFKIRKCKESTGRVVMWKQFNVNDSYTLEATFSGTDINDRR--HFNINDLENIGKIFSESLFSYISIMKDEQQQKEIGLDLLKAILKQIVSK 2290
            E ++L+FESRFE+GNL+++ R   YEYEL L  DLYT +HTQWFYFR+QN  K+ TY+F I+NLLK KSLY  GM+ L+YS  +A T +IGW R G+ I+Y +N T       + +  ++ L + I+F Y +DTC+ +H YPYT+TDL+  L +  +N       K   LC +  GN+ +LLTIT+ S   +E   K   V++ARVHPGE+N SW+MKG + +++ NS  A+ LR   VFK++PMLNPDGVIVGNYRCS  GRDLNR+Y+   +E FP I++T+ +I+ L +                + + LYCD HGHSRK+N+F+YGC                 N N  + ++ +R+F  ++ KN P+ FSF+ C+FK++KCKE TGRVVMW+   + +SYT+E+TF G+ + ++R  HF I DL+++G    ++L  +      +Q +    L  LK +L+Q + K
Sbjct:  224 EDNTLLFESRFESGNLQKAVRVDTYEYELTLRTDLYTNKHTQWFYFRVQNTRKDATYRFTIVNLLKPKSLYTVGMKPLLYSQLDANTRNIGWRREGNEIKYYKNNTD------DGQQPFYCLTWTIQFPYDQDTCFFAHFYPYTYTDLQCYLLSVANNPIQSQFCKLQTLCRSLAGNTVYLLTITNPSQTPQEAAAKKAVVLSARVHPGESNGSWVMKGFLDFILSNSPDAQLLRDIFVFKVLPMLNPDGVIVGNYRCSLAGRDLNRHYKTILKESFPCIWYTRNMIKRLLEE---------------REVLLYCDFHGHSRKNNIFLYGC-----------------NNNNRKYWLHERVFPLMLCKNAPDKFSFHSCNFKVQKCKEGTGRVVMWR-MGILNSYTMESTFGGSTLGNKRDTHFTIEDLKSLGYHVCDTLLDFCD---PDQMKFTQCLAELKELLRQEIHK 652          
BLAST of Cytosolic carboxypeptidase 2 vs. Ensembl Human
Match: AGBL2 (ATP/GTP binding protein like 2 [Source:HGNC Symbol;Acc:HGNC:26296])

HSP 1 Score: 379.793 bits (974), Expect = 7.124e-115
Identity = 204/471 (43.31%), Postives = 298/471 (63.27%), Query Frame = 2
Query:  893 ESSSLIFESRFETGNLRQSRRTGQXXXXXXXXXXXXTKRHTQWFYFRLQNMEKNVTYKFIIINLLKSKSLYEEGMRILMYSDKNATTNSIGWYRTGHHIRYTRNFTRLQCPLLNREMAYFQLEFQIEFQYSEDTCYLSHCYPYTFTDLKNDLRTFESNCNTKPLLKKDILCETNIGNSCFLLTITDKSIPEKE---KLGAVITARVHPGETNSSWMMKGLIQYLIGNSETAKTLRRRIVFKIVPMLNPDGVIVGNYRCSTVGRDLNRNYRNPKEERFPTIFHTKRLIEDLKKSCTVGVSVVIKYFYVIQAMALYCDLHGHSRKHNVFMYGCDSQYLHSENFNDINPVLNINTIEDYIKDRIFTFLMQKNGPETFSFNGCHFKIRKCKESTGRVVMWKQFNVNDSYTLEATFSGTDINDRR--HFNINDLENIGKIFSESLFSYISIMKDEQQQKEIGLDLLKAILKQIVSK 2290
            E ++L+FESRFE+GNL+++ R   YEYEL L  DLYT +HTQWFYFR+QN  K+ TY+F I+NLLK KSLY  GM+ L+YS  +A T +IGW R G+ I+Y +N T       + +  ++ L + I+F Y +DTC+ +H YPYT+TDL+  L +  +N       K   LC +  GN+ +LLTIT+ S   +E   K   V++ARVHPGE+N SW+MKG + +++ NS  A+ LR   VFK++PMLNPDGVIVGNYRCS  GRDLNR+Y+   +E FP I++T+ +I+ L +                + + LYCD HGHSRK+N+F+YGC                 N N  + ++ +R+F  ++ KN P+ FSF+ C+FK++KCKE TGRVVMW+   + +SYT+E+TF G+ + ++R  HF I DL+++G    ++L  +      +Q +    L  LK +L+Q + K
Sbjct:  224 EDNTLLFESRFESGNLQKAVRVDTYEYELTLRTDLYTNKHTQWFYFRVQNTRKDATYRFTIVNLLKPKSLYTVGMKPLLYSQLDANTRNIGWRREGNEIKYYKNNTD------DGQQPFYCLTWTIQFPYDQDTCFFAHFYPYTYTDLQCYLLSVANNPIQSQFCKLQTLCRSLAGNTVYLLTITNPSQTPQEAAAKKAVVLSARVHPGESNGSWVMKGFLDFILSNSPDAQLLRDIFVFKVLPMLNPDGVIVGNYRCSLAGRDLNRHYKTILKESFPCIWYTRNMIKRLLEE---------------REVLLYCDFHGHSRKNNIFLYGC-----------------NNNNRKYWLHERVFPLMLCKNAPDKFSFHSCNFKVQKCKEGTGRVVMWR-MGILNSYTMESTFGGSTLGNKRDTHFTIEDLKSLGYHVCDTLLDFCD---PDQMKFTQCLAELKELLRQEIHK 652          
BLAST of Cytosolic carboxypeptidase 2 vs. Ensembl Human
Match: AGBL3 (ATP/GTP binding protein like 3 [Source:HGNC Symbol;Acc:HGNC:27981])

HSP 1 Score: 374.785 bits (961), Expect = 1.915e-114
Identity = 220/546 (40.29%), Postives = 314/546 (57.51%), Query Frame = 2
Query:  632 EFRDKFGIVRSKDGPF----WPKDIGPLFPAPHHKIFQSSY-EPLFDPLKDKETSKQAPPNGSHPAGWKHMQIVYDSE--------TYSR---NQRP-HQHSECESSSLIFESRFETGNLRQSRRTGQXXXXXXXXXXXXTKRHTQWFYFRLQNMEKNVTYKFIIINLLKSKSLYEEGMRILMYSDKNATTNSIGWYRTGHHIRYTRNFTRLQCPLLNREMAYFQLEFQIEFQYSEDTCYLSHCYPYTFTDLKNDLRTFESNCNTKPLLKKDILCETNIGNSCFLLTITD--KSIPEKEKLGAVITARVHPGETNSSWMMKGLIQYLIGNSETAKTLRRRIVFKIVPMLNPDGVIVGNYRCSTVGRDLNRNYRNPKEERFPTIFHTKRLIEDLKKSCTVGVSVVIKYFYVIQAMALYCDLHGHSRKHNVFMYGCDSQYLHSENFNDINPVLNINTIEDYIKDRIFTFLMQKNGPETFSFNGCHFKIRKCKESTGRVVMWKQFNVNDSYTLEATFSGTDINDRR--HFNINDLENIGKIFSESLFSY 2206
            E RD +G+  S  GP     WP     +     H  +  S  EP++ P    ET    P +       K   +VY +E         YSR   N+ P  Q  +   ++L+FE+RFE+GNL++  +  +YEY+L +  DL+T +HTQW+YF++ NM   + Y+F I+N  K  SLY  GMR L YS+K A  + IGW R G  I+Y RN              YF L +  +F +++DTCY +HCYPYT+T+L+  L    ++       K  +LC T   N  ++LTIT   K+   +++   ++TARVHPGETNSSW+MKG + Y++GNS  A+ LR   VFK+VPMLNPDGVIVGNYRCS  GRDLNRNY +  +E FP++++T+ ++  L +                + + LYCDLHGHSRK N+FMYGCD         +D +  L       Y++ RIF  ++ KN P+ FSF+ C F ++K KE TGRVVMWK   + +S+T+EATF G+ + ++R  HF+  DLE++G  F +SL  Y
Sbjct:   71 EPRDLYGV--SSSGPLSPTRWPYHCEVIDEKVQHIDWTPSCPEPVYIP-TGLETEPLYPDS-------KEATVVYLAEDAYKEPCFVYSRVGGNRTPLKQPVDYRDNTLMFEARFESGNLQKVVKVAEYEYQLTVRPDLFTNKHTQWYYFQVTNMRAGIVYRFTIVNFTKPASLYSRGMRPLFYSEKEAKAHHIGWQRIGDQIKYYRNNPG------QDGRHYFSLTWTFQFPHNKDTCYFAHCYPYTYTNLQEYLSGINNDPVRSKFCKIRVLCHTLARNMVYILTITTPLKNSDSRKRKAVILTARVHPGETNSSWIMKGFLDYILGNSSDAQLLRDTFVFKVVPMLNPDGVIVGNYRCSLAGRDLNRNYTSLLKESFPSVWYTRNMVHRLMEK---------------REVILYCDLHGHSRKENIFMYGCDG--------SDRSKTL-------YLQQRIFPLMLSKNCPDKFSFSACKFNVQKSKEGTGRVVMWK-MGIRNSFTMEATFCGSTLGNKRGTHFSTKDLESMGYHFCDSLLDY 569          
BLAST of Cytosolic carboxypeptidase 2 vs. Ensembl Human
Match: AGBL2 (ATP/GTP binding protein like 2 [Source:HGNC Symbol;Acc:HGNC:26296])

HSP 1 Score: 380.563 bits (976), Expect = 2.213e-114
Identity = 204/471 (43.31%), Postives = 298/471 (63.27%), Query Frame = 2
Query:  893 ESSSLIFESRFETGNLRQSRRTGQXXXXXXXXXXXXTKRHTQWFYFRLQNMEKNVTYKFIIINLLKSKSLYEEGMRILMYSDKNATTNSIGWYRTGHHIRYTRNFTRLQCPLLNREMAYFQLEFQIEFQYSEDTCYLSHCYPYTFTDLKNDLRTFESNCNTKPLLKKDILCETNIGNSCFLLTITDKSIPEKE---KLGAVITARVHPGETNSSWMMKGLIQYLIGNSETAKTLRRRIVFKIVPMLNPDGVIVGNYRCSTVGRDLNRNYRNPKEERFPTIFHTKRLIEDLKKSCTVGVSVVIKYFYVIQAMALYCDLHGHSRKHNVFMYGCDSQYLHSENFNDINPVLNINTIEDYIKDRIFTFLMQKNGPETFSFNGCHFKIRKCKESTGRVVMWKQFNVNDSYTLEATFSGTDINDRR--HFNINDLENIGKIFSESLFSYISIMKDEQQQKEIGLDLLKAILKQIVSK 2290
            E ++L+FESRFE+GNL+++ R   YEYEL L  DLYT +HTQWFYFR+QN  K+ TY+F I+NLLK KSLY  GM+ L+YS  +A T +IGW R G+ I+Y +N T       + +  ++ L + I+F Y +DTC+ +H YPYT+TDL+  L +  +N       K   LC +  GN+ +LLTIT+ S   +E   K   V++ARVHPGE+N SW+MKG + +++ NS  A+ LR   VFK++PMLNPDGVIVGNYRCS  GRDLNR+Y+   +E FP I++T+ +I+ L +                + + LYCD HGHSRK+N+F+YGC                 N N  + ++ +R+F  ++ KN P+ FSF+ C+FK++KCKE TGRVVMW+   + +SYT+E+TF G+ + ++R  HF I DL+++G    ++L  +      +Q +    L  LK +L+Q + K
Sbjct:  262 EDNTLLFESRFESGNLQKAVRVDTYEYELTLRTDLYTNKHTQWFYFRVQNTRKDATYRFTIVNLLKPKSLYTVGMKPLLYSQLDANTRNIGWRREGNEIKYYKNNTD------DGQQPFYCLTWTIQFPYDQDTCFFAHFYPYTYTDLQCYLLSVANNPIQSQFCKLQTLCRSLAGNTVYLLTITNPSQTPQEAAAKKAVVLSARVHPGESNGSWVMKGFLDFILSNSPDAQLLRDIFVFKVLPMLNPDGVIVGNYRCSLAGRDLNRHYKTILKESFPCIWYTRNMIKRLLEE---------------REVLLYCDFHGHSRKNNIFLYGC-----------------NNNNRKYWLHERVFPLMLCKNAPDKFSFHSCNFKVQKCKEGTGRVVMWR-MGILNSYTMESTFGGSTLGNKRDTHFTIEDLKSLGYHVCDTLLDFCD---PDQMKFTQCLAELKELLRQEIHK 690          
BLAST of Cytosolic carboxypeptidase 2 vs. Ensembl Celegans
Match: ccpp-1 (Cytosolic carboxypeptidase 1 [Source:UniProtKB/Swiss-Prot;Acc:O76373])

HSP 1 Score: 253.447 bits (646), Expect = 2.719e-69
Identity = 170/489 (34.76%), Postives = 265/489 (54.19%), Query Frame = 2
Query:  830 QIVYDSETYSRNQRPHQHSEC--------ESSSLIFESRFETGNLRQSRRTGQXXXXXXXXXXXXTKR-HTQWFYFRLQNMEKNVTYKFIIINLLKSKSLYEEGMRILMYSDKNATTNSIGWYRTGHHIRYTRNF------TRLQCPLLNREMAYFQLEFQIEFQYSEDTCYLSHCYPYTFTDLKNDLRTFESNCNTKPLLKKDILCETNIGNSCFLLTITDKS----IPEKEKLGAVITARVHPGETNSSWMMKGLIQYLIG-NSETAKTLRRRIVFKIVPMLNPDGVIVGNYRCSTVGRDLNRNYRNPKEERFPTIFHTKRLIEDLKKSCTVGVSVVIKYFYVIQAMALYCDLHGHSRKHNVFMYGCDSQYLHSENFNDINPVLNINTIEDYIKDRIFTFL---MQKNGPETFSFNGCHFKIRKCKESTGRVVMWKQFNVNDSYTLEATFSGTDINDRRHFNIN--DLENIGKIFSESLFSYISIMK 2221
            Q++YD +T + +  P               S  L F+SRFE+GNLR   +     YEL L+ D+   R H QWF+F++ NM K+V Y F I+N LKS SLY +GM+ +MYS   +     GW R G ++ Y RN        +       ++  Y+ + F + FQ + D CY+++ YPYT++ L + L   +         ++D++  +  GN   +LTIT  +    I  +E +  V++ARVHPGETN+SW+M+G+++ L+   S     LR   +FKIVPM+NPDGV  G++RCS  G DLNR +  P E   P +F TK +I+ L   C V      K F        Y D+HGHS+K + F+YG ++    SE++   + VL++   +  +++ +   L   ++   P  F+ + C F I + KES+ RV +W+QF V+ +YTLE+TF G        + IN  DL+ IG+   + L S++ + K
Sbjct:  554 QVIYDLDTAAFDGLPSPELPFVTGGGKLDTSKDLQFDSRFESGNLRMVIQVAPTHYELFLSPDVNQLRDHYQWFFFQVSNMRKSVKYTFEIVNCLKSTSLYSQGMQPVMYSMMESAN---GWRRVGENVCYFRNLYINENEEKKNVEEQKKKKYYYSIRFNVTFQNTGDICYIAYHYPYTYSFLNSSLSMLKKRKQENVYCREDVIGHSLAGNPIKMLTITTPASAAEIAAREVI--VLSARVHPGETNASWIMQGILENLLCRQSNEMYRLRESFIFKIVPMINPDGVTNGSHRCSLAGIDLNRMWDRPNEALHPEVFATKAIIQYL---CEVANK---KPF-------AYVDIHGHSKKWDYFVYGNNA----SESWR-ADDVLDVGAAQ--LEEELHLALPKALEATCPSRFNASECRFNITRAKESSARVNVWRQFGVSTAYTLESTFCGFHKGQNSGYQINTSDLKEIGR---DLLHSFLEMTK 1014          
BLAST of Cytosolic carboxypeptidase 2 vs. Ensembl Celegans
Match: ccpp-6 (Cytosolic carboxypeptidase 6 [Source:UniProtKB/Swiss-Prot;Acc:Q09296])

HSP 1 Score: 166.777 bits (421), Expect = 7.815e-44
Identity = 134/447 (29.98%), Postives = 210/447 (46.98%), Query Frame = 2
Query:  902 SLIFESRFETGNLRQSRRTGQXXXXXXXXXXXXTKRHTQWFYFRLQNMEKNVTYKFIIINLLKSKSLYEEGMRILMYSDKNATTNSIGWYRT-GHHIRYTRNFTRLQCPLLNREMAYFQLEFQIEFQYSEDTCYLSHCYPYTFTDLKNDLRTFESNCNTKPLLKKDILCETNIGNSCFLLTI--TDKSIPEKEKLGAVITARVHPGETNSSWMMKGLIQYLIGNSETAKTLRRRIVFKIVPMLNPDGVIVGNYRCSTVGRDLNRNYRNPKEERFPTIFHTKRLIEDLKKSCTVGVSVVIKYFYVIQAMALYCDLHGHSRKHNVFMYGCDSQYLHSENFNDINPVLNINTIEDYIKDR-IFTFLMQKNGPETFSFNGCHFKIRKCKESTGRVVMWKQFNVNDSYTLEATF--------SGTDINDRRHFNINDLENIGKIFSESLFSY 2206
            +L+FE+ FE+GNL +  +    EY+L +  D    ++  WFYF  +N  +N    F I+N  K ++L+E G+   +   K+   NS  W R    HI Y R+         ++    + L F   F+ S D    ++C PYT+  ++  L   ES     P   +D+L +T       L+TI  T  +    +K+   +TARVHPGE+ SS +M G+I++L+   + A+ LR+   FKI+PMLNPDGV +GNYRCS +G DLNR +R P +   P+I+  K L+     +                   +Y DLH HS+K N F+YG                 +N++ +E+    R ++   +  +  E +S     F     K  TGR  M    +    YTLE +F        SG  I     +     E +G+ F  +L ++
Sbjct:   18 NLVFEASFESGNLGRVDKVSCSEYDLFIRPDTLNNKYRVWFYFECKNASENQRAIFNIVNFSKQRTLFEMGIAAPVV--KSNAQNS--WARIPSRHIYYYRS---------SQHNDRWILSFAFIFE-SPDPVQFAYCIPYTYGQMQIWLNELESR--KYPFFHRDLLVQTVQKRRVDLITIDATPDTFQGSKKM-IFLTARVHPGESPSSHVMHGIIEFLVSKDDRAQKLRKVYCFKIIPMLNPDGVFLGNYRCSLMGHDLNRMWRTPSDWAHPSIYAVKNLLTQYDNNPQAQT-------------VIYVDLHAHSQKPNCFLYGN----------------VNMSAVEEKSTFRQLWLPHLLADLSEDYSLEFTQFNTDVEKAGTGRRTMGDLLSCL-CYTLEVSFFSYRHTDSSGNGIQHCTPYLQYKYEALGEAFCRALLNF 417          
BLAST of Cytosolic carboxypeptidase 2 vs. Ensembl Fly
Match: Nna1 (gene:FBgn0265726 transcript:FBtr0340677)

HSP 1 Score: 345.51 bits (885), Expect = 1.815e-103
Identity = 214/588 (36.39%), Postives = 313/588 (53.23%), Query Frame = 2
Query:  539 FFSTFTKQGFREAMRTGKL---PDGSKLEALAN-GEFRDKFGIVRSKD------GPFWPKDIGPLFPAPHHKIFQSSYEPLFDPLKDKETSKQAPPNGSHPAGWKHMQIVYDSET------YSRNQ--------RPHQHSECESSSLIFESRFETGNLRQSRRTGQXXXXXXXXXXXXTKRHTQWFYFRLQNMEKNVTYKFIIINLLKSKSLYEEGMRILMYSDKNATTNSIGWYRTGHHIRYTRNFTRLQCPLLNRE---MAYFQLEFQIEFQYSEDTCYLSHCYPYTFTDLKNDLRTFESNCNTKPLLKKDILCETNIGNSCFLLTITDKSIPE---KEKLGAVITARVHPGETNSSWMMKGLIQYLIGNSETAKTLRRRIVFKIVPMLNPDGVIVGNYRCSTVGRDLNRNYRNPKEERFPTIFHTKRLIEDLKKSCTVGVSVVIKYFYVIQAMALYCDLHGHSRKHNVFMYGCDSQYLHSENFNDINPVLNINTIEDYIKDRIFTFLMQKNGPETFSFNGCHFKIRKCKESTGRVVMWKQFNVNDSYTLEATFSGTDINDRR--HFNINDLENIGKIFSESLFSY 2206
            F  +F  +G    ++T +L    D   L  +A   E RD F + + KD       P WP +   +      +I    Y P      +  T  +  P    P G ++  +V+          +SR+           H  +  E   L FESRFE+GNL ++ +     YEL L  DLYT R  QWFYFR++   + + Y+F I+NL+KS SLY +GM+ +MYS   A   S GW R G +I Y RN         N +    + + L F IEF++ +DT + +H YPYT++DL++ L   + +       K  +LC T  GN+ + LT+T  S  E   + K   V++ARVHP ET +SWMMKGL+ ++ G++  AK LR + +FK+VPMLNPDGVIVGN R S  G+DLNR YR    E +P+I++TK +I  L + C V               A+YCD+H HSRKHN+F+YGC+         N  NP       E  + +++F  ++ KN  + FSF  C FKI++ KE TGR+V+W    + +SYT+EA+F G+ +  R+  HFN  D E++G+ F E+L  Y
Sbjct:  145 FLGSFLSKG----LKTNQLVVNTDEKTLRPVARLKEPRDLFALPKDKDNDCSQQAPRWPVECQVI----EERIIHIPYVPAVPEPLNAPTGNELKP---RPVGEENGIVVFSYSPISAVNYFSRSAVGGARFMTNCHPMNPEEYDGLEFESRFESGNLAKAVQITPTYYELYLRPDLYTSRSKQWFYFRVRRTRRKMLYRFSIVNLVKSDSLYNDGMQPVMYSTLGAKEKSEGWRRCGDNICYYRNDDESASSSANEDDEDNSTYTLTFTIEFEHDDDTVFFAHSYPYTYSDLQDYLMEIQRHPVKSKFCKLRLLCRTLAGNNVYYLTVTAPSSNEENMRRKKSIVVSARVHPSETPASWMMKGLMDFITGDTTVAKRLRHKFIFKLVPMLNPDGVIVGNTRNSLTGKDLNRQYRTVIRETYPSIWYTKAMIRRLIEECGV---------------AMYCDMHAHSRKHNIFIYGCE---------NKRNP-------EKKLTEQVFPLMLHKNSADRFSFESCKFKIQRSKEGTGRIVVW-MLGITNSYTIEASFGGSSLGSRKGTHFNTQDYEHMGRAFCETLLDY 689          
BLAST of Cytosolic carboxypeptidase 2 vs. Ensembl Fly
Match: Nna1 (gene:FBgn0265726 transcript:FBtr0340672)

HSP 1 Score: 343.969 bits (881), Expect = 4.055e-101
Identity = 193/480 (40.21%), Postives = 276/480 (57.50%), Query Frame = 2
Query:  791 PPNGSHPAGWKHMQIVYDSETYSRNQRPHQHSECESSSLIFESRFETGNLRQSRRTGQXXXXXXXXXXXXTKRHTQWFYFRLQNMEKNVTYKFIIINLLKSKSLYEEGMRILMYSDKNATTNSIGWYRTGHHIRYTRNFTRLQCPLLNRE---MAYFQLEFQIEFQYSEDTCYLSHCYPYTFTDLKNDLRTFESNCNTKPLLKKDILCETNIGNSCFLLTITDKSIPE---KEKLGAVITARVHPGETNSSWMMKGLIQYLIGNSETAKTLRRRIVFKIVPMLNPDGVIVGNYRCSTVGRDLNRNYRNPKEERFPTIFHTKRLIEDLKKSCTVGVSVVIKYFYVIQAMALYCDLHGHSRKHNVFMYGCDSQYLHSENFNDINPVLNINTIEDYIKDRIFTFLMQKNGPETFSFNGCHFKIRKCKESTGRVVMWKQFNVNDSYTLEATFSGTDINDRR--HFNINDLENIGKIFSESLFSY 2206
            PP+GS     K  +       +  N  P    E +   L FESRFE+GNL ++ +     YEL L  DLYT R  QWFYFR++   + + Y+F I+NL+KS SLY +GM+ +MYS   A   S GW R G +I Y RN         N +    + + L F IEF++ +DT + +H YPYT++DL++ L   + +       K  +LC T  GN+ + LT+T  S  E   + K   V++ARVHP ET +SWMMKGL+ ++ G++  AK LR + +FK+VPMLNPDGVIVGN R S  G+DLNR YR    E +P+I++TK +I  L + C V               A+YCD+H HSRKHN+F+YGC+         N  NP       E  + +++F  ++ KN  + FSF  C FKI++ KE TGR+V+W    + +SYT+EA+F G+ +  R+  HFN  D E++G+ F E+L  Y
Sbjct:  437 PPSGSQ----KFSRSAVGGARFMTNCHPMNPEEYDG--LEFESRFESGNLAKAVQITPTYYELYLRPDLYTSRSKQWFYFRVRRTRRKMLYRFSIVNLVKSDSLYNDGMQPVMYSTLGAKEKSEGWRRCGDNICYYRNDDESASSSANEDDEDNSTYTLTFTIEFEHDDDTVFFAHSYPYTYSDLQDYLMEIQRHPVKSKFCKLRLLCRTLAGNNVYYLTVTAPSSNEENMRRKKSIVVSARVHPSETPASWMMKGLMDFITGDTTVAKRLRHKFIFKLVPMLNPDGVIVGNTRNSLTGKDLNRQYRTVIRETYPSIWYTKAMIRRLIEECGV---------------AMYCDMHAHSRKHNIFIYGCE---------NKRNP-------EKKLTEQVFPLMLHKNSADRFSFESCKFKIQRSKEGTGRIVVW-MLGITNSYTIEASFGGSSLGSRKGTHFNTQDYEHMGRAFCETLLDY 878          
BLAST of Cytosolic carboxypeptidase 2 vs. Ensembl Fly
Match: Nna1 (gene:FBgn0265726 transcript:FBtr0340676)

HSP 1 Score: 342.813 bits (878), Expect = 7.230e-101
Identity = 186/446 (41.70%), Postives = 265/446 (59.42%), Query Frame = 2
Query:  893 ESSSLIFESRFETGNLRQSRRTGQXXXXXXXXXXXXTKRHTQWFYFRLQNMEKNVTYKFIIINLLKSKSLYEEGMRILMYSDKNATTNSIGWYRTGHHIRYTRNFTRLQCPLLNRE---MAYFQLEFQIEFQYSEDTCYLSHCYPYTFTDLKNDLRTFESNCNTKPLLKKDILCETNIGNSCFLLTITDKSIPE---KEKLGAVITARVHPGETNSSWMMKGLIQYLIGNSETAKTLRRRIVFKIVPMLNPDGVIVGNYRCSTVGRDLNRNYRNPKEERFPTIFHTKRLIEDLKKSCTVGVSVVIKYFYVIQAMALYCDLHGHSRKHNVFMYGCDSQYLHSENFNDINPVLNINTIEDYIKDRIFTFLMQKNGPETFSFNGCHFKIRKCKESTGRVVMWKQFNVNDSYTLEATFSGTDINDRR--HFNINDLENIGKIFSESLFSY 2206
            E   L FESRFE+GNL ++ +     YEL L  DLYT R  QWFYFR++   + + Y+F I+NL+KS SLY +GM+ +MYS   A   S GW R G +I Y RN         N +    + + L F IEF++ +DT + +H YPYT++DL++ L   + +       K  +LC T  GN+ + LT+T  S  E   + K   V++ARVHP ET +SWMMKGL+ ++ G++  AK LR + +FK+VPMLNPDGVIVGN R S  G+DLNR YR    E +P+I++TK +I  L + C V               A+YCD+H HSRKHN+F+YGC+         N  NP       E  + +++F  ++ KN  + FSF  C FKI++ KE TGR+V+W    + +SYT+EA+F G+ +  R+  HFN  D E++G+ F E+L  Y
Sbjct:  441 EYDGLEFESRFESGNLAKAVQITPTYYELYLRPDLYTSRSKQWFYFRVRRTRRKMLYRFSIVNLVKSDSLYNDGMQPVMYSTLGAKEKSEGWRRCGDNICYYRNDDESASSSANEDDEDNSTYTLTFTIEFEHDDDTVFFAHSYPYTYSDLQDYLMEIQRHPVKSKFCKLRLLCRTLAGNNVYYLTVTAPSSNEENMRRKKSIVVSARVHPSETPASWMMKGLMDFITGDTTVAKRLRHKFIFKLVPMLNPDGVIVGNTRNSLTGKDLNRQYRTVIRETYPSIWYTKAMIRRLIEECGV---------------AMYCDMHAHSRKHNIFIYGCE---------NKRNP-------EKKLTEQVFPLMLHKNSADRFSFESCKFKIQRSKEGTGRIVVW-MLGITNSYTIEASFGGSSLGSRKGTHFNTQDYEHMGRAFCETLLDY 854          
BLAST of Cytosolic carboxypeptidase 2 vs. Ensembl Fly
Match: Nna1 (gene:FBgn0265726 transcript:FBtr0340673)

HSP 1 Score: 342.813 bits (878), Expect = 7.230e-101
Identity = 186/446 (41.70%), Postives = 265/446 (59.42%), Query Frame = 2
Query:  893 ESSSLIFESRFETGNLRQSRRTGQXXXXXXXXXXXXTKRHTQWFYFRLQNMEKNVTYKFIIINLLKSKSLYEEGMRILMYSDKNATTNSIGWYRTGHHIRYTRNFTRLQCPLLNRE---MAYFQLEFQIEFQYSEDTCYLSHCYPYTFTDLKNDLRTFESNCNTKPLLKKDILCETNIGNSCFLLTITDKSIPE---KEKLGAVITARVHPGETNSSWMMKGLIQYLIGNSETAKTLRRRIVFKIVPMLNPDGVIVGNYRCSTVGRDLNRNYRNPKEERFPTIFHTKRLIEDLKKSCTVGVSVVIKYFYVIQAMALYCDLHGHSRKHNVFMYGCDSQYLHSENFNDINPVLNINTIEDYIKDRIFTFLMQKNGPETFSFNGCHFKIRKCKESTGRVVMWKQFNVNDSYTLEATFSGTDINDRR--HFNINDLENIGKIFSESLFSY 2206
            E   L FESRFE+GNL ++ +     YEL L  DLYT R  QWFYFR++   + + Y+F I+NL+KS SLY +GM+ +MYS   A   S GW R G +I Y RN         N +    + + L F IEF++ +DT + +H YPYT++DL++ L   + +       K  +LC T  GN+ + LT+T  S  E   + K   V++ARVHP ET +SWMMKGL+ ++ G++  AK LR + +FK+VPMLNPDGVIVGN R S  G+DLNR YR    E +P+I++TK +I  L + C V               A+YCD+H HSRKHN+F+YGC+         N  NP       E  + +++F  ++ KN  + FSF  C FKI++ KE TGR+V+W    + +SYT+EA+F G+ +  R+  HFN  D E++G+ F E+L  Y
Sbjct:  441 EYDGLEFESRFESGNLAKAVQITPTYYELYLRPDLYTSRSKQWFYFRVRRTRRKMLYRFSIVNLVKSDSLYNDGMQPVMYSTLGAKEKSEGWRRCGDNICYYRNDDESASSSANEDDEDNSTYTLTFTIEFEHDDDTVFFAHSYPYTYSDLQDYLMEIQRHPVKSKFCKLRLLCRTLAGNNVYYLTVTAPSSNEENMRRKKSIVVSARVHPSETPASWMMKGLMDFITGDTTVAKRLRHKFIFKLVPMLNPDGVIVGNTRNSLTGKDLNRQYRTVIRETYPSIWYTKAMIRRLIEECGV---------------AMYCDMHAHSRKHNIFIYGCE---------NKRNP-------EKKLTEQVFPLMLHKNSADRFSFESCKFKIQRSKEGTGRIVVW-MLGITNSYTIEASFGGSSLGSRKGTHFNTQDYEHMGRAFCETLLDY 854          
BLAST of Cytosolic carboxypeptidase 2 vs. Ensembl Fly
Match: Nna1 (gene:FBgn0265726 transcript:FBtr0340674)

HSP 1 Score: 343.584 bits (880), Expect = 9.262e-100
Identity = 187/452 (41.37%), Postives = 267/452 (59.07%), Query Frame = 2
Query:  875 HQHSECESSSLIFESRFETGNLRQSRRTGQXXXXXXXXXXXXTKRHTQWFYFRLQNMEKNVTYKFIIINLLKSKSLYEEGMRILMYSDKNATTNSIGWYRTGHHIRYTRNFTRLQCPLLNRE---MAYFQLEFQIEFQYSEDTCYLSHCYPYTFTDLKNDLRTFESNCNTKPLLKKDILCETNIGNSCFLLTITDKSIPE---KEKLGAVITARVHPGETNSSWMMKGLIQYLIGNSETAKTLRRRIVFKIVPMLNPDGVIVGNYRCSTVGRDLNRNYRNPKEERFPTIFHTKRLIEDLKKSCTVGVSVVIKYFYVIQAMALYCDLHGHSRKHNVFMYGCDSQYLHSENFNDINPVLNINTIEDYIKDRIFTFLMQKNGPETFSFNGCHFKIRKCKESTGRVVMWKQFNVNDSYTLEATFSGTDINDRR--HFNINDLENIGKIFSESLFSY 2206
            H  +  E   L FESRFE+GNL ++ +     YEL L  DLYT R  QWFYFR++   + + Y+F I+NL+KS SLY +GM+ +MYS   A   S GW R G +I Y RN         N +    + + L F IEF++ +DT + +H YPYT++DL++ L   + +       K  +LC T  GN+ + LT+T  S  E   + K   V++ARVHP ET +SWMMKGL+ ++ G++  AK LR + +FK+VPMLNPDGVIVGN R S  G+DLNR YR    E +P+I++TK +I  L + C V               A+YCD+H HSRKHN+F+YGC+         N  NP       E  + +++F  ++ KN  + FSF  C FKI++ KE TGR+V+W    + +SYT+EA+F G+ +  R+  HFN  D E++G+ F E+L  Y
Sbjct:  606 HPMNPEEYDGLEFESRFESGNLAKAVQITPTYYELYLRPDLYTSRSKQWFYFRVRRTRRKMLYRFSIVNLVKSDSLYNDGMQPVMYSTLGAKEKSEGWRRCGDNICYYRNDDESASSSANEDDEDNSTYTLTFTIEFEHDDDTVFFAHSYPYTYSDLQDYLMEIQRHPVKSKFCKLRLLCRTLAGNNVYYLTVTAPSSNEENMRRKKSIVVSARVHPSETPASWMMKGLMDFITGDTTVAKRLRHKFIFKLVPMLNPDGVIVGNTRNSLTGKDLNRQYRTVIRETYPSIWYTKAMIRRLIEECGV---------------AMYCDMHAHSRKHNIFIYGCE---------NKRNP-------EKKLTEQVFPLMLHKNSADRFSFESCKFKIQRSKEGTGRIVVW-MLGITNSYTIEASFGGSSLGSRKGTHFNTQDYEHMGRAFCETLLDY 1025          
BLAST of Cytosolic carboxypeptidase 2 vs. Ensembl Zebrafish
Match: agbl2 (ATP/GTP binding protein-like 2 [Source:NCBI gene;Acc:568152])

HSP 1 Score: 377.096 bits (967), Expect = 3.186e-115
Identity = 207/500 (41.40%), Postives = 301/500 (60.20%), Query Frame = 2
Query:  902 SLIFESRFETGNLRQSRRTGQXXXXXXXXXXXXTKRHTQWFYFRLQNMEKNVTYKFIIINLLKSKSLYEEGMRILMYSDKNATTNSIGWYRTGHHIRYTRNFTRLQCPLLNREMAYFQLEFQIEFQYSEDTCYLSHCYPYTFTDLKNDLRTFESNCNTKPLLKKDILCETNIGNSCFLLTITDKS---IPEKEKLGAVITARVHPGETNSSWMMKGLIQYLIGNSETAKTLRRRIVFKIVPMLNPDGVIVGNYRCSTVGRDLNRNYRNPKEERFPTIFHTKRLIEDLKKSCTVGVSVVIKYFYVIQAMALYCDLHGHSRKHNVFMYGCDSQYLHSENFNDINPVLNINTIEDYIKDRIFTFLMQKNGPETFSFNGCHFKIRKCKESTGRVVMWKQFNVNDSYTLEATFSGTDINDRR--HFNINDLENIGKIFSESLFSYI--SIMKDEQQQKEIGLDLLKAILKQIVSKSKAMNQLFRKLVSQTTDHIGSEVSLTNNIP 2380
            +L FESRFE GNL+++ + GQY+YEL L  DLYT +HTQWFYFR++NM + VTY+F IINL+KS SLY  GM  L+YS+K A     GW RTG  IRY RN       +     A + L + +EF Y  DTCYL+HCYPYT++ L++ LR   S+       K  +LC +  GN+ ++LTIT  S      K K   V+TARVHPGETN SWMM+G +++L+ +   A  LR   +FK++PMLNPDGV+VGNYRCS  GRDLNRNYR+   + FP I++T+ +               +K     + + +YCD HGHSRK+NVFMYGC+ +   S+                 +++R+F  +M KN  + FSF  C FK+ K KE TGR+VMW+   + +SYT+E+TF G+ + DR+  HF+  DL+++G  F ++L  +      K  +  +E+G+ L + I +++  +  ++  L    +  +T   GS  + ++ +P
Sbjct:  203 TLAFESRFECGNLQKAVQVGQYDYELTLRTDLYTTKHTQWFYFRVRNMREGVTYRFTIINLMKSSSLYGAGMCPLLYSEKTAWLKGEGWKRTGSSIRYYRN------NIEQDGKALYSLTWTLEFPYDGDTCYLAHCYPYTYSKLQHYLREVISDPVRAAYCKLRVLCRSLAGNAVYVLTITAPSSSLAERKAKRAVVVTARVHPGETNGSWMMQGFLEFLLSDLPDAHLLRETFIFKVIPMLNPDGVVVGNYRCSLAGRDLNRNYRSMLRDSFPCIWYTRNM---------------VKRLLAEREVVVYCDFHGHSRKNNVFMYGCNERKDASQ----------------CLQERVFPLMMSKNAKDKFSFRSCKFKMHKSKEGTGRIVMWR-LGIRNSYTMESTFGGSTLGDRKGTHFSTLDLKSMGYCFCDTLLDFCDPDPAKMTRCLEELGVLLKQEIRRKLGREVDSLENLSDIDIESSTS--GSNSTESDGLP 662          
BLAST of Cytosolic carboxypeptidase 2 vs. Ensembl Zebrafish
Match: agbl2 (ATP/GTP binding protein-like 2 [Source:NCBI gene;Acc:568152])

HSP 1 Score: 378.637 bits (971), Expect = 1.130e-112
Identity = 207/500 (41.40%), Postives = 301/500 (60.20%), Query Frame = 2
Query:  902 SLIFESRFETGNLRQSRRTGQXXXXXXXXXXXXTKRHTQWFYFRLQNMEKNVTYKFIIINLLKSKSLYEEGMRILMYSDKNATTNSIGWYRTGHHIRYTRNFTRLQCPLLNREMAYFQLEFQIEFQYSEDTCYLSHCYPYTFTDLKNDLRTFESNCNTKPLLKKDILCETNIGNSCFLLTITDKS---IPEKEKLGAVITARVHPGETNSSWMMKGLIQYLIGNSETAKTLRRRIVFKIVPMLNPDGVIVGNYRCSTVGRDLNRNYRNPKEERFPTIFHTKRLIEDLKKSCTVGVSVVIKYFYVIQAMALYCDLHGHSRKHNVFMYGCDSQYLHSENFNDINPVLNINTIEDYIKDRIFTFLMQKNGPETFSFNGCHFKIRKCKESTGRVVMWKQFNVNDSYTLEATFSGTDINDRR--HFNINDLENIGKIFSESLFSYI--SIMKDEQQQKEIGLDLLKAILKQIVSKSKAMNQLFRKLVSQTTDHIGSEVSLTNNIP 2380
            +L FESRFE GNL+++ + GQY+YEL L  DLYT +HTQWFYFR++NM + VTY+F IINL+KS SLY  GM  L+YS+K A     GW RTG  IRY RN       +     A + L + +EF Y  DTCYL+HCYPYT++ L++ LR   S+       K  +LC +  GN+ ++LTIT  S      K K   V+TARVHPGETN SWMM+G +++L+ +   A  LR   +FK++PMLNPDGV+VGNYRCS  GRDLNRNYR+   + FP I++T+ +               +K     + + +YCD HGHSRK+NVFMYGC+ +   S+                 +++R+F  +M KN  + FSF  C FK+ K KE TGR+VMW+   + +SYT+E+TF G+ + DR+  HF+  DL+++G  F ++L  +      K  +  +E+G+ L + I +++  +  ++  L    +  +T   GS  + ++ +P
Sbjct:  204 TLAFESRFECGNLQKAVQVGQYDYELTLRTDLYTTKHTQWFYFRVRNMREGVTYRFTIINLMKSSSLYGAGMCPLLYSEKTAWLKGEGWKRTGSSIRYYRNN------IEQDGKALYSLTWTLEFPYDGDTCYLAHCYPYTYSKLQHYLREVISDPVRAAYCKLRVLCRSLAGNAVYVLTITAPSSSLAERKAKRAVVVTARVHPGETNGSWMMQGFLEFLLSDLPDAHLLRETFIFKVIPMLNPDGVVVGNYRCSLAGRDLNRNYRSMLRDSFPCIWYTRNM---------------VKRLLAEREVVVYCDFHGHSRKNNVFMYGCNERKDASQ----------------CLQERVFPLMMSKNAKDKFSFRSCKFKMHKSKEGTGRIVMWR-LGIRNSYTMESTFGGSTLGDRKGTHFSTLDLKSMGYCFCDTLLDFCDPDPAKMTRCLEELGVLLKQEIRRKLGREVDSLENLSDIDIESSTS--GSNSTESDGLP 663          
BLAST of Cytosolic carboxypeptidase 2 vs. Ensembl Zebrafish
Match: agbl2 (ATP/GTP binding protein-like 2 [Source:NCBI gene;Acc:568152])

HSP 1 Score: 377.867 bits (969), Expect = 1.779e-112
Identity = 207/500 (41.40%), Postives = 301/500 (60.20%), Query Frame = 2
Query:  902 SLIFESRFETGNLRQSRRTGQXXXXXXXXXXXXTKRHTQWFYFRLQNMEKNVTYKFIIINLLKSKSLYEEGMRILMYSDKNATTNSIGWYRTGHHIRYTRNFTRLQCPLLNREMAYFQLEFQIEFQYSEDTCYLSHCYPYTFTDLKNDLRTFESNCNTKPLLKKDILCETNIGNSCFLLTITDKS---IPEKEKLGAVITARVHPGETNSSWMMKGLIQYLIGNSETAKTLRRRIVFKIVPMLNPDGVIVGNYRCSTVGRDLNRNYRNPKEERFPTIFHTKRLIEDLKKSCTVGVSVVIKYFYVIQAMALYCDLHGHSRKHNVFMYGCDSQYLHSENFNDINPVLNINTIEDYIKDRIFTFLMQKNGPETFSFNGCHFKIRKCKESTGRVVMWKQFNVNDSYTLEATFSGTDINDRR--HFNINDLENIGKIFSESLFSYI--SIMKDEQQQKEIGLDLLKAILKQIVSKSKAMNQLFRKLVSQTTDHIGSEVSLTNNIP 2380
            +L FESRFE GNL+++ + GQY+YEL L  DLYT +HTQWFYFR++NM + VTY+F IINL+KS SLY  GM  L+YS+K A     GW RTG  IRY RN       +     A + L + +EF Y  DTCYL+HCYPYT++ L++ LR   S+       K  +LC +  GN+ ++LTIT  S      K K   V+TARVHPGETN SWMM+G +++L+ +   A  LR   +FK++PMLNPDGV+VGNYRCS  GRDLNRNYR+   + FP I++T+ +               +K     + + +YCD HGHSRK+NVFMYGC+ +   S+                 +++R+F  +M KN  + FSF  C FK+ K KE TGR+VMW+   + +SYT+E+TF G+ + DR+  HF+  DL+++G  F ++L  +      K  +  +E+G+ L + I +++  +  ++  L    +  +T   GS  + ++ +P
Sbjct:  202 TLAFESRFECGNLQKAVQVGQYDYELTLRTDLYTTKHTQWFYFRVRNMREGVTYRFTIINLMKSSSLYGAGMCPLLYSEKTAWLKGEGWKRTGSSIRYYRNN------IEQDGKALYSLTWTLEFPYDGDTCYLAHCYPYTYSKLQHYLREVISDPVRAAYCKLRVLCRSLAGNAVYVLTITAPSSSLAERKAKRAVVVTARVHPGETNGSWMMQGFLEFLLSDLPDAHLLRETFIFKVIPMLNPDGVVVGNYRCSLAGRDLNRNYRSMLRDSFPCIWYTRNM---------------VKRLLAEREVVVYCDFHGHSRKNNVFMYGCNERKDASQ----------------CLQERVFPLMMSKNAKDKFSFRSCKFKMHKSKEGTGRIVMWR-LGIRNSYTMESTFGGSTLGDRKGTHFSTLDLKSMGYCFCDTLLDFCDPDPAKMTRCLEELGVLLKQEIRRKLGREVDSLENLSDIDIESSTS--GSNSTESDGLP 661          
BLAST of Cytosolic carboxypeptidase 2 vs. Ensembl Zebrafish
Match: agtpbp1 (ATP/GTP binding protein 1 [Source:NCBI gene;Acc:554164])

HSP 1 Score: 304.679 bits (779), Expect = 7.800e-89
Identity = 178/452 (39.38%), Postives = 265/452 (58.63%), Query Frame = 2
Query:  902 SLIFESRFETGNLRQSRRTGQXXXXXXXXXXXXTKRHTQWFYFRLQNMEKNVTYKFIIINLLKSKSLYEEGMRILMYSDKNATTNSIGWYRTGHHIRYTRN-FTRLQCPLLNRE-MAYFQLEFQIEFQYSEDTCYLSHCYPYTFTDLKNDLRTFESNCNTKPLLKKDILCETNIGNSCFLLTITDKSIPE----------KEKLGAVITARVHPGETNSSWMMKGLIQYLIGNSETAKTLRRRIVFKIVPMLNPDGVIVGNYRCSTVGRDLNRNYRNPKEERFPTIFHTKRLIEDLKKSCTVGVSVVIKYFYVIQAMALYCDLHGHSRKHNVFMYGC---DSQYLHSENFN--DINPVLNINTIEDYIKDRIFTFLMQKNGPETFSFNGCHFKIRKCKESTGRVVMWKQFNVNDSYTLEATFSGTDINDRRHFNI--NDLENIGKIFSESLF 2200
            SL F S+FE+GNLR++ +  ++EY+L+LN+D+ +  + QWFYF + NM   V Y+F IIN  KS S +  GM+++MYS + A   S  W RTG  I Y +N F R       ++  +YF + F + FQ+ +D CY ++ YPYT++ LK  L+   + C  +   +++ LCET  GN C LLTIT  ++PE          + +    ++ARVHPGETNSSW+MKG +++L+  S  A++LR+  +FKI+PMLNPDGVI GN+RCS  G DLNR ++NP  E  PTI+H K L++ L+ +    +              ++CD HGHSRK NVFMYGC   ++ +  S N +  D+N  L   T+           L+ +  P  FS + C F + + KE+T RVV+W++  V  SYT+E+T  G D    +   I  ++LE +G  F  +L 
Sbjct:  204 SLKFNSKFESGNLRKAIQVRKFEYDLILNSDINSNHYHQWFYFEVGNMRPGVRYRFNIINCEKSNSQFNYGMQVIMYSVQEAINGSPHWVRTGSDICYYKNHFARSSIAAGGQKGKSYFTMTFTVTFQHKDDVCYFAYHYPYTYSMLKMHLQKLSALCTPEIYYRQEDLCETLGGNGCPLLTIT--AMPESSSDEHISQFRSRPVIFLSARVHPGETNSSWVMKGSLEFLMSCSPQAQSLRQSYIFKIMPMLNPDGVINGNHRCSLSGEDLNRQWQNPNAELHPTIYHAKSLLQYLRATGRTPL--------------VFCDYHGHSRKKNVFMYGCSIKETMWQSSVNTSTCDLNEDLGYRTLPK---------LLSQMAP-AFSLSSCSFVVERSKEATARVVVWREIGVQRSYTMESTLCGCDQGKYKGLQIGTSELEEMGSQFCLALL 629          
BLAST of Cytosolic carboxypeptidase 2 vs. Ensembl Zebrafish
Match: agtpbp1 (ATP/GTP binding protein 1 [Source:NCBI gene;Acc:554164])

HSP 1 Score: 303.908 bits (777), Expect = 1.759e-85
Identity = 178/452 (39.38%), Postives = 265/452 (58.63%), Query Frame = 2
Query:  902 SLIFESRFETGNLRQSRRTGQXXXXXXXXXXXXTKRHTQWFYFRLQNMEKNVTYKFIIINLLKSKSLYEEGMRILMYSDKNATTNSIGWYRTGHHIRYTRN-FTRLQCPLLNRE-MAYFQLEFQIEFQYSEDTCYLSHCYPYTFTDLKNDLRTFESNCNTKPLLKKDILCETNIGNSCFLLTITDKSIPE----------KEKLGAVITARVHPGETNSSWMMKGLIQYLIGNSETAKTLRRRIVFKIVPMLNPDGVIVGNYRCSTVGRDLNRNYRNPKEERFPTIFHTKRLIEDLKKSCTVGVSVVIKYFYVIQAMALYCDLHGHSRKHNVFMYGC---DSQYLHSENFN--DINPVLNINTIEDYIKDRIFTFLMQKNGPETFSFNGCHFKIRKCKESTGRVVMWKQFNVNDSYTLEATFSGTDINDRRHFNI--NDLENIGKIFSESLF 2200
            SL F S+FE+GNLR++ +  ++EY+L+LN+D+ +  + QWFYF + NM   V Y+F IIN  KS S +  GM+++MYS + A   S  W RTG  I Y +N F R       ++  +YF + F + FQ+ +D CY ++ YPYT++ LK  L+   + C  +   +++ LCET  GN C LLTIT  ++PE          + +    ++ARVHPGETNSSW+MKG +++L+  S  A++LR+  +FKI+PMLNPDGVI GN+RCS  G DLNR ++NP  E  PTI+H K L++ L+ +    +              ++CD HGHSRK NVFMYGC   ++ +  S N +  D+N  L   T+           L+ +  P  FS + C F + + KE+T RVV+W++  V  SYT+E+T  G D    +   I  ++LE +G  F  +L 
Sbjct:  635 SLKFNSKFESGNLRKAIQVRKFEYDLILNSDINSNHYHQWFYFEVGNMRPGVRYRFNIINCEKSNSQFNYGMQVIMYSVQEAINGSPHWVRTGSDICYYKNHFARSSIAAGGQKGKSYFTMTFTVTFQHKDDVCYFAYHYPYTYSMLKMHLQKLSALCTPEIYYRQEDLCETLGGNGCPLLTIT--AMPESSSDEHISQFRSRPVIFLSARVHPGETNSSWVMKGSLEFLMSCSPQAQSLRQSYIFKIMPMLNPDGVINGNHRCSLSGEDLNRQWQNPNAELHPTIYHAKSLLQYLRATGRTPL--------------VFCDYHGHSRKKNVFMYGCSIKETMWQSSVNTSTCDLNEDLGYRTLPK---------LLSQMAP-AFSLSSCSFVVERSKEATARVVVWREIGVQRSYTMESTLCGCDQGKYKGLQIGTSELEEMGSQFCLALL 1060          
BLAST of Cytosolic carboxypeptidase 2 vs. Ensembl Xenopus
Match: AGBL3 (ATP/GTP binding protein like 3 [Source:HGNC Symbol;Acc:HGNC:27981])

HSP 1 Score: 380.948 bits (977), Expect = 4.608e-117
Identity = 205/450 (45.56%), Postives = 282/450 (62.67%), Query Frame = 2
Query:  872 PHQHSECESSSLIFESRFETGNLRQSRRTGQXXXXXXXXXXXXTKRHTQWFYFRLQNMEKNVTYKFIIINLLKSKSLYEEGMRILMYSDKNATTNSIGWYRTGHHIRYTRNFTRLQCPLLNREMAYFQLEFQIEFQYSEDTCYLSHCYPYTFTDLKNDLRTFESNCNTKPLLKKDILCETNIGNSCFLLTITDKSIPEKE---KLGAVITARVHPGETNSSWMMKGLIQYLIGNSETAKTLRRRIVFKIVPMLNPDGVIVGNYRCSTVGRDLNRNYRNPKEERFPTIFHTKRLIEDLKKSCTVGVSVVIKYFYVIQAMALYCDLHGHSRKHNVFMYGCDSQYLHSENFNDINPVLNINTIEDYIKDRIFTFLMQKNGPETFSFNGCHFKIRKCKESTGRVVMWKQFNVNDSYTLEATFSGTDINDR--RHFNINDLENIGKIFSESLFSY 2206
            PH   E +++ L FE+RFE+GNL+++ R G+Y+Y+L L  DLYT RHTQWFYFR++N    V Y+F I NL K  SLY  GMR L+YS+  A +  IGW+RTG +I+Y RN       L     + F L +   F +S DTCY +HCYPYT+++L++ L    S+       K  +LC +  GN  ++LTIT+ S        K   ++TARVHPGETNSSW+MKG + +L+  S  A+ LR  +VFK+VPMLNPDGVIVGNYRCS  GRDLNRNY++  ++ FP+I+ T+ +I  +++                + + LYCDLHGHSRK NVFMYGC      S  +            ++Y+ +R+F F++ KN PE FSF+ C FK+RK KE TGRVVMWK   + +SYTLEAT+ G+ +  R   HF+  DLE++G  F ++L  Y
Sbjct:  177 PHGWEESDNT-LEFEARFESGNLQKAVRVGEYDYQLTLRTDLYTARHTQWFYFRVRNTRAGVPYRFTITNLRKPASLYSRGMRPLIYSELEAKSRGIGWHRTGENIKYYRN------NLDQDGQSLFSLSWTFCFPHSMDTCYFAHCYPYTYSNLQDYLAGITSDPERSRYCKIRVLCHSLAGNRVYVLTITNPSPATDRPIRKKAVIVTARVHPGETNSSWVMKGFLDFLLSPSNDARVLRDSLVFKVVPMLNPDGVIVGNYRCSLTGRDLNRNYKSRLKDSFPSIWFTRNMIRVMQE----------------REILLYCDLHGHSRKQNVFMYGCKKS---SREY---------QAKQEYLYERMFPFMLSKNAPEKFSFSSCKFKMRKSKEGTGRVVMWK-MGIQNSYTLEATYCGSTLGPRCGTHFSTKDLESVGHHFCDTLLYY 590          
BLAST of Cytosolic carboxypeptidase 2 vs. Ensembl Xenopus
Match: fgfr1 (fibroblast growth factor receptor 1 [Source:Xenbase;Acc:XB-GENE-1018554])

HSP 1 Score: 380.178 bits (975), Expect = 1.194e-113
Identity = 213/508 (41.93%), Postives = 308/508 (60.63%), Query Frame = 2
Query:  863 NQRPHQHSECESSSLIFESRFETGNLRQSRRTGQXXXXXXXXXXXXTKRHTQWFYFRLQNMEKNVTYKFIIINLLKSKSLYEEGMRILMYSDKNATTNSIGWYRTGHHIRYTRNFTRLQCPLLNREMAYFQLEFQIEFQYSEDTCYLSHCYPYTFTDLKNDLRTFESNCNTKPLLKKDILCETNIGNSCFLLTITDKSI---PEKEKLGAVITARVHPGETNSSWMMKGLIQYLIGNSETAKTLRRRIVFKIVPMLNPDGVIVGNYRCSTVGRDLNRNYRNPKEERFPTIFHTKRLIEDLKKSCTVGVSVVIKYFYVIQAMALYCDLHGHSRKHNVFMYGCDSQYLHSENFNDINPVLNINTIEDYIKDRIFTFLMQKNGPETFSFNGCHFKIRKCKESTGRVVMWKQFNVNDSYTLEATFSGTDINDRR--HFNINDLENIGKIFSESLFSYISIMKDEQQQKEIGLDLLKAILKQIVSKSKAMNQLFRKLVSQTTDHIGSEVSLTN 2371
            + R +Q  +C ++ L FESRFE+GNL+++ + G YEYEL L  DLYT +HTQWFYF+++N  K V Y+F I NL+K+ SLY EG++ L+YS ++A    IGW R G  I+Y +N   L         + + L +  EF + +D CY +HCYPYT++DL+ DL++  S+       K   LC +  GNS +LLTIT  S       +K   V+TARVHPGETN SWMMKG + +++ +S  A+ LR   +FK+VPMLNPDGVIVGNYRCS  GRDLNRNY++  ++ FP I+HT+ +               +K     + + LYCD HGHSRK+NVFMYGC+S+          +P+  ++       +RIF  ++ KN P+ F F GC FK++K KE TGR+ MWKQ  + +SYT+EATF G+ + +R+  HF   DL+++G  F ++L  Y     D  + K    +L + + + I  K   M QL R + S   D   S+++L++
Sbjct:  187 SHRKNQKVQC-NNDLQFESRFESGNLQKAMKVGMYEYELTLRTDLYTSKHTQWFYFQVKNTRKGVPYRFTITNLMKTNSLYNEGLKPLLYSQQDAALKGIGWRREGKDIKYYKNTRSLD------GRSLYSLTWTFEFPHDDDICYFAHCYPYTYSDLQRDLKSKISDPACSHYCKLRTLCRSLAGNSIYLLTITSPSTNLTTGAKKKAIVVTARVHPGETNGSWMMKGFLDFILSDSPDAQLLRDTFIFKVVPMLNPDGVIVGNYRCSLSGRDLNRNYKSMLKDAFPCIWHTRSM---------------VKRLLTEREVILYCDFHGHSRKNNVFMYGCNSKG---------HPLTKLH-------ERIFPLMLSKNAPDKFLFKGCKFKVQKSKEGTGRIDMWKQ-GIQNSYTMEATFGGSTLGNRKDTHFTTQDLKSMGHHFCDTLLDYCD--PDSSKFKLCLSELQRLVEEDIREK---MKQLGRDMDS---DFTLSDITLSD 647          
BLAST of Cytosolic carboxypeptidase 2 vs. Ensembl Xenopus
Match: agtpbp1 (ATP/GTP binding protein 1 [Source:NCBI gene;Acc:100135097])

HSP 1 Score: 300.056 bits (767), Expect = 2.071e-84
Identity = 184/474 (38.82%), Postives = 272/474 (57.38%), Query Frame = 2
Query:  830 QIVYDSETYSRNQRPHQHSECESSSLIFESRFETGNLRQSRRTGQXXXXXXXXXXXXTKRHTQWFYFRLQNMEKNVTYKFIIINLLKSKSLYEEGMRILMYSDKNATTNSIGWYRTGHHIRYTRN-FTRLQCPLLNRE-MAYFQLEFQIEFQYSEDTCYLSHCYPYTFTDLKNDLRTFESNCNTKPL-LKKDILCETNIGNSCFLLTITDKSIPEKEKLGAV----------ITARVHPGETNSSWMMKGLIQYLIGNSETAKTLRRRIVFKIVPMLNPDGVIVGNYRCSTVGRDLNRNYRNPKEERFPTIFHTKRLIEDLKKSCTVGVSVVIKYFYVIQAMAL-YCDLHGHSRKHNVFMYGCD-SQYLHSENFNDINPVLNINTIEDYIKDRIFTFLMQKNGPETFSFNGCHFKIRKCKESTGRVVMWKQFNVNDSYTLEATFSGTDINDRRHFNIN--DLENIGKIFSESLF 2200
            ++VYD +  S +      ++ ES  L F S+FE+GNLR+  +  + EY+L+LN+D+ +  + QWFYF +  M   V Y+F IIN  KS S +  GM+ LMYS + A  +   WYR G  I Y +N F+R       ++  +Y+ + F + F + +D CY ++ YPYT++ LK  L+  ES  N + +  ++++LCET  GN C ++TIT  ++PE      V          +++RVHPGETN+SW+MKG +++L+G+S +A++LR   +FKIVPMLNPDGVI GN+RCS  G DLNR ++NP  +  PTI+HTK L++               Y   I+   L YCD HGHSRK NVFMYGC   + +   N N      + + +ED    R    ++ +  P  FS + C F + K KEST RVV+W++  V  SYT+E+T  G D    +   I   +LE +G  F   L 
Sbjct:  569 RVVYDLDNSSCS------AQDESEVLKFNSKFESGNLRKVIQIRKNEYDLILNSDINSNHYHQWFYFEVSGMRTGVAYRFNIINCEKSNSQFNYGMQPLMYSVQEALASRPWWYRVGMDICYYKNHFSRSSIATGGQKGKSYYTITFTVTFPHRDDVCYFAYHYPYTYSTLKMHLKKLESLHNPQQVYFRQEVLCETLGGNGCPVITIT--AMPESNYYEHVYQFRNRPYIFLSSRVHPGETNASWVMKGTLEFLMGSSTSAQSLRESYIFKIVPMLNPDGVINGNHRCSLSGEDLNRQWQNPNVDLHPTIYHTKGLLQ---------------YLAAIRRTPLVYCDYHGHSRKKNVFMYGCSIKETVWHTNAN----AASCDMVEDS-GYRTLPKVLNQLAP-AFSMSSCSFVVEKSKESTARVVVWREIGVQRSYTMESTLCGCDQGKYKDLQIGTKELEEMGAKFCVGLL 1013          
BLAST of Cytosolic carboxypeptidase 2 vs. Ensembl Xenopus
Match: agtpbp1 (ATP/GTP binding protein 1 [Source:NCBI gene;Acc:100135097])

HSP 1 Score: 300.442 bits (768), Expect = 3.646e-84
Identity = 184/474 (38.82%), Postives = 272/474 (57.38%), Query Frame = 2
Query:  830 QIVYDSETYSRNQRPHQHSECESSSLIFESRFETGNLRQSRRTGQXXXXXXXXXXXXTKRHTQWFYFRLQNMEKNVTYKFIIINLLKSKSLYEEGMRILMYSDKNATTNSIGWYRTGHHIRYTRN-FTRLQCPLLNRE-MAYFQLEFQIEFQYSEDTCYLSHCYPYTFTDLKNDLRTFESNCNTKPL-LKKDILCETNIGNSCFLLTITDKSIPEKEKLGAV----------ITARVHPGETNSSWMMKGLIQYLIGNSETAKTLRRRIVFKIVPMLNPDGVIVGNYRCSTVGRDLNRNYRNPKEERFPTIFHTKRLIEDLKKSCTVGVSVVIKYFYVIQAMAL-YCDLHGHSRKHNVFMYGCD-SQYLHSENFNDINPVLNINTIEDYIKDRIFTFLMQKNGPETFSFNGCHFKIRKCKESTGRVVMWKQFNVNDSYTLEATFSGTDINDRRHFNIN--DLENIGKIFSESLF 2200
            ++VYD +  S +      ++ ES  L F S+FE+GNLR+  +  + EY+L+LN+D+ +  + QWFYF +  M   V Y+F IIN  KS S +  GM+ LMYS + A  +   WYR G  I Y +N F+R       ++  +Y+ + F + F + +D CY ++ YPYT++ LK  L+  ES  N + +  ++++LCET  GN C ++TIT  ++PE      V          +++RVHPGETN+SW+MKG +++L+G+S +A++LR   +FKIVPMLNPDGVI GN+RCS  G DLNR ++NP  +  PTI+HTK L++               Y   I+   L YCD HGHSRK NVFMYGC   + +   N N      + + +ED    R    ++ +  P  FS + C F + K KEST RVV+W++  V  SYT+E+T  G D    +   I   +LE +G  F   L 
Sbjct:  607 RVVYDLDNSSCS------AQDESEVLKFNSKFESGNLRKVIQIRKNEYDLILNSDINSNHYHQWFYFEVSGMRTGVAYRFNIINCEKSNSQFNYGMQPLMYSVQEALASRPWWYRVGMDICYYKNHFSRSSIATGGQKGKSYYTITFTVTFPHRDDVCYFAYHYPYTYSTLKMHLKKLESLHNPQQVYFRQEVLCETLGGNGCPVITIT--AMPESNYYEHVYQFRNRPYIFLSSRVHPGETNASWVMKGTLEFLMGSSTSAQSLRESYIFKIVPMLNPDGVINGNHRCSLSGEDLNRQWQNPNVDLHPTIYHTKGLLQ---------------YLAAIRRTPLVYCDYHGHSRKKNVFMYGCSIKETVWHTNAN----AASCDMVEDS-GYRTLPKVLNQLAP-AFSMSSCSFVVEKSKESTARVVVWREIGVQRSYTMESTLCGCDQGKYKDLQIGTKELEEMGAKFCVGLL 1051          
BLAST of Cytosolic carboxypeptidase 2 vs. Ensembl Xenopus
Match: agtpbp1 (ATP/GTP binding protein 1 [Source:NCBI gene;Acc:100135097])

HSP 1 Score: 300.442 bits (768), Expect = 5.463e-84
Identity = 184/474 (38.82%), Postives = 272/474 (57.38%), Query Frame = 2
Query:  830 QIVYDSETYSRNQRPHQHSECESSSLIFESRFETGNLRQSRRTGQXXXXXXXXXXXXTKRHTQWFYFRLQNMEKNVTYKFIIINLLKSKSLYEEGMRILMYSDKNATTNSIGWYRTGHHIRYTRN-FTRLQCPLLNRE-MAYFQLEFQIEFQYSEDTCYLSHCYPYTFTDLKNDLRTFESNCNTKPL-LKKDILCETNIGNSCFLLTITDKSIPEKEKLGAV----------ITARVHPGETNSSWMMKGLIQYLIGNSETAKTLRRRIVFKIVPMLNPDGVIVGNYRCSTVGRDLNRNYRNPKEERFPTIFHTKRLIEDLKKSCTVGVSVVIKYFYVIQAMAL-YCDLHGHSRKHNVFMYGCD-SQYLHSENFNDINPVLNINTIEDYIKDRIFTFLMQKNGPETFSFNGCHFKIRKCKESTGRVVMWKQFNVNDSYTLEATFSGTDINDRRHFNIN--DLENIGKIFSESLF 2200
            ++VYD +  S +      ++ ES  L F S+FE+GNLR+  +  + EY+L+LN+D+ +  + QWFYF +  M   V Y+F IIN  KS S +  GM+ LMYS + A  +   WYR G  I Y +N F+R       ++  +Y+ + F + F + +D CY ++ YPYT++ LK  L+  ES  N + +  ++++LCET  GN C ++TIT  ++PE      V          +++RVHPGETN+SW+MKG +++L+G+S +A++LR   +FKIVPMLNPDGVI GN+RCS  G DLNR ++NP  +  PTI+HTK L++               Y   I+   L YCD HGHSRK NVFMYGC   + +   N N      + + +ED    R    ++ +  P  FS + C F + K KEST RVV+W++  V  SYT+E+T  G D    +   I   +LE +G  F   L 
Sbjct:  631 RVVYDLDNSSCS------AQDESEVLKFNSKFESGNLRKVIQIRKNEYDLILNSDINSNHYHQWFYFEVSGMRTGVAYRFNIINCEKSNSQFNYGMQPLMYSVQEALASRPWWYRVGMDICYYKNHFSRSSIATGGQKGKSYYTITFTVTFPHRDDVCYFAYHYPYTYSTLKMHLKKLESLHNPQQVYFRQEVLCETLGGNGCPVITIT--AMPESNYYEHVYQFRNRPYIFLSSRVHPGETNASWVMKGTLEFLMGSSTSAQSLRESYIFKIVPMLNPDGVINGNHRCSLSGEDLNRQWQNPNVDLHPTIYHTKGLLQ---------------YLAAIRRTPLVYCDYHGHSRKKNVFMYGCSIKETVWHTNAN----AASCDMVEDS-GYRTLPKVLNQLAP-AFSMSSCSFVVEKSKESTARVVVWREIGVQRSYTMESTLCGCDQGKYKDLQIGTKELEEMGAKFCVGLL 1075          
BLAST of Cytosolic carboxypeptidase 2 vs. Ensembl Mouse
Match: Agbl2 (ATP/GTP binding protein-like 2 [Source:MGI Symbol;Acc:MGI:2443254])

HSP 1 Score: 374.4 bits (960), Expect = 2.874e-114
Identity = 203/471 (43.10%), Postives = 295/471 (62.63%), Query Frame = 2
Query:  893 ESSSLIFESRFETGNLRQSRRTGQXXXXXXXXXXXXTKRHTQWFYFRLQNMEKNVTYKFIIINLLKSKSLYEEGMRILMYSDKNATTNSIGWYRTGHHIRYTRNFTRLQCPLLNREMAYFQLEFQIEFQYSEDTCYLSHCYPYTFTDLKNDLRTFESNCNTKPLLKKDILCETNIGNSCFLLTITDKSIPEKE---KLGAVITARVHPGETNSSWMMKGLIQYLIGNSETAKTLRRRIVFKIVPMLNPDGVIVGNYRCSTVGRDLNRNYRNPKEERFPTIFHTKRLIEDLKKSCTVGVSVVIKYFYVIQAMALYCDLHGHSRKHNVFMYGCDSQYLHSENFNDINPVLNINTIEDYIKDRIFTFLMQKNGPETFSFNGCHFKIRKCKESTGRVVMWKQFNVNDSYTLEATFSGTDINDRR--HFNINDLENIGKIFSESLFSYISIMKDEQQQKEIGLDLLKAILKQIVSK 2290
            + ++L+FESRFE+GNL+++ R G YEYEL L  DLYT +HTQWFYFR+QN  K+ TY+F I+NLLK KSLY  GM+ LMYS  +AT  +IGW R G  I+Y +N         + +   + L +  +F + +DTC+ +H YPYT+TDL+  L +  +N       K   LC +  GN+ +LLTIT+ S   +E   K   V++ARVHPGE+NSSW+M G + +++ NS  A+ LR   VFK++PMLNPDGVIVGNYRCS  GRDLNR+Y+   ++ FP I++TK +I+ L +                + + LYCD HGHSRK+N+F+YGC S                 N  + ++ +R+F  ++ KN P+ FSF+ C+FK++KCKE TGRVVMW+   +N SYT+E+TF G+ +  +R  HF I DL+++G    ++L  +      +Q +    L  LK +L+Q ++K
Sbjct:  225 DDNTLLFESRFESGNLQKAVRVGIYEYELTLRTDLYTDKHTQWFYFRVQNTRKDATYRFTIVNLLKPKSLYAVGMKPLMYSQLDATIYNIGWRREGREIKYYKNNVD------DGQQPLYCLTWTTQFPHDQDTCFFAHFYPYTYTDLQCYLLSVANNPIQSQFCKLRALCRSLAGNTVYLLTITNPSRTPQEAAAKKAVVLSARVHPGESNSSWIMNGFLDFILSNSPDAQLLRDIFVFKVIPMLNPDGVIVGNYRCSLAGRDLNRHYKTVLKDSFPCIWYTKNMIKRLLEE---------------REVLLYCDFHGHSRKNNIFLYGCHS-----------------NNRKHWLHERVFPLMLSKNAPDKFSFDSCNFKVQKCKEGTGRVVMWRMGIIN-SYTMESTFGGSTLGSKRDTHFTIEDLKSLGYHVCDTLLDFCD---PDQTKYTQCLQELKELLQQEINK 653          
BLAST of Cytosolic carboxypeptidase 2 vs. Ensembl Mouse
Match: Agbl2 (ATP/GTP binding protein-like 2 [Source:MGI Symbol;Acc:MGI:2443254])

HSP 1 Score: 374.785 bits (961), Expect = 2.178e-113
Identity = 206/472 (43.64%), Postives = 296/472 (62.71%), Query Frame = 2
Query:  893 ESSSLIFESRFETGNLRQSRRTGQXXXXXXXXXXXXTKRHTQWFYFRLQNMEKNVTYKFIIINLLKSKSLYEEGMRILMYSDKNATTNSIGWYRTGHHIRYTRN-FTRLQCPLLNREMAYFQLEFQIEFQYSEDTCYLSHCYPYTFTDLKNDLRTFESNCNTKPLLKKDILCETNIGNSCFLLTITDKSIPEKE---KLGAVITARVHPGETNSSWMMKGLIQYLIGNSETAKTLRRRIVFKIVPMLNPDGVIVGNYRCSTVGRDLNRNYRNPKEERFPTIFHTKRLIEDLKKSCTVGVSVVIKYFYVIQAMALYCDLHGHSRKHNVFMYGCDSQYLHSENFNDINPVLNINTIEDYIKDRIFTFLMQKNGPETFSFNGCHFKIRKCKESTGRVVMWKQFNVNDSYTLEATFSGTDINDRR--HFNINDLENIGKIFSESLFSYISIMKDEQQQKEIGLDLLKAILKQIVSK 2290
            + ++L+FESRFE+GNL+++ R G YEYEL L  DLYT +HTQWFYFR+QN  K+ TY+F I+NLLK KSLY  GM+ LMYS  +AT  +IGW R G  I+Y +N     Q PL       + L +  +F + +DTC+ +H YPYT+TDL+  L +  +N       K   LC +  GN+ +LLTIT+ S   +E   K   V++ARVHPGE+NSSW+M G + +++ NS  A+ LR   VFK++PMLNPDGVIVGNYRCS  GRDLNR+Y+   ++ FP I++TK +I+ L +                + + LYCD HGHSRK+N+F+YGC S                 N  + ++ +R+F  ++ KN P+ FSF+ C+FK++KCKE TGRVVMW+   +N SYT+E+TF G+ +  +R  HF I DL+++G    ++L  +      +Q +    L  LK +L+Q ++K
Sbjct:  225 DDNTLLFESRFESGNLQKAVRVGIYEYELTLRTDLYTDKHTQWFYFRVQNTRKDATYRFTIVNLLKPKSLYAVGMKPLMYSQLDATIYNIGWRREGREIKYYKNNVDDGQQPL-------YCLTWTTQFPHDQDTCFFAHFYPYTYTDLQCYLLSVANNPIQSQFCKLRALCRSLAGNTVYLLTITNPSRTPQEAAAKKAVVLSARVHPGESNSSWIMNGFLDFILSNSPDAQLLRDIFVFKVIPMLNPDGVIVGNYRCSLAGRDLNRHYKTVLKDSFPCIWYTKNMIKRLLEE---------------REVLLYCDFHGHSRKNNIFLYGCHS-----------------NNRKHWLHERVFPLMLSKNAPDKFSFDSCNFKVQKCKEGTGRVVMWRMGIIN-SYTMESTFGGSTLGSKRDTHFTIEDLKSLGYHVCDTLLDFCD---PDQTKYTQCLQELKELLQQEINK 653          
BLAST of Cytosolic carboxypeptidase 2 vs. Ensembl Mouse
Match: Agbl2 (ATP/GTP binding protein-like 2 [Source:MGI Symbol;Acc:MGI:2443254])

HSP 1 Score: 375.17 bits (962), Expect = 2.701e-113
Identity = 203/471 (43.10%), Postives = 295/471 (62.63%), Query Frame = 2
Query:  893 ESSSLIFESRFETGNLRQSRRTGQXXXXXXXXXXXXTKRHTQWFYFRLQNMEKNVTYKFIIINLLKSKSLYEEGMRILMYSDKNATTNSIGWYRTGHHIRYTRNFTRLQCPLLNREMAYFQLEFQIEFQYSEDTCYLSHCYPYTFTDLKNDLRTFESNCNTKPLLKKDILCETNIGNSCFLLTITDKSIPEKE---KLGAVITARVHPGETNSSWMMKGLIQYLIGNSETAKTLRRRIVFKIVPMLNPDGVIVGNYRCSTVGRDLNRNYRNPKEERFPTIFHTKRLIEDLKKSCTVGVSVVIKYFYVIQAMALYCDLHGHSRKHNVFMYGCDSQYLHSENFNDINPVLNINTIEDYIKDRIFTFLMQKNGPETFSFNGCHFKIRKCKESTGRVVMWKQFNVNDSYTLEATFSGTDINDRR--HFNINDLENIGKIFSESLFSYISIMKDEQQQKEIGLDLLKAILKQIVSK 2290
            + ++L+FESRFE+GNL+++ R G YEYEL L  DLYT +HTQWFYFR+QN  K+ TY+F I+NLLK KSLY  GM+ LMYS  +AT  +IGW R G  I+Y +N         + +   + L +  +F + +DTC+ +H YPYT+TDL+  L +  +N       K   LC +  GN+ +LLTIT+ S   +E   K   V++ARVHPGE+NSSW+M G + +++ NS  A+ LR   VFK++PMLNPDGVIVGNYRCS  GRDLNR+Y+   ++ FP I++TK +I+ L +                + + LYCD HGHSRK+N+F+YGC S                 N  + ++ +R+F  ++ KN P+ FSF+ C+FK++KCKE TGRVVMW+   +N SYT+E+TF G+ +  +R  HF I DL+++G    ++L  +      +Q +    L  LK +L+Q ++K
Sbjct:  225 DDNTLLFESRFESGNLQKAVRVGIYEYELTLRTDLYTDKHTQWFYFRVQNTRKDATYRFTIVNLLKPKSLYAVGMKPLMYSQLDATIYNIGWRREGREIKYYKNNVD------DGQQPLYCLTWTTQFPHDQDTCFFAHFYPYTYTDLQCYLLSVANNPIQSQFCKLRALCRSLAGNTVYLLTITNPSRTPQEAAAKKAVVLSARVHPGESNSSWIMNGFLDFILSNSPDAQLLRDIFVFKVIPMLNPDGVIVGNYRCSLAGRDLNRHYKTVLKDSFPCIWYTKNMIKRLLEE---------------REVLLYCDFHGHSRKNNIFLYGCHS-----------------NNRKHWLHERVFPLMLSKNAPDKFSFDSCNFKVQKCKEGTGRVVMWRMGIIN-SYTMESTFGGSTLGSKRDTHFTIEDLKSLGYHVCDTLLDFCD---PDQTKYTQCLQELKELLQQEINK 653          
BLAST of Cytosolic carboxypeptidase 2 vs. Ensembl Mouse
Match: Agbl2 (ATP/GTP binding protein-like 2 [Source:MGI Symbol;Acc:MGI:2443254])

HSP 1 Score: 375.555 bits (963), Expect = 3.716e-113
Identity = 206/472 (43.64%), Postives = 296/472 (62.71%), Query Frame = 2
Query:  893 ESSSLIFESRFETGNLRQSRRTGQXXXXXXXXXXXXTKRHTQWFYFRLQNMEKNVTYKFIIINLLKSKSLYEEGMRILMYSDKNATTNSIGWYRTGHHIRYTRN-FTRLQCPLLNREMAYFQLEFQIEFQYSEDTCYLSHCYPYTFTDLKNDLRTFESNCNTKPLLKKDILCETNIGNSCFLLTITDKSIPEKE---KLGAVITARVHPGETNSSWMMKGLIQYLIGNSETAKTLRRRIVFKIVPMLNPDGVIVGNYRCSTVGRDLNRNYRNPKEERFPTIFHTKRLIEDLKKSCTVGVSVVIKYFYVIQAMALYCDLHGHSRKHNVFMYGCDSQYLHSENFNDINPVLNINTIEDYIKDRIFTFLMQKNGPETFSFNGCHFKIRKCKESTGRVVMWKQFNVNDSYTLEATFSGTDINDRR--HFNINDLENIGKIFSESLFSYISIMKDEQQQKEIGLDLLKAILKQIVSK 2290
            + ++L+FESRFE+GNL+++ R G YEYEL L  DLYT +HTQWFYFR+QN  K+ TY+F I+NLLK KSLY  GM+ LMYS  +AT  +IGW R G  I+Y +N     Q PL       + L +  +F + +DTC+ +H YPYT+TDL+  L +  +N       K   LC +  GN+ +LLTIT+ S   +E   K   V++ARVHPGE+NSSW+M G + +++ NS  A+ LR   VFK++PMLNPDGVIVGNYRCS  GRDLNR+Y+   ++ FP I++TK +I+ L +                + + LYCD HGHSRK+N+F+YGC S                 N  + ++ +R+F  ++ KN P+ FSF+ C+FK++KCKE TGRVVMW+   +N SYT+E+TF G+ +  +R  HF I DL+++G    ++L  +      +Q +    L  LK +L+Q ++K
Sbjct:  225 DDNTLLFESRFESGNLQKAVRVGIYEYELTLRTDLYTDKHTQWFYFRVQNTRKDATYRFTIVNLLKPKSLYAVGMKPLMYSQLDATIYNIGWRREGREIKYYKNNVDDGQQPL-------YCLTWTTQFPHDQDTCFFAHFYPYTYTDLQCYLLSVANNPIQSQFCKLRALCRSLAGNTVYLLTITNPSRTPQEAAAKKAVVLSARVHPGESNSSWIMNGFLDFILSNSPDAQLLRDIFVFKVIPMLNPDGVIVGNYRCSLAGRDLNRHYKTVLKDSFPCIWYTKNMIKRLLEE---------------REVLLYCDFHGHSRKNNIFLYGCHS-----------------NNRKHWLHERVFPLMLSKNAPDKFSFDSCNFKVQKCKEGTGRVVMWRMGIIN-SYTMESTFGGSTLGSKRDTHFTIEDLKSLGYHVCDTLLDFCD---PDQTKYTQCLQELKELLQQEINK 653          
BLAST of Cytosolic carboxypeptidase 2 vs. Ensembl Mouse
Match: Agbl2 (ATP/GTP binding protein-like 2 [Source:MGI Symbol;Acc:MGI:2443254])

HSP 1 Score: 375.555 bits (963), Expect = 3.716e-113
Identity = 206/472 (43.64%), Postives = 296/472 (62.71%), Query Frame = 2
Query:  893 ESSSLIFESRFETGNLRQSRRTGQXXXXXXXXXXXXTKRHTQWFYFRLQNMEKNVTYKFIIINLLKSKSLYEEGMRILMYSDKNATTNSIGWYRTGHHIRYTRN-FTRLQCPLLNREMAYFQLEFQIEFQYSEDTCYLSHCYPYTFTDLKNDLRTFESNCNTKPLLKKDILCETNIGNSCFLLTITDKSIPEKE---KLGAVITARVHPGETNSSWMMKGLIQYLIGNSETAKTLRRRIVFKIVPMLNPDGVIVGNYRCSTVGRDLNRNYRNPKEERFPTIFHTKRLIEDLKKSCTVGVSVVIKYFYVIQAMALYCDLHGHSRKHNVFMYGCDSQYLHSENFNDINPVLNINTIEDYIKDRIFTFLMQKNGPETFSFNGCHFKIRKCKESTGRVVMWKQFNVNDSYTLEATFSGTDINDRR--HFNINDLENIGKIFSESLFSYISIMKDEQQQKEIGLDLLKAILKQIVSK 2290
            + ++L+FESRFE+GNL+++ R G YEYEL L  DLYT +HTQWFYFR+QN  K+ TY+F I+NLLK KSLY  GM+ LMYS  +AT  +IGW R G  I+Y +N     Q PL       + L +  +F + +DTC+ +H YPYT+TDL+  L +  +N       K   LC +  GN+ +LLTIT+ S   +E   K   V++ARVHPGE+NSSW+M G + +++ NS  A+ LR   VFK++PMLNPDGVIVGNYRCS  GRDLNR+Y+   ++ FP I++TK +I+ L +                + + LYCD HGHSRK+N+F+YGC S                 N  + ++ +R+F  ++ KN P+ FSF+ C+FK++KCKE TGRVVMW+   +N SYT+E+TF G+ +  +R  HF I DL+++G    ++L  +      +Q +    L  LK +L+Q ++K
Sbjct:  225 DDNTLLFESRFESGNLQKAVRVGIYEYELTLRTDLYTDKHTQWFYFRVQNTRKDATYRFTIVNLLKPKSLYAVGMKPLMYSQLDATIYNIGWRREGREIKYYKNNVDDGQQPL-------YCLTWTTQFPHDQDTCFFAHFYPYTYTDLQCYLLSVANNPIQSQFCKLRALCRSLAGNTVYLLTITNPSRTPQEAAAKKAVVLSARVHPGESNSSWIMNGFLDFILSNSPDAQLLRDIFVFKVIPMLNPDGVIVGNYRCSLAGRDLNRHYKTVLKDSFPCIWYTKNMIKRLLEE---------------REVLLYCDFHGHSRKNNIFLYGCHS-----------------NNRKHWLHERVFPLMLSKNAPDKFSFDSCNFKVQKCKEGTGRVVMWRMGIIN-SYTMESTFGGSTLGSKRDTHFTIEDLKSLGYHVCDTLLDFCD---PDQTKYTQCLQELKELLQQEINK 653          
BLAST of Cytosolic carboxypeptidase 2 vs. UniProt/SwissProt
Match: sp|A6H8T7|CBPC2_DANRE (Cytosolic carboxypeptidase 2 OS=Danio rerio OX=7955 GN=zte25 PE=2 SV=1)

HSP 1 Score: 377.096 bits (967), Expect = 2.611e-114
Identity = 206/500 (41.20%), Postives = 300/500 (60.00%), Query Frame = 2
Query:  902 SLIFESRFETGNLRQSRRTGQXXXXXXXXXXXXTKRHTQWFYFRLQNMEKNVTYKFIIINLLKSKSLYEEGMRILMYSDKNATTNSIGWYRTGHHIRYTRNFTRLQCPLLNREMAYFQLEFQIEFQYSEDTCYLSHCYPYTFTDLKNDLRTFESNCNTKPLLKKDILCETNIGNSCFLLTITDKS---IPEKEKLGAVITARVHPGETNSSWMMKGLIQYLIGNSETAKTLRRRIVFKIVPMLNPDGVIVGNYRCSTVGRDLNRNYRNPKEERFPTIFHTKRLIEDLKKSCTVGVSVVIKYFYVIQAMALYCDLHGHSRKHNVFMYGCDSQYLHSENFNDINPVLNINTIEDYIKDRIFTFLMQKNGPETFSFNGCHFKIRKCKESTGRVVMWKQFNVNDSYTLEATFSGTDINDRR--HFNINDLENIGKIFSESLFSYI--SIMKDEQQQKEIGLDLLKAILKQIVSKSKAMNQLFRKLVSQTTDHIGSEVSLTNNIP 2380
            +L FESRFE GNL+++ + GQY+Y L L  DLYT +HTQWFYFR++NM + VTY+F IINL+KS SLY  GM  L+YS+K A     GW RTG  IRY RN       +     A + L + +EF Y  DTCYL+HCYPYT++ L++ LR   S+       K  +LC +  GN+ ++LTIT  S      K K   V+TARVHPGETN SWMM+G +++L+ +   A  LR   +FK++PMLNPDGV+VGNYRCS  GRDLNRNYR+   + FP I++T+ +               +K     + + +YCD HGHSRK+NVFMYGC+ +   S+                 +++R+F  +M KN  + FSF  C FK+ K KE TGR+VMW+   + +SYT+E+TF G+ + DR+  HF+  DL+++G  F ++L  +      K  +  +E+G+ L + I +++  +  ++  L    +  +T   GS  + ++ +P
Sbjct:  203 TLAFESRFECGNLQKAVQVGQYDYGLTLRTDLYTTKHTQWFYFRVRNMREGVTYRFTIINLMKSSSLYGAGMCPLLYSEKTAWLKGEGWKRTGSSIRYYRN------NIEQDGKALYSLTWTLEFPYDGDTCYLAHCYPYTYSKLQHYLREVISDPVRAAYCKLRVLCRSLAGNAVYVLTITAPSSSLAERKAKRAVVVTARVHPGETNGSWMMQGFLEFLLSDLPDAHLLRETFIFKVIPMLNPDGVVVGNYRCSLAGRDLNRNYRSMLRDSFPCIWYTRNM---------------VKRLLAEREVVVYCDFHGHSRKNNVFMYGCNERKDASQ----------------CLQERVFPLMMSKNAKDKFSFRSCKFKMHKSKEGTGRIVMWR-LGIRNSYTMESTFGGSTLGDRKGTHFSTLDLKSMGYCFCDTLLDFCDPDPAKMTRCLEELGVLLKQEIRRKLGREVDSLENLSDIDIESSTS--GSNSTESDGLP 662          
BLAST of Cytosolic carboxypeptidase 2 vs. UniProt/SwissProt
Match: sp|Q5U5Z8|CBPC2_HUMAN (Cytosolic carboxypeptidase 2 OS=Homo sapiens OX=9606 GN=AGBL2 PE=1 SV=2)

HSP 1 Score: 380.563 bits (976), Expect = 1.063e-113
Identity = 204/471 (43.31%), Postives = 298/471 (63.27%), Query Frame = 2
Query:  893 ESSSLIFESRFETGNLRQSRRTGQXXXXXXXXXXXXTKRHTQWFYFRLQNMEKNVTYKFIIINLLKSKSLYEEGMRILMYSDKNATTNSIGWYRTGHHIRYTRNFTRLQCPLLNREMAYFQLEFQIEFQYSEDTCYLSHCYPYTFTDLKNDLRTFESNCNTKPLLKKDILCETNIGNSCFLLTITDKSIPEKE---KLGAVITARVHPGETNSSWMMKGLIQYLIGNSETAKTLRRRIVFKIVPMLNPDGVIVGNYRCSTVGRDLNRNYRNPKEERFPTIFHTKRLIEDLKKSCTVGVSVVIKYFYVIQAMALYCDLHGHSRKHNVFMYGCDSQYLHSENFNDINPVLNINTIEDYIKDRIFTFLMQKNGPETFSFNGCHFKIRKCKESTGRVVMWKQFNVNDSYTLEATFSGTDINDRR--HFNINDLENIGKIFSESLFSYISIMKDEQQQKEIGLDLLKAILKQIVSK 2290
            E ++L+FESRFE+GNL+++ R   YEYEL L  DLYT +HTQWFYFR+QN  K+ TY+F I+NLLK KSLY  GM+ L+YS  +A T +IGW R G+ I+Y +N T       + +  ++ L + I+F Y +DTC+ +H YPYT+TDL+  L +  +N       K   LC +  GN+ +LLTIT+ S   +E   K   V++ARVHPGE+N SW+MKG + +++ NS  A+ LR   VFK++PMLNPDGVIVGNYRCS  GRDLNR+Y+   +E FP I++T+ +I+ L +                + + LYCD HGHSRK+N+F+YGC                 N N  + ++ +R+F  ++ KN P+ FSF+ C+FK++KCKE TGRVVMW+   + +SYT+E+TF G+ + ++R  HF I DL+++G    ++L  +      +Q +    L  LK +L+Q + K
Sbjct:  262 EDNTLLFESRFESGNLQKAVRVDTYEYELTLRTDLYTNKHTQWFYFRVQNTRKDATYRFTIVNLLKPKSLYTVGMKPLLYSQLDANTRNIGWRREGNEIKYYKNNTD------DGQQPFYCLTWTIQFPYDQDTCFFAHFYPYTYTDLQCYLLSVANNPIQSQFCKLQTLCRSLAGNTVYLLTITNPSQTPQEAAAKKAVVLSARVHPGESNGSWVMKGFLDFILSNSPDAQLLRDIFVFKVLPMLNPDGVIVGNYRCSLAGRDLNRHYKTILKESFPCIWYTRNMIKRLLEE---------------REVLLYCDFHGHSRKNNIFLYGC-----------------NNNNRKYWLHERVFPLMLCKNAPDKFSFHSCNFKVQKCKEGTGRVVMWR-MGILNSYTMESTFGGSTLGNKRDTHFTIEDLKSLGYHVCDTLLDFCD---PDQMKFTQCLAELKELLRQEIHK 690          
BLAST of Cytosolic carboxypeptidase 2 vs. UniProt/SwissProt
Match: sp|Q4R632|CBPC2_MACFA (Cytosolic carboxypeptidase 2 OS=Macaca fascicularis OX=9541 GN=AGBL2 PE=2 SV=1)

HSP 1 Score: 377.096 bits (967), Expect = 4.244e-113
Identity = 204/471 (43.31%), Postives = 295/471 (62.63%), Query Frame = 2
Query:  893 ESSSLIFESRFETGNLRQSRRTGQXXXXXXXXXXXXTKRHTQWFYFRLQNMEKNVTYKFIIINLLKSKSLYEEGMRILMYSDKNATTNSIGWYRTGHHIRYTRNFTRLQCPLLNREMAYFQLEFQIEFQYSEDTCYLSHCYPYTFTDLKNDLRTFESNCNTKPLLKKDILCETNIGNSCFLLTITDKSIPEKE---KLGAVITARVHPGETNSSWMMKGLIQYLIGNSETAKTLRRRIVFKIVPMLNPDGVIVGNYRCSTVGRDLNRNYRNPKEERFPTIFHTKRLIEDLKKSCTVGVSVVIKYFYVIQAMALYCDLHGHSRKHNVFMYGCDSQYLHSENFNDINPVLNINTIEDYIKDRIFTFLMQKNGPETFSFNGCHFKIRKCKESTGRVVMWKQFNVNDSYTLEATFSGTDINDRR--HFNINDLENIGKIFSESLFSYISIMKDEQQQKEIGLDLLKAILKQIVSK 2290
            E ++L+FESRFE GNL+++ R   YEYEL L  DLYT RHTQWFYFR+QN  K+ TY+F I+NLLK KSLY  GM+ L+YS  +A T +IGW R G+ I+Y +N       + + +  ++ L + I+F Y +DTC+ +H YPYT+TDL+  L +  +N       K   LC +  GN+ +LLTIT+ S   +E   K   V++ARVHPGE+N SW+MKG + +++ NS  A+ LR   VFK++PMLNPDGVIVGNYRCS  GRDLNR+Y+   +E FP I++T+ +I+ L +                + + LYCD HGHSRK+N F+YGC                 N N  + ++ +R+F  ++ KN P+ FSF+ C+FK++KCKE TGRVVMW+   + +SYT+E+TF G+ +  +R  HF I DL+++G    ++L  +      +Q +    L  LK +L+Q + K
Sbjct:  224 EDNTLLFESRFECGNLQKAVRVDTYEYELTLRTDLYTNRHTQWFYFRVQNTRKDATYRFTIVNLLKPKSLYTVGMKPLLYSQMDANTRNIGWRREGNEIKYCKN------NMDDGQQPFYCLTWTIQFPYDQDTCFFAHFYPYTYTDLQCYLLSVANNPIQSQFCKLQTLCRSLAGNTVYLLTITNPSQTPQEAAAKKAVVLSARVHPGESNGSWVMKGFLDFILSNSPDAQLLRDIFVFKVLPMLNPDGVIVGNYRCSLAGRDLNRHYKTILKESFPCIWYTRNMIKRLLEE---------------REVLLYCDFHGHSRKNNTFLYGC-----------------NNNNRKYWLHERVFPLMLSKNAPDRFSFHSCNFKVQKCKEGTGRVVMWR-MGILNSYTMESTFGGSTLGSKRDTHFTIEDLKSLGYHVCDTLLDFCD---PDQTKFTQCLAELKELLRQEIHK 652          
BLAST of Cytosolic carboxypeptidase 2 vs. UniProt/SwissProt
Match: sp|Q0P4M4|CBPC2_XENTR (Cytosolic carboxypeptidase 2 OS=Xenopus tropicalis OX=8364 GN=agbl2 PE=2 SV=1)

HSP 1 Score: 380.563 bits (976), Expect = 5.108e-113
Identity = 213/508 (41.93%), Postives = 308/508 (60.63%), Query Frame = 2
Query:  863 NQRPHQHSECESSSLIFESRFETGNLRQSRRTGQXXXXXXXXXXXXTKRHTQWFYFRLQNMEKNVTYKFIIINLLKSKSLYEEGMRILMYSDKNATTNSIGWYRTGHHIRYTRNFTRLQCPLLNREMAYFQLEFQIEFQYSEDTCYLSHCYPYTFTDLKNDLRTFESNCNTKPLLKKDILCETNIGNSCFLLTITDKSI---PEKEKLGAVITARVHPGETNSSWMMKGLIQYLIGNSETAKTLRRRIVFKIVPMLNPDGVIVGNYRCSTVGRDLNRNYRNPKEERFPTIFHTKRLIEDLKKSCTVGVSVVIKYFYVIQAMALYCDLHGHSRKHNVFMYGCDSQYLHSENFNDINPVLNINTIEDYIKDRIFTFLMQKNGPETFSFNGCHFKIRKCKESTGRVVMWKQFNVNDSYTLEATFSGTDINDRR--HFNINDLENIGKIFSESLFSYISIMKDEQQQKEIGLDLLKAILKQIVSKSKAMNQLFRKLVSQTTDHIGSEVSLTN 2371
            + R +Q  +C ++ L FESRFE+GNL+++ + G YEYEL L  DLYT +HTQWFYF+++N  K V Y+F I NL+K+ SLY EG++ L+YS ++A    IGW R G  I+Y +N   L         + + L +  EF + +D CY +HCYPYT++DL+ DL++  S+       K   LC +  GNS +LLTIT  S       +K   V+TARVHPGETN SWMMKG + +++ +S  A+ LR   +FK+VPMLNPDGVIVGNYRCS  GRDLNRNY++  ++ FP I+HT+ +               +K     + + LYCD HGHSRK+NVFMYGC+S+          +P+  ++       +RIF  ++ KN P+ F F GC FK++K KE TGR+ MWKQ  + +SYT+EATF G+ + +R+  HF   DL+++G  F ++L  Y     D  + K    +L + + + I  K   M QL R + S   D   S+++L++
Sbjct:  187 SHRKNQKVQC-NNDLQFESRFESGNLQKAMKVGMYEYELTLRTDLYTSKHTQWFYFQVKNTRKGVPYRFTITNLMKTNSLYNEGLKPLLYSQQDAALKGIGWRREGKDIKYYKNTRSLD------GRSLYSLTWTFEFPHDDDICYFAHCYPYTYSDLQRDLKSKISDPACSHYCKLRTLCRSLAGNSIYLLTITSPSTNLTTGAKKKAIVVTARVHPGETNGSWMMKGFLDFILSDSPDAQLLRDTFIFKVVPMLNPDGVIVGNYRCSLSGRDLNRNYKSMLKDAFPCIWHTRSM---------------VKRLLTEREVILYCDFHGHSRKNNVFMYGCNSKG---------HPLTKLH-------ERIFPLMLSKNAPDKFLFKGCKFKVQKSKEGTGRIDMWKQ-GIQNSYTMEATFGGSTLGNRKDTHFTTQDLKSMGHHFCDTLLDYCD--PDSSKFKLCLSELQRLVEEDIREK---MKQLGRDMDS---DFTLSDITLSD 647          
BLAST of Cytosolic carboxypeptidase 2 vs. UniProt/SwissProt
Match: sp|Q8CDK2|CBPC2_MOUSE (Cytosolic carboxypeptidase 2 OS=Mus musculus OX=10090 GN=Agbl2 PE=1 SV=1)

HSP 1 Score: 375.555 bits (963), Expect = 2.599e-112
Identity = 206/472 (43.64%), Postives = 296/472 (62.71%), Query Frame = 2
Query:  893 ESSSLIFESRFETGNLRQSRRTGQXXXXXXXXXXXXTKRHTQWFYFRLQNMEKNVTYKFIIINLLKSKSLYEEGMRILMYSDKNATTNSIGWYRTGHHIRYTRN-FTRLQCPLLNREMAYFQLEFQIEFQYSEDTCYLSHCYPYTFTDLKNDLRTFESNCNTKPLLKKDILCETNIGNSCFLLTITDKSIPEKE---KLGAVITARVHPGETNSSWMMKGLIQYLIGNSETAKTLRRRIVFKIVPMLNPDGVIVGNYRCSTVGRDLNRNYRNPKEERFPTIFHTKRLIEDLKKSCTVGVSVVIKYFYVIQAMALYCDLHGHSRKHNVFMYGCDSQYLHSENFNDINPVLNINTIEDYIKDRIFTFLMQKNGPETFSFNGCHFKIRKCKESTGRVVMWKQFNVNDSYTLEATFSGTDINDRR--HFNINDLENIGKIFSESLFSYISIMKDEQQQKEIGLDLLKAILKQIVSK 2290
            + ++L+FESRFE+GNL+++ R G YEYEL L  DLYT +HTQWFYFR+QN  K+ TY+F I+NLLK KSLY  GM+ LMYS  +AT  +IGW R G  I+Y +N     Q PL       + L +  +F + +DTC+ +H YPYT+TDL+  L +  +N       K   LC +  GN+ +LLTIT+ S   +E   K   V++ARVHPGE+NSSW+M G + +++ NS  A+ LR   VFK++PMLNPDGVIVGNYRCS  GRDLNR+Y+   ++ FP I++TK +I+ L +                + + LYCD HGHSRK+N+F+YGC S                 N  + ++ +R+F  ++ KN P+ FSF+ C+FK++KCKE TGRVVMW+   +N SYT+E+TF G+ +  +R  HF I DL+++G    ++L  +      +Q +    L  LK +L+Q ++K
Sbjct:  225 DDNTLLFESRFESGNLQKAVRVGIYEYELTLRTDLYTDKHTQWFYFRVQNTRKDATYRFTIVNLLKPKSLYAVGMKPLMYSQLDATIYNIGWRREGREIKYYKNNVDDGQQPL-------YCLTWTTQFPHDQDTCFFAHFYPYTYTDLQCYLLSVANNPIQSQFCKLRALCRSLAGNTVYLLTITNPSRTPQEAAAKKAVVLSARVHPGESNSSWIMNGFLDFILSNSPDAQLLRDIFVFKVIPMLNPDGVIVGNYRCSLAGRDLNRHYKTVLKDSFPCIWYTKNMIKRLLEE---------------REVLLYCDFHGHSRKNNIFLYGCHS-----------------NNRKHWLHERVFPLMLSKNAPDKFSFDSCNFKVQKCKEGTGRVVMWRMGIIN-SYTMESTFGGSTLGSKRDTHFTIEDLKSLGYHVCDTLLDFCD---PDQTKYTQCLQELKELLQQEINK 653          
BLAST of Cytosolic carboxypeptidase 2 vs. TrEMBL
Match: A0A267GTP5 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig000412g1 PE=4 SV=1)

HSP 1 Score: 643.269 bits (1658), Expect = 0.000e+0
Identity = 315/659 (47.80%), Postives = 429/659 (65.10%), Query Frame = 2
Query:  461 LESKTLRTGFEAVQNFGSLTLEEKEIFFSTFTKQGFREAMRTGKLPDGSKLEALANGEFRDKFGIVRSKDGPFWPKDIGPLFPAPHHKIFQSSYE---------PLFDPLKDKETSKQAPPNGSHPAGWKHMQIVYDSETYSRNQRPHQHSECESSSLIFESRFETGNLRQSRRTGQXXXXXXXXXXXXTKRHTQWFYFRLQNMEKNVTYKFIIINLLKSKSLYEEGMRILMYSDKNATTNSIGWYRTGHHIRYTRNFTRLQCPLLNREMAYFQLEFQIEFQYSEDTCYLSHCYPYTFTDLKNDLRTFESNCNTKPLLKKDILCETNIGNSCFLLTITDKSIPEKEKLGAVITARVHPGETNSSWMMKGLIQYLIGNSETAKTLRRRIVFKIVPMLNPDGVIVGNYRCSTVGRDLNRNYRNPKEERFPTIFHTKRLIEDLKKSCTVGVSVVIKYFYVIQAMALYCDLHGHSRKHNVFMYGCDSQYLHSENFNDINPVLNINTI------EDYIKDRIFTFLMQKNGPETFSFNGCHFKIRKCKESTGRVVMWKQFNVNDSYTLEATFSGTDIN--DRRHFNINDLENIGKIFSESLFSYISIMKDEQQQKEIGLDLLKAILKQIVSKSKAMNQLFRKLVSQTTDHIGSEVSLTNNIPKV 2386
            L     R G EA+++FG LT +EK   F+ FT+ GFREA+RTG+LPDGS L    +G +RD+FG+ R   GPFWP+D GP  P P H+                P  +P    +T +           W+  QIV+DSE   R+  P    E    SL+FESRFE+GNLRQ+RR G +EYEL+L  DLYTKRHTQWFYFR+QN    + YKF+I+NLLKS SLY EGM+ L YS+K+A T  +GW+R GHHIRY+RN TRLQ  LL R+MAY+QLE+Q++F +  D+CYL+HCYPYT++DL++DL   + +   +   +++ILCET  GN+CFLLT+TD  +P++ K G V+TARVHPGE NSSWMMKGLI +L G+   A+ LR+  +FKIVPMLNPDGVIVGNYR S  GRDLNRNYR+P++E FPT++HTK ++E   K                + +ALYCDLHGHSRK +VFMYGCDSQY       D+ PV  +N +      E ++ +R+F +L+ +  P  FSF+GC F IR+CKE+TGRVVMW+QF++ +S+T+EATFSGT +   D RHFN  DLE +G   + +L+ Y  +  D  +Q ++ +D+   ++  ++++     +    LV + T     E   + N+P  
Sbjct:  184 LSLPAFRLGAEAMRHFGDLTPDEKLRLFANFTRDGFREAVRTGRLPDGSPLILQPDGRYRDQFGVARDSRGPFWPRDFGPCHPTPSHRRLACPGPEPLLLPLKNPGSEPTVTFDTQRT-----QFSGRWRGTQIVFDSERSPRHYSPPNVPEDTCPSLLFESRFESGNLRQARRVGMFEYELVLRTDLYTKRHTQWFYFRVQNARPGIVYKFVIVNLLKSSSLYGEGMKPLCYSEKSAQTRGLGWHRAGHHIRYSRNATRLQSALLQRDMAYYQLEWQMDFPHESDSCYLAHCYPYTYSDLRSDLAGLQRDQLRRRHAREEILCETRAGNACFLLTVTDPDVPDEGKHGVVVTARVHPGEANSSWMMKGLIDFLTGDGPEARELRKHFIFKIVPMLNPDGVIVGNYRTSLAGRDLNRNYRHPRKETFPTVYHTKAMLESFAKE---------------RPVALYCDLHGHSRKSHVFMYGCDSQY------RDVEPV-RVNAVRLRLQPEAFLNERLFPWLVSRCAPGLFSFHGCRFNIRRCKEATGRVVMWRQFDIANSFTMEATFSGTSVTEEDSRHFNTEDLETMGGSLASALWQYQQVKSDTTRQSQVVVDMTFDLVLNVLNERGVDVERQLSLVDKKTAEANQE---SANVPDA 812          
BLAST of Cytosolic carboxypeptidase 2 vs. TrEMBL
Match: A0A267H055 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig032425g2 PE=4 SV=1)

HSP 1 Score: 639.417 bits (1648), Expect = 0.000e+0
Identity = 325/661 (49.17%), Postives = 446/661 (67.47%), Query Frame = 2
Query:  404 QLTSAGVL------QKLDENNAINSLES-KTLRTGFEAVQNFGSLTLEEKEIFFSTFTKQGFREAMRTG------------KLPDGSKLEALANGEFRDKFGIVRSKDGPFWPKDIGPLFPAPHHKIFQSS-YEPLFDPLK----------DKETSKQAPPNGSHPAGWKHMQIVYDSETYSRNQRPHQHSECESSSLIFESRFETGNLRQSRRTGQXXXXXXXXXXXXTKRHTQWFYFRLQNMEKNVTYKFIIINLLKSKSLYEEGMRILMYSDKNATTNSIGWYRTGHHIRYTRNFTRLQCPLLNREMAYFQLEFQIEFQYSEDTCYLSHCYPYTFTDLKNDLRTFESNCNTKPLLKKDILCETNIGNSCFLLTITDKSIPEK-----EKLGAVITARVHPGETNSSWMMKGLIQYLIGNSETAKTLRRRIVFKIVPMLNPDGVIVGNYRCSTVGRDLNRNYRNPKEERFPTIFHTKRLIEDLKKSCTVGVSVVIKYFYVIQAMALYCDLHGHSRKHNVFMYGCDSQYLHSENFNDINPV-LNINTIEDYIKDRIFTFLMQKNGPETFSFNGCHFKIRKCKESTGRVVMWKQFNVNDSYTLEATFSGT--DINDRRHFNINDLENIGKIFSESLFSYISIMKDEQQQKEIGLDLLKAIL 2272
            QLT  G        Q+   N++ + + S + LR G EA+++FG LT++E+ + F  FT+ GFR+A   G            +LPDGS L   A+G +RD++G+VR   GPFWP+D GP  P P H+   S  +EPL  PL+          D +T++       +   W+ +QIVYDSE   R+  P   SE  S SL+FESRFE+GNLRQ+RR G +EYEL+L  DLYTKRHTQWFYF++ N +  + YKF+I+NLLK  SLY EGM+ L+YS+K A T+S+GW+R GHHIRY+RN TRLQ  LL+R+M Y+QLE+Q+EF + ED+CY++H YPYT++DL+ DL   +S+ +    +K+++LC+T  GNSCFLLT+TD+S  E       K G V+TARVHPGE+NSSWMMKGL+ +L G+S TA  LR+  VFK+VPMLNPDGVIVGNYR S   RDLNRNYR+P+ E FPT++HTKR++E L++                + + LYCDLHGHSRK NVFMYGCDSQY    + + +N V L IN  E ++K+R+F +L+ +  P+ FS+ GC F IRKCKE+TGRVVMW+QF + +S+T+EATFSGT   ++D RHFN NDLE++G   + +L+ Y  + +D  +Q  + +D+   +L
Sbjct:  222 QLTGTGAALWTSPQQRQRRNSSTSDVTSGQPLRQGLEAMRHFGDLTIDERILLFRNFTRDGFRQACSGGGGGAGVGCIIGGRLPDGSVLTRQADGRYRDQYGLVRDSHGPFWPRDFGPCHPTPRHRRLPSPEFEPLLLPLRNPGCEPLLTVDNQTTQ-------YTGRWRGVQIVYDSEKCPRHYTPSPVSEGLSPSLVFESRFESGNLRQARRVGMFEYELVLRTDLYTKRHTQWFYFKVHNAQPQIVYKFVILNLLKPTSLYGEGMKPLLYSEKLAATDSVGWHRRGHHIRYSRNVTRLQSALLHRDMVYYQLEWQMEFPHPEDSCYVAHSYPYTYSDLRADLIALQSDQSRSRFIKEEVLCQTRAGNSCFLLTVTDESDAESRRNSHSKPGVVVTARVHPGESNSSWMMKGLVDFLTGDSATACCLRKHFVFKLVPMLNPDGVIVGNYRTSLAARDLNRNYRHPRPEAFPTVYHTKRMLERLQQE---------------RPVILYCDLHGHSRKSNVFMYGCDSQY-RGVDADQVNSVRLKINP-EGFLKERLFPWLVSRCSPQLFSYRGCKFNIRKCKEATGRVVMWRQFGIENSFTMEATFSGTSASMSDCRHFNTNDLESMGHSLASALWQYKQVKEDSVRQCSLVIDMTLHLL 858          
BLAST of Cytosolic carboxypeptidase 2 vs. TrEMBL
Match: A0A267EJ08 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig000412g2 PE=4 SV=1)

HSP 1 Score: 639.032 bits (1647), Expect = 0.000e+0
Identity = 313/659 (47.50%), Postives = 429/659 (65.10%), Query Frame = 2
Query:  461 LESKTLRTGFEAVQNFGSLTLEEKEIFFSTFTKQGFREAMRTGKLPDGSKLEALANGEFRDKFGIVRSKDGPFWPKDIGPLFPAPHHKIFQSSYE---------PLFDPLKDKETSKQAPPNGSHPAGWKHMQIVYDSETYSRNQRPHQHSECESSSLIFESRFETGNLRQSRRTGQXXXXXXXXXXXXTKRHTQWFYFRLQNMEKNVTYKFIIINLLKSKSLYEEGMRILMYSDKNATTNSIGWYRTGHHIRYTRNFTRLQCPLLNREMAYFQLEFQIEFQYSEDTCYLSHCYPYTFTDLKNDLRTFESNCNTKPLLKKDILCETNIGNSCFLLTITDKSIPEKEKLGAVITARVHPGETNSSWMMKGLIQYLIGNSETAKTLRRRIVFKIVPMLNPDGVIVGNYRCSTVGRDLNRNYRNPKEERFPTIFHTKRLIEDLKKSCTVGVSVVIKYFYVIQAMALYCDLHGHSRKHNVFMYGCDSQYLHSENFNDINPVLNINTI------EDYIKDRIFTFLMQKNGPETFSFNGCHFKIRKCKESTGRVVMWKQFNVNDSYTLEATFSGTDIN--DRRHFNINDLENIGKIFSESLFSYISIMKDEQQQKEIGLDLLKAILKQIVSKSKAMNQLFRKLVSQTTDHIGSEVSLTNNIPKV 2386
            L     R G EA+++FG LT +EK   F+ FT+ GFREA+RTG+LPDGS L    +G +RD+FG+ R   GPFWP+D GP  P P H+                P  +P    +T +           W+  QIV+DSE   R+  P    E    SL+FESRFE+GNLRQ+RR G +EYEL+L  DLYTKRHTQWFYFR+QN    + YKF+I+NLLKS SLY EGM+ L YS+K+A T  +GW+R GHHIRY+RN TRLQ  LL R+MAY+QLE+Q++F +  D+CYL+HCYPYT++DL++DL   + +   +   +++ILCET  GN+CFLLT+TD  +P++ K G V+TARVHPGE NSSWMMKGLI +L G+   A+ L++  +FKIVPMLNPDGVIVGNYR S  GRDLNRNYR+P++E FPT++HTK ++E   K                + +ALYCDLHGHSRK +VFMYGCDSQY       D+ PV  +N +      + ++ +R+F +L+ +  P  FSF+GC F IR+CKE+TGRVVMW+QF++ +S+T+EATFSGT +   D RHFN  DLE +G   + +L+ Y  +  D  +Q ++ +D+   ++  ++++     +    LV + T     E   + N+P  
Sbjct:  184 LSLPAFRLGAEAMRHFGDLTPDEKLRLFANFTRDGFREAVRTGRLPDGSPLILQPDGRYRDQFGVARDSRGPFWPRDFGPCHPTPSHRRLACPGPEPLLLPLKNPGSEPTVTFDTQRT-----QFSGRWRGTQIVFDSERSPRHYSPPTVPEDTCPSLVFESRFESGNLRQARRVGMFEYELVLRTDLYTKRHTQWFYFRVQNARPGIVYKFVIVNLLKSSSLYGEGMKPLCYSEKSARTRGLGWHRAGHHIRYSRNATRLQSALLQRDMAYYQLEWQMDFPHESDSCYLAHCYPYTYSDLRSDLAGLQRDQLRRRHAREEILCETRAGNACFLLTVTDPDVPDEGKHGVVVTARVHPGEANSSWMMKGLIDFLTGDGPEARELQKHFIFKIVPMLNPDGVIVGNYRTSLAGRDLNRNYRHPRKETFPTVYHTKAMLESFAKE---------------RPVALYCDLHGHSRKSHVFMYGCDSQY------RDVEPV-RVNAVRLRLQPKAFLNERLFPWLVSRCAPGLFSFHGCRFNIRRCKEATGRVVMWRQFDIANSFTMEATFSGTSVTEEDSRHFNTEDLETMGGSLASALWQYQQVKSDTTRQSQVVVDMTFDLVLNVLNERGVDVERQLSLVDKKTAEANQE---SANVPDA 812          
BLAST of Cytosolic carboxypeptidase 2 vs. TrEMBL
Match: A0A267EVR2 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig032425g1 PE=4 SV=1)

HSP 1 Score: 639.032 bits (1647), Expect = 0.000e+0
Identity = 324/656 (49.39%), Postives = 443/656 (67.53%), Query Frame = 2
Query:  404 QLTSAGVL------QKLDENNAINSLES-KTLRTGFEAVQNFGSLTLEEKEIFFSTFTKQGFREAMRTG------------KLPDGSKLEALANGEFRDKFGIVRSKDGPFWPKDIGPLFPAPHHKIFQS-SYEPLFDPLK----------DKETSKQAPPNGSHPAGWKHMQIVYDSETYSRNQRPHQHSECESSSLIFESRFETGNLRQSRRTGQXXXXXXXXXXXXTKRHTQWFYFRLQNMEKNVTYKFIIINLLKSKSLYEEGMRILMYSDKNATTNSIGWYRTGHHIRYTRNFTRLQCPLLNREMAYFQLEFQIEFQYSEDTCYLSHCYPYTFTDLKNDLRTFESNCNTKPLLKKDILCETNIGNSCFLLTITDKSIPEK-----EKLGAVITARVHPGETNSSWMMKGLIQYLIGNSETAKTLRRRIVFKIVPMLNPDGVIVGNYRCSTVGRDLNRNYRNPKEERFPTIFHTKRLIEDLKKSCTVGVSVVIKYFYVIQAMALYCDLHGHSRKHNVFMYGCDSQYLHSENFNDINPV-LNINTIEDYIKDRIFTFLMQKNGPETFSFNGCHFKIRKCKESTGRVVMWKQFNVNDSYTLEATFSGT--DINDRRHFNINDLENIGKIFSESLFSYISIMKDEQQQKEIGLDL 2257
            QLT  G        Q+   N++ + + S + LR G EA+++FG LT++E+ + F  FT+ GFR+A   G            +LPDGS L   A+G +RD++G+VR   GPFWP+D GP  P P H+   S  +EPL  PL+          D +T++       +   W+ +QIVYDSE   R+  P   SE  S SL+FESRFE+GNLRQ+RR G +EYEL+L  DLYTKRHTQWFYF++ N +  + YKF+I+NLLK  SLY EGM+ L+YS+K A T+S+GW+R GHHIRY+RN TRLQ  LL+R+M Y+QLE+Q+EF + ED+CY++H YPYT++DL+ DL   +S+ +    +K+++LC+T  GNSCFLLT+TD+S  E       K G V+TARVHPGE+NSSWMMKGL+ +L G+S TA  LR+  VFK+VPMLNPDGVIVGNYR S   RDLNRNYR+P+ E FPT++HTKR++E L++                + + LYCDLHGHSRK NVFMYGCDSQY    + + +N V L IN  E ++K+R+F +L+ +  P+ FS+ GC F IRKCKE+TGRVVMW+QF + +S+T+EATFSGT   ++D RHFN NDLE++G   + +L+ Y  + +D   Q  + +D+
Sbjct:  222 QLTGTGAALWTSPQQRQRRNSSTSDVTSGQPLRQGLEAMRHFGDLTIDERILLFRNFTRDGFRQACSGGGGGAGVGCIIGGRLPDGSVLTRQADGRYRDQYGLVRDSHGPFWPRDFGPCHPTPRHRRLPSPEFEPLLLPLRNPGCEPLLTVDNQTTQ-------YTGRWRGVQIVYDSEKCPRHYTPSPVSEGLSPSLVFESRFESGNLRQARRVGMFEYELVLRTDLYTKRHTQWFYFKVHNAQPQIVYKFVILNLLKPTSLYGEGMKPLLYSEKLAATDSVGWHRRGHHIRYSRNVTRLQSALLHRDMVYYQLEWQMEFPHPEDSCYVAHSYPYTYSDLRADLIALQSDQSRSRFIKEEVLCQTRAGNSCFLLTVTDESDAESRRNSHSKPGVVVTARVHPGESNSSWMMKGLVDFLTGDSATACCLRKHFVFKLVPMLNPDGVIVGNYRTSLAARDLNRNYRHPRPEAFPTVYHTKRMLERLQQE---------------RPVILYCDLHGHSRKSNVFMYGCDSQY-RGVDADQVNSVRLKINP-EGFLKERLFPWLVSRCSPQLFSYRGCKFNIRKCKEATGRVVMWRQFGIENSFTMEATFSGTSASMSDCRHFNTNDLESMGHSLASALWQYKQVKEDSVTQCSVVVDM 853          
BLAST of Cytosolic carboxypeptidase 2 vs. TrEMBL
Match: A0A267H007 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig032425g3 PE=4 SV=1)

HSP 1 Score: 637.876 bits (1644), Expect = 0.000e+0
Identity = 324/661 (49.02%), Postives = 445/661 (67.32%), Query Frame = 2
Query:  404 QLTSAGVL------QKLDENNAINSLES-KTLRTGFEAVQNFGSLTLEEKEIFFSTFTKQGFREAMRTG------------KLPDGSKLEALANGEFRDKFGIVRSKDGPFWPKDIGPLFPAPHHKIFQSS-YEPLFDPLK----------DKETSKQAPPNGSHPAGWKHMQIVYDSETYSRNQRPHQHSECESSSLIFESRFETGNLRQSRRTGQXXXXXXXXXXXXTKRHTQWFYFRLQNMEKNVTYKFIIINLLKSKSLYEEGMRILMYSDKNATTNSIGWYRTGHHIRYTRNFTRLQCPLLNREMAYFQLEFQIEFQYSEDTCYLSHCYPYTFTDLKNDLRTFESNCNTKPLLKKDILCETNIGNSCFLLTITDKSIPEK-----EKLGAVITARVHPGETNSSWMMKGLIQYLIGNSETAKTLRRRIVFKIVPMLNPDGVIVGNYRCSTVGRDLNRNYRNPKEERFPTIFHTKRLIEDLKKSCTVGVSVVIKYFYVIQAMALYCDLHGHSRKHNVFMYGCDSQYLHSENFNDINPV-LNINTIEDYIKDRIFTFLMQKNGPETFSFNGCHFKIRKCKESTGRVVMWKQFNVNDSYTLEATFSGT--DINDRRHFNINDLENIGKIFSESLFSYISIMKDEQQQKEIGLDLLKAIL 2272
            QLT  G        Q+   N++ + + S + LR G EA+++FG LT++E+ + F  FT+ GFR+A   G            +LPDGS L   A+G +RD++G+VR   GPFWP+D GP  P P H+   S  +EPL  PL+          D +T++       +   W+ +QIVYDSE   R+  P   SE  S SL+FESRFE+GNLRQ+RR G +EYEL+L  DLYTKRHTQWFYF++ N +  + YKF+I+NLLK  SLY EGM+ L+YS+K A T+S+GW+R GHHIRY+RN TRLQ  LL+R+M Y+QLE+Q+EF + ED+CY++H YPYT++DL+ DL   +S+ +    +K+++LC+T  GNSCFLLT+TD+S  E       K G V+TARVHPGE+NSSWMMKGL+ +L G+S TA  LR+  VFK+VPMLNPDGVIVGNYR S   RDLNRNYR+P+ E FPT++HTKR++E L++                + + LYCD HGHSRK NVFMYGCDSQY    + + +N V L IN  E ++K+R+F +L+ +  P+ FS+ GC F IRKCKE+TGRVVMW+QF + +S+T+EATFSGT   ++D RHFN NDLE++G   + +L+ Y  + +D  +Q  + +D+   +L
Sbjct:  222 QLTGTGAALWTSPQQRQRRNSSTSDVTSGQPLRQGLEAMRHFGDLTIDERILLFRNFTRDGFRQACSGGGGGAGVGCIIGGRLPDGSVLTRQADGRYRDQYGLVRDSHGPFWPRDFGPCHPTPRHRRLPSPEFEPLLLPLRNPGCEPLLTVDNQTTQ-------YTGRWRGVQIVYDSEKCPRHYTPSPVSEGLSPSLVFESRFESGNLRQARRVGMFEYELVLRTDLYTKRHTQWFYFKVHNAQPQIVYKFVILNLLKPTSLYGEGMKPLLYSEKLAATDSVGWHRRGHHIRYSRNVTRLQSALLHRDMVYYQLEWQMEFPHPEDSCYVAHSYPYTYSDLRADLIALQSDQSRSRFIKEEVLCQTRAGNSCFLLTVTDESDAESRRNSHSKPGVVVTARVHPGESNSSWMMKGLVDFLTGDSATACCLRKHFVFKLVPMLNPDGVIVGNYRTSLAARDLNRNYRHPRPEAFPTVYHTKRMLERLQQE---------------RPVILYCDFHGHSRKSNVFMYGCDSQY-RGVDADQVNSVRLKINP-EGFLKERLFPWLVSRCSPQLFSYRGCKFNIRKCKEATGRVVMWRQFGIENSFTMEATFSGTSASMSDCRHFNTNDLESMGHSLASALWQYKQVKEDSVRQCSLVIDMTLHLL 858          
BLAST of Cytosolic carboxypeptidase 2 vs. Ensembl Cavefish
Match: agbl2 (cytosolic carboxypeptidase 2 [Source:NCBI gene;Acc:103041446])

HSP 1 Score: 390.193 bits (1001), Expect = 1.176e-120
Identity = 207/469 (44.14%), Postives = 293/469 (62.47%), Query Frame = 2
Query:  893 ESSSLIFESRFETGNLRQSRRTGQXXXXXXXXXXXXTKRHTQWFYFRLQNMEKNVTYKFIIINLLKSKSLYEEGMRILMYSDKNATTNSIGWYRTGHHIRYTRNFTRLQCPLLNREMAYFQLEFQIEFQYSEDTCYLSHCYPYTFTDLKNDLRTFESNCNTKPLLKKDILCETNIGNSCFLLTITDKSIPEKE---KLGAVITARVHPGETNSSWMMKGLIQYLIGNSETAKTLRRRIVFKIVPMLNPDGVIVGNYRCSTVGRDLNRNYRNPKEERFPTIFHTKRLIEDLKKSCTVGVSVVIKYFYVIQAMALYCDLHGHSRKHNVFMYGCDSQYLHSENFNDINPVLNINTIEDYIKDRIFTFLMQKNGPETFSFNGCHFKIRKCKESTGRVVMWKQFNVNDSYTLEATFSGTDINDRR--HFNINDLENIGKIFSESLFSYISIMKDEQQQKEIGLDLLKAILKQIV 2284
            E+SSL FESRFE+GNL+++ + G Y+YEL L +D+YT +HTQWFYFR++NM+  VTY+F IINL+KS SLYE GMR L+YS+  A     GW R G +IRY RN         N   A + L + ++F Y  DTCYL+HCYPYT++DL++ LR   S+       K  +LC +  GN+ ++LTIT      KE   K   V+TARVHPGETN SWMM+G + +L+G+S  A+ LR   VFK+VPMLNPDGV+VGNYRCS  G DLNRNYR    + FP +++T+ +++ L                  + + LYCD HGHSRK+NVFMYGC+     S                  +++RIF  +M KN  + FSF  C F++++ KE TGR+VMW+   + +SYT+E+TF G+ +  R+  HF++ DL+++G  F ++L  +      +Q + E  L  L+A+L+Q +
Sbjct:  193 ETSSLSFESRFESGNLQKAVQVGLYDYELTLRHDMYTTKHTQWFYFRVRNMKAGVTYRFTIINLMKSSSLYEAGMRPLLYSELAAWLKGEGWCRDGSNIRYYRNLCE------NEGTALYSLTWTMQFPYENDTCYLAHCYPYTYSDLQHYLRGVISDSVRAAYCKVRVLCRSLAGNAVYVLTITAPGATWKERRNKQAVVVTARVHPGETNGSWMMQGFLDFLLGDSLDARLLRETFVFKVVPMLNPDGVVVGNYRCSLAGCDLNRNYRTLLRDSFPCVWYTRNMVKKLVAE---------------REVVLYCDFHGHSRKNNVFMYGCNDHKDASLQ----------------LQERIFPLMMSKNAQDKFSFRSCKFRMQRSKEGTGRIVMWR-LGIRNSYTMESTFGGSTLGSRKGTHFSMGDLKSMGYHFCDTLLDFCD---PDQTKAEHCLAELEALLRQQI 620          
BLAST of Cytosolic carboxypeptidase 2 vs. Ensembl Cavefish
Match: agbl2 (cytosolic carboxypeptidase 2 [Source:NCBI gene;Acc:103041446])

HSP 1 Score: 390.963 bits (1003), Expect = 2.919e-118
Identity = 207/469 (44.14%), Postives = 293/469 (62.47%), Query Frame = 2
Query:  893 ESSSLIFESRFETGNLRQSRRTGQXXXXXXXXXXXXTKRHTQWFYFRLQNMEKNVTYKFIIINLLKSKSLYEEGMRILMYSDKNATTNSIGWYRTGHHIRYTRNFTRLQCPLLNREMAYFQLEFQIEFQYSEDTCYLSHCYPYTFTDLKNDLRTFESNCNTKPLLKKDILCETNIGNSCFLLTITDKSIPEKE---KLGAVITARVHPGETNSSWMMKGLIQYLIGNSETAKTLRRRIVFKIVPMLNPDGVIVGNYRCSTVGRDLNRNYRNPKEERFPTIFHTKRLIEDLKKSCTVGVSVVIKYFYVIQAMALYCDLHGHSRKHNVFMYGCDSQYLHSENFNDINPVLNINTIEDYIKDRIFTFLMQKNGPETFSFNGCHFKIRKCKESTGRVVMWKQFNVNDSYTLEATFSGTDINDRR--HFNINDLENIGKIFSESLFSYISIMKDEQQQKEIGLDLLKAILKQIV 2284
            E+SSL FESRFE+GNL+++ + G Y+YEL L +D+YT +HTQWFYFR++NM+  VTY+F IINL+KS SLYE GMR L+YS+  A     GW R G +IRY RN         N   A + L + ++F Y  DTCYL+HCYPYT++DL++ LR   S+       K  +LC +  GN+ ++LTIT      KE   K   V+TARVHPGETN SWMM+G + +L+G+S  A+ LR   VFK+VPMLNPDGV+VGNYRCS  G DLNRNYR    + FP +++T+ +++ L                  + + LYCD HGHSRK+NVFMYGC+     S                  +++RIF  +M KN  + FSF  C F++++ KE TGR+VMW+   + +SYT+E+TF G+ +  R+  HF++ DL+++G  F ++L  +      +Q + E  L  L+A+L+Q +
Sbjct:  200 ETSSLSFESRFESGNLQKAVQVGLYDYELTLRHDMYTTKHTQWFYFRVRNMKAGVTYRFTIINLMKSSSLYEAGMRPLLYSELAAWLKGEGWCRDGSNIRYYRNLCE------NEGTALYSLTWTMQFPYENDTCYLAHCYPYTYSDLQHYLRGVISDSVRAAYCKVRVLCRSLAGNAVYVLTITAPGATWKERRNKQAVVVTARVHPGETNGSWMMQGFLDFLLGDSLDARLLRETFVFKVVPMLNPDGVVVGNYRCSLAGCDLNRNYRTLLRDSFPCVWYTRNMVKKL---------------VAEREVVLYCDFHGHSRKNNVFMYGCNDHKDASLQ----------------LQERIFPLMMSKNAQDKFSFRSCKFRMQRSKEGTGRIVMWR-LGIRNSYTMESTFGGSTLGSRKGTHFSMGDLKSMGYHFCDTLLDFCD---PDQTKAEHCLAELEALLRQQI 627          
BLAST of Cytosolic carboxypeptidase 2 vs. Ensembl Cavefish
Match: agbl2 (cytosolic carboxypeptidase 2 [Source:NCBI gene;Acc:103041446])

HSP 1 Score: 390.578 bits (1002), Expect = 6.140e-118
Identity = 207/469 (44.14%), Postives = 293/469 (62.47%), Query Frame = 2
Query:  893 ESSSLIFESRFETGNLRQSRRTGQXXXXXXXXXXXXTKRHTQWFYFRLQNMEKNVTYKFIIINLLKSKSLYEEGMRILMYSDKNATTNSIGWYRTGHHIRYTRNFTRLQCPLLNREMAYFQLEFQIEFQYSEDTCYLSHCYPYTFTDLKNDLRTFESNCNTKPLLKKDILCETNIGNSCFLLTITDKSIPEKE---KLGAVITARVHPGETNSSWMMKGLIQYLIGNSETAKTLRRRIVFKIVPMLNPDGVIVGNYRCSTVGRDLNRNYRNPKEERFPTIFHTKRLIEDLKKSCTVGVSVVIKYFYVIQAMALYCDLHGHSRKHNVFMYGCDSQYLHSENFNDINPVLNINTIEDYIKDRIFTFLMQKNGPETFSFNGCHFKIRKCKESTGRVVMWKQFNVNDSYTLEATFSGTDINDRR--HFNINDLENIGKIFSESLFSYISIMKDEQQQKEIGLDLLKAILKQIV 2284
            E+SSL FESRFE+GNL+++ + G Y+YEL L +D+YT +HTQWFYFR++NM+  VTY+F IINL+KS SLYE GMR L+YS+  A     GW R G +IRY RN         N   A + L + ++F Y  DTCYL+HCYPYT++DL++ LR   S+       K  +LC +  GN+ ++LTIT      KE   K   V+TARVHPGETN SWMM+G + +L+G+S  A+ LR   VFK+VPMLNPDGV+VGNYRCS  G DLNRNYR    + FP +++T+ +++ L                  + + LYCD HGHSRK+NVFMYGC+     S                  +++RIF  +M KN  + FSF  C F++++ KE TGR+VMW+   + +SYT+E+TF G+ +  R+  HF++ DL+++G  F ++L  +      +Q + E  L  L+A+L+Q +
Sbjct:  200 ETSSLSFESRFESGNLQKAVQVGLYDYELTLRHDMYTTKHTQWFYFRVRNMKAGVTYRFTIINLMKSSSLYEAGMRPLLYSELAAWLKGEGWCRDGSNIRYYRNLCE------NEGTALYSLTWTMQFPYENDTCYLAHCYPYTYSDLQHYLRGVISDSVRAAYCKVRVLCRSLAGNAVYVLTITAPGATWKERRNKQAVVVTARVHPGETNGSWMMQGFLDFLLGDSLDARLLRETFVFKVVPMLNPDGVVVGNYRCSLAGCDLNRNYRTLLRDSFPCVWYTRNMVKKLVAE---------------REVVLYCDFHGHSRKNNVFMYGCNDHKDASLQ----------------LQERIFPLMMSKNAQDKFSFRSCKFRMQRSKEGTGRIVMWR-LGIRNSYTMESTFGGSTLGSRKGTHFSMGDLKSMGYHFCDTLLDFCD---PDQTKAEHCLAELEALLRQQI 627          
BLAST of Cytosolic carboxypeptidase 2 vs. Ensembl Cavefish
Match: agbl2 (cytosolic carboxypeptidase 2 [Source:NCBI gene;Acc:103041446])

HSP 1 Score: 390.963 bits (1003), Expect = 9.264e-118
Identity = 207/469 (44.14%), Postives = 293/469 (62.47%), Query Frame = 2
Query:  893 ESSSLIFESRFETGNLRQSRRTGQXXXXXXXXXXXXTKRHTQWFYFRLQNMEKNVTYKFIIINLLKSKSLYEEGMRILMYSDKNATTNSIGWYRTGHHIRYTRNFTRLQCPLLNREMAYFQLEFQIEFQYSEDTCYLSHCYPYTFTDLKNDLRTFESNCNTKPLLKKDILCETNIGNSCFLLTITDKSIPEKE---KLGAVITARVHPGETNSSWMMKGLIQYLIGNSETAKTLRRRIVFKIVPMLNPDGVIVGNYRCSTVGRDLNRNYRNPKEERFPTIFHTKRLIEDLKKSCTVGVSVVIKYFYVIQAMALYCDLHGHSRKHNVFMYGCDSQYLHSENFNDINPVLNINTIEDYIKDRIFTFLMQKNGPETFSFNGCHFKIRKCKESTGRVVMWKQFNVNDSYTLEATFSGTDINDRR--HFNINDLENIGKIFSESLFSYISIMKDEQQQKEIGLDLLKAILKQIV 2284
            E+SSL FESRFE+GNL+++ + G Y+YEL L +D+YT +HTQWFYFR++NM+  VTY+F IINL+KS SLYE GMR L+YS+  A     GW R G +IRY RN         N   A + L + ++F Y  DTCYL+HCYPYT++DL++ LR   S+       K  +LC +  GN+ ++LTIT      KE   K   V+TARVHPGETN SWMM+G + +L+G+S  A+ LR   VFK+VPMLNPDGV+VGNYRCS  G DLNRNYR    + FP +++T+ +++ L                  + + LYCD HGHSRK+NVFMYGC+     S                  +++RIF  +M KN  + FSF  C F++++ KE TGR+VMW+   + +SYT+E+TF G+ +  R+  HF++ DL+++G  F ++L  +      +Q + E  L  L+A+L+Q +
Sbjct:  200 ETSSLSFESRFESGNLQKAVQVGLYDYELTLRHDMYTTKHTQWFYFRVRNMKAGVTYRFTIINLMKSSSLYEAGMRPLLYSELAAWLKGEGWCRDGSNIRYYRNLCE------NEGTALYSLTWTMQFPYENDTCYLAHCYPYTYSDLQHYLRGVISDSVRAAYCKVRVLCRSLAGNAVYVLTITAPGATWKERRNKQAVVVTARVHPGETNGSWMMQGFLDFLLGDSLDARLLRETFVFKVVPMLNPDGVVVGNYRCSLAGCDLNRNYRTLLRDSFPCVWYTRNMVKKL---------------VAEREVVLYCDFHGHSRKNNVFMYGCNDHKDASLQ----------------LQERIFPLMMSKNAQDKFSFRSCKFRMQRSKEGTGRIVMWR-LGIRNSYTMESTFGGSTLGSRKGTHFSMGDLKSMGYHFCDTLLDFCD---PDQTKAEHCLAELEALLRQQI 627          
BLAST of Cytosolic carboxypeptidase 2 vs. Ensembl Cavefish
Match: agbl2 (cytosolic carboxypeptidase 2 [Source:NCBI gene;Acc:103041446])

HSP 1 Score: 391.349 bits (1004), Expect = 1.516e-117
Identity = 207/469 (44.14%), Postives = 293/469 (62.47%), Query Frame = 2
Query:  893 ESSSLIFESRFETGNLRQSRRTGQXXXXXXXXXXXXTKRHTQWFYFRLQNMEKNVTYKFIIINLLKSKSLYEEGMRILMYSDKNATTNSIGWYRTGHHIRYTRNFTRLQCPLLNREMAYFQLEFQIEFQYSEDTCYLSHCYPYTFTDLKNDLRTFESNCNTKPLLKKDILCETNIGNSCFLLTITDKSIPEKE---KLGAVITARVHPGETNSSWMMKGLIQYLIGNSETAKTLRRRIVFKIVPMLNPDGVIVGNYRCSTVGRDLNRNYRNPKEERFPTIFHTKRLIEDLKKSCTVGVSVVIKYFYVIQAMALYCDLHGHSRKHNVFMYGCDSQYLHSENFNDINPVLNINTIEDYIKDRIFTFLMQKNGPETFSFNGCHFKIRKCKESTGRVVMWKQFNVNDSYTLEATFSGTDINDRR--HFNINDLENIGKIFSESLFSYISIMKDEQQQKEIGLDLLKAILKQIV 2284
            E+SSL FESRFE+GNL+++ + G Y+YEL L +D+YT +HTQWFYFR++NM+  VTY+F IINL+KS SLYE GMR L+YS+  A     GW R G +IRY RN         N   A + L + ++F Y  DTCYL+HCYPYT++DL++ LR   S+       K  +LC +  GN+ ++LTIT      KE   K   V+TARVHPGETN SWMM+G + +L+G+S  A+ LR   VFK+VPMLNPDGV+VGNYRCS  G DLNRNYR    + FP +++T+ +++ L                  + + LYCD HGHSRK+NVFMYGC+     S                  +++RIF  +M KN  + FSF  C F++++ KE TGR+VMW+   + +SYT+E+TF G+ +  R+  HF++ DL+++G  F ++L  +      +Q + E  L  L+A+L+Q +
Sbjct:  200 ETSSLSFESRFESGNLQKAVQVGLYDYELTLRHDMYTTKHTQWFYFRVRNMKAGVTYRFTIINLMKSSSLYEAGMRPLLYSELAAWLKGEGWCRDGSNIRYYRNLCE------NEGTALYSLTWTMQFPYENDTCYLAHCYPYTYSDLQHYLRGVISDSVRAAYCKVRVLCRSLAGNAVYVLTITAPGATWKERRNKQAVVVTARVHPGETNGSWMMQGFLDFLLGDSLDARLLRETFVFKVVPMLNPDGVVVGNYRCSLAGCDLNRNYRTLLRDSFPCVWYTRNMVKKL---------------VAEREVVLYCDFHGHSRKNNVFMYGCNDHKDASLQ----------------LQERIFPLMMSKNAQDKFSFRSCKFRMQRSKEGTGRIVMWR-LGIRNSYTMESTFGGSTLGSRKGTHFSMGDLKSMGYHFCDTLLDFCD---PDQTKAEHCLAELEALLRQQI 627          
BLAST of Cytosolic carboxypeptidase 2 vs. Ensembl Sea Lamprey
Match: agtpbp1 (ATP/GTP binding protein 1 [Source:NCBI gene;Acc:554164])

HSP 1 Score: 281.952 bits (720), Expect = 1.057e-78
Identity = 170/472 (36.02%), Postives = 255/472 (54.03%), Query Frame = 2
Query:  830 QIVYDSETYSRNQRPHQHSECESSSLIFESRFETGNLRQSRRTGQXXXXXXXXXXXXTKRHTQWFYFRLQNMEKNVTYKFIIINLLKSKSLYEEGMRILMYSDKNATTNSIGWYRTGHHIRYTRN-FTRLQCPLLN-REMAYFQLEFQIEFQYSEDTCYLSHCYPYTFTDLKNDLRTFESNCNTKPL-LKKDILCETNIGNSCFLLTITDKSIPEKEKLGAV----------ITARVHPGETNSSWMMKGLIQYLIGNSETAKTLRRRIVFKIVPMLNPDGVIVGNYRCSTVGRDLNRNYRNPKEERFPTIFHTKRLIEDLKKSCTVGVSVVIKYFYVIQAMALYCDLHGHSRKHNVFMYGCDSQYLHSENFNDINPVLNINTIEDYIKDRIFTFLMQKNGPETFSFNGCHFKIRKCKESTGRVVMWKQFNVNDSYTLEATFSGTD--INDRRHFNINDLENIGKIFSESLF 2200
            ++VYD +       P   SE +   L F S FE+GNLR++    +YEY+L+L++D+ + RH QWFYF +  ME  V Y+F I+N  K  S +  GM+ +MYS + A      W R G  I Y +N F+R        R  +Y+ L F + F + +D CY ++ +PYT+T L   L+   + C+ + +  K+  LC++  GN C ++TIT  + P+      +          +T+RVHPGE+NSSW+MKG +++L+ +   A++LR   +FKIVPMLN DGVI G+YRCS  G DLNR + +P  E  PTIFHTK L++ L                +     +YCD HGHSRK NVF+YGC  +    E           +++ + +  R    ++ +  P  F  + C+F + K K ST RVV+W+   V  SYT+E+T+ G D  I         +LE +G  F  +L 
Sbjct:  662 RVVYDLDM------PSLVSE-DGDCLKFCSEFESGNLRKAIHIRRYEYDLILDSDINSNRHHQWFYFEVSGMESGVPYRFNIVNCEKVNSQFNYGMQPVMYSVREAMAGRPHWVRAGTDICYYKNSFSRSSAAAGGQRGKSYYTLTFTVTFFHKDDACYFAYHFPYTYTSLMAHLQGLGAACDQRQIYFKQQTLCQSMGGNGCPVVTIT--AAPQSTGWQDIYRLRNRPYIFLTSRVHPGESNSSWVMKGSLEFLMSDDPLAQSLRESYIFKIVPMLNADGVINGSYRCSLGGEDLNRQWSSPDPELHPTIFHTKGLLQYLAS--------------IAHTPLVYCDYHGHSRKKNVFLYGCSMK----ETIWQTAAEAKASSVYEDLSYRTLPRILHQIAP-AFCLSSCNFVVEKSKASTARVVVWRDIGVLRSYTMESTYCGCDQGIYKGSQMGSQELEEMGAKFCVALL 1105          
BLAST of Cytosolic carboxypeptidase 2 vs. Ensembl Nematostella
Match: EDO42858 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0D9])

HSP 1 Score: 445.277 bits (1144), Expect = 2.216e-145
Identity = 224/440 (50.91%), Postives = 307/440 (69.77%), Query Frame = 2
Query:  905 LIFESRFETGNLRQSRRTGQXXXXXXXXXXXXTKRHTQWFYFRLQNMEKNVTYKFIIINLLKSKSLYEEGMRILMYSDKNATTNSIGWYRTGHHIRYTRNFTRLQCPLLNREMAYFQLEFQIEFQYSEDTCYLSHCYPYTFTDLKNDLRTFESNCNTKPLLKKDILCETNIGNSCFLLTITDK---SIPEKEKLGAVITARVHPGETNSSWMMKGLIQYLIGNSETAKTLRRRIVFKIVPMLNPDGVIVGNYRCSTVGRDLNRNYRNPKEERFPTIFHTKRLIEDLKKSCTVGVSVVIKYFYVIQAMALYCDLHGHSRKHNVFMYGCDSQYLHSENFNDINPVLNINTIEDYIKDRIFTFLMQKNGPETFSFNGCHFKIRKCKESTGRVVMWKQFNVNDSYTLEATFSGTDINDR---RHFNINDLENIGKIFSESLFSY 2206
            L FESRFE GNL+Q++R G+YEY+L+L+NDLYTKRHTQW+YFR++NM   VTYKF IINLLK  SLY  GM+ L+YS K A  +SIGW R+GHH+ YTR        LL+R++ YF L FQ+EF ++ DTCYL+HCYPY+++DL+  L +   N  T   +++++LC+T  GN+C++LTIT     ++   +KLG VI+ARVHPGETN+SWMMKGL+ YL  N + A++LR++ VFKIVPMLNPDGVIVGNYR +   RDLNR Y++PK+E FPT+++TK ++E  KK+                 + +YCDLHGHSRK NVFMYGC +           +P   + +   ++++R+F ++M +  P+ FSF GC F +RKCKEST RVVMW+Q  + +S+T+EATF G++  D    RHFN  D E++G+ F E L  Y
Sbjct:    5 LKFESRFECGNLQQAKRIGRYEYDLVLSNDLYTKRHTQWYYFRVENMVPGVTYKFNIINLLKRDSLYNYGMKPLLYSSKVAEDSSIGWQRSGHHVNYTRTVNNKNV-LLSRDLIYFTLTFQVEFPHAGDTCYLAHCYPYSYSDLERYLMSLVDNPLTSQHVRREVLCKTKAGNNCYVLTITSSQGMNLETVDKLGVVISARVHPGETNASWMMKGLLDYLSSNDKVAESLRQKFVFKIVPMLNPDGVIVGNYRTNLAARDLNRTYKDPKKESFPTVWYTKNMLESFKKN---------------HEVIIYCDLHGHSRKPNVFMYGCTA-----------DP--KVYSSASFLEERLFPWMMSQKAPDKFSFQGCKFMVRKCKESTARVVMWQQLGIMNSFTMEATFCGSNFGDMEGGRHFNTRDFEDMGRHFCEVLLEY 415          
BLAST of Cytosolic carboxypeptidase 2 vs. Ensembl Nematostella
Match: EDO49270 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RH06])

HSP 1 Score: 402.519 bits (1033), Expect = 5.666e-128
Identity = 213/473 (45.03%), Postives = 302/473 (63.85%), Query Frame = 2
Query:  893 ESSSLIFESRFETGNLRQSRRTGQXXXXXXXXXXXXTKRHTQWFYFRLQNMEKNVTYKFIIINLLKSKSLYEEGMRILMYSDKNATTNSIGWYRTGHHIRYTRNFTRLQCPLLNREMAYFQLEFQIEFQYSEDTCYLSHCYPYTFTDLKNDLRTFESNCNTKPLLKKDILCETNIGNSCFLLTITDKS---IPEKEKLGAVITARVHPGETNSSWMMKGLIQYLIGNSETAKTLRRRIVFKIVPMLNPDGVIVGNYRCSTVGRDLNRNYRNPKEERFPTIFHTKRLIEDLKKSCTVGVSVVIKYFYVIQAMALYCDLHGHSRKHNVFMYGCDSQYLHSENFNDINPVLNINTIEDYIKDRIFTFLMQKNGPETFSFNGCHFKIRKCKESTGRVVMWKQFNVNDSYTLEATFSGTDINDRR--HFNINDLENIGKIFSESLFSYISIMKDEQQQKEIGLDLLKAILKQIVSKSK 2296
            +  +L+FESRFE+GNL+++ +TG YEY+L +  DLYT +HTQWFYFR++N     TYKF I+N +KS SLY +GMR L YS+ NA+ N IGW RTG +++Y +  T ++     ++  Y+ L +  +FQYS DTCY +HCYPYT++DL+  L+   ++     + K+ +LC T  GN  ++LT+T+ S      + K   V+TARVHPGETNSSWMMKGL+ +L  NS  AK LR   +FKIVPM+NPDGVIVGNYRCS  GRDLNRNY+   ++ FP+I+H + +I+ L +                + + +YCD HGHSRK NVFMYGC+         N  NP+         +++R+F  +M KN P  FS+ GC FK++K KE TGRVVMW Q  + +S+T+EATF G+ +  R   HFN  DLE +G  F ++L  +     D+ +   I L+L K + ++I++K K
Sbjct:   21 DDHTLLFESRFESGNLKRAIKTGDYEYQLWMRTDLYTSKHTQWFYFRVRNTRAGATYKFTIMNFIKSGSLYNDGMRPLAYSEVNASKNKIGWLRTGSNVKYYK--TEIRRDDTTKDRYYYALTWTCQFQYSNDTCYFAHCYPYTYSDLQEYLQGIRNDPVKSRICKQRVLCRTLAGNFVYILTVTNPSRRPSDAEAKRAVVVTARVHPGETNSSWMMKGLLDFLTSNSADAKLLRDTFIFKIVPMINPDGVIVGNYRCSLAGRDLNRNYKTMLKDSFPSIWHVRNMIKRLLEE---------------REITVYCDFHGHSRKQNVFMYGCE---------NRSNPLKR-------LRERVFPTMMAKNAPCKFSYKGCKFKVQKSKEGTGRVVMW-QLGILNSFTMEATFCGSSLGKRNGFHFNTVDLEAMGYHFCDTLLDFCD--PDDTKYVAILLELEKTLREKILAKMK 457          
BLAST of Cytosolic carboxypeptidase 2 vs. Ensembl Nematostella
Match: EDO47454 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RM73])

HSP 1 Score: 178.718 bits (452), Expect = 3.818e-48
Identity = 137/425 (32.24%), Postives = 202/425 (47.53%), Query Frame = 2
Query:  872 PHQHSECESSSLIFESRFETGNLRQSRRTGQXXXXXXXXXXXXTKRHTQWFYFRLQNMEKNVTYKFIIINLLKSKSLYEEGMRILMYSDKNATTNSIGWYRTGHHIRYTRNFTRLQCPLLNREMAYFQLEFQIEFQYSEDTCYLSHCYPYTFTDLKNDLRTFESNCNTKPLLKKDILCETNIGNSCFLLTIT---DKSIPEKEKLGAVITARVHPGETNSSWMMKGLIQYLIGNSETAKTLRRRIVFKIVPMLNPDGVIVGNYRCSTVGRDLNRNYRNPKEERFPTIFHTKRLIEDLKKSCTVGVSVVIKYFYVIQAMALYCDLHGHSRKHNVFMYGCDSQYLHSENFNDINPVLNINTIEDYIKDRIFTFLMQKNGPETFSFNGCHFKIRKCKESTGRVVMWKQFNV-NDSYTLEATFSGTDIN 2134
            P    + +   LIF++ FE+GNL +     ++EY+L +  D    R   WF F ++N        F I+N  K+KSLY EGM  L+ S     T+   W R        +N    +CP   +    + L F   F    D    ++C+PYT++ L+  L   E    +    K+++LC T       LLTIT   + + P ++++   ITAR+HPGET SS++ +GLI ++I N   AK LR  +VFK++PMLNPDGV++GNYRCS +G DLNR++  P     PT+  +K L+ +L    T               +  Y D+H HS   N FMYG         N  D          E Y +  +F  L+  N  + FS +   F     K  TGR  +    +     YTLE +F   + N
Sbjct:   18 PGYTGKTKKGHLIFDACFESGNLGRVDYITEFEYDLFIRPDTCNPRFRVWFNFTVENTAPYQRVIFNIVNFSKTKSLYREGMTPLVKS-----TSRPRWQRIP-----AKNCFYYRCPDHRKN---YVLSFAFAFDNDTDVYQFAYCFPYTYSRLQGYLDDIERR--SLSYFKREMLCLTVQQRRLDLLTITSPDNMNSPLRKRV-VFITARIHPGETPSSYVCQGLIDFIISNHPVAKVLREYLVFKVIPMLNPDGVVLGNYRCSLMGFDLNRHWHEPSPWAHPTLVASKNLLMELDSDSTA-------------HLDFYIDIHAHSTLMNGFMYG---------NIYDEE--------ERYERQAVFPKLLCANA-DDFSMSNTSFNRDAMKAGTGRRFLGSSLDPETHCYTLEVSFFSYNTN 395          
BLAST of Cytosolic carboxypeptidase 2 vs. Ensembl Nematostella
Match: EDO34305 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPP4])

HSP 1 Score: 185.652 bits (470), Expect = 5.885e-48
Identity = 110/261 (42.15%), Postives = 163/261 (62.45%), Query Frame = 2
Query:  902 SLIFESRFETGNLRQSRRTGQXXXXXXXXXXXXTKRHTQWFYFRLQNMEKNVTYKFIIINLLKSKSLYEEGMRILMYSDKNATTNS-IGWYRTGHHIRYTRN-FTRLQ-CPLLNREMAYFQLEFQIEFQYSEDTCYLSHCYPYTFTDLKNDLRTFESNCNTKPLLKKDILCETNIGNSCFLLTITDKSIPE----------KEKLGAVITARVHPGETNSSWMMKGLIQYLIGNSETAKTLRRRIVFKIVPMLNPDGVIVG 1645
            +L FESRFE+GNLR++ +  +YEY+L+LN D+  + H QWFYF + NME +V Y+F IIN  K  S +  GM+ ++YS + A       W RTG ++ Y RN F+R Q      +   YF   F + F +++D CYL++ YPYT++ L+  L   ES+ ++    ++  LC +  GN+C ++TIT  S P           + +    ++ARVHPGE+N+SW+MKG++++L+    TAK LR R +FKIVPMLNPDGVI G
Sbjct:  691 ALRFESRFESGNLRKAIQVREYEYDLILNPDINCRHHHQWFYFEVSNMEADVPYRFNIINCEKINSQFNFGMQPVLYSMQEAVVEGRPCWARTGANVCYYRNYFSRSQDLGGGQKSKTYFTATFTVTFPHADDVCYLAYHYPYTYSMLQEHLANIESSIDSDVYYRRSTLCHSLAGNACDVITIT--SNPRHRDAYTLDSFRSRPYVFLSARVHPGESNASWVMKGVLEFLLSAFYTAKHLRDRFIFKIVPMLNPDGVING 949          
BLAST of Cytosolic carboxypeptidase 2 vs. Ensembl Nematostella
Match: EDO32134 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SVW8])

HSP 1 Score: 99.3673 bits (246), Expect = 2.866e-21
Identity = 61/185 (32.97%), Postives = 96/185 (51.89%), Query Frame = 2
Query:  902 SLIFESRFETGNLRQSRRTGQXXXXXXXXXXXXTKRHTQWFYFRLQNMEKNVTYKFIIINLLKSKSLYEEGMRILMYSDKNATTNS-IGWYRTGHHIRYTRN-FTRLQ-CPLLNREMAYFQLEFQIEFQYSEDTCYLSHCYPYTFTDLKNDLRTFESNCNTKPLLKKDILCETNIGNSCFLLTIT 1447
            +L FESRFE+GNLR++                           ++ NME +V Y+F IIN  K  S +  GM+ ++YS + A       W RTG ++ Y RN F+R Q      +   YF   F + F +++D CYL++ YPYT++ L+  L   ES+ ++    ++  LC +  GN+C ++TIT
Sbjct:  262 ALRFESRFESGNLRKA--------------------------IQVSNMEADVPYRFNIINCEKINSQFNFGMQPVLYSMQEAVVEGRPCWARTGANVCYYRNYFSRSQDLGGGQKSKTYFTATFTVTFPHADDVCYLAYHYPYTYSMLQEHLANIESSIDSDVYYRRSTLCHSLAGNACDVITIT 420          

HSP 2 Score: 84.7297 bits (208), Expect = 1.234e-16
Identity = 52/148 (35.14%), Postives = 69/148 (46.62%), Query Frame = 2
Query: 1820 LYCDLHGHSRKHNVFMYGCDSQY------------LHSENFNDINPVLNI-------NTIEDYIKDRIFTFLMQKNGPETFSFNGCHFKIRKCKESTGRVVMWKQFNVNDSYTLEATFSGTDINDRR--HFNINDLENIGKIFSESLF 2200
            +YCD HGHSRK NVFMYGC +              L         P  NI        T+ED +  R    ++    P  FS   C F +   KEST RVV+W++  V  SYT+E+T+SG D    +  H    +LE +G+ F   L 
Sbjct:  460 VYCDFHGHSRKKNVFMYGCSTLATIAAASPSSSADLEVAAPTPATPAPNIPASADPNETVED-VGYRTLPRVLHNIAP-AFSLGSCSFVVEPSKESTARVVVWRELGVVRSYTMESTYSGCDQGPYKGYHLGTRELEEMGRFFCAGLL 605          
BLAST of Cytosolic carboxypeptidase 2 vs. Ensembl Medaka
Match: agtpbp1 (ATP/GTP binding protein 1 [Source:NCBI gene;Acc:101172500])

HSP 1 Score: 312.768 bits (800), Expect = 1.959e-88
Identity = 189/485 (38.97%), Postives = 277/485 (57.11%), Query Frame = 2
Query:  893 ESSSLIFESRFETGNLRQSRRTGQXXXXXXXXXXXXTKRHTQWFYFRLQNMEKNVTYKFIIINLLKSKSLYEEGMRILMYSDKNATTNSIGWYRTGHHIRYTRN-FTRLQCPLLNRE-MAYFQLEFQIEFQYSEDTCYLSHCYPYTFTDLKNDLRTFESNCNTKPLLKKDILCETNIGNSCFLLTITDKSIPEKEKLGAV----------ITARVHPGETNSSWMMKGLIQYLIGNSETAKTLRRRIVFKIVPMLNPDGVIVGNYRCSTVGRDLNRNYRNPKEERFPTIFHTKRLIEDLKKSCTVGVSVVIKYFYVIQAMALYCDLHGHSRKHNVFMYGCDSQYLHSENFNDINPVLNINTIEDYIKDRIFTFLMQKNGPETFSFNGCHFKIRKCKESTGRVVMWKQFNVNDSYTLEATFSGTDINDRRHFNIN--DLENIGKIFSESLFSYISIM--KDEQQQKEIGLDLLKAILKQIVSKSKA 2299
            E  SL F S+FE+GNLR++ +  +YEY+L+LN D+ +  + QWFYF +  M   VTY+F IIN  KS S +  GM++LMYS + A +    W RTG  I Y +N F R       ++  +Y+ L F + F + +D CY ++ YPYTF+ LK  L   E     +  L++D+LCET  GN C LLTIT  ++PE +    +          ++ARVHPGETN+SW+MKG +++L+G S  A +LR   +FKIVPMLNPDGVI GN+RCS  G DLNR ++NP  E  PTI+HTK L++ L               ++ +A  ++CD HGHSRK NVFMYGC  +    E     N     + +++ +  R    ++ +  P  FS     F + + KEST RVV+W++  V  SYT+E+T  G D    + F I   +LE +G  F  +L     ++  ++ Q   ++  D++ AI  + VS S +
Sbjct:  681 EGESLKFNSQFESGNLRKAIQARKYEYDLVLNADINSNHYHQWFYFEVSGMRVGVTYRFNIINCEKSNSQFNYGMQVLMYSVQEAISGRPCWVRTGTDICYYKNYFARSSIAAGGQKGKSYYTLTFSMSFSHKDDVCYFAYHYPYTFSTLKMHLSKLEDLRTPQIYLRQDVLCETLGGNHCPLLTIT--AMPESKSSNHIYQFRNRPLIFLSARVHPGETNASWVMKGTLEFLMGTSTLAASLREAYIFKIVPMLNPDGVINGNHRCSLSGEDLNRQWQNPNPELHPTIYHTKSLLQYLA--------------HIQRAPLVFCDYHGHSRKKNVFMYGCSLK----ETVWQSNISATSSDLQEDLGYRTLPKILSEIAP-AFSMASSSFVVERSKESTARVVVWREIGVQRSYTMESTLCGCDQGKYKGFQIGTRELEEMGAQFCVALLRLKRLIGFRNHQHGWDLDNDVI-AIPAKTVSSSPS 1143          
BLAST of Cytosolic carboxypeptidase 2 vs. Ensembl Medaka
Match: agtpbp1 (ATP/GTP binding protein 1 [Source:NCBI gene;Acc:101172500])

HSP 1 Score: 312.768 bits (800), Expect = 3.291e-88
Identity = 189/485 (38.97%), Postives = 277/485 (57.11%), Query Frame = 2
Query:  893 ESSSLIFESRFETGNLRQSRRTGQXXXXXXXXXXXXTKRHTQWFYFRLQNMEKNVTYKFIIINLLKSKSLYEEGMRILMYSDKNATTNSIGWYRTGHHIRYTRN-FTRLQCPLLNRE-MAYFQLEFQIEFQYSEDTCYLSHCYPYTFTDLKNDLRTFESNCNTKPLLKKDILCETNIGNSCFLLTITDKSIPEKEKLGAV----------ITARVHPGETNSSWMMKGLIQYLIGNSETAKTLRRRIVFKIVPMLNPDGVIVGNYRCSTVGRDLNRNYRNPKEERFPTIFHTKRLIEDLKKSCTVGVSVVIKYFYVIQAMALYCDLHGHSRKHNVFMYGCDSQYLHSENFNDINPVLNINTIEDYIKDRIFTFLMQKNGPETFSFNGCHFKIRKCKESTGRVVMWKQFNVNDSYTLEATFSGTDINDRRHFNIN--DLENIGKIFSESLFSYISIM--KDEQQQKEIGLDLLKAILKQIVSKSKA 2299
            E  SL F S+FE+GNLR++ +  +YEY+L+LN D+ +  + QWFYF +  M   VTY+F IIN  KS S +  GM++LMYS + A +    W RTG  I Y +N F R       ++  +Y+ L F + F + +D CY ++ YPYTF+ LK  L   E     +  L++D+LCET  GN C LLTIT  ++PE +    +          ++ARVHPGETN+SW+MKG +++L+G S  A +LR   +FKIVPMLNPDGVI GN+RCS  G DLNR ++NP  E  PTI+HTK L++ L               ++ +A  ++CD HGHSRK NVFMYGC  +    E     N     + +++ +  R    ++ +  P  FS     F + + KEST RVV+W++  V  SYT+E+T  G D    + F I   +LE +G  F  +L     ++  ++ Q   ++  D++ AI  + VS S +
Sbjct:  716 EGESLKFNSQFESGNLRKAIQARKYEYDLVLNADINSNHYHQWFYFEVSGMRVGVTYRFNIINCEKSNSQFNYGMQVLMYSVQEAISGRPCWVRTGTDICYYKNYFARSSIAAGGQKGKSYYTLTFSMSFSHKDDVCYFAYHYPYTFSTLKMHLSKLEDLRTPQIYLRQDVLCETLGGNHCPLLTIT--AMPESKSSNHIYQFRNRPLIFLSARVHPGETNASWVMKGTLEFLMGTSTLAASLREAYIFKIVPMLNPDGVINGNHRCSLSGEDLNRQWQNPNPELHPTIYHTKSLLQYLA--------------HIQRAPLVFCDYHGHSRKKNVFMYGCSLK----ETVWQSNISATSSDLQEDLGYRTLPKILSEIAP-AFSMASSSFVVERSKESTARVVVWREIGVQRSYTMESTLCGCDQGKYKGFQIGTRELEEMGAQFCVALLRLKRLIGFRNHQHGWDLDNDVI-AIPAKTVSSSPS 1178          
BLAST of Cytosolic carboxypeptidase 2 vs. Ensembl Medaka
Match: agtpbp1 (ATP/GTP binding protein 1 [Source:NCBI gene;Acc:101172500])

HSP 1 Score: 312.768 bits (800), Expect = 3.888e-88
Identity = 189/485 (38.97%), Postives = 277/485 (57.11%), Query Frame = 2
Query:  893 ESSSLIFESRFETGNLRQSRRTGQXXXXXXXXXXXXTKRHTQWFYFRLQNMEKNVTYKFIIINLLKSKSLYEEGMRILMYSDKNATTNSIGWYRTGHHIRYTRN-FTRLQCPLLNRE-MAYFQLEFQIEFQYSEDTCYLSHCYPYTFTDLKNDLRTFESNCNTKPLLKKDILCETNIGNSCFLLTITDKSIPEKEKLGAV----------ITARVHPGETNSSWMMKGLIQYLIGNSETAKTLRRRIVFKIVPMLNPDGVIVGNYRCSTVGRDLNRNYRNPKEERFPTIFHTKRLIEDLKKSCTVGVSVVIKYFYVIQAMALYCDLHGHSRKHNVFMYGCDSQYLHSENFNDINPVLNINTIEDYIKDRIFTFLMQKNGPETFSFNGCHFKIRKCKESTGRVVMWKQFNVNDSYTLEATFSGTDINDRRHFNIN--DLENIGKIFSESLFSYISIM--KDEQQQKEIGLDLLKAILKQIVSKSKA 2299
            E  SL F S+FE+GNLR++ +  +YEY+L+LN D+ +  + QWFYF +  M   VTY+F IIN  KS S +  GM++LMYS + A +    W RTG  I Y +N F R       ++  +Y+ L F + F + +D CY ++ YPYTF+ LK  L   E     +  L++D+LCET  GN C LLTIT  ++PE +    +          ++ARVHPGETN+SW+MKG +++L+G S  A +LR   +FKIVPMLNPDGVI GN+RCS  G DLNR ++NP  E  PTI+HTK L++ L               ++ +A  ++CD HGHSRK NVFMYGC  +    E     N     + +++ +  R    ++ +  P  FS     F + + KEST RVV+W++  V  SYT+E+T  G D    + F I   +LE +G  F  +L     ++  ++ Q   ++  D++ AI  + VS S +
Sbjct:  730 EGESLKFNSQFESGNLRKAIQARKYEYDLVLNADINSNHYHQWFYFEVSGMRVGVTYRFNIINCEKSNSQFNYGMQVLMYSVQEAISGRPCWVRTGTDICYYKNYFARSSIAAGGQKGKSYYTLTFSMSFSHKDDVCYFAYHYPYTFSTLKMHLSKLEDLRTPQIYLRQDVLCETLGGNHCPLLTIT--AMPESKSSNHIYQFRNRPLIFLSARVHPGETNASWVMKGTLEFLMGTSTLAASLREAYIFKIVPMLNPDGVINGNHRCSLSGEDLNRQWQNPNPELHPTIYHTKSLLQYLA--------------HIQRAPLVFCDYHGHSRKKNVFMYGCSLK----ETVWQSNISATSSDLQEDLGYRTLPKILSEIAP-AFSMASSSFVVERSKESTARVVVWREIGVQRSYTMESTLCGCDQGKYKGFQIGTRELEEMGAQFCVALLRLKRLIGFRNHQHGWDLDNDVI-AIPAKTVSSSPS 1192          
BLAST of Cytosolic carboxypeptidase 2 vs. Ensembl Medaka
Match: ENSORLT00000020650.2 (pep primary_assembly:ASM223467v1:6:31072043:31073402:1 gene:ENSORLG00000016495.2 transcript:ENSORLT00000020650.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 212.616 bits (540), Expect = 1.371e-61
Identity = 109/252 (43.25%), Postives = 148/252 (58.73%), Query Frame = 2
Query: 1418 GNSCFLLTITDKSIPEKE---KLGAVITARVHPGETNSSWMMKGLIQYLIGNSETAKTLRRRIVFKIVPMLNPDGVIVGNYRCSTVGRDLNRNYRNPKEERFPTIFHTKRLIEDLKKSCTVGVSVVIKYFYVIQAMALYCDLHGHSRKHNVFMYGCDSQYLHSENFNDINPVLNINTIEDYIKDRIFTFLMQKNGPETFSFNGCHFKIRKCKESTGRVVMWKQFNVNDSYTLEATFSGTDINDRRHFNINDL 2164
            GN+  +LT+T +S   +E   K   V+TARVHPGETN+SW+M+GL+ +L+G+SE A+ LR   VFK+VPMLNPDGV+VGNYRCS  GRDLNR YR+   E FP ++HTK ++E L+    V               ALYCD HGH+RK+N FMYGC   +L S                       F  L     P  FSF  C F+++K KE TGR+ MW+   + +SYT+E +F G+ + ++  F  + L
Sbjct:   16 GNAVHVLTVTSESASRREAAHKRAVVLTARVHPGETNASWVMEGLLDFLLGDSEDAQVLRDNFVFKVVPMLNPDGVVVGNYRCSLAGRDLNRYYRSVLRESFPGVWHTKNMVERLRAEMEV---------------ALYCDFHGHNRKNNAFMYGCRRPHLLS------------------CCTSAFVQL-----PLQFSFQSCKFRVQKSKEGTGRICMWR-LGIQNSYTMETSFGGSTLGEQTSFGGSTL 228          
BLAST of Cytosolic carboxypeptidase 2 vs. Ensembl Medaka
Match: agbl5 (ATP/GTP binding protein like 5 [Source:NCBI gene;Acc:101155157])

HSP 1 Score: 112.464 bits (280), Expect = 1.106e-24
Identity = 79/279 (28.32%), Postives = 126/279 (45.16%), Query Frame = 2
Query: 1019 WFYFRLQNMEKNVTYKFIIINLLKSKSLYEEGMRILMYS--DKNATTNSIGWYRTGHHIRYTRNFTRLQCPLLNREMAYFQLEFQIEFQYSED-TCYLSHCYPYTFTDLKNDLRTFE-----------SNCNTKPLLKKDILCETNIGNSCFLLTIT------------------DKSIPEKEKLGA----VITARVHPGETNSSWMMKGLIQYLIGNSET-AKTLRRRIVFKIVPMLNPDGVIVGNYRCSTVGRDLNRNYRNPKEERFPTIFHTKRLI 1744
            WFYF ++        K  + N+   + LY +GM  L+ S   KN               R+ R   R    +++ +   F L F      +   T Y S CYPY++T+ +  L+  +           S+  +     +++LC +  GN   LLT+T                  D + P   +        +++RVHPGET SS++  G + +++   +  A  LR   VFK++PMLNPDGV+ G+YR  + G +LNR Y NP  E  P+I+  K L+
Sbjct:   74 WFYFSVKGAAPGKLVKINVRNMNNQRKLYSQGMAPLVRSLPGKN---------------RWERIRDRPTTEIIDNQ---FVLSFTHRLSEARGATTYFSFCYPYSYTECQEMLQKLDDSYPNAAQLSPSSAPSTVYYHRELLCRSLDGNRVDLLTVTNCSKMQEEREARLPKLFPDTNTPRPHRFAGKRVFFLSSRVHPGETPSSFVFNGFLSFILRRDDPRAHMLRSMFVFKLIPMLNPDGVVRGHYRTDSRGVNLNRQYLNPSPELHPSIYAAKTLL 334          
BLAST of Cytosolic carboxypeptidase 2 vs. Planmine SMEST
Match: SMESG000006325.1 (SMESG000006325.1)

HSP 1 Score: 1590.86 bits (4118), Expect = 0.000e+0
Identity = 796/818 (97.31%), Postives = 800/818 (97.80%), Query Frame = 2
Query:   38 LLELDSNWKMAIKEQIENELNRRVREALDTPPMERWKRNQKEALLRKSSQETNKKNLNSHIKFDSKERYKFRANLLNSTKCSENEQLEKKFXXXXXXXXXXXXXXXXXXKFEYWLKPQVQPSQLTSAGVLQKLDENNAINSLESKTLRTGFEAVQNFGSLTLEEKEIFFSTFTKQGFREAMRTGKLPDGSKLEALANGEFRDKFGIVRSKDGPFWPKDIGPLFPAPHHKIFQSSYEPLFDPLKDKETSKQAPPNGSHPAGWKHMQIVYDSETYSRNQRPHQHSECESSSLIFESRFETGNLRQSRRTGQXXXXXXXXXXXXTKRHTQWFYFRLQNMEKNVTYKFIIINLLKSKSLYEEGMRILMYSDKNATTNSIGWYRTGHHIRYTRNFTRLQCPLLNREMAYFQLEFQIEFQYSEDTCYLSHCYPYTFTDLKNDLRTFESNCNTKPLLKKDILCETNIGNSCFLLTITDKSIPEKEKLGAVITARVHPGETNSSWMMKGLIQYLIGNSETAKTLRRRIVFKIVPMLNPDGVIVGNYRCSTVGRDLNRNYRNPKEERFPTIFHTKRLIEDLKKSCTVGVSVVIKYFYVIQAMALYCDLHGHSRKHNVFMYGCDSQYLHSENFNDINPVLNINTIEDYIKDRIFTFLMQKNGPETFSFNGCHFKIRKCKESTGRVVMWKQFNVNDSYTLEATFSGTDINDRRHFNINDLENIGKIFSESLFSYISIMKDEQQQKEIGLDLLKAILKQIVSKSKAMNQLFRKLVSQTTDHIGSEVSLTNNIPKVIPSDLLENINELKDNSLDLFIDNLKMDDISN*KKL 2491
             ++LDSNWKMAIKEQIENELNRRVREALDTPPMERWKRNQKEALLRKSSQETNKKNLNSHIKFDSKERYKFRANLLNSTKCSENEQLEKKFENLNNSSSNEENISIEYNKFEYWLKPQVQPSQLTSAGVLQKLDENNAINSLESKTLRTGFEAVQNFGSLTLEEKEIFFSTFTKQGFREAMRTGKLPDGSKLEALANGEFRDKFGIVRSKDGPFWPKDIGPLFPAPHHKIFQSSYEPLFDPLKDKETSKQAPPNGSHPAGWKHMQIVYDSETYSRNQRPHQHSECESSSLIFESRFETGNLRQSRRTGQYEYELLLNNDLYTKRHTQWFYFRLQNMEKNVTYKFIIINLLKSKSLYEEGMRILMYSDKNATTNSIGWYRTGHHIRYTRNFTRLQCPLLNREMAYFQLEFQIEFQYSEDTCYLSHCYPYTFTDLKNDLRTFESNCNTKPLLKKDILCETNIGNSCFLLTITDKSIPEKEKLGAVITARVHPGETNSSWMMKGLIQYLIGNSETAKTLRRRIVFKIVPMLNPDGVIVGNYRCSTVGRDLNRNYRNPKEERFPTIFHTKRLIEDLKKSCT              AMALYCDLHGHSRKHNVFMYGCDSQYLHSENFNDINPVLNINTIEDYIKDRIFTFLMQKNGPETFSFNGCHFKIRKCKESTGRVVMWKQFNVNDSYTLEATFSGTDINDRRHFNINDLENIGKIFSESLFSYISIMKDEQQQKEIGLDLLKAILKQIVSKSKAMNQLFRKLVSQTTDHIGSEVSLTNNIPKVIPSDLLENINELKDNSLDLFIDNLKMDDI   K++
Sbjct:   30 FIKLDSNWKMAIKEQIENELNRRVREALDTPPMERWKRNQKEALLRKSSQETNKKNLNSHIKFDSKERYKFRANLLNSTKCSENEQLEKKFENLNNSSSNEENISIEYNKFEYWLKPQVQPSQLTSAGVLQKLDENNAINSLESKTLRTGFEAVQNFGSLTLEEKEIFFSTFTKQGFREAMRTGKLPDGSKLEALANGEFRDKFGIVRSKDGPFWPKDIGPLFPAPHHKIFQSSYEPLFDPLKDKETSKQAPPNGSHPAGWKHMQIVYDSETYSRNQRPHQHSECESSSLIFESRFETGNLRQSRRTGQYEYELLLNNDLYTKRHTQWFYFRLQNMEKNVTYKFIIINLLKSKSLYEEGMRILMYSDKNATTNSIGWYRTGHHIRYTRNFTRLQCPLLNREMAYFQLEFQIEFQYSEDTCYLSHCYPYTFTDLKNDLRTFESNCNTKPLLKKDILCETNIGNSCFLLTITDKSIPEKEKLGAVITARVHPGETNSSWMMKGLIQYLIGNSETAKTLRRRIVFKIVPMLNPDGVIVGNYRCSTVGRDLNRNYRNPKEERFPTIFHTKRLIEDLKKSCT--------------AMALYCDLHGHSRKHNVFMYGCDSQYLHSENFNDINPVLNINTIEDYIKDRIFTFLMQKNGPETFSFNGCHFKIRKCKESTGRVVMWKQFNVNDSYTLEATFSGTDINDRRHFNINDLENIGKIFSESLFSYISIMKDEQQQKEIGLDLLKAILKQIVSKSKAMNQLFRKLVSQTTDHIGSEVSLTNNIPKVIPSDLLENINELKDNSLDLFIDNLKMDDIKQLKEI 833          

HSP 2 Score: 333.954 bits (855), Expect = 4.871e-96
Identity = 164/164 (100.00%), Postives = 164/164 (100.00%), Query Frame = 2
Query: 3035 PLRQWPIFLSKFDGRTNGGIPCFTEERVLERARRKSLTSIRKDIEESLFKIPFEYTNEYLDRKLNAENRLSSLMQTSELLNEQYCKLQKHSDEILLYRLYKSDTSEEYSENNKERILPKPVYNTNNLKDIQKSSVKQHILVKNEESQAFKSLTLDSPTLPTKEI 3526
            PLRQWPIFLSKFDGRTNGGIPCFTEERVLERARRKSLTSIRKDIEESLFKIPFEYTNEYLDRKLNAENRLSSLMQTSELLNEQYCKLQKHSDEILLYRLYKSDTSEEYSENNKERILPKPVYNTNNLKDIQKSSVKQHILVKNEESQAFKSLTLDSPTLPTKEI
Sbjct:  990 PLRQWPIFLSKFDGRTNGGIPCFTEERVLERARRKSLTSIRKDIEESLFKIPFEYTNEYLDRKLNAENRLSSLMQTSELLNEQYCKLQKHSDEILLYRLYKSDTSEEYSENNKERILPKPVYNTNNLKDIQKSSVKQHILVKNEESQAFKSLTLDSPTLPTKEI 1153          

HSP 3 Score: 157.918 bits (398), Expect = 1.071e-38
Identity = 145/145 (100.00%), Postives = 145/145 (100.00%), Query Frame = 1
Query: 2473 KQLKEINFXXXXXXXXXXXXXXXXXQPGEEIIENEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNKGESSSPANEMKNTEKGSIKTEGNQVTSELAKSSREKHNINTPFRLSREMTRINVPSGSTESNIVNSIRQ 2907
            KQLKEINFDVSDIEDSSSSDSDSDSQPGEEIIENEQKLSAKVKKRKKKSKIQIKELLTKKPLLKKLSSKILPSINKGESSSPANEMKNTEKGSIKTEGNQVTSELAKSSREKHNINTPFRLSREMTRINVPSGSTESNIVNSIRQ
Sbjct:  828 KQLKEINFDVSDIEDSSSSDSDSDSQPGEEIIENEQKLSAKVKKRKKKSKIQIKELLTKKPLLKKLSSKILPSINKGESSSPANEMKNTEKGSIKTEGNQVTSELAKSSREKHNINTPFRLSREMTRINVPSGSTESNIVNSIRQ 972          
BLAST of Cytosolic carboxypeptidase 2 vs. Planmine SMEST
Match: SMESG000006325.1 (SMESG000006325.1)

HSP 1 Score: 1589.32 bits (4114), Expect = 0.000e+0
Identity = 796/818 (97.31%), Postives = 800/818 (97.80%), Query Frame = 2
Query:   38 LLELDSNWKMAIKEQIENELNRRVREALDTPPMERWKRNQKEALLRKSSQETNKKNLNSHIKFDSKERYKFRANLLNSTKCSENEQLEKKFXXXXXXXXXXXXXXXXXXKFEYWLKPQVQPSQLTSAGVLQKLDENNAINSLESKTLRTGFEAVQNFGSLTLEEKEIFFSTFTKQGFREAMRTGKLPDGSKLEALANGEFRDKFGIVRSKDGPFWPKDIGPLFPAPHHKIFQSSYEPLFDPLKDKETSKQAPPNGSHPAGWKHMQIVYDSETYSRNQRPHQHSECESSSLIFESRFETGNLRQSRRTGQXXXXXXXXXXXXTKRHTQWFYFRLQNMEKNVTYKFIIINLLKSKSLYEEGMRILMYSDKNATTNSIGWYRTGHHIRYTRNFTRLQCPLLNREMAYFQLEFQIEFQYSEDTCYLSHCYPYTFTDLKNDLRTFESNCNTKPLLKKDILCETNIGNSCFLLTITDKSIPEKEKLGAVITARVHPGETNSSWMMKGLIQYLIGNSETAKTLRRRIVFKIVPMLNPDGVIVGNYRCSTVGRDLNRNYRNPKEERFPTIFHTKRLIEDLKKSCTVGVSVVIKYFYVIQAMALYCDLHGHSRKHNVFMYGCDSQYLHSENFNDINPVLNINTIEDYIKDRIFTFLMQKNGPETFSFNGCHFKIRKCKESTGRVVMWKQFNVNDSYTLEATFSGTDINDRRHFNINDLENIGKIFSESLFSYISIMKDEQQQKEIGLDLLKAILKQIVSKSKAMNQLFRKLVSQTTDHIGSEVSLTNNIPKVIPSDLLENINELKDNSLDLFIDNLKMDDISN*KKL 2491
             ++LDSNWKMAIKEQIENELNRRVREALDTPPMERWKRNQKEALLRKSSQETNKKNLNSHIKFDSKERYKFRANLLNSTKCSENEQLEKKFENLNNSSSNEENISIEYNKFEYWLKPQVQPSQLTSAGVLQKLDENNAINSLESKTLRTGFEAVQNFGSLTLEEKEIFFSTFTKQGFREAMRTGKLPDGSKLEALANGEFRDKFGIVRSKDGPFWPKDIGPLFPAPHHKIFQSSYEPLFDPLKDKETSKQAPPNGSHPAGWKHMQIVYDSETYSRNQRPHQHSECESSSLIFESRFETGNLRQSRRTGQYEYELLLNNDLYTKRHTQWFYFRLQNMEKNVTYKFIIINLLKSKSLYEEGMRILMYSDKNATTNSIGWYRTGHHIRYTRNFTRLQCPLLNREMAYFQLEFQIEFQYSEDTCYLSHCYPYTFTDLKNDLRTFESNCNTKPLLKKDILCETNIGNSCFLLTITDKSIPEKEKLGAVITARVHPGETNSSWMMKGLIQYLIGNSETAKTLRRRIVFKIVPMLNPDGVIVGNYRCSTVGRDLNRNYRNPKEERFPTIFHTKRLIEDLKKSCT              AMALYCDLHGHSRKHNVFMYGCDSQYLHSENFNDINPVLNINTIEDYIKDRIFTFLMQKNGPETFSFNGCHFKIRKCKESTGRVVMWKQFNVNDSYTLEATFSGTDINDRRHFNINDLENIGKIFSESLFSYISIMKDEQQQKEIGLDLLKAILKQIVSKSKAMNQLFRKLVSQTTDHIGSEVSLTNNIPKVIPSDLLENINELKDNSLDLFIDNLKMDDI   K++
Sbjct:   30 FIKLDSNWKMAIKEQIENELNRRVREALDTPPMERWKRNQKEALLRKSSQETNKKNLNSHIKFDSKERYKFRANLLNSTKCSENEQLEKKFENLNNSSSNEENISIEYNKFEYWLKPQVQPSQLTSAGVLQKLDENNAINSLESKTLRTGFEAVQNFGSLTLEEKEIFFSTFTKQGFREAMRTGKLPDGSKLEALANGEFRDKFGIVRSKDGPFWPKDIGPLFPAPHHKIFQSSYEPLFDPLKDKETSKQAPPNGSHPAGWKHMQIVYDSETYSRNQRPHQHSECESSSLIFESRFETGNLRQSRRTGQYEYELLLNNDLYTKRHTQWFYFRLQNMEKNVTYKFIIINLLKSKSLYEEGMRILMYSDKNATTNSIGWYRTGHHIRYTRNFTRLQCPLLNREMAYFQLEFQIEFQYSEDTCYLSHCYPYTFTDLKNDLRTFESNCNTKPLLKKDILCETNIGNSCFLLTITDKSIPEKEKLGAVITARVHPGETNSSWMMKGLIQYLIGNSETAKTLRRRIVFKIVPMLNPDGVIVGNYRCSTVGRDLNRNYRNPKEERFPTIFHTKRLIEDLKKSCT--------------AMALYCDLHGHSRKHNVFMYGCDSQYLHSENFNDINPVLNINTIEDYIKDRIFTFLMQKNGPETFSFNGCHFKIRKCKESTGRVVMWKQFNVNDSYTLEATFSGTDINDRRHFNINDLENIGKIFSESLFSYISIMKDEQQQKEIGLDLLKAILKQIVSKSKAMNQLFRKLVSQTTDHIGSEVSLTNNIPKVIPSDLLENINELKDNSLDLFIDNLKMDDIKQLKEI 833          

HSP 2 Score: 333.954 bits (855), Expect = 2.608e-96
Identity = 164/164 (100.00%), Postives = 164/164 (100.00%), Query Frame = 2
Query: 3035 PLRQWPIFLSKFDGRTNGGIPCFTEERVLERARRKSLTSIRKDIEESLFKIPFEYTNEYLDRKLNAENRLSSLMQTSELLNEQYCKLQKHSDEILLYRLYKSDTSEEYSENNKERILPKPVYNTNNLKDIQKSSVKQHILVKNEESQAFKSLTLDSPTLPTKEI 3526
            PLRQWPIFLSKFDGRTNGGIPCFTEERVLERARRKSLTSIRKDIEESLFKIPFEYTNEYLDRKLNAENRLSSLMQTSELLNEQYCKLQKHSDEILLYRLYKSDTSEEYSENNKERILPKPVYNTNNLKDIQKSSVKQHILVKNEESQAFKSLTLDSPTLPTKEI
Sbjct:  930 PLRQWPIFLSKFDGRTNGGIPCFTEERVLERARRKSLTSIRKDIEESLFKIPFEYTNEYLDRKLNAENRLSSLMQTSELLNEQYCKLQKHSDEILLYRLYKSDTSEEYSENNKERILPKPVYNTNNLKDIQKSSVKQHILVKNEESQAFKSLTLDSPTLPTKEI 1093          
BLAST of Cytosolic carboxypeptidase 2 vs. Planmine SMEST
Match: SMESG000006325.1 (SMESG000006325.1)

HSP 1 Score: 1588.93 bits (4113), Expect = 0.000e+0
Identity = 796/818 (97.31%), Postives = 800/818 (97.80%), Query Frame = 2
Query:   38 LLELDSNWKMAIKEQIENELNRRVREALDTPPMERWKRNQKEALLRKSSQETNKKNLNSHIKFDSKERYKFRANLLNSTKCSENEQLEKKFXXXXXXXXXXXXXXXXXXKFEYWLKPQVQPSQLTSAGVLQKLDENNAINSLESKTLRTGFEAVQNFGSLTLEEKEIFFSTFTKQGFREAMRTGKLPDGSKLEALANGEFRDKFGIVRSKDGPFWPKDIGPLFPAPHHKIFQSSYEPLFDPLKDKETSKQAPPNGSHPAGWKHMQIVYDSETYSRNQRPHQHSECESSSLIFESRFETGNLRQSRRTGQXXXXXXXXXXXXTKRHTQWFYFRLQNMEKNVTYKFIIINLLKSKSLYEEGMRILMYSDKNATTNSIGWYRTGHHIRYTRNFTRLQCPLLNREMAYFQLEFQIEFQYSEDTCYLSHCYPYTFTDLKNDLRTFESNCNTKPLLKKDILCETNIGNSCFLLTITDKSIPEKEKLGAVITARVHPGETNSSWMMKGLIQYLIGNSETAKTLRRRIVFKIVPMLNPDGVIVGNYRCSTVGRDLNRNYRNPKEERFPTIFHTKRLIEDLKKSCTVGVSVVIKYFYVIQAMALYCDLHGHSRKHNVFMYGCDSQYLHSENFNDINPVLNINTIEDYIKDRIFTFLMQKNGPETFSFNGCHFKIRKCKESTGRVVMWKQFNVNDSYTLEATFSGTDINDRRHFNINDLENIGKIFSESLFSYISIMKDEQQQKEIGLDLLKAILKQIVSKSKAMNQLFRKLVSQTTDHIGSEVSLTNNIPKVIPSDLLENINELKDNSLDLFIDNLKMDDISN*KKL 2491
             ++LDSNWKMAIKEQIENELNRRVREALDTPPMERWKRNQKEALLRKSSQETNKKNLNSHIKFDSKERYKFRANLLNSTKCSENEQLEKKFENLNNSSSNEENISIEYNKFEYWLKPQVQPSQLTSAGVLQKLDENNAINSLESKTLRTGFEAVQNFGSLTLEEKEIFFSTFTKQGFREAMRTGKLPDGSKLEALANGEFRDKFGIVRSKDGPFWPKDIGPLFPAPHHKIFQSSYEPLFDPLKDKETSKQAPPNGSHPAGWKHMQIVYDSETYSRNQRPHQHSECESSSLIFESRFETGNLRQSRRTGQYEYELLLNNDLYTKRHTQWFYFRLQNMEKNVTYKFIIINLLKSKSLYEEGMRILMYSDKNATTNSIGWYRTGHHIRYTRNFTRLQCPLLNREMAYFQLEFQIEFQYSEDTCYLSHCYPYTFTDLKNDLRTFESNCNTKPLLKKDILCETNIGNSCFLLTITDKSIPEKEKLGAVITARVHPGETNSSWMMKGLIQYLIGNSETAKTLRRRIVFKIVPMLNPDGVIVGNYRCSTVGRDLNRNYRNPKEERFPTIFHTKRLIEDLKKSCT              AMALYCDLHGHSRKHNVFMYGCDSQYLHSENFNDINPVLNINTIEDYIKDRIFTFLMQKNGPETFSFNGCHFKIRKCKESTGRVVMWKQFNVNDSYTLEATFSGTDINDRRHFNINDLENIGKIFSESLFSYISIMKDEQQQKEIGLDLLKAILKQIVSKSKAMNQLFRKLVSQTTDHIGSEVSLTNNIPKVIPSDLLENINELKDNSLDLFIDNLKMDDI   K++
Sbjct:   30 FIKLDSNWKMAIKEQIENELNRRVREALDTPPMERWKRNQKEALLRKSSQETNKKNLNSHIKFDSKERYKFRANLLNSTKCSENEQLEKKFENLNNSSSNEENISIEYNKFEYWLKPQVQPSQLTSAGVLQKLDENNAINSLESKTLRTGFEAVQNFGSLTLEEKEIFFSTFTKQGFREAMRTGKLPDGSKLEALANGEFRDKFGIVRSKDGPFWPKDIGPLFPAPHHKIFQSSYEPLFDPLKDKETSKQAPPNGSHPAGWKHMQIVYDSETYSRNQRPHQHSECESSSLIFESRFETGNLRQSRRTGQYEYELLLNNDLYTKRHTQWFYFRLQNMEKNVTYKFIIINLLKSKSLYEEGMRILMYSDKNATTNSIGWYRTGHHIRYTRNFTRLQCPLLNREMAYFQLEFQIEFQYSEDTCYLSHCYPYTFTDLKNDLRTFESNCNTKPLLKKDILCETNIGNSCFLLTITDKSIPEKEKLGAVITARVHPGETNSSWMMKGLIQYLIGNSETAKTLRRRIVFKIVPMLNPDGVIVGNYRCSTVGRDLNRNYRNPKEERFPTIFHTKRLIEDLKKSCT--------------AMALYCDLHGHSRKHNVFMYGCDSQYLHSENFNDINPVLNINTIEDYIKDRIFTFLMQKNGPETFSFNGCHFKIRKCKESTGRVVMWKQFNVNDSYTLEATFSGTDINDRRHFNINDLENIGKIFSESLFSYISIMKDEQQQKEIGLDLLKAILKQIVSKSKAMNQLFRKLVSQTTDHIGSEVSLTNNIPKVIPSDLLENINELKDNSLDLFIDNLKMDDIKQLKEI 833          

HSP 2 Score: 434.876 bits (1117), Expect = 1.618e-132
Identity = 215/215 (100.00%), Postives = 215/215 (100.00%), Query Frame = 2
Query: 3035 PLRQWPIFLSKFDGRTNGGIPCFTEERVLERARRKSLTSIRKDIEESLFKIPFEYTNEYLDRKLNAENRLSSLMQTSELLNEQYCKLQKHSDEILLYRLYKSDTSEEYSENNKERILPKPVYNTNNLKDIQKSSVKQHILVKNEESQAFKSLTLDSPTLPTKEIDNKFFSRCKKQFIKYSLLKKLESKNPNKSHLMSSNYVKMFTRSHKDVQSEF 3679
            PLRQWPIFLSKFDGRTNGGIPCFTEERVLERARRKSLTSIRKDIEESLFKIPFEYTNEYLDRKLNAENRLSSLMQTSELLNEQYCKLQKHSDEILLYRLYKSDTSEEYSENNKERILPKPVYNTNNLKDIQKSSVKQHILVKNEESQAFKSLTLDSPTLPTKEIDNKFFSRCKKQFIKYSLLKKLESKNPNKSHLMSSNYVKMFTRSHKDVQSEF
Sbjct:  930 PLRQWPIFLSKFDGRTNGGIPCFTEERVLERARRKSLTSIRKDIEESLFKIPFEYTNEYLDRKLNAENRLSSLMQTSELLNEQYCKLQKHSDEILLYRLYKSDTSEEYSENNKERILPKPVYNTNNLKDIQKSSVKQHILVKNEESQAFKSLTLDSPTLPTKEIDNKFFSRCKKQFIKYSLLKKLESKNPNKSHLMSSNYVKMFTRSHKDVQSEF 1144          
BLAST of Cytosolic carboxypeptidase 2 vs. Planmine SMEST
Match: SMESG000058240.1 (SMESG000058240.1)

HSP 1 Score: 323.553 bits (828), Expect = 6.089e-94
Identity = 193/476 (40.55%), Postives = 277/476 (58.19%), Query Frame = 2
Query:  887 ECESS-SLIFESRFETGNLRQSRRTGQXXXXXXXXXXXXTKRHTQWFYFRLQNMEKNVTYKFIIINLLKSKSLYEEGMRILMYSDKNATTNSIGWYRTGHHIRYTRNFTRLQCPLLNREMAYFQLEFQIEFQYSEDTCYLSHCYPYTFTDLKNDLRTFESNCNTKPLLKKDILCETNIGNSCFLLTITDKSIPEKEKLG----AVITARVHPGETNSSWMMKGLIQYLIGNSETAKTLRRRIVFKIVPMLNPDGVIVGNYRCSTVGRDLNRNYRNPKEERFPTIFHTKRLIEDLKKSCTVGVSVVIKYFYVIQAMALYCDLHGHSRKHNVFMYGCDSQYLHSENFNDINPVLNINTIEDYIKDRIFTFLMQKNGPETFSFNGCHFKIRKCKESTGRVVMWKQFNVNDSYTLEATFSGTDI----NDRR-----HFNINDLENIGKIFSESLFSYISIMKDEQQQKEIGLDLLKAIL 2272
            E ES+ +L FESRFE+GNL +  +   +EYEL L  D+YT +HTQW+YFR+ N  +N  Y+F I+N  K++SLY EG++ L+YS+K+A  ++ GW R G +I Y RN   L+      E  Y+ L +   F +  DT Y SHCYPYT+++L   + T   +     + +  +L ++   N   LLTIT+ S  E+E+       +IT RVHPGETN+SWMM+G++ +L+ +   A  LR   +FKIVPMLNPDGVIVGNYRCS  GRDLNRNY++  ++ +P I   K L E L K                  +  YCD HGHSRK+N+FMYGC+ Q   SEN              +++ +R F +++ KN  + F +  C FK++K K  T R+V ++ F +  S+TLEA+F GTD+    N  R     HFN +DL+ +G+ F  SL  +      +Q Q  I L+ +K  L
Sbjct:  187 ESESNETLCFESRFESGNLEKVYKISPFEYELHLRPDMYTSKHTQWYYFRVSNTRENKMYRFTIVNFYKAESLYNEGLKPLLYSEKDARLSNKGWRRWGSNIAYYRN--NLKYETKKGENYYYSLTWNCLFPHDNDTVYFSHCYPYTYSNLMKYVETVSKDPVKSKICRIKLLTKSLAENISLLLTITN-SFTEQERKNYKKIILITGRVHPGETNASWMMEGVLDFLLSDKPDAMLLRDLFIFKIVPMLNPDGVIVGNYRCSLTGRDLNRNYKSKLKDYYPIICSVKNLAEKLLKD---------------HEILFYCDFHGHSRKNNIFMYGCNDQ--KSEN--------------EFLLERAFPYILAKNASDKFDYKSCKFKMQKSKSGTSRIV-FRNFGIPHSFTLEASFCGTDLISNTNSNRNEQFYHFNTDDLKKMGEAFCYSLLDF---SDPDQTQMNIILENIKEDL 624          
BLAST of Cytosolic carboxypeptidase 2 vs. Planmine SMEST
Match: SMESG000058240.1 (SMESG000058240.1)

HSP 1 Score: 323.553 bits (828), Expect = 7.990e-94
Identity = 193/476 (40.55%), Postives = 277/476 (58.19%), Query Frame = 2
Query:  887 ECESS-SLIFESRFETGNLRQSRRTGQXXXXXXXXXXXXTKRHTQWFYFRLQNMEKNVTYKFIIINLLKSKSLYEEGMRILMYSDKNATTNSIGWYRTGHHIRYTRNFTRLQCPLLNREMAYFQLEFQIEFQYSEDTCYLSHCYPYTFTDLKNDLRTFESNCNTKPLLKKDILCETNIGNSCFLLTITDKSIPEKEKLG----AVITARVHPGETNSSWMMKGLIQYLIGNSETAKTLRRRIVFKIVPMLNPDGVIVGNYRCSTVGRDLNRNYRNPKEERFPTIFHTKRLIEDLKKSCTVGVSVVIKYFYVIQAMALYCDLHGHSRKHNVFMYGCDSQYLHSENFNDINPVLNINTIEDYIKDRIFTFLMQKNGPETFSFNGCHFKIRKCKESTGRVVMWKQFNVNDSYTLEATFSGTDI----NDRR-----HFNINDLENIGKIFSESLFSYISIMKDEQQQKEIGLDLLKAIL 2272
            E ES+ +L FESRFE+GNL +  +   +EYEL L  D+YT +HTQW+YFR+ N  +N  Y+F I+N  K++SLY EG++ L+YS+K+A  ++ GW R G +I Y RN   L+      E  Y+ L +   F +  DT Y SHCYPYT+++L   + T   +     + +  +L ++   N   LLTIT+ S  E+E+       +IT RVHPGETN+SWMM+G++ +L+ +   A  LR   +FKIVPMLNPDGVIVGNYRCS  GRDLNRNY++  ++ +P I   K L E L K                  +  YCD HGHSRK+N+FMYGC+ Q   SEN              +++ +R F +++ KN  + F +  C FK++K K  T R+V ++ F +  S+TLEA+F GTD+    N  R     HFN +DL+ +G+ F  SL  +      +Q Q  I L+ +K  L
Sbjct:  187 ESESNETLCFESRFESGNLEKVYKISPFEYELHLRPDMYTSKHTQWYYFRVSNTRENKMYRFTIVNFYKAESLYNEGLKPLLYSEKDARLSNKGWRRWGSNIAYYRN--NLKYETKKGENYYYSLTWNCLFPHDNDTVYFSHCYPYTYSNLMKYVETVSKDPVKSKICRIKLLTKSLAENISLLLTITN-SFTEQERKNYKKIILITGRVHPGETNASWMMEGVLDFLLSDKPDAMLLRDLFIFKIVPMLNPDGVIVGNYRCSLTGRDLNRNYKSKLKDYYPIICSVKNLAEKLLKD---------------HEILFYCDFHGHSRKNNIFMYGCNDQ--KSEN--------------EFLLERAFPYILAKNASDKFDYKSCKFKMQKSKSGTSRIV-FRNFGIPHSFTLEASFCGTDLISNTNSNRNEQFYHFNTDDLKKMGEAFCYSLLDF---SDPDQTQMNIILENIKEDL 624          
The following BLAST results are available for this feature:
BLAST of Cytosolic carboxypeptidase 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
AGBL32.687e-11540.29ATP/GTP binding protein like 3 [Source:HGNC Symbol... [more]
AGBL27.124e-11543.31ATP/GTP binding protein like 2 [Source:HGNC Symbol... [more]
AGBL27.124e-11543.31ATP/GTP binding protein like 2 [Source:HGNC Symbol... [more]
AGBL31.915e-11440.29ATP/GTP binding protein like 3 [Source:HGNC Symbol... [more]
AGBL22.213e-11443.31ATP/GTP binding protein like 2 [Source:HGNC Symbol... [more]
back to top
BLAST of Cytosolic carboxypeptidase 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ccpp-12.719e-6934.76Cytosolic carboxypeptidase 1 [Source:UniProtKB/Sw... [more]
ccpp-67.815e-4429.98Cytosolic carboxypeptidase 6 [Source:UniProtKB/Sw... [more]
back to top
BLAST of Cytosolic carboxypeptidase 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Nna11.815e-10336.39gene:FBgn0265726 transcript:FBtr0340677[more]
Nna14.055e-10140.21gene:FBgn0265726 transcript:FBtr0340672[more]
Nna17.230e-10141.70gene:FBgn0265726 transcript:FBtr0340676[more]
Nna17.230e-10141.70gene:FBgn0265726 transcript:FBtr0340673[more]
Nna19.262e-10041.37gene:FBgn0265726 transcript:FBtr0340674[more]
back to top
BLAST of Cytosolic carboxypeptidase 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
agbl23.186e-11541.40ATP/GTP binding protein-like 2 [Source:NCBI gene;A... [more]
agbl21.130e-11241.40ATP/GTP binding protein-like 2 [Source:NCBI gene;A... [more]
agbl21.779e-11241.40ATP/GTP binding protein-like 2 [Source:NCBI gene;A... [more]
agtpbp17.800e-8939.38ATP/GTP binding protein 1 [Source:NCBI gene;Acc:55... [more]
agtpbp11.759e-8539.38ATP/GTP binding protein 1 [Source:NCBI gene;Acc:55... [more]
back to top
BLAST of Cytosolic carboxypeptidase 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
AGBL34.608e-11745.56ATP/GTP binding protein like 3 [Source:HGNC Symbol... [more]
fgfr11.194e-11341.93fibroblast growth factor receptor 1 [Source:Xenbas... [more]
agtpbp12.071e-8438.82ATP/GTP binding protein 1 [Source:NCBI gene;Acc:10... [more]
agtpbp13.646e-8438.82ATP/GTP binding protein 1 [Source:NCBI gene;Acc:10... [more]
agtpbp15.463e-8438.82ATP/GTP binding protein 1 [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Cytosolic carboxypeptidase 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Agbl22.874e-11443.10ATP/GTP binding protein-like 2 [Source:MGI Symbol;... [more]
Agbl22.178e-11343.64ATP/GTP binding protein-like 2 [Source:MGI Symbol;... [more]
Agbl22.701e-11343.10ATP/GTP binding protein-like 2 [Source:MGI Symbol;... [more]
Agbl23.716e-11343.64ATP/GTP binding protein-like 2 [Source:MGI Symbol;... [more]
Agbl23.716e-11343.64ATP/GTP binding protein-like 2 [Source:MGI Symbol;... [more]
back to top
BLAST of Cytosolic carboxypeptidase 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A6H8T7|CBPC2_DANRE2.611e-11441.20Cytosolic carboxypeptidase 2 OS=Danio rerio OX=795... [more]
sp|Q5U5Z8|CBPC2_HUMAN1.063e-11343.31Cytosolic carboxypeptidase 2 OS=Homo sapiens OX=96... [more]
sp|Q4R632|CBPC2_MACFA4.244e-11343.31Cytosolic carboxypeptidase 2 OS=Macaca fasciculari... [more]
sp|Q0P4M4|CBPC2_XENTR5.108e-11341.93Cytosolic carboxypeptidase 2 OS=Xenopus tropicalis... [more]
sp|Q8CDK2|CBPC2_MOUSE2.599e-11243.64Cytosolic carboxypeptidase 2 OS=Mus musculus OX=10... [more]
back to top
BLAST of Cytosolic carboxypeptidase 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267GTP50.000e+047.80Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267H0550.000e+049.17Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267EJ080.000e+047.50Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267EVR20.000e+049.39Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267H0070.000e+049.02Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of Cytosolic carboxypeptidase 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
agbl21.176e-12044.14cytosolic carboxypeptidase 2 [Source:NCBI gene;Acc... [more]
agbl22.919e-11844.14cytosolic carboxypeptidase 2 [Source:NCBI gene;Acc... [more]
agbl26.140e-11844.14cytosolic carboxypeptidase 2 [Source:NCBI gene;Acc... [more]
agbl29.264e-11844.14cytosolic carboxypeptidase 2 [Source:NCBI gene;Acc... [more]
agbl21.516e-11744.14cytosolic carboxypeptidase 2 [Source:NCBI gene;Acc... [more]
back to top
BLAST of Cytosolic carboxypeptidase 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
agtpbp11.057e-7836.02ATP/GTP binding protein 1 [Source:NCBI gene;Acc:55... [more]
back to top
BLAST of Cytosolic carboxypeptidase 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cytosolic carboxypeptidase 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO428582.216e-14550.91Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO492705.666e-12845.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO474543.818e-4832.24Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO343055.885e-4842.15Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO321342.866e-2132.97Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Cytosolic carboxypeptidase 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
agtpbp11.959e-8838.97ATP/GTP binding protein 1 [Source:NCBI gene;Acc:10... [more]
agtpbp13.291e-8838.97ATP/GTP binding protein 1 [Source:NCBI gene;Acc:10... [more]
agtpbp13.888e-8838.97ATP/GTP binding protein 1 [Source:NCBI gene;Acc:10... [more]
ENSORLT00000020650.21.371e-6143.25pep primary_assembly:ASM223467v1:6:31072043:310734... [more]
agbl51.106e-2428.32ATP/GTP binding protein like 5 [Source:NCBI gene;A... [more]
back to top
BLAST of Cytosolic carboxypeptidase 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000006325.14.871e-9697.31SMESG000006325.1[more]
SMESG000006325.12.608e-9697.31SMESG000006325.1[more]
SMESG000006325.11.618e-13297.31SMESG000006325.1[more]
SMESG000058240.16.089e-9440.55SMESG000058240.1[more]
SMESG000058240.17.990e-9440.55SMESG000058240.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30028343 ID=SMED30028343|Name=Cytosolic carboxypeptidase 2|organism=Schmidtea mediterranea sexual|type=transcript|length=3700bp
AGATTATTTTATAATTATATTTCTTGTTTAAACATCACTTTTAGAGTTAG
ATTCTAATTGGAAAATGGCGATAAAGGAACAAATAGAAAATGAGCTAAAC
CGAAGAGTTAGAGAAGCATTGGATACCCCTCCAATGGAAAGATGGAAAAG
AAATCAAAAGGAAGCCCTACTAAGAAAATCTAGTCAAGAGACTAATAAAA
AAAATCTGAATTCACATATCAAATTTGATTCCAAAGAACGATATAAGTTT
CGAGCAAATTTGTTAAACTCAACGAAATGCTCAGAAAATGAGCAGTTGGA
AAAGAAATTTGAAAACCTCAACAACTCTTCATCAAATGAGGAAAATATCT
CAATTGAATATAACAAATTCGAGTATTGGTTAAAGCCACAAGTCCAGCCT
TCACAACTCACAAGTGCGGGAGTATTACAGAAACTGGATGAAAATAATGC
AATTAATAGCCTGGAGTCGAAAACTCTAAGAACTGGTTTTGAAGCTGTTC
AAAATTTTGGATCTTTAACTCTAGAAGAAAAAGAAATATTTTTTTCTACT
TTTACAAAACAAGGTTTTAGAGAAGCAATGAGAACCGGAAAATTACCTGA
TGGTAGCAAACTTGAAGCATTGGCTAATGGAGAATTTAGAGATAAATTCG
GAATAGTTCGTAGCAAAGATGGACCGTTTTGGCCAAAGGACATTGGTCCA
CTTTTTCCAGCCCCACATCACAAAATATTTCAATCCTCTTATGAACCTCT
TTTCGATCCTTTGAAAGATAAAGAAACTTCGAAGCAAGCACCACCAAATG
GCAGTCACCCAGCAGGATGGAAACACATGCAAATTGTGTATGATTCTGAA
ACTTATTCAAGAAATCAGAGACCTCATCAACATTCCGAATGTGAAAGTTC
ATCTTTAATTTTTGAATCGCGATTCGAAACTGGAAACCTCCGGCAATCTC
GACGAACTGGACAATATGAATACGAACTTCTTCTAAATAATGATTTATAC
ACTAAAAGACATACACAATGGTTTTATTTTCGCCTGCAAAATATGGAAAA
AAATGTCACCTATAAATTTATTATAATAAATTTGTTAAAGTCAAAGAGTC
TTTATGAAGAAGGAATGAGAATACTAATGTATTCGGATAAAAATGCTACA
ACAAATAGTATTGGATGGTATAGAACCGGACATCATATTCGCTATACAAG
AAATTTCACTCGATTGCAATGCCCACTGCTCAACCGGGAAATGGCATACT
TTCAGCTGGAGTTTCAAATAGAATTTCAGTATTCTGAGGACACATGCTAT
TTATCACATTGTTATCCTTACACGTTCACAGATTTGAAAAATGACCTAAG
AACCTTTGAATCAAACTGTAACACAAAACCTTTGTTAAAGAAAGATATTC
TATGTGAGACAAATATTGGAAACAGTTGCTTTCTTCTTACAATTACAGAT
AAAAGCATTCCCGAAAAAGAAAAGCTCGGTGCAGTAATCACAGCCCGTGT
TCATCCGGGTGAAACCAATTCTAGCTGGATGATGAAAGGACTTATACAAT
ATTTAATTGGAAATAGTGAGACGGCCAAAACTTTAAGGCGACGAATAGTA
TTTAAAATTGTACCGATGCTGAATCCAGATGGAGTAATAGTGGGAAATTA
CAGGTGCTCAACAGTTGGCAGGGATTTAAATCGAAATTACAGAAATCCCA
AAGAAGAAAGATTCCCAACAATATTTCATACAAAGAGATTGATAGAAGAT
TTGAAAAAGTCTTGCACAGTTGGTGTTTCAGTTGTCATTAAATATTTTTA
TGTGATTCAGGCGATGGCCCTATACTGCGATTTGCATGGGCATAGTAGGA
AGCATAACGTATTCATGTATGGCTGCGACTCGCAGTATTTACATTCGGAA
AATTTTAACGACATCAATCCTGTGTTAAACATCAACACTATCGAAGATTA
TATTAAAGATCGAATATTTACATTTTTAATGCAAAAAAATGGTCCAGAAA
CGTTTTCCTTTAATGGATGCCATTTTAAGATAAGGAAATGTAAAGAGTCA
ACTGGTAGAGTAGTCATGTGGAAACAATTCAATGTGAATGATAGCTACAC
TTTGGAAGCAACTTTCAGCGGAACAGATATAAATGATCGAAGGCATTTTA
ATATCAACGATTTAGAAAACATTGGTAAAATATTCAGTGAATCCTTGTTT
TCATATATATCAATTATGAAAGATGAACAACAACAGAAAGAAATAGGTCT
TGATTTATTGAAAGCAATACTAAAACAAATAGTTTCCAAAAGTAAAGCAA
TGAATCAACTATTCAGAAAATTGGTCAGTCAAACAACAGATCACATCGGG
TCGGAAGTATCTCTAACAAATAATATTCCGAAAGTTATCCCGTCAGATCT
ATTGGAAAATATAAATGAATTAAAAGATAACAGCCTGGACCTATTCATTG
ATAATCTTAAAATGGATGACATAAGCAATTGAAAGAAATTAACTTTGATG
TTTCAGATATTGAAGATTCTTCGTCATCAGATTCAGATAGCGATTCCCAG
CCAGGAGAAGAAATAATAGAGAATGAGCAGAAATTATCTGCAAAAGTCAA
AAAAAGAAAGAAAAAATCAAAAATCCAGATAAAAGAACTTTTAACCAAAA
AGCCTTTACTCAAAAAGCTTAGTTCGAAAATTCTCCCATCTATTAATAAA
GGGGAAAGTTCATCACCTGCAAATGAAATGAAAAATACAGAAAAGGGTTC
TATAAAAACCGAAGGTAATCAAGTAACCTCAGAGTTAGCCAAGAGCAGTC
GAGAAAAACATAATATTAATACACCTTTTCGACTCTCTCGAGAAATGACT
CGAATAAATGTTCCTTCTGGTAGCACTGAATCAAATATCGTAAATTCAAT
TCGCCAAAAAAATAATATGTCAAGTAGAAATTTATTAAAATCTTCAAGAA
GTTTATACACTAAAAAGCTACAGAATACTGAAAACTCTCTAAAGTGTGAA
GAATTCAAATTTGAAATTACTCACAAAATCTTCACCTTTGCGACAGTGGC
CAATTTTTTTGAGCAAATTCGATGGTCGTACAAATGGCGGAATTCCATGT
TTTACAGAAGAAAGGGTACTTGAAAGAGCACGAAGAAAATCATTGACTTC
AATTAGAAAGGACATAGAAGAATCTTTATTTAAAATTCCTTTTGAATATA
CTAATGAATATTTGGATAGAAAGCTAAACGCAGAAAACAGATTGTCCAGT
CTAATGCAAACATCGGAACTTCTAAATGAGCAGTATTGTAAACTTCAGAA
GCACTCTGATGAGATTTTGTTATATAGATTATATAAAAGTGATACAAGTG
AAGAATACTCAGAAAACAATAAAGAACGGATCTTACCGAAACCAGTATAT
AACACAAATAACCTCAAAGATATCCAAAAGTCCAGTGTAAAACAGCATAT
ACTTGTTAAAAACGAAGAAAGTCAAGCATTTAAGTCTCTAACCTTAGATT
CTCCAACACTGCCAACCAAAGAGATTGACAATAAATTCTTTTCAAGATGT
AAAAAACAATTTATAAAATATTCCTTACTAAAAAAATTGGAAAGTAAGAA
TCCAAATAAAAGTCATTTGATGTCCAGTAATTATGTAAAAATGTTTACAA
GGTCTCATAAAGATGTACAATCAGAGTTTTAGGCATGCTAAATATTGTAG
back to top

protein sequence of SMED30028343-orf-1

>SMED30028343-orf-1 ID=SMED30028343-orf-1|Name=SMED30028343-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=806bp
MAIKEQIENELNRRVREALDTPPMERWKRNQKEALLRKSSQETNKKNLNS
HIKFDSKERYKFRANLLNSTKCSENEQLEKKFENLNNSSSNEENISIEYN
KFEYWLKPQVQPSQLTSAGVLQKLDENNAINSLESKTLRTGFEAVQNFGS
LTLEEKEIFFSTFTKQGFREAMRTGKLPDGSKLEALANGEFRDKFGIVRS
KDGPFWPKDIGPLFPAPHHKIFQSSYEPLFDPLKDKETSKQAPPNGSHPA
GWKHMQIVYDSETYSRNQRPHQHSECESSSLIFESRFETGNLRQSRRTGQ
YEYELLLNNDLYTKRHTQWFYFRLQNMEKNVTYKFIIINLLKSKSLYEEG
MRILMYSDKNATTNSIGWYRTGHHIRYTRNFTRLQCPLLNREMAYFQLEF
QIEFQYSEDTCYLSHCYPYTFTDLKNDLRTFESNCNTKPLLKKDILCETN
IGNSCFLLTITDKSIPEKEKLGAVITARVHPGETNSSWMMKGLIQYLIGN
SETAKTLRRRIVFKIVPMLNPDGVIVGNYRCSTVGRDLNRNYRNPKEERF
PTIFHTKRLIEDLKKSCTVGVSVVIKYFYVIQAMALYCDLHGHSRKHNVF
MYGCDSQYLHSENFNDINPVLNINTIEDYIKDRIFTFLMQKNGPETFSFN
GCHFKIRKCKESTGRVVMWKQFNVNDSYTLEATFSGTDINDRRHFNINDL
ENIGKIFSESLFSYISIMKDEQQQKEIGLDLLKAILKQIVSKSKAMNQLF
RKLVSQTTDHIGSEVSLTNNIPKVIPSDLLENINELKDNSLDLFIDNLKM
DDISN*
back to top

protein sequence of SMED30028343-orf-2

>SMED30028343-orf-2 ID=SMED30028343-orf-2|Name=SMED30028343-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=132bp
MKNTEKGSIKTEGNQVTSELAKSSREKHNINTPFRLSREMTRINVPSGST
ESNIVNSIRQKNNMSSRNLLKSSRSLYTKKLQNTENSLKCEEFKFEITHK
IFTFATVANFFEQIRWSYKWRNSMFYRRKGT*
back to top

protein sequence of SMED30028343-orf-3

>SMED30028343-orf-3 ID=SMED30028343-orf-3|Name=SMED30028343-orf-3|organism=Schmidtea mediterranea sexual|type=polypeptide|length=143bp
MQTSELLNEQYCKLQKHSDEILLYRLYKSDTSEEYSENNKERILPKPVYN
TNNLKDIQKSSVKQHILVKNEESQAFKSLTLDSPTLPTKEIDNKFFSRCK
KQFIKYSLLKKLESKNPNKSHLMSSNYVKMFTRSHKDVQSEF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000106ciliated epithelial cell
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR040626Pepdidase_M14_N
IPR001138Zn2-C6_fun-type_DNA-bd
IPR000834Peptidase_M14
Vocabulary: molecular function
TermDefinition
GO:0000981RNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0008270zinc ion binding
GO:0004181metallocarboxypeptidase activity
GO:0004180carboxypeptidase activity
GO:0008233peptidase activity
GO:0008237metallopeptidase activity
GO:0016787hydrolase activity
GO:0046872metal ion binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005737cytoplasm
GO:0005829cytosol
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
GO:0006508proteolysis
GO:0035610protein side chain deglutamylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 75..95
NoneNo IPR availableGENE3DG3DSA:3.40.630.10coord: 426..719
e-value: 7.7E-72
score: 243.8
NoneNo IPR availableGENE3DG3DSA:2.60.40.3120coord: 268..397
e-value: 5.9E-13
score: 50.6
NoneNo IPR availablePANTHERPTHR12756ATP/GTP-BINDING MOTIF CONTAINING PROTEIN RELATEDcoord: 268..716
NoneNo IPR availablePANTHERPTHR12756:SF4coord: 268..716
NoneNo IPR availableCDDcd06907M14_AGBL2-3_likecoord: 441..715
e-value: 1.05101E-119
score: 359.303
NoneNo IPR availableSUPERFAMILYSSF53187Zn-dependent exopeptidasescoord: 409..718
IPR000834Peptidase M14, carboxypeptidase APFAMPF00246Peptidase_M14coord: 450..613
e-value: 4.8E-15
score: 56.1
IPR040626Cytosolic carboxypeptidase, N-terminalPFAMPF18027Pepdidase_M14_Ncoord: 283..414
e-value: 2.4E-14
score: 53.6