Potassium voltage-gated channel protein Shaw

Overview
NamePotassium voltage-gated channel protein Shaw
Smed IDSMED30028339
Length (bp)918
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30028339

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30028339SMESG000025883.1 dd_Smed_v4_50723_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30028339SMESG000025883.1 dd_Smed_v4_50723_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Human
Match: KCNC1 (potassium voltage-gated channel subfamily C member 1 [Source:HGNC Symbol;Acc:HGNC:6233])

HSP 1 Score: 98.5969 bits (244), Expect = 1.726e-22
Identity = 85/334 (25.45%), Postives = 142/334 (42.51%), Query Frame = 3
Query:   21 DPDSTVIVNVRGKRFELLWSTLKKLPD------LENAIRIRGIYRKSLQEYFFDRDPDVFKCLLNYCRLGELHVPSTICGPIFTKELHAWGIMKVDNIEYCCLM------------------GINNSLMRLENLRKFDNMFPESNTEI-----------GTDYDKFVRFRLFVWNILDQPTSSSFALIYAIILYLTVLGSLFVFITDSVDHPTFSTPFTDVDYSIKYGWTSQQLSEILSWPNATKILNEKKRTIQMNAIFIATNS--FLTFDMVARMIFTTKFCSFIMNPYTIIDILSLIPFYYNLIDTVSHSKRSINVAFFSQSNDLIRLLSL 911
            D    +++NV G R +   STL+ LP        E        Y     E+FFDR P VF  +LNY R G+LH P+ +CGP++ +EL  WGI + D +E CC M                   ++NS    +     D+   E   E+           G     + R++  +W + + P SS +A   A      +L S+  F  ++  H  F+ P  +              +EI +  N T++   ++   +    +I      + TF+ + R+IF      FI N   IID ++++PFY  +  +   SK + +V  F +    +R+L +
Sbjct:    5 DESERIVINVGGTRHQTYRSTLRTLPGTRLAWLAEPDAHSHFDYDPRADEFFFDRHPGVFAHILNYYRTGKLHCPADVCGPLYEEELAFWGIDETD-VEPCCWMTYRQHRDAEEALDSFGGAPLDNSADDADADGPGDSGDGEDELEMTKRLALSDSPDGRPGGFWRRWQPRIWALFEDPYSSRYARYVAFASLFFILVSITTFCLET--HERFN-PIVNK-------------TEIENVRNGTQVRYYREAETEAFLTYIEGVCVVWFTFEFLMRVIFCPNKVEFIKNSLNIIDFVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRILRI 321          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Human
Match: KCNC1 (potassium voltage-gated channel subfamily C member 1 [Source:HGNC Symbol;Acc:HGNC:6233])

HSP 1 Score: 98.9821 bits (245), Expect = 1.942e-22
Identity = 85/334 (25.45%), Postives = 142/334 (42.51%), Query Frame = 3
Query:   21 DPDSTVIVNVRGKRFELLWSTLKKLPD------LENAIRIRGIYRKSLQEYFFDRDPDVFKCLLNYCRLGELHVPSTICGPIFTKELHAWGIMKVDNIEYCCLM------------------GINNSLMRLENLRKFDNMFPESNTEI-----------GTDYDKFVRFRLFVWNILDQPTSSSFALIYAIILYLTVLGSLFVFITDSVDHPTFSTPFTDVDYSIKYGWTSQQLSEILSWPNATKILNEKKRTIQMNAIFIATNS--FLTFDMVARMIFTTKFCSFIMNPYTIIDILSLIPFYYNLIDTVSHSKRSINVAFFSQSNDLIRLLSL 911
            D    +++NV G R +   STL+ LP        E        Y     E+FFDR P VF  +LNY R G+LH P+ +CGP++ +EL  WGI + D +E CC M                   ++NS    +     D+   E   E+           G     + R++  +W + + P SS +A   A      +L S+  F  ++  H  F+ P  +              +EI +  N T++   ++   +    +I      + TF+ + R+IF      FI N   IID ++++PFY  +  +   SK + +V  F +    +R+L +
Sbjct:    5 DESERIVINVGGTRHQTYRSTLRTLPGTRLAWLAEPDAHSHFDYDPRADEFFFDRHPGVFAHILNYYRTGKLHCPADVCGPLYEEELAFWGIDETD-VEPCCWMTYRQHRDAEEALDSFGGAPLDNSADDADADGPGDSGDGEDELEMTKRLALSDSPDGRPGGFWRRWQPRIWALFEDPYSSRYARYVAFASLFFILVSITTFCLET--HERFN-PIVNK-------------TEIENVRNGTQVRYYREAETEAFLTYIEGVCVVWFTFEFLMRVIFCPNKVEFIKNSLNIIDFVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRILRI 321          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Human
Match: KCND3 (potassium voltage-gated channel subfamily D member 3 [Source:HGNC Symbol;Acc:HGNC:6239])

HSP 1 Score: 90.8929 bits (224), Expect = 8.987e-20
Identity = 69/271 (25.46%), Postives = 131/271 (48.34%), Query Frame = 3
Query:   27 DSTVIVNVRGKRFELLWSTLKKLPD-LENAIRIRGIYRKSLQEYFFDRDPDVFKCLLNYCRLGELHVPSTICGPIFTKELHAWGIMKVDNIEYCCLMGINNSLMRLENLRKFDNMFPESNTEIGTDYDKFVRFRLFVWNILDQPTSSSFALIYAIILYLTVLGSLFVFITDSVDHPTFSTPFTDVDYSIKYGWTSQQLSEILSWPNATKILNEKKRTIQMNAIFIATNSFLTFDMVARMIFTTKFCSFIMNPYTIIDILSLIPFYYNLIDT 836
            D  +++NV G+RF+   +TL++ PD L  +      + +  +EYFFDRDP+VF+C+LN+ R G+LH P   C   +  EL  +GI+  + I  CC     +   + EN  +   +  ++++E   +    + FR  +W   + P +S+ AL++    Y+T       FI  SV         T+V  ++  G          + P + ++   ++ ++    +  A     T + + R+        FI +  +IID+++++P+Y  L+ T
Sbjct:   39 DELIVLNVSGRRFQTWRTTLERYPDTLLGSTEKEFFFNEDTKEYFFDRDPEVFRCVLNFYRTGKLHYPRYECISAYDDELAFYGILP-EIIGDCCYEEYKDR--KRENAER---LMDDNDSENNQESMPSLSFRQTMWRAFENPHTSTLALVF---YYVTGF-----FIAVSV--------ITNVVETVPCG----------TVPGSKELPCGERYSVAFFCLDTACVMIFTVEYLLRLFAAPSRYRFIRSVMSIIDVVAIMPYYIGLVMT 277          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Human
Match: KCND3 (potassium voltage-gated channel subfamily D member 3 [Source:HGNC Symbol;Acc:HGNC:6239])

HSP 1 Score: 90.8929 bits (224), Expect = 8.987e-20
Identity = 69/271 (25.46%), Postives = 131/271 (48.34%), Query Frame = 3
Query:   27 DSTVIVNVRGKRFELLWSTLKKLPD-LENAIRIRGIYRKSLQEYFFDRDPDVFKCLLNYCRLGELHVPSTICGPIFTKELHAWGIMKVDNIEYCCLMGINNSLMRLENLRKFDNMFPESNTEIGTDYDKFVRFRLFVWNILDQPTSSSFALIYAIILYLTVLGSLFVFITDSVDHPTFSTPFTDVDYSIKYGWTSQQLSEILSWPNATKILNEKKRTIQMNAIFIATNSFLTFDMVARMIFTTKFCSFIMNPYTIIDILSLIPFYYNLIDT 836
            D  +++NV G+RF+   +TL++ PD L  +      + +  +EYFFDRDP+VF+C+LN+ R G+LH P   C   +  EL  +GI+  + I  CC     +   + EN  +   +  ++++E   +    + FR  +W   + P +S+ AL++    Y+T       FI  SV         T+V  ++  G          + P + ++   ++ ++    +  A     T + + R+        FI +  +IID+++++P+Y  L+ T
Sbjct:   39 DELIVLNVSGRRFQTWRTTLERYPDTLLGSTEKEFFFNEDTKEYFFDRDPEVFRCVLNFYRTGKLHYPRYECISAYDDELAFYGILP-EIIGDCCYEEYKDR--KRENAER---LMDDNDSENNQESMPSLSFRQTMWRAFENPHTSTLALVF---YYVTGF-----FIAVSV--------ITNVVETVPCG----------TVPGSKELPCGERYSVAFFCLDTACVMIFTVEYLLRLFAAPSRYRFIRSVMSIIDVVAIMPYYIGLVMT 277          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Human
Match: KCND3 (potassium voltage-gated channel subfamily D member 3 [Source:HGNC Symbol;Acc:HGNC:6239])

HSP 1 Score: 90.8929 bits (224), Expect = 9.568e-20
Identity = 69/271 (25.46%), Postives = 131/271 (48.34%), Query Frame = 3
Query:   27 DSTVIVNVRGKRFELLWSTLKKLPD-LENAIRIRGIYRKSLQEYFFDRDPDVFKCLLNYCRLGELHVPSTICGPIFTKELHAWGIMKVDNIEYCCLMGINNSLMRLENLRKFDNMFPESNTEIGTDYDKFVRFRLFVWNILDQPTSSSFALIYAIILYLTVLGSLFVFITDSVDHPTFSTPFTDVDYSIKYGWTSQQLSEILSWPNATKILNEKKRTIQMNAIFIATNSFLTFDMVARMIFTTKFCSFIMNPYTIIDILSLIPFYYNLIDT 836
            D  +++NV G+RF+   +TL++ PD L  +      + +  +EYFFDRDP+VF+C+LN+ R G+LH P   C   +  EL  +GI+  + I  CC     +   + EN  +   +  ++++E   +    + FR  +W   + P +S+ AL++    Y+T       FI  SV         T+V  ++  G          + P + ++   ++ ++    +  A     T + + R+        FI +  +IID+++++P+Y  L+ T
Sbjct:   39 DELIVLNVSGRRFQTWRTTLERYPDTLLGSTEKEFFFNEDTKEYFFDRDPEVFRCVLNFYRTGKLHYPRYECISAYDDELAFYGILP-EIIGDCCYEEYKDR--KRENAER---LMDDNDSENNQESMPSLSFRQTMWRAFENPHTSTLALVF---YYVTGF-----FIAVSV--------ITNVVETVPCG----------TVPGSKELPCGERYSVAFFCLDTACVMIFTVEYLLRLFAAPSRYRFIRSVMSIIDVVAIMPYYIGLVMT 277          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Celegans
Match: shw-1 (SHaW family of potassium channels [Source:UniProtKB/TrEMBL;Acc:Q8I4L3])

HSP 1 Score: 126.331 bits (316), Expect = 2.506e-32
Identity = 99/325 (30.46%), Postives = 157/325 (48.31%), Query Frame = 3
Query:   21 DPDSTVIVNVRGKRFELLWSTLKKLPDLENAIRIRGI------YRKSLQEYFFDRDPDVFKCLLNYCRLGELHVPSTICGPIFTKELHAWGIMKVDNIEYCCLM------GINNSLMRLENLRKFDNMFPESNTEIGTDYD-----------KFVRFRLFVWNILDQPTSSSFALIYAIILYLTVLGSLFVFITDSVDHPTFSTPFTDVDYSIKYGWTSQQLSEILSWPNATKILNEKKRTIQMNAIF---IATNSFLTFDMVARMIFTTKFCSFIMNPYTIIDILSLIPFY--YNLIDTVSHSKRSINVAFFSQSNDLIRLLSL 911
            D +  VI+NV G R E     LKK+P    A R+  +      Y   L EYFFDR P VF  +LNY R G+LH P+ +CGP+F +EL  WG +  + +E CC M         ++L  +E+L    +  P +  EI   +            ++ R +  VW + D+P SS +A + +++  + V+ S+  F   +  HP+F  P  D+D S   G  S  L+ +        I   K  T    + F   + +N + + + + RM+F     +F+  P  +ID ++ + FY  + L  T+S S R  +V FFS    +IR+L L
Sbjct:   98 DTEHRVILNVGGIRHETYSHVLKKIP----ATRLSRLTPNLANYDPVLNEYFFDRHPGVFSMILNYYRTGKLHYPTNVCGPLFEEELEFWG-LDANQVEPCCWMTYTQHRDTQDTLAVIESLDLDGD--PPTQEEIAKKFGWEDDYYTGNMSQWQRLKPRVWALFDEPWSSKYARVISVVNIIFVIISIVCFCLKT--HPSFRIP--DIDISTTMGNFSAPLNGV----QMNNIYVGKTATRAHPSFFYVELLSNIWFSGEFLTRMVFCPNVATFLRTPVNLIDFIATVSFYIDWALDRTLSGSNRD-SVEFFS----IIRILRL 402          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Celegans
Match: shw-1 (SHaW family of potassium channels [Source:UniProtKB/TrEMBL;Acc:Q8I4L3])

HSP 1 Score: 120.168 bits (300), Expect = 1.870e-30
Identity = 88/301 (29.24%), Postives = 141/301 (46.84%), Query Frame = 3
Query:    3 QQKDLTDPDSTVIVNVRGKRFELLWSTLKKLPDLENAIRIRGI------YRKSLQEYFFDRDPDVFKCLLNYCRLGELHVPSTICGPIFTKELHAWGIMKVDNIEYCCLM------GINNSLMRLENLRKFDNMFPESNTEIGTDYD-----------KFVRFRLFVWNILDQPTSSSFALIYAIILYLTVLGSLFVFITDSVDHPTFSTPFTDVDYSIKYGWTSQQLSEILSWPNATKILNEKKRTIQMNAIF----IATNSFLTFDMVARMIFTTKFCSFIMNPYTIIDILSLIPFYYN 824
            + K   D +  VI+NV G R E     LKK+P    A R+  +      Y   L EYFFDR P VF  +LNY R G+LH P+ +CGP+F +EL  WG +  + +E CC M         ++L  +E+L    +  P +  EI   +            ++ R +  VW + D+P SS +A + + +    +L S   FI  +   P+F  P  DV YS++       + +   + N  K +   K     +  F    +  N + T +++ R +F   F  F+ +P TIID++S   F++ 
Sbjct:   13 KTKSWMDTEHRVILNVGGIRHETYSHVLKKIP----ATRLSRLTPNLANYDPVLNEYFFDRHPGVFSMILNYYRTGKLHYPTNVCGPLFEEELEFWG-LDANQVEPCCWMTYTQHRDTQDTLAVIESLDLDGD--PPTQEEIAKKFGWEDDYYTGNMSQWQRLKPRVWALFDEPWSSKYARVISSLSVAFILASTCSFILKT--DPSFQIPDIDVFYSLR-------VVDEGGFKNYHKTIGTDKPVTSPHPNFFYVDLICNIWFTIELLIRSLFCPSFHKFVRSPLTIIDVISTGAFFFE 297          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Celegans
Match: shw-1 (SHaW family of potassium channels [Source:UniProtKB/TrEMBL;Acc:Q8I4L3])

HSP 1 Score: 119.398 bits (298), Expect = 2.986e-30
Identity = 87/301 (28.90%), Postives = 142/301 (47.18%), Query Frame = 3
Query:    3 QQKDLTDPDSTVIVNVRGKRFELLWSTLKKLPDLENAIRIRGI------YRKSLQEYFFDRDPDVFKCLLNYCRLGELHVPSTICGPIFTKELHAWGIMKVDNIEYCCLM------GINNSLMRLENLRKFDNMFPESNTEIGTDY-----------DKFVRFRLFVWNILDQPTSSSFALIYAIILYLTVLGSLFVFITDSVDHPTFSTPFTDVDYSIKYGWTSQQLSEILSWPNATKILNEKKRTIQMNAIF----IATNSFLTFDMVARMIFTTKFCSFIMNPYTIIDILSLIPFYYN 824
            +++   D +  VI+NV G R E     LKK+P    A R+  +      Y   L EYFFDR P VF  +LNY R G+LH P+ +CGP+F +EL  WG +  + +E CC M         ++L  +E+L    +  P +  EI   +            ++ R +  VW + D+P SS +A + + +    +L S   FI  +   P+F  P  DV YS++       + +   + N  K +   K     +  F    +  N + T +++ R +F   F  F+ +P TIID++S   F++ 
Sbjct:    6 RKESWMDTEHRVILNVGGIRHETYSHVLKKIP----ATRLSRLTPNLANYDPVLNEYFFDRHPGVFSMILNYYRTGKLHYPTNVCGPLFEEELEFWG-LDANQVEPCCWMTYTQHRDTQDTLAVIESLDLDGD--PPTQEEIAKKFGWEDDYYTGNMSQWQRLKPRVWALFDEPWSSKYARVISSLSVAFILASTCSFILKT--DPSFQIPDIDVFYSLR-------VVDEGGFKNYHKTIGTDKPVTSPHPNFFYVDLICNIWFTIELLIRSLFCPSFHKFVRSPLTIIDVISTGAFFFE 290          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Celegans
Match: shw-1 (SHaW family of potassium channels [Source:UniProtKB/TrEMBL;Acc:Q8I4L3])

HSP 1 Score: 119.398 bits (298), Expect = 3.652e-30
Identity = 87/301 (28.90%), Postives = 142/301 (47.18%), Query Frame = 3
Query:    3 QQKDLTDPDSTVIVNVRGKRFELLWSTLKKLPDLENAIRIRGI------YRKSLQEYFFDRDPDVFKCLLNYCRLGELHVPSTICGPIFTKELHAWGIMKVDNIEYCCLM------GINNSLMRLENLRKFDNMFPESNTEIGTDY-----------DKFVRFRLFVWNILDQPTSSSFALIYAIILYLTVLGSLFVFITDSVDHPTFSTPFTDVDYSIKYGWTSQQLSEILSWPNATKILNEKKRTIQMNAIF----IATNSFLTFDMVARMIFTTKFCSFIMNPYTIIDILSLIPFYYN 824
            +++   D +  VI+NV G R E     LKK+P    A R+  +      Y   L EYFFDR P VF  +LNY R G+LH P+ +CGP+F +EL  WG +  + +E CC M         ++L  +E+L    +  P +  EI   +            ++ R +  VW + D+P SS +A + + +    +L S   FI  +   P+F  P  DV YS++       + +   + N  K +   K     +  F    +  N + T +++ R +F   F  F+ +P TIID++S   F++ 
Sbjct:   19 RRESWMDTEHRVILNVGGIRHETYSHVLKKIP----ATRLSRLTPNLANYDPVLNEYFFDRHPGVFSMILNYYRTGKLHYPTNVCGPLFEEELEFWG-LDANQVEPCCWMTYTQHRDTQDTLAVIESLDLDGD--PPTQEEIAKKFGWEDDYYTGNMSQWQRLKPRVWALFDEPWSSKYARVISSLSVAFILASTCSFILKT--DPSFQIPDIDVFYSLR-------VVDEGGFKNYHKTIGTDKPVTSPHPNFFYVDLICNIWFTIELLIRSLFCPSFHKFVRSPLTIIDVISTGAFFFE 303          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Celegans
Match: shw-1 (SHaW family of potassium channels [Source:UniProtKB/TrEMBL;Acc:Q8I4L3])

HSP 1 Score: 119.013 bits (297), Expect = 4.080e-30
Identity = 87/295 (29.49%), Postives = 139/295 (47.12%), Query Frame = 3
Query:   21 DPDSTVIVNVRGKRFELLWSTLKKLPDLENAIRIRGI------YRKSLQEYFFDRDPDVFKCLLNYCRLGELHVPSTICGPIFTKELHAWGIMKVDNIEYCCLM------GINNSLMRLENLRKFDNMFPESNTEIGTDY-----------DKFVRFRLFVWNILDQPTSSSFALIYAIILYLTVLGSLFVFITDSVDHPTFSTPFTDVDYSIKYGWTSQQLSEILSWPNATKILNEKKRTIQMNAIF----IATNSFLTFDMVARMIFTTKFCSFIMNPYTIIDILSLIPFYYN 824
            D +  VI+NV G R E     LKK+P    A R+  +      Y   L EYFFDR P VF  +LNY R G+LH P+ +CGP+F +EL  WG +  + +E CC M         ++L  +E+L    +  P +  EI   +            ++ R +  VW + D+P SS +A + + +    +L S   FI  +   P+F  P  DV YS++       + +   + N  K +   K     +  F    +  N + T +++ R +F   F  F+ +P TIID++S   F++ 
Sbjct:    2 DTEHRVILNVGGIRHETYSHVLKKIP----ATRLSRLTPNLANYDPVLNEYFFDRHPGVFSMILNYYRTGKLHYPTNVCGPLFEEELEFWG-LDANQVEPCCWMTYTQHRDTQDTLAVIESLDLDGD--PPTQEEIAKKFGWEDDYYTGNMSQWQRLKPRVWALFDEPWSSKYARVISSLSVAFILASTCSFILKT--DPSFQIPDIDVFYSLR-------VVDEGGFKNYHKTIGTDKPVTSPHPNFFYVDLICNIWFTIELLIRSLFCPSFHKFVRSPLTIIDVISTGAFFFE 280          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Fly
Match: Shaw (gene:FBgn0003386 transcript:FBtr0089274)

HSP 1 Score: 105.531 bits (262), Expect = 3.466e-25
Identity = 89/318 (27.99%), Postives = 144/318 (45.28%), Query Frame = 3
Query:   21 DPDSTVIVNVRGKRFELLWSTLKKLPD--LENAIRIRGIYRKSLQEYFFDRDPDVFKCLLNYCRLGELHVPSTICGPIFTKELHAWGIMKVDNIEYCCLMGINNSLMRLENLRKFDNM----FPESNTEIG------TDYDK-----FVRFRLFVWNILDQPTSSSFALIYAIILYLTVLGSLFVFITDSVDHPTFSTPFTDVDYSIKYGWTSQQLSEILSWPNATKILNEKKRTIQMNAIFI--ATNSFLTFDMVARMIFTTKFCSFIMNPYTIIDILSLIPFYYNLI--DTVSHSKRSINVAFFSQSNDLIRLLSL 911
            D ++ V++NV G R E   +TLKK+P   L         Y   L EYFFDR P VF  +LNY R G+LH P+ +CGP+F +EL  WG +  + +E CC M         E L   D +       S  E+        DY K     +   +  +W++ D+P SS+ A    ++    +  S+  F   +  HP    P    + ++K    S        W      L++ +    +   +I    N++ TF+++ R I +     FI +   IID ++ + FY +L+     SH + +  + FFS    +IR++ L
Sbjct:    7 DSENRVVLNVGGIRHETYKATLKKIPATRLSRLTEALANYDPILNEYFFDRHPGVFAQVLNYYRTGKLHYPTDVCGPLFEEELEFWG-LDSNQVEPCCWMTYTQHRDTQETLAVLDRLDLDTEKPSEEELARKFGFEEDYYKGTISWWQEMKPRIWSLFDEPYSSNAAKTIGVVSVFFICISILSFCLKT--HPDMRVPIVR-NITVKTANGSN------GW-----FLDKTQTNAHIAFFYIECVCNAWFTFEILVRFISSPNKWEFIKSSVNIIDYIATLSFYIDLVLQRFASHLENADILEFFS----IIRIMRL 305          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Fly
Match: Shaw (gene:FBgn0003386 transcript:FBtr0332184)

HSP 1 Score: 105.531 bits (262), Expect = 3.552e-25
Identity = 89/318 (27.99%), Postives = 144/318 (45.28%), Query Frame = 3
Query:   21 DPDSTVIVNVRGKRFELLWSTLKKLPD--LENAIRIRGIYRKSLQEYFFDRDPDVFKCLLNYCRLGELHVPSTICGPIFTKELHAWGIMKVDNIEYCCLMGINNSLMRLENLRKFDNM----FPESNTEIG------TDYDK-----FVRFRLFVWNILDQPTSSSFALIYAIILYLTVLGSLFVFITDSVDHPTFSTPFTDVDYSIKYGWTSQQLSEILSWPNATKILNEKKRTIQMNAIFI--ATNSFLTFDMVARMIFTTKFCSFIMNPYTIIDILSLIPFYYNLI--DTVSHSKRSINVAFFSQSNDLIRLLSL 911
            D ++ V++NV G R E   +TLKK+P   L         Y   L EYFFDR P VF  +LNY R G+LH P+ +CGP+F +EL  WG +  + +E CC M         E L   D +       S  E+        DY K     +   +  +W++ D+P SS+ A    ++    +  S+  F   +  HP    P    + ++K    S        W      L++ +    +   +I    N++ TF+++ R I +     FI +   IID ++ + FY +L+     SH + +  + FFS    +IR++ L
Sbjct:    7 DSENRVVLNVGGIRHETYKATLKKIPATRLSRLTEALANYDPILNEYFFDRHPGVFAQVLNYYRTGKLHYPTDVCGPLFEEELEFWG-LDSNQVEPCCWMTYTQHRDTQETLAVLDRLDLDTEKPSEEELARKFGFEEDYYKGTISWWQEMKPRIWSLFDEPYSSNAAKTIGVVSVFFICISILSFCLKT--HPDMRVPIVR-NITVKTANGSN------GW-----FLDKTQTNAHIAFFYIECVCNAWFTFEILVRFISSPNKWEFIKSSVNIIDYIATLSFYIDLVLQRFASHLENADILEFFS----IIRIMRL 305          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Fly
Match: Shaw (gene:FBgn0003386 transcript:FBtr0089275)

HSP 1 Score: 104.76 bits (260), Expect = 9.083e-25
Identity = 89/318 (27.99%), Postives = 144/318 (45.28%), Query Frame = 3
Query:   21 DPDSTVIVNVRGKRFELLWSTLKKLPD--LENAIRIRGIYRKSLQEYFFDRDPDVFKCLLNYCRLGELHVPSTICGPIFTKELHAWGIMKVDNIEYCCLMGINNSLMRLENLRKFDNM----FPESNTEIG------TDYDK-----FVRFRLFVWNILDQPTSSSFALIYAIILYLTVLGSLFVFITDSVDHPTFSTPFTDVDYSIKYGWTSQQLSEILSWPNATKILNEKKRTIQMNAIFI--ATNSFLTFDMVARMIFTTKFCSFIMNPYTIIDILSLIPFYYNLI--DTVSHSKRSINVAFFSQSNDLIRLLSL 911
            D ++ V++NV G R E   +TLKK+P   L         Y   L EYFFDR P VF  +LNY R G+LH P+ +CGP+F +EL  WG +  + +E CC M         E L   D +       S  E+        DY K     +   +  +W++ D+P SS+ A    ++    +  S+  F   +  HP    P    + ++K    S        W      L++ +    +   +I    N++ TF+++ R I +     FI +   IID ++ + FY +L+     SH + +  + FFS    +IR++ L
Sbjct:    7 DSENRVVLNVGGIRHETYKATLKKIPATRLSRLTEALANYDPILNEYFFDRHPGVFAQVLNYYRTGKLHYPTDVCGPLFEEELEFWG-LDSNQVEPCCWMTYTQHRDTQETLAVLDRLDLDTEKPSEEELARKFGFEEDYYKGTISWWQEMKPRIWSLFDEPYSSNAAKTIGVVSVFFICISILSFCLKT--HPDMRVPIVR-NITVKTANGSN------GW-----FLDKTQTNAHIAFFYIECVCNAWFTFEILVRFISSPNKWEFIKSSVNIIDYIATLSFYIDLVLQRFASHLENADILEFFS----IIRIMRL 305          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Fly
Match: Shaw (gene:FBgn0003386 transcript:FBtr0332185)

HSP 1 Score: 104.76 bits (260), Expect = 9.235e-25
Identity = 89/318 (27.99%), Postives = 144/318 (45.28%), Query Frame = 3
Query:   21 DPDSTVIVNVRGKRFELLWSTLKKLPD--LENAIRIRGIYRKSLQEYFFDRDPDVFKCLLNYCRLGELHVPSTICGPIFTKELHAWGIMKVDNIEYCCLMGINNSLMRLENLRKFDNM----FPESNTEIG------TDYDK-----FVRFRLFVWNILDQPTSSSFALIYAIILYLTVLGSLFVFITDSVDHPTFSTPFTDVDYSIKYGWTSQQLSEILSWPNATKILNEKKRTIQMNAIFI--ATNSFLTFDMVARMIFTTKFCSFIMNPYTIIDILSLIPFYYNLI--DTVSHSKRSINVAFFSQSNDLIRLLSL 911
            D ++ V++NV G R E   +TLKK+P   L         Y   L EYFFDR P VF  +LNY R G+LH P+ +CGP+F +EL  WG +  + +E CC M         E L   D +       S  E+        DY K     +   +  +W++ D+P SS+ A    ++    +  S+  F   +  HP    P    + ++K    S        W      L++ +    +   +I    N++ TF+++ R I +     FI +   IID ++ + FY +L+     SH + +  + FFS    +IR++ L
Sbjct:    7 DSENRVVLNVGGIRHETYKATLKKIPATRLSRLTEALANYDPILNEYFFDRHPGVFAQVLNYYRTGKLHYPTDVCGPLFEEELEFWG-LDSNQVEPCCWMTYTQHRDTQETLAVLDRLDLDTEKPSEEELARKFGFEEDYYKGTISWWQEMKPRIWSLFDEPYSSNAAKTIGVVSVFFICISILSFCLKT--HPDMRVPIVR-NITVKTANGSN------GW-----FLDKTQTNAHIAFFYIECVCNAWFTFEILVRFISSPNKWEFIKSSVNIIDYIATLSFYIDLVLQRFASHLENADILEFFS----IIRIMRL 305          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Fly
Match: Shaw (gene:FBgn0003386 transcript:FBtr0289989)

HSP 1 Score: 104.76 bits (260), Expect = 9.416e-25
Identity = 89/318 (27.99%), Postives = 144/318 (45.28%), Query Frame = 3
Query:   21 DPDSTVIVNVRGKRFELLWSTLKKLPD--LENAIRIRGIYRKSLQEYFFDRDPDVFKCLLNYCRLGELHVPSTICGPIFTKELHAWGIMKVDNIEYCCLMGINNSLMRLENLRKFDNM----FPESNTEIG------TDYDK-----FVRFRLFVWNILDQPTSSSFALIYAIILYLTVLGSLFVFITDSVDHPTFSTPFTDVDYSIKYGWTSQQLSEILSWPNATKILNEKKRTIQMNAIFI--ATNSFLTFDMVARMIFTTKFCSFIMNPYTIIDILSLIPFYYNLI--DTVSHSKRSINVAFFSQSNDLIRLLSL 911
            D ++ V++NV G R E   +TLKK+P   L         Y   L EYFFDR P VF  +LNY R G+LH P+ +CGP+F +EL  WG +  + +E CC M         E L   D +       S  E+        DY K     +   +  +W++ D+P SS+ A    ++    +  S+  F   +  HP    P    + ++K    S        W      L++ +    +   +I    N++ TF+++ R I +     FI +   IID ++ + FY +L+     SH + +  + FFS    +IR++ L
Sbjct:   22 DSENRVVLNVGGIRHETYKATLKKIPATRLSRLTEALANYDPILNEYFFDRHPGVFAQVLNYYRTGKLHYPTDVCGPLFEEELEFWG-LDSNQVEPCCWMTYTQHRDTQETLAVLDRLDLDTEKPSEEELARKFGFEEDYYKGTISWWQEMKPRIWSLFDEPYSSNAAKTIGVVSVFFICISILSFCLKT--HPDMRVPIVR-NITVKTANGSN------GW-----FLDKTQTNAHIAFFYIECVCNAWFTFEILVRFISSPNKWEFIKSSVNIIDYIATLSFYIDLVLQRFASHLENADILEFFS----IIRIMRL 320          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Zebrafish
Match: kcnc2 (potassium voltage-gated channel, Shaw-related subfamily, member 2 [Source:ZFIN;Acc:ZDB-GENE-070410-118])

HSP 1 Score: 109.768 bits (273), Expect = 1.901e-26
Identity = 98/329 (29.79%), Postives = 147/329 (44.68%), Query Frame = 3
Query:   21 DPDSTVIVNVRGKRFELLWSTLKKLP-----------DLENAI----RIRGI--YRKSLQEYFFDRDPDVFKCLLNYCRLGELHVPSTICGPIFTKELHAWGIMKVDNIEYCCLMGINNSLMRLENLRKFD-NMFPESNTEIG------------TDYDKFVRFRLFVWNILDQPTSSSFALIYAIILYLTVLGSLFVFITDSVDHPTFSTPFTDVDYSIKYGWT--SQQLSEILSWPNATKILNEKKRTIQMNAIFIATNSFLTFDMVARMIFTTKFCSFIMNPYTIIDILSLIPFYYNLIDTVSHSKRSINVAFFSQSNDLIRLLSL 911
            D    VI+NV G R E   STLK LP           DLE  +    ++ G   Y     EYFFDR P VF  +LNY R G+LH P+ +CGP+F +EL  WGI + D +E CC M         E L  F+ N+  E + E G                ++ R++  +WN+ D P SS  A   A      ++ S+  F  ++  H  F+T     D       T  SQQ  EI + P  T +            + +    + TF+ + R+ F+     FI +   IID ++++PFY  +  +   SK + +V  F +    +R+L +
Sbjct:    5 DERERVILNVGGTRHETYRSTLKTLPGTRLALLASESDLELVLDQLQQVPGFIEYSARSNEYFFDRHPGVFAYVLNYYRTGKLHCPADVCGPLFEEELSFWGIDETD-VEPCCWMTYRQHRDAEEALDVFEMNVDTEEDDEYGKRLGIEDVVSADGTVSRWRRWQPVIWNLFDDPYSSRAARFIAFASLFFIMVSITTFCLET--HEAFNTIINKTDPLRNETLTDISQQY-EIETDPALTYV----------EGVCVL---WFTFEFLVRITFSPDKLEFIKSVLNIIDFVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRILRI 316          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Zebrafish
Match: kcnc2 (potassium voltage-gated channel, Shaw-related subfamily, member 2 [Source:ZFIN;Acc:ZDB-GENE-070410-118])

HSP 1 Score: 109.383 bits (272), Expect = 2.810e-26
Identity = 98/329 (29.79%), Postives = 147/329 (44.68%), Query Frame = 3
Query:   21 DPDSTVIVNVRGKRFELLWSTLKKLP-----------DLENAI----RIRGI--YRKSLQEYFFDRDPDVFKCLLNYCRLGELHVPSTICGPIFTKELHAWGIMKVDNIEYCCLMGINNSLMRLENLRKFD-NMFPESNTEIG------------TDYDKFVRFRLFVWNILDQPTSSSFALIYAIILYLTVLGSLFVFITDSVDHPTFSTPFTDVDYSIKYGWT--SQQLSEILSWPNATKILNEKKRTIQMNAIFIATNSFLTFDMVARMIFTTKFCSFIMNPYTIIDILSLIPFYYNLIDTVSHSKRSINVAFFSQSNDLIRLLSL 911
            D    VI+NV G R E   STLK LP           DLE  +    ++ G   Y     EYFFDR P VF  +LNY R G+LH P+ +CGP+F +EL  WGI + D +E CC M         E L  F+ N+  E + E G                ++ R++  +WN+ D P SS  A   A      ++ S+  F  ++  H  F+T     D       T  SQQ  EI + P  T +            + +    + TF+ + R+ F+     FI +   IID ++++PFY  +  +   SK + +V  F +    +R+L +
Sbjct:    5 DERERVILNVGGTRHETYRSTLKTLPGTRLALLASESDLELVLDQLQQVPGFIEYSARSNEYFFDRHPGVFAYVLNYYRTGKLHCPADVCGPLFEEELSFWGIDETD-VEPCCWMTYRQHRDAEEALDVFEMNVDTEEDDEYGKRLGIEDVVSADGTVSRWRRWQPVIWNLFDDPYSSRAARFIAFASLFFIMVSITTFCLET--HEAFNTIINKTDPLRNETLTDISQQY-EIETDPALTYV----------EGVCVL---WFTFEFLVRITFSPDKLEFIKSVLNIIDFVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRILRI 316          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Zebrafish
Match: kcnc3b (potassium voltage-gated channel, Shaw-related subfamily, member 3b [Source:ZFIN;Acc:ZDB-GENE-100901-2])

HSP 1 Score: 104.375 bits (259), Expect = 1.633e-24
Identity = 90/340 (26.47%), Postives = 143/340 (42.06%), Query Frame = 3
Query:   12 DLTDPDST--VIVNVRGKRFELLWSTLKKLPDLENAIRIRGI----------YRKSLQEYFFDRDPDVFKCLLNYCRLGELHVPSTICGPIFTKELHAWGIMKVDNIEYCCLMGINNSLMRLENLRKFDNMFPESN-----------------TEIGTDYDKFVRFRLFVWNILDQPTSSSFALIYAIILYLTVLGSLFVFITDSVDHPTFSTPFTDVDYSIKYGWTSQQLSEILSWPNATKILNEKKRTIQMNAIFIATNSFLTF-----------DMVARMIFTTKFCSFIMNPYTIIDILSLIPFYYNLIDTVSHSKRSINVAFFSQSNDLIRLLSL 911
            D+T P  +  +++N  G R E   STLK LP      R+  +          Y     E+FFDR P VF  +LNY R G+LH P+ +CGP+F +EL  WGI + D +E CC M         E L  F+   PE                    E G     +  +R  +W + + P SS +A   A    L +L S+  F  ++  H  F+T +                       N T+ + E   T +     + T+S+LT+           ++  R++F      F  +P  IID ++++PFY  +  +   SK + +V  F +    +R+L +
Sbjct:   28 DMTCPSESEKIVINCGGVRHETYRSTLKTLP----GTRLSWLTEPDAFSNFDYDPKSDEFFFDRHPSVFSFILNYYRTGKLHCPNDVCGPLFEEELAFWGIDETD-VEACCWMNYRQHRDAEEALDSFETPEPEVPDDDPALAGDGDLKRLCLQEDGRKAGWWRVWRPRIWALFEDPYSSKYARYVAFGSLLFILISISTFCMET--HEAFNTIY-----------------------NKTENVTEGNVTREEIVYEVVTDSWLTYVEGVCVVWFTIEVFTRVVFCPDKMEFFKSPLNIIDFVAVLPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRILRI 337          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Zebrafish
Match: kcnc1a (potassium voltage-gated channel, Shaw-related subfamily, member 1a [Source:ZFIN;Acc:ZDB-GENE-061220-10])

HSP 1 Score: 100.138 bits (248), Expect = 4.696e-23
Identity = 85/332 (25.60%), Postives = 140/332 (42.17%), Query Frame = 3
Query:   21 DPDSTVIVNVRGKRFELLWSTLKKLPD------LENAIRIRGIYRKSLQEYFFDRDPDVFKCLLNYCRLGELHVPSTICGPIFTKELHAWGIMKVDNIEYCCLMGINNSLMRLENLRKF---------DNMFPESNTEIGTDYDK--------------------FVRFRLFVWNILDQPTSSSFALIYAIILYLTVLGSLFVFITDSVDHPTFSTPFTDVDYSIKYGWTSQQLSEILSWPNATKILNEKKRTIQMNAIFIATNSFLTFDMVARMIFTTKFCSFIMNPYTIIDILSLIPFYYNLIDTVSHSKRSINVAFFSQSNDLIRLLSL 911
            D    V++NV G R +   STL+ LP        E        Y   + E+FFDR P VF  +LNY R G+LH P+ +CGP++ +EL  WGI + D +E CC M         E L  F         D+M  E+  + G   ++                    + R++  VW + + P SS +A   A      +L S+  F  ++  H  F+ P  +  Y             + +  N ++   E +  + +  I      + TF+ + R+ F      FI N   IID ++++PFY  +  +   S  + +V  F +    +R+L +
Sbjct:    5 DEKDRVVINVGGIRHQTYRSTLRTLPGTRLAWLAEPDAHSHFDYDAQIDEFFFDRHPGVFAHILNYYRTGKLHCPADVCGPLYEEELAFWGIDETD-VEPCCWMTYRQHREAEEALDSFGGGPVEMGNDDMDTEALGDPGDGDEELEMTKRLAVGDSPDTKGAGFWQRWQRRVWALFEDPYSSKYARWVAFASLFFILVSITTFCLET--HEAFN-PIINRTY-------------VNTQDNTSRFHLETETVVYLTYIEGVCVVWFTFEFLMRVTFCPDKKKFIKNTLNIIDFVAILPFYLEVGLSGLSSSEAKDVLGFLRVVRFVRILRI 319          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Zebrafish
Match: kcnc1a (potassium voltage-gated channel, Shaw-related subfamily, member 1a [Source:ZFIN;Acc:ZDB-GENE-061220-10])

HSP 1 Score: 99.3673 bits (246), Expect = 7.804e-23
Identity = 85/332 (25.60%), Postives = 140/332 (42.17%), Query Frame = 3
Query:   21 DPDSTVIVNVRGKRFELLWSTLKKLPD------LENAIRIRGIYRKSLQEYFFDRDPDVFKCLLNYCRLGELHVPSTICGPIFTKELHAWGIMKVDNIEYCCLMGINNSLMRLENLRKF---------DNMFPESNTEIGTDYDK--------------------FVRFRLFVWNILDQPTSSSFALIYAIILYLTVLGSLFVFITDSVDHPTFSTPFTDVDYSIKYGWTSQQLSEILSWPNATKILNEKKRTIQMNAIFIATNSFLTFDMVARMIFTTKFCSFIMNPYTIIDILSLIPFYYNLIDTVSHSKRSINVAFFSQSNDLIRLLSL 911
            D    V++NV G R +   STL+ LP        E        Y   + E+FFDR P VF  +LNY R G+LH P+ +CGP++ +EL  WGI + D +E CC M         E L  F         D+M  E+  + G   ++                    + R++  VW + + P SS +A   A      +L S+  F  ++  H  F+ P  +  Y             + +  N ++   E +  + +  I      + TF+ + R+ F      FI N   IID ++++PFY  +  +   S  + +V  F +    +R+L +
Sbjct:    5 DEKDRVVINVGGIRHQTYRSTLRTLPGTRLAWLAEPDAHSHFDYDAQIDEFFFDRHPGVFAHILNYYRTGKLHCPADVCGPLYEEELAFWGIDETD-VEPCCWMTYRQHREAEEALDSFGGGPVEMGNDDMDTEALGDPGDGDEELEMTKRLAVGDSPDTKGAGFWQRWQRRVWALFEDPYSSKYARWVAFASLFFILVSITTFCLET--HEAFN-PIINRTY-------------VNTQDNTSRFHLETETVVYLTYIEGVCVVWFTFEFLMRVTFCPDKKKFIKNTLNIIDFVAILPFYLEVGLSGLSSSEAKDVLGFLRVVRFVRILRI 319          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Xenopus
Match: KCNC4 (potassium channel, voltage gated Shaw related subfamily C, member 4 [Source:NCBI gene;Acc:100492941])

HSP 1 Score: 102.064 bits (253), Expect = 1.465e-23
Identity = 87/315 (27.62%), Postives = 144/315 (45.71%), Query Frame = 3
Query:   36 VIVNVRGKRFELLWSTLKKLP--------DLENAIRIRGIYRKSLQEYFFDRDPDVFKCLLNYCRLGELHVPSTICGPIFTKELHAWGIMKVDNIEYCCLMGINNSLMRLENLRKFDNMFPESNTEIG-------------TDYDK--FVRFRLFVWNILDQPTSSSFALIYAIILYLTVLGSLFVFITDSVDHPTFSTPFTDVDYSIKYGWTSQQLSEILSWPNATKILNEKKRTIQMNAIFIATNSFLTFDMVARMIFTTKFCSFIMNPYTIIDILSLIPFYYNLIDTVSHSKRSINVAFFSQSNDLIRLLSL 911
            + +NV G R E   STL+ LP        D + A       +++  E+FFDR P +F  +LNY R G+LH P+ ICGP+F +EL  WGI + D +E CC M         E L  F+N+ PE   E               TD  +  +  ++  +W + + P SS  A + A +    +L S+  F  ++  H +F      VD ++    T   ++EIL       ++ E +    +  I      + T + + R+I       F+ N   IID ++++PFY  +  +   SK + +V  F +    +R+L +
Sbjct:   38 ITINVGGTRHETYKSTLRTLPGTRLAWLADPDTASNSESDSQRT--EFFFDRHPGIFSYVLNYYRTGKLHCPADICGPLFEEELAFWGIDETD-VEPCCWMTYRQHRDAEEALDIFENVEPEDGEEENKGSSPELLCIEERTDRSRGCWKVWQPKMWALFEDPYSSRAARVVAFVSLFFILMSITTFCLET--HESFI-----VDRNVTETVTIGNMTEIL-------VVREVETEPILTYIEGVCVFWFTLEFLVRIICCPDKVFFVKNLLNIIDFVAILPFYLEVGLSGLSSKAARDVLGFLRVVRFVRILRI 335          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Xenopus
Match: tamm41 (TAM41 mitochondrial translocator assembly and maintenance homolog [Source:Xenbase;Acc:XB-GENE-995882])

HSP 1 Score: 100.908 bits (250), Expect = 3.192e-23
Identity = 87/324 (26.85%), Postives = 135/324 (41.67%), Query Frame = 3
Query:   36 VIVNVRGKRFELLWSTLKKLPDLENAIRIRGI----------YRKSLQEYFFDRDPDVFKCLLNYCRLGELHVPSTICGPIFTKELHAWGIMKVDNIEYCCLMGINNSLMRLENLRKFDNMFPESN-----------TEIGTDYDKFVRFRLFVWNILDQPTSSSFALIYAIILYLTVLGSLFVFITDSVDHPTFSTPFTDVDYSIKYGWTSQQLSEILSWPNATKILNEKKRTIQMNAIFIATNSFL-----------TFDMVARMIFTTKFCSFIMNPYTIIDILSLIPFYYNLIDTVSHSKRSINVAFFSQSNDLIRLLSL 911
            +++NV G R E   STLK LP      R+  +          Y     E+FFDR P VF  +LNY R G+LH P+ +CGP++ +EL  WGI + D +E CC M         E L  F+   P               E G    ++ R +  VW + + P SS  A   A      +L S+  F  ++ +       F DV+                   N T++  +   T     + + T  FL           TF+ + R+IF      FI +   IID ++++PFY  +  +   SK + +V  F +    +R+L +
Sbjct:   38 IVINVGGIRHETYRSTLKTLP----GTRLSWLTEPDAFSNFDYDPKTDEFFFDRHPQVFAYVLNYYRTGKLHCPADVCGPLYEEELAFWGIDETD-VEACCWMNYRQHRDAEEALDSFETPEPTEEEEDGDLKRLCLQEDGRKLGRWKRLQPKVWALFEDPYSSKAARYIAFASLFFILISITTFCLETHE------AFNDVN-------------------NKTEVFTQGNITRTETILEMETEPFLTYVEGICVIWFTFEFLIRVIFCPDKMEFIKSSLNIIDFVAILPFYLEIGLSGLSSKAAKDVLGFLRVVRFVRILRI 331          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Xenopus
Match: tamm41 (TAM41 mitochondrial translocator assembly and maintenance homolog [Source:Xenbase;Acc:XB-GENE-995882])

HSP 1 Score: 100.908 bits (250), Expect = 3.881e-23
Identity = 87/324 (26.85%), Postives = 135/324 (41.67%), Query Frame = 3
Query:   36 VIVNVRGKRFELLWSTLKKLPDLENAIRIRGI----------YRKSLQEYFFDRDPDVFKCLLNYCRLGELHVPSTICGPIFTKELHAWGIMKVDNIEYCCLMGINNSLMRLENLRKFDNMFPESN-----------TEIGTDYDKFVRFRLFVWNILDQPTSSSFALIYAIILYLTVLGSLFVFITDSVDHPTFSTPFTDVDYSIKYGWTSQQLSEILSWPNATKILNEKKRTIQMNAIFIATNSFL-----------TFDMVARMIFTTKFCSFIMNPYTIIDILSLIPFYYNLIDTVSHSKRSINVAFFSQSNDLIRLLSL 911
            +++NV G R E   STLK LP      R+  +          Y     E+FFDR P VF  +LNY R G+LH P+ +CGP++ +EL  WGI + D +E CC M         E L  F+   P               E G    ++ R +  VW + + P SS  A   A      +L S+  F  ++ +       F DV+                   N T++  +   T     + + T  FL           TF+ + R+IF      FI +   IID ++++PFY  +  +   SK + +V  F +    +R+L +
Sbjct:   38 IVINVGGIRHETYRSTLKTLP----GTRLSWLTEPDAFSNFDYDPKTDEFFFDRHPQVFAYVLNYYRTGKLHCPADVCGPLYEEELAFWGIDETD-VEACCWMNYRQHRDAEEALDSFETPEPTEEEEDGDLKRLCLQEDGRKLGRWKRLQPKVWALFEDPYSSKAARYIAFASLFFILISITTFCLETHEA------FNDVN-------------------NKTEVFTQGNITRTETILEMETEPFLTYVEGICVIWFTFEFLIRVIFCPDKMEFIKSSLNIIDFVAILPFYLEIGLSGLSSKAAKDVLGFLRVVRFVRILRI 331          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Xenopus
Match: tamm41 (TAM41 mitochondrial translocator assembly and maintenance homolog [Source:Xenbase;Acc:XB-GENE-995882])

HSP 1 Score: 100.523 bits (249), Expect = 4.228e-23
Identity = 87/324 (26.85%), Postives = 135/324 (41.67%), Query Frame = 3
Query:   36 VIVNVRGKRFELLWSTLKKLPDLENAIRIRGI----------YRKSLQEYFFDRDPDVFKCLLNYCRLGELHVPSTICGPIFTKELHAWGIMKVDNIEYCCLMGINNSLMRLENLRKFDNMFPESN-----------TEIGTDYDKFVRFRLFVWNILDQPTSSSFALIYAIILYLTVLGSLFVFITDSVDHPTFSTPFTDVDYSIKYGWTSQQLSEILSWPNATKILNEKKRTIQMNAIFIATNSFL-----------TFDMVARMIFTTKFCSFIMNPYTIIDILSLIPFYYNLIDTVSHSKRSINVAFFSQSNDLIRLLSL 911
            +++NV G R E   STLK LP      R+  +          Y     E+FFDR P VF  +LNY R G+LH P+ +CGP++ +EL  WGI + D +E CC M         E L  F+   P               E G    ++ R +  VW + + P SS  A   A      +L S+  F  ++ +       F DV+                   N T++  +   T     + + T  FL           TF+ + R+IF      FI +   IID ++++PFY  +  +   SK + +V  F +    +R+L +
Sbjct:   38 IVINVGGIRHETYRSTLKTLP----GTRLSWLTEPDAFSNFDYDPKTDEFFFDRHPQVFAYVLNYYRTGKLHCPADVCGPLYEEELAFWGIDETD-VEACCWMNYRQHRDAEEALDSFETPEPTEEEEDGDLKRLCLQEDGRKLGRWKRLQPKVWALFEDPYSSKAARYIAFASLFFILISITTFCLETHEA------FNDVN-------------------NKTEVFTQGNITRTETILEMETEPFLTYVEGICVIWFTFEFLIRVIFCPDKMEFIKSSLNIIDFVAILPFYLEIGLSGLSSKAAKDVLGFLRVVRFVRILRI 331          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Xenopus
Match: tamm41 (TAM41 mitochondrial translocator assembly and maintenance homolog [Source:Xenbase;Acc:XB-GENE-995882])

HSP 1 Score: 100.523 bits (249), Expect = 4.344e-23
Identity = 87/324 (26.85%), Postives = 135/324 (41.67%), Query Frame = 3
Query:   36 VIVNVRGKRFELLWSTLKKLPDLENAIRIRGI----------YRKSLQEYFFDRDPDVFKCLLNYCRLGELHVPSTICGPIFTKELHAWGIMKVDNIEYCCLMGINNSLMRLENLRKFDNMFPESN-----------TEIGTDYDKFVRFRLFVWNILDQPTSSSFALIYAIILYLTVLGSLFVFITDSVDHPTFSTPFTDVDYSIKYGWTSQQLSEILSWPNATKILNEKKRTIQMNAIFIATNSFL-----------TFDMVARMIFTTKFCSFIMNPYTIIDILSLIPFYYNLIDTVSHSKRSINVAFFSQSNDLIRLLSL 911
            +++NV G R E   STLK LP      R+  +          Y     E+FFDR P VF  +LNY R G+LH P+ +CGP++ +EL  WGI + D +E CC M         E L  F+   P               E G    ++ R +  VW + + P SS  A   A      +L S+  F  ++ +       F DV+                   N T++  +   T     + + T  FL           TF+ + R+IF      FI +   IID ++++PFY  +  +   SK + +V  F +    +R+L +
Sbjct:   38 IVINVGGIRHETYRSTLKTLP----GTRLSWLTEPDAFSNFDYDPKTDEFFFDRHPQVFAYVLNYYRTGKLHCPADVCGPLYEEELAFWGIDETD-VEACCWMNYRQHRDAEEALDSFETPEPTEEEEDGDLKRLCLQEDGRKLGRWKRLQPKVWALFEDPYSSKAARYIAFASLFFILISITTFCLETHE------AFNDVN-------------------NKTEVFTQGNITRTETILEMETEPFLTYVEGICVIWFTFEFLIRVIFCPDKMEFIKSSLNIIDFVAILPFYLEIGLSGLSSKAAKDVLGFLRVVRFVRILRI 331          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Mouse
Match: Kcnc1 (potassium voltage gated channel, Shaw-related subfamily, member 1 [Source:MGI Symbol;Acc:MGI:96667])

HSP 1 Score: 98.2117 bits (243), Expect = 1.564e-22
Identity = 84/334 (25.15%), Postives = 142/334 (42.51%), Query Frame = 3
Query:   21 DPDSTVIVNVRGKRFELLWSTLKKLPD------LENAIRIRGIYRKSLQEYFFDRDPDVFKCLLNYCRLGELHVPSTICGPIFTKELHAWGIMKVDNIEYCCLM------------------GINNSLMRLENLRKFDNMFPESNTEI-----------GTDYDKFVRFRLFVWNILDQPTSSSFALIYAIILYLTVLGSLFVFITDSVDHPTFSTPFTDVDYSIKYGWTSQQLSEILSWPNATKILNEKKRTIQMNAIFIATNS--FLTFDMVARMIFTTKFCSFIMNPYTIIDILSLIPFYYNLIDTVSHSKRSINVAFFSQSNDLIRLLSL 911
            D    +++NV G R +   STL+ LP        E        Y     E+FFDR P VF  +LNY R G+LH P+ +CGP++ +EL  WGI + D +E CC M                   ++NS    +     D+   E   E+           G     + R++  +W + + P SS +A   A      +L S+  F  ++  H  F+ P  +              +EI +  N T++   ++   +    +I      + TF+ + R++F      FI N   IID ++++PFY  +  +   SK + +V  F +    +R+L +
Sbjct:    5 DESERIVINVGGTRHQTYRSTLRTLPGTRLAWLAEPDAHSHFDYDPRADEFFFDRHPGVFAHILNYYRTGKLHCPADVCGPLYEEELAFWGIDETD-VEPCCWMTYRQHRDAEEALDSFGGAPLDNSADDADADGPGDSGDGEDELEMTKRLALSDSPDGRPGGFWRRWQPRIWALFEDPYSSRYARYVAFASLFFILVSITTFCLET--HERFN-PIVNK-------------TEIENVRNGTQVRYYREAETEAFLTYIEGVCVVWFTFEFLMRVVFCPNKVEFIKNSLNIIDFVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRILRI 321          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Mouse
Match: Kcnc1 (potassium voltage gated channel, Shaw-related subfamily, member 1 [Source:MGI Symbol;Acc:MGI:96667])

HSP 1 Score: 98.2117 bits (243), Expect = 2.201e-22
Identity = 84/334 (25.15%), Postives = 142/334 (42.51%), Query Frame = 3
Query:   21 DPDSTVIVNVRGKRFELLWSTLKKLPD------LENAIRIRGIYRKSLQEYFFDRDPDVFKCLLNYCRLGELHVPSTICGPIFTKELHAWGIMKVDNIEYCCLM------------------GINNSLMRLENLRKFDNMFPESNTEI-----------GTDYDKFVRFRLFVWNILDQPTSSSFALIYAIILYLTVLGSLFVFITDSVDHPTFSTPFTDVDYSIKYGWTSQQLSEILSWPNATKILNEKKRTIQMNAIFIATNS--FLTFDMVARMIFTTKFCSFIMNPYTIIDILSLIPFYYNLIDTVSHSKRSINVAFFSQSNDLIRLLSL 911
            D    +++NV G R +   STL+ LP        E        Y     E+FFDR P VF  +LNY R G+LH P+ +CGP++ +EL  WGI + D +E CC M                   ++NS    +     D+   E   E+           G     + R++  +W + + P SS +A   A      +L S+  F  ++  H  F+ P  +              +EI +  N T++   ++   +    +I      + TF+ + R++F      FI N   IID ++++PFY  +  +   SK + +V  F +    +R+L +
Sbjct:    5 DESERIVINVGGTRHQTYRSTLRTLPGTRLAWLAEPDAHSHFDYDPRADEFFFDRHPGVFAHILNYYRTGKLHCPADVCGPLYEEELAFWGIDETD-VEPCCWMTYRQHRDAEEALDSFGGAPLDNSADDADADGPGDSGDGEDELEMTKRLALSDSPDGRPGGFWRRWQPRIWALFEDPYSSRYARYVAFASLFFILVSITTFCLET--HERFN-PIVNK-------------TEIENVRNGTQVRYYREAETEAFLTYIEGVCVVWFTFEFLMRVVFCPNKVEFIKNSLNIIDFVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRILRI 321          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Mouse
Match: Kcnd1 (potassium voltage-gated channel, Shal-related family, member 1 [Source:MGI Symbol;Acc:MGI:96671])

HSP 1 Score: 91.6633 bits (226), Expect = 3.734e-20
Identity = 68/268 (25.37%), Postives = 118/268 (44.03%), Query Frame = 3
Query:   27 DSTVIVNVRGKRFELLWSTLKKLPD-LENAIRIRGIYRKSLQEYFFDRDPDVFKCLLNYCRLGELHVPSTICGPIFTKELHAWGIMKVDNIEYCCLMGINNSLMRLENLRKFDNMFPESNTEIGTDYDKFVRFRLFVWNILDQPTSSSFALIYAIILYLTVLGSLFVFITDSVDHPTFSTPFTDVDYSIKYGWTSQQLSEILSWPNATKILNEKKRTIQMNAIFIATNSFLTFDMVARMIFTTKFCSFIMNPYTIIDILSLIPFYYNL 827
            D  ++VNV G+RFE   +TL + PD L  +      Y     EYFFDRDPD+F+ +LN+ R G LH P   C   F +EL  +G++  + +  CCL    +   + EN  +            G         R  +W   + P +S+ AL++  +    +  S+   + +++  P   TP           W S++ S    +P A   ++          + I T  +L      R+      C F+ +  ++ID+++++P+Y  L
Sbjct:   39 DEVLVVNVSGRRFETWKNTLDRYPDTLLGSSEKEFFYDAESGEYFFDRDPDMFRHVLNFYRTGRLHCPRQECIQAFDEELAFYGLVP-ELVGDCCLEEYRD--RKKENAERLAEDEEAEQAGEGPALPAGSSLRQRLWRAFENPHTSTAALVFYYVTGFFIAVSVIANVVETI--PCRGTPR----------WPSKEQSCGDRFPTAFFCMDTA-------CVLIFTGEYLL-----RLFAAPSRCRFLRSVMSLIDVVAILPYYIGL 279          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Mouse
Match: Kcnd3 (potassium voltage-gated channel, Shal-related family, member 3 [Source:MGI Symbol;Acc:MGI:1928743])

HSP 1 Score: 91.2781 bits (225), Expect = 5.982e-20
Identity = 69/271 (25.46%), Postives = 131/271 (48.34%), Query Frame = 3
Query:   27 DSTVIVNVRGKRFELLWSTLKKLPD-LENAIRIRGIYRKSLQEYFFDRDPDVFKCLLNYCRLGELHVPSTICGPIFTKELHAWGIMKVDNIEYCCLMGINNSLMRLENLRKFDNMFPESNTEIGTDYDKFVRFRLFVWNILDQPTSSSFALIYAIILYLTVLGSLFVFITDSVDHPTFSTPFTDVDYSIKYGWTSQQLSEILSWPNATKILNEKKRTIQMNAIFIATNSFLTFDMVARMIFTTKFCSFIMNPYTIIDILSLIPFYYNLIDT 836
            D  +++NV G+RF+   +TL++ PD L  +      + +  +EYFFDRDP+VF+C+LN+ R G+LH P   C   +  EL  +GI+  + I  CC     +   + EN  +   +  ++++E   +    + FR  +W   + P +S+ AL++    Y+T       FI  SV         T+V  ++  G          + P + ++   ++ ++    +  A     T + + R+        FI +  +IID+++++P+Y  L+ T
Sbjct:   39 DELIVLNVSGRRFQTWRTTLERYPDTLLGSTEKEFFFNEDTKEYFFDRDPEVFRCVLNFYRTGKLHYPRYECISAYDDELAFYGILP-EIIGDCCYEEYKDR--KRENAER---LMDDNDSENNQESMPSLSFRQTMWRAFENPHTSTLALVF---YYVTGF-----FIAVSV--------ITNVVETVPCG----------TVPGSKELPCGERYSVAFFCLDTACVMIFTVEYLLRLFAAPSRYRFIRSVMSIIDVVAIMPYYIGLVMT 277          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Mouse
Match: Kcnd3 (potassium voltage-gated channel, Shal-related family, member 3 [Source:MGI Symbol;Acc:MGI:1928743])

HSP 1 Score: 91.2781 bits (225), Expect = 5.982e-20
Identity = 69/271 (25.46%), Postives = 131/271 (48.34%), Query Frame = 3
Query:   27 DSTVIVNVRGKRFELLWSTLKKLPD-LENAIRIRGIYRKSLQEYFFDRDPDVFKCLLNYCRLGELHVPSTICGPIFTKELHAWGIMKVDNIEYCCLMGINNSLMRLENLRKFDNMFPESNTEIGTDYDKFVRFRLFVWNILDQPTSSSFALIYAIILYLTVLGSLFVFITDSVDHPTFSTPFTDVDYSIKYGWTSQQLSEILSWPNATKILNEKKRTIQMNAIFIATNSFLTFDMVARMIFTTKFCSFIMNPYTIIDILSLIPFYYNLIDT 836
            D  +++NV G+RF+   +TL++ PD L  +      + +  +EYFFDRDP+VF+C+LN+ R G+LH P   C   +  EL  +GI+  + I  CC     +   + EN  +   +  ++++E   +    + FR  +W   + P +S+ AL++    Y+T       FI  SV         T+V  ++  G          + P + ++   ++ ++    +  A     T + + R+        FI +  +IID+++++P+Y  L+ T
Sbjct:   39 DELIVLNVSGRRFQTWRTTLERYPDTLLGSTEKEFFFNEDTKEYFFDRDPEVFRCVLNFYRTGKLHYPRYECISAYDDELAFYGILP-EIIGDCCYEEYKDR--KRENAER---LMDDNDSENNQESMPSLSFRQTMWRAFENPHTSTLALVF---YYVTGF-----FIAVSV--------ITNVVETVPCG----------TVPGSKELPCGERYSVAFFCLDTACVMIFTVEYLLRLFAAPSRYRFIRSVMSIIDVVAIMPYYIGLVMT 277          
BLAST of Potassium voltage-gated channel protein Shaw vs. UniProt/SwissProt
Match: sp|G5EFC3|KCNAG_CAEEL (Potassium voltage-gated channel protein egl-36 OS=Caenorhabditis elegans OX=6239 GN=egl-36 PE=1 SV=1)

HSP 1 Score: 107.071 bits (266), Expect = 1.243e-24
Identity = 81/293 (27.65%), Postives = 134/293 (45.73%), Query Frame = 3
Query:   27 DSTVIVNVRGKRFELLWSTLKKLPDLENAIRIRGI------YRKSLQEYFFDRDPDVFKCLLNYCRLGELHVPSTICGPIFTKELHAWGIMKVDNIEYCCLMGINNSLMRLENLRKFDNM---------FPESNT--EIGTDYDKF-------VRFRLFVWNILDQPTSSSFALIYAIILYLTVLGSLFVFITDSVDHPTFSTP-FTDVDYSIKYGWTSQQLSEILSWPNATKILNEKKRTIQMNAIFIATNSFLTFDMVARMIFTTKFCSFIMNPYTIIDILSLIPFYYNLI 830
            D  +++NV G R E   +TLKK+P    A R+  +      +   L EYFFDR P VF  +LNY R G+LH P+ +CGP+F +EL  WG+   D  E CC M + ++    E L   D M           E +T  + G + D F       ++ +  +W++ D+P SS  A + A I  L +  S+F F   +  H +F  P     + ++  G     +  + + P                 I +  N + T +++ R +F      F  +P  +ID+++ + FY + +
Sbjct:   36 DERIVLNVGGVRHETYQATLKKIP----ATRLSRLTPSLANFDPLLNEYFFDRHPAVFAMILNYYRTGKLHYPTDVCGPLFEEELQYWGLDASDT-EPCCWMQLLHAKDTQETLAVLDRMDADHEDDPQLREQDTMKKFGWEEDYFQGKRTRWMKLKPQMWSLFDEPYSSQAAKLIAGISVLFIFISIFSFCLKT--HQSFRLPVLIGQNITMPGGVVQPSIERVSTEPLPI-----------FGQIEMLCNIWFTLELIIRFVFCPSKIRFFKSPLNMIDLVATLSFYADAM 310          
BLAST of Potassium voltage-gated channel protein Shaw vs. UniProt/SwissProt
Match: sp|P17972|KCNAW_DROME (Potassium voltage-gated channel protein Shaw OS=Drosophila melanogaster OX=7227 GN=Shaw PE=2 SV=1)

HSP 1 Score: 105.531 bits (262), Expect = 3.474e-24
Identity = 89/318 (27.99%), Postives = 144/318 (45.28%), Query Frame = 3
Query:   21 DPDSTVIVNVRGKRFELLWSTLKKLPD--LENAIRIRGIYRKSLQEYFFDRDPDVFKCLLNYCRLGELHVPSTICGPIFTKELHAWGIMKVDNIEYCCLMGINNSLMRLENLRKFDNM----FPESNTEIG------TDYDK-----FVRFRLFVWNILDQPTSSSFALIYAIILYLTVLGSLFVFITDSVDHPTFSTPFTDVDYSIKYGWTSQQLSEILSWPNATKILNEKKRTIQMNAIFI--ATNSFLTFDMVARMIFTTKFCSFIMNPYTIIDILSLIPFYYNLI--DTVSHSKRSINVAFFSQSNDLIRLLSL 911
            D ++ V++NV G R E   +TLKK+P   L         Y   L EYFFDR P VF  +LNY R G+LH P+ +CGP+F +EL  WG +  + +E CC M         E L   D +       S  E+        DY K     +   +  +W++ D+P SS+ A    ++    +  S+  F   +  HP    P    + ++K    S        W      L++ +    +   +I    N++ TF+++ R I +     FI +   IID ++ + FY +L+     SH + +  + FFS    +IR++ L
Sbjct:    7 DSENRVVLNVGGIRHETYKATLKKIPATRLSRLTEALANYDPILNEYFFDRHPGVFAQVLNYYRTGKLHYPTDVCGPLFEEELEFWG-LDSNQVEPCCWMTYTQHRDTQETLAVLDRLDLDTEKPSEEELARKFGFEEDYYKGTISWWQEMKPRIWSLFDEPYSSNAAKTIGVVSVFFICISILSFCLKT--HPDMRVPIVR-NITVKTANGSN------GW-----FLDKTQTNAHIAFFYIECVCNAWFTFEILVRFISSPNKWEFIKSSVNIIDYIATLSFYIDLVLQRFASHLENADILEFFS----IIRIMRL 305          
BLAST of Potassium voltage-gated channel protein Shaw vs. UniProt/SwissProt
Match: sp|P48547|KCNC1_HUMAN (Potassium voltage-gated channel subfamily C member 1 OS=Homo sapiens OX=9606 GN=KCNC1 PE=1 SV=1)

HSP 1 Score: 98.5969 bits (244), Expect = 8.289e-22
Identity = 85/334 (25.45%), Postives = 142/334 (42.51%), Query Frame = 3
Query:   21 DPDSTVIVNVRGKRFELLWSTLKKLPD------LENAIRIRGIYRKSLQEYFFDRDPDVFKCLLNYCRLGELHVPSTICGPIFTKELHAWGIMKVDNIEYCCLM------------------GINNSLMRLENLRKFDNMFPESNTEI-----------GTDYDKFVRFRLFVWNILDQPTSSSFALIYAIILYLTVLGSLFVFITDSVDHPTFSTPFTDVDYSIKYGWTSQQLSEILSWPNATKILNEKKRTIQMNAIFIATNS--FLTFDMVARMIFTTKFCSFIMNPYTIIDILSLIPFYYNLIDTVSHSKRSINVAFFSQSNDLIRLLSL 911
            D    +++NV G R +   STL+ LP        E        Y     E+FFDR P VF  +LNY R G+LH P+ +CGP++ +EL  WGI + D +E CC M                   ++NS    +     D+   E   E+           G     + R++  +W + + P SS +A   A      +L S+  F  ++  H  F+ P  +              +EI +  N T++   ++   +    +I      + TF+ + R+IF      FI N   IID ++++PFY  +  +   SK + +V  F +    +R+L +
Sbjct:    5 DESERIVINVGGTRHQTYRSTLRTLPGTRLAWLAEPDAHSHFDYDPRADEFFFDRHPGVFAHILNYYRTGKLHCPADVCGPLYEEELAFWGIDETD-VEPCCWMTYRQHRDAEEALDSFGGAPLDNSADDADADGPGDSGDGEDELEMTKRLALSDSPDGRPGGFWRRWQPRIWALFEDPYSSRYARYVAFASLFFILVSITTFCLET--HERFN-PIVNK-------------TEIENVRNGTQVRYYREAETEAFLTYIEGVCVVWFTFEFLMRVIFCPNKVEFIKNSLNIIDFVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRILRI 321          
BLAST of Potassium voltage-gated channel protein Shaw vs. UniProt/SwissProt
Match: sp|P15388|KCNC1_MOUSE (Potassium voltage-gated channel subfamily C member 1 OS=Mus musculus OX=10090 GN=Kcnc1 PE=1 SV=1)

HSP 1 Score: 98.2117 bits (243), Expect = 1.094e-21
Identity = 84/334 (25.15%), Postives = 142/334 (42.51%), Query Frame = 3
Query:   21 DPDSTVIVNVRGKRFELLWSTLKKLPD------LENAIRIRGIYRKSLQEYFFDRDPDVFKCLLNYCRLGELHVPSTICGPIFTKELHAWGIMKVDNIEYCCLM------------------GINNSLMRLENLRKFDNMFPESNTEI-----------GTDYDKFVRFRLFVWNILDQPTSSSFALIYAIILYLTVLGSLFVFITDSVDHPTFSTPFTDVDYSIKYGWTSQQLSEILSWPNATKILNEKKRTIQMNAIFIATNS--FLTFDMVARMIFTTKFCSFIMNPYTIIDILSLIPFYYNLIDTVSHSKRSINVAFFSQSNDLIRLLSL 911
            D    +++NV G R +   STL+ LP        E        Y     E+FFDR P VF  +LNY R G+LH P+ +CGP++ +EL  WGI + D +E CC M                   ++NS    +     D+   E   E+           G     + R++  +W + + P SS +A   A      +L S+  F  ++  H  F+ P  +              +EI +  N T++   ++   +    +I      + TF+ + R++F      FI N   IID ++++PFY  +  +   SK + +V  F +    +R+L +
Sbjct:    5 DESERIVINVGGTRHQTYRSTLRTLPGTRLAWLAEPDAHSHFDYDPRADEFFFDRHPGVFAHILNYYRTGKLHCPADVCGPLYEEELAFWGIDETD-VEPCCWMTYRQHRDAEEALDSFGGAPLDNSADDADADGPGDSGDGEDELEMTKRLALSDSPDGRPGGFWRRWQPRIWALFEDPYSSRYARYVAFASLFFILVSITTFCLET--HERFN-PIVNK-------------TEIENVRNGTQVRYYREAETEAFLTYIEGVCVVWFTFEFLMRVVFCPNKVEFIKNSLNIIDFVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRILRI 321          
BLAST of Potassium voltage-gated channel protein Shaw vs. UniProt/SwissProt
Match: sp|P25122|KCNC1_RAT (Potassium voltage-gated channel subfamily C member 1 OS=Rattus norvegicus OX=10116 GN=Kcnc1 PE=1 SV=1)

HSP 1 Score: 98.2117 bits (243), Expect = 1.539e-21
Identity = 84/334 (25.15%), Postives = 142/334 (42.51%), Query Frame = 3
Query:   21 DPDSTVIVNVRGKRFELLWSTLKKLPD------LENAIRIRGIYRKSLQEYFFDRDPDVFKCLLNYCRLGELHVPSTICGPIFTKELHAWGIMKVDNIEYCCLM------------------GINNSLMRLENLRKFDNMFPESNTEI-----------GTDYDKFVRFRLFVWNILDQPTSSSFALIYAIILYLTVLGSLFVFITDSVDHPTFSTPFTDVDYSIKYGWTSQQLSEILSWPNATKILNEKKRTIQMNAIFIATNS--FLTFDMVARMIFTTKFCSFIMNPYTIIDILSLIPFYYNLIDTVSHSKRSINVAFFSQSNDLIRLLSL 911
            D    +++NV G R +   STL+ LP        E        Y     E+FFDR P VF  +LNY R G+LH P+ +CGP++ +EL  WGI + D +E CC M                   ++NS    +     D+   E   E+           G     + R++  +W + + P SS +A   A      +L S+  F  ++  H  F+ P  +              +EI +  N T++   ++   +    +I      + TF+ + R++F      FI N   IID ++++PFY  +  +   SK + +V  F +    +R+L +
Sbjct:    5 DESERIVINVGGTRHQTYRSTLRTLPGTRLAWLAEPDAHSHFDYDPRADEFFFDRHPGVFAHILNYYRTGKLHCPADVCGPLYEEELAFWGIDETD-VEPCCWMTYRQHRDAEEALDSFGGAPLDNSADDADADGPGDSGDGEDELEMTKRLALSDSPDGRPGGFWRRWQPRIWALFEDPYSSRYARYVAFASLFFILVSITTFCLET--HERFN-PIVNK-------------TEIENVRNGTQVRYYREAETEAFLTYIEGVCVVWFTFEFLMRVVFCPNKVEFIKNSLNIIDFVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRILRI 321          
BLAST of Potassium voltage-gated channel protein Shaw vs. TrEMBL
Match: A0A1I8F268 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 163.31 bits (412), Expect = 1.974e-41
Identity = 106/313 (33.87%), Postives = 150/313 (47.92%), Query Frame = 3
Query:   12 DLTDPDSTVIVNVRGKRFELLWSTLKKLPDLENAIRIRGIYRKSLQEYFFDRDPDVFKCLLNYCRLGELHVPSTICGPIFTKELHAWGIMKVDNIEYCCLMGINNSLMRLENLRKFDNMFPESNTEI------GTDYD-------------------KFVRFRLFVWNILDQPTSSSFALIYAIILYLTVLGSLFVFITDSVD-----------------HPTFSTPFTDVDYSIKYGWTSQQLSEILSWPNATKILNEKKRTIQMNAIFIATNSFLTFDMVARMIFTTKFCSFIMNPYTIIDILSLIPFYYN 824
            D  D    V +NV G RFE+L STL K   + + +   GIYR + QEY+FDRDP +FK +L YCR GELHVP   CGP+  +EL  WG+  V  I+ CC+  + ++  RL +L+KF+N F E           G ++D                        R   W ILD P+SS  A +YA+IL +TVL ++F F+  + D                 HP +    T+ +  IK  W        L++P+                 +IA    LTFD   R++F     ++  N YTIID+LS++PFY N
Sbjct:  239 DSIDVLGLVRMNVSGTRFEVLRSTLLKQRHIYDKLLHDGIYRAAQQEYYFDRDPAIFKIVLWYCRYGELHVPHHYCGPLLERELALWGVQSVIEIQNCCVSHLMDTKSRLVSLKKFENFFKEEMESEPLLLPEGVEFDDPLDLDPAKAHGWRRRVKDALAALRRRCWKILDHPSSSFPAAVYAVILSVTVLYTVFSFVASTSDRFQRPMSPGEIAFYSAKHPAWYGNHTNTNPQIKVDW--------LTFPD-----------------WIAFG-VLTFDFFVRLLFCKNKLAYFKNNYTIIDMLSILPFYVN 525          
BLAST of Potassium voltage-gated channel protein Shaw vs. TrEMBL
Match: A0A1I8I7R2 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 159.073 bits (401), Expect = 1.436e-40
Identity = 101/301 (33.55%), Postives = 149/301 (49.50%), Query Frame = 3
Query:   12 DLTDPDSTVIVNVRGKRFELLWSTLKKLPDLENAIRIRGIYRKSLQEYFFDRDPDVFKCLLNYCRLGELHVPSTICGPIFTKELHAWGIMKVDNIEYCCLMGINNSLMRLENLRKFDNMFPESNTE----IGTDY----------------------DKFVRFRLFVWNILDQPTSSSFALIYAIILYLTVLGSLFVFITDSVDH-PTFSTPFTDVDYSIKYGWTSQQLSEILSWPNATKILNEKKRTIQMNAIFIA---TNSFLTFDMVARMIFTTKFCSFIMNPYTIIDILSLIPFYYN 824
            D  D    + +NV G RFE+L STL K   + + +   GIYR   QEY+FDRDPD+F  +L YCR GELHVP   CGP+  +EL  WGI     I+ CC+  + ++  RL +L+KF+N F E        I TD+                      +  +  R   W ILD P+SS  A +YA++L +TVL ++F F+  + +H     TP     YS K+             P+      + +  I+++ +          LTFD + R++      ++  N YTIID+LS++PFY N
Sbjct:   36 DSLDVLGLIRLNVSGTRFEVLRSTLLKQRYVYDKLMHDGIYRAPQQEYYFDRDPDIFTIVLWYCRYGELHVPHHYCGPLLERELALWGIQPAIEIQNCCVSHVMDTKSRLVSLKKFENFFKEEMENEPLIIPTDHEFEEQNLLQDLQKSHGWQKRLKEALIAMRRRCWKILDHPSSSFPAAVYAVLLSITVLYTVFSFVASTSEHFQRLMTPREVAFYSSKH-------------PSWYGNHTDGRSRIKVDWLVFPDWIGFGVLTFDFLVRLLCCRNKLAYFRNNYTIIDLLSILPFYVN 323          
BLAST of Potassium voltage-gated channel protein Shaw vs. TrEMBL
Match: A0A1I8GWX8 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 155.606 bits (392), Expect = 4.433e-40
Identity = 102/303 (33.66%), Postives = 142/303 (46.86%), Query Frame = 3
Query:   42 VNVRGKRFELLWSTLKKLPDLENAIRIRGIYRKSLQEYFFDRDPDVFKCLLNYCRLGELHVPSTICGPIFTKELHAWGIMKVDNIEYCCLMGINNSLMRLENLRKFDNMFPES--------------NTEIGTDYDK-----------FVRFRLFVWNILDQPTSSSFALIYAIILYLTVLGSLFVFITD-----------------SVDHPTFSTPFTDVDYSIKYGWTSQQLSEILSWPNATKILNEKKRTIQMNAIFIATNSFLTFDMVARMIFTTKFCSFIMNPYTIIDILSLIPFYYN 824
            +N+ G RFE+L +TL     + + +   GIYR + QEY+FDRDP +FK +L YCR GELHVP   CGP+  +EL  WGI  V  I+ CC+  + ++  RL +L+KF+N F E                  +  D  K            +  R   W ILD P+SS  A +YA+IL +TVL ++F F+                   S  HP +    TD    IK  W        L++P+                 +IA  + LTFD   R I      ++  N YTIID LS++PFY N
Sbjct:   50 LNISGTRFEVLRATLLNQRYIYDKLLHDGIYRAAQQEYYFDRDPAIFKIVLWYCRYGELHVPHHYCGPLLERELALWGIQSVIEIQNCCVSHLMDTKSRLVSLKKFENFFKEEMESEPLLLPNSVELEEHLSKDLSKAHGWRKRIKEALIALRKRCWKILDHPSSSFPAAVYAVILSVTVLYTVFSFVASTSERFQRPMTPGEVAFYSAKHPAWYGNRTDASAKIKVDW--------LTFPD-----------------WIAFGT-LTFDFCVRFICCKNKLAYFKNNYTIIDFLSILPFYIN 326          
BLAST of Potassium voltage-gated channel protein Shaw vs. TrEMBL
Match: A0A267H4B4 (BTB domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig014518g1 PE=3 SV=1)

HSP 1 Score: 156.762 bits (395), Expect = 1.397e-39
Identity = 100/314 (31.85%), Postives = 147/314 (46.82%), Query Frame = 3
Query:   12 DLTDPD--STVIVNVRGKRFELLWSTLKKLPDLENAIRIRGIYRKSLQEYFFDRDPDVFKCLLNYCRLGELHVPSTICGPIFTKELHAWGIMKVDNIEYCCLMGINNSLMRLENLRKFDNMF----------------------PESNTEIGTDYDK--FVRFRLFVWNILDQPTSSSFALIYAIILYLTVLGSLFVFITDSVD-----------------HPTFSTPFTDVDYSIKYGWTSQQLSEILSWPNATKILNEKKRTIQMNAIFIATNSFLTFDMVARMIFTTKFCSFIMNPYTIIDILSLIPFYYN 824
            D+ D D  S + VNV G+RFE+L STL +   +   +   G+YR   +EYFFDRDP VF  +L YCR GELHVP  +CGP+  +EL  WGI     I+ CC+  + ++  RL +L++F+N F                      P SN+  G    K      R   W ILD P+S   A +YA++L +TVL ++F F+  + +                 HP++    TD    IK  W     S+  ++                          LTFD + R++      ++  N YT+ID+LS++PFY N
Sbjct:   86 DIEDADVLSLIRVNVGGRRFEVLKSTLMRQHFIYEKLLHDGVYRAGQEEYFFDRDPTVFNIVLWYCRYGELHVPHHLCGPLLERELALWGIQPAIEIQNCCVSHLMDTKSRLISLKQFENFFKEEMETEPVVPLDCIENDDFGGPTSNSSKGWQRVKAFLASLRRRCWKILDHPSSGFPATVYAVLLTITVLYAVFSFVASTSEQFQRLLTQREIQFYSNKHPSWYGNHTDAQTRIKADWLV--FSDWFAF------------------------GVLTFDFLVRLLCCKNKLAYFKNAYTVIDLLSILPFYVN 373          
BLAST of Potassium voltage-gated channel protein Shaw vs. TrEMBL
Match: A0A1I8GSR2 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 156.377 bits (394), Expect = 1.438e-39
Identity = 102/303 (33.66%), Postives = 142/303 (46.86%), Query Frame = 3
Query:   42 VNVRGKRFELLWSTLKKLPDLENAIRIRGIYRKSLQEYFFDRDPDVFKCLLNYCRLGELHVPSTICGPIFTKELHAWGIMKVDNIEYCCLMGINNSLMRLENLRKFDNMFPES--------------NTEIGTDYDK-----------FVRFRLFVWNILDQPTSSSFALIYAIILYLTVLGSLFVFITD-----------------SVDHPTFSTPFTDVDYSIKYGWTSQQLSEILSWPNATKILNEKKRTIQMNAIFIATNSFLTFDMVARMIFTTKFCSFIMNPYTIIDILSLIPFYYN 824
            +N+ G RFE+L +TL     + + +   GIYR + QEY+FDRDP +FK +L YCR GELHVP   CGP+  +EL  WGI  V  I+ CC+  + ++  RL +L+KF+N F E                  +  D  K            +  R   W ILD P+SS  A +YA+IL +TVL ++F F+                   S  HP +    TD    IK  W        L++P+                 +IA  + LTFD   R I      ++  N YTIID LS++PFY N
Sbjct:   50 LNISGTRFEVLRATLLNQRYIYDKLLHDGIYRAAQQEYYFDRDPAIFKIVLWYCRYGELHVPHHYCGPLLERELALWGIQSVIEIQNCCVSHLMDTKSRLVSLKKFENFFKEEMESEPLLLPNSVELEEHLSKDLSKAHGWRKRIKEALIALRKRCWKILDHPSSSFPAAVYAVILSVTVLYTVFSFVASTSERFQRPMTPGEVAFYSAKHPAWYGNRTDASAKIKVDW--------LTFPD-----------------WIAFGT-LTFDFCVRFICCKNKLAYFKNNYTIIDFLSILPFYIN 326          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Cavefish
Match: kcnc1b (potassium voltage-gated channel subfamily C member 1 [Source:NCBI gene;Acc:103042627])

HSP 1 Score: 105.145 bits (261), Expect = 8.031e-25
Identity = 82/331 (24.77%), Postives = 140/331 (42.30%), Query Frame = 3
Query:   21 DPDSTVIVNVRGKRFELLWSTLKKLPDLENAIRIRGIYRKSLQEYFFDRDPDVFKCLLNYCRLGELHVPSTICGPIFTKELHAWGIMKVDNIEYCCLMGINNSLMRLENLRKFDNMFP-------ESNTEIGTD---------------------------YDKFVRFRLFVWNILDQPTSSSFALIYAIILYLTVLGSLFVFITDSVDHPTFSTPFTDVDYSIKYGWTSQQLSEILSWPNATKILNEKKRTIQMNAIFIATNSFLTFDMVARMIFTTKFCSFIMNPYTIIDILSLIPFYYNLIDTVSHSKRSINVAFFSQSNDLIRLLSL 911
            D +  V++NV G R E    TL+ LP    A R+      +  ++FFDR P VF  +LNY R G+LH P+ +CGP++ +EL  WGI + D +E CC M         E L  F    P       E   E+  D                             ++ R++  +W + + P SS +A   A      +L S+  F  ++  H  F+      +Y +       ++ E        + + + +  +Q+  I      + TF+ + R+ F      F+ N   IID ++++PFY  +  +   SK + +V  F +    +R+L +
Sbjct:    5 DDEERVVLNVGGVRHETYRGTLRTLPGTRLA-RLAEQAEGAGHDFFFDRHPGVFAHILNYYRTGKLHCPADVCGPLYEEELSFWGIDETD-VEPCCWMTYRQHREAEEALVSFGGAAPLDNGHRHELEVEVAADGTHEAADGDEGAEMTRRLAHGDAADASGGRWKRWQKKMWALFEDPYSSRYARWVAFASLFFILVSITTFCLET--HEAFNPIINRTEYDV----VDNEIVE--------RNVPQTETMVQLTYIEGVCVVWFTFEFLIRITFCPDKLKFVRNALNIIDFVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRILRI 319          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Cavefish
Match: kcnc1a (potassium voltage-gated channel subfamily C member 1 [Source:NCBI gene;Acc:103038026])

HSP 1 Score: 104.76 bits (260), Expect = 8.343e-25
Identity = 86/334 (25.75%), Postives = 138/334 (41.32%), Query Frame = 3
Query:   21 DPDSTVIVNVRGKRFELLWSTLKKLPD------LENAIRIRGIYRKSLQEYFFDRDPDVFKCLLNYCRLGELHVPSTICGPIFTKELHAWGIMKVDNIEYCCLMGINNSLMRLENLRKFDNMFPE-----------------------------SNTEIGTDYDKFVRFRLFVWNILDQPTSSSFA--LIYAIILYLTVLGSLFVFITDSVDHPTFSTPFTDVDYSIKYGWTSQQLSEILSWPNATKILNEKKRTIQMNAIFIATNSFLTFDMVARMIFTTKFCSFIMNPYTIIDILSLIPFYYNLIDTVSHSKRSINVAFFSQSNDLIRLLSL 911
            D    V++NV G R +   STL+ LP        E        Y   + E+FFDR P VF  +LNY R G+LH P+ +CGP++ +EL  WGI + D +E CC M         E L  F     E                              +   G     + R++  VW + + P SS +A  + +A + ++ V  + F   T    +P  +   TD+D                   N+T+I  E +  + +  I      + TF+ + R+ F      FI N   IID ++++PFY  +  +   SK + +V  F +    +R+L +
Sbjct:    5 DEKDRVVINVGGIRHQTYRSTLRTLPGTRLAWLAEPDAHSHFDYDAQIDEFFFDRHPGVFAHILNYYRTGKLHCPADVCGPLYEEELAFWGIDETD-VEPCCWMTYRQHREAEEALDSFGGGPAELGNDDTDADGLGDPGDGDEELEMTKRLALGDAPDGKAGGLWQRWQRRVWALFEDPYSSKYARWVAFASLFFILVSITTFCLETHEAFNPIINR--TDIDPV----------------DNSTRIYQETETEVFLTYIEGVCVVWFTFEFLMRVTFCPDKKKFIKNTLNIIDFVAILPFYLEVGLSGLSSKEAKDVLGFLRVVRFVRILRI 319          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Cavefish
Match: kcnc1b (potassium voltage-gated channel subfamily C member 1 [Source:NCBI gene;Acc:103042627])

HSP 1 Score: 104.76 bits (260), Expect = 9.079e-25
Identity = 82/331 (24.77%), Postives = 140/331 (42.30%), Query Frame = 3
Query:   21 DPDSTVIVNVRGKRFELLWSTLKKLPDLENAIRIRGIYRKSLQEYFFDRDPDVFKCLLNYCRLGELHVPSTICGPIFTKELHAWGIMKVDNIEYCCLMGINNSLMRLENLRKFDNMFP-------ESNTEIGTD---------------------------YDKFVRFRLFVWNILDQPTSSSFALIYAIILYLTVLGSLFVFITDSVDHPTFSTPFTDVDYSIKYGWTSQQLSEILSWPNATKILNEKKRTIQMNAIFIATNSFLTFDMVARMIFTTKFCSFIMNPYTIIDILSLIPFYYNLIDTVSHSKRSINVAFFSQSNDLIRLLSL 911
            D +  V++NV G R E    TL+ LP    A R+      +  ++FFDR P VF  +LNY R G+LH P+ +CGP++ +EL  WGI + D +E CC M         E L  F    P       E   E+  D                             ++ R++  +W + + P SS +A   A      +L S+  F  ++  H  F+      +Y +       ++ E        + + + +  +Q+  I      + TF+ + R+ F      F+ N   IID ++++PFY  +  +   SK + +V  F +    +R+L +
Sbjct:    5 DDEERVVLNVGGVRHETYRGTLRTLPGTRLA-RLAEQAEGAGHDFFFDRHPGVFAHILNYYRTGKLHCPADVCGPLYEEELSFWGIDETD-VEPCCWMTYRQHREAEEALVSFGGAAPLDNGHRHELEVEVAADGTHEAADGDEGAEMTRRLAHGDAADASGGRWKRWQKKMWALFEDPYSSRYARWVAFASLFFILVSITTFCLET--HEAFNPIINRTEYDV----VDNEIVE--------RNVPQTETMVQLTYIEGVCVVWFTFEFLIRITFCPDKLKFVRNALNIIDFVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRILRI 319          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Cavefish
Match: kcnc1a (potassium voltage-gated channel subfamily C member 1 [Source:NCBI gene;Acc:103038026])

HSP 1 Score: 104.375 bits (259), Expect = 1.171e-24
Identity = 86/334 (25.75%), Postives = 138/334 (41.32%), Query Frame = 3
Query:   21 DPDSTVIVNVRGKRFELLWSTLKKLPD------LENAIRIRGIYRKSLQEYFFDRDPDVFKCLLNYCRLGELHVPSTICGPIFTKELHAWGIMKVDNIEYCCLMGINNSLMRLENLRKFDNMFPE-----------------------------SNTEIGTDYDKFVRFRLFVWNILDQPTSSSFA--LIYAIILYLTVLGSLFVFITDSVDHPTFSTPFTDVDYSIKYGWTSQQLSEILSWPNATKILNEKKRTIQMNAIFIATNSFLTFDMVARMIFTTKFCSFIMNPYTIIDILSLIPFYYNLIDTVSHSKRSINVAFFSQSNDLIRLLSL 911
            D    V++NV G R +   STL+ LP        E        Y   + E+FFDR P VF  +LNY R G+LH P+ +CGP++ +EL  WGI + D +E CC M         E L  F     E                              +   G     + R++  VW + + P SS +A  + +A + ++ V  + F   T    +P  +   TD+D                   N+T+I  E +  + +  I      + TF+ + R+ F      FI N   IID ++++PFY  +  +   SK + +V  F +    +R+L +
Sbjct:    5 DEKDRVVINVGGIRHQTYRSTLRTLPGTRLAWLAEPDAHSHFDYDAQIDEFFFDRHPGVFAHILNYYRTGKLHCPADVCGPLYEEELAFWGIDETD-VEPCCWMTYRQHREAEEALDSFGGGPAELGNDDTDADGLGDPGDGDEELEMTKRLALGDAPDGKAGGLWQRWQRRVWALFEDPYSSKYARWVAFASLFFILVSITTFCLETHEAFNPIINR--TDID----------------PVDNSTRIYQETETEVFLTYIEGVCVVWFTFEFLMRVTFCPDKKKFIKNTLNIIDFVAILPFYLEVGLSGLSSKEAKDVLGFLRVVRFVRILRI 319          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Cavefish
Match: kcnc1a (potassium voltage-gated channel subfamily C member 1 [Source:NCBI gene;Acc:103038026])

HSP 1 Score: 104.375 bits (259), Expect = 1.506e-24
Identity = 86/334 (25.75%), Postives = 138/334 (41.32%), Query Frame = 3
Query:   21 DPDSTVIVNVRGKRFELLWSTLKKLPD------LENAIRIRGIYRKSLQEYFFDRDPDVFKCLLNYCRLGELHVPSTICGPIFTKELHAWGIMKVDNIEYCCLMGINNSLMRLENLRKFDNMFPE-----------------------------SNTEIGTDYDKFVRFRLFVWNILDQPTSSSFA--LIYAIILYLTVLGSLFVFITDSVDHPTFSTPFTDVDYSIKYGWTSQQLSEILSWPNATKILNEKKRTIQMNAIFIATNSFLTFDMVARMIFTTKFCSFIMNPYTIIDILSLIPFYYNLIDTVSHSKRSINVAFFSQSNDLIRLLSL 911
            D    V++NV G R +   STL+ LP        E        Y   + E+FFDR P VF  +LNY R G+LH P+ +CGP++ +EL  WGI + D +E CC M         E L  F     E                              +   G     + R++  VW + + P SS +A  + +A + ++ V  + F   T    +P  +   TD+D                   N+T+I  E +  + +  I      + TF+ + R+ F      FI N   IID ++++PFY  +  +   SK + +V  F +    +R+L +
Sbjct:    5 DEKDRVVINVGGIRHQTYRSTLRTLPGTRLAWLAEPDAHSHFDYDAQIDEFFFDRHPGVFAHILNYYRTGKLHCPADVCGPLYEEELAFWGIDETD-VEPCCWMTYRQHREAEEALDSFGGGPAELGNDDTDADGLGDPGDGDEELEMTKRLALGDAPDGKAGGLWQRWQRRVWALFEDPYSSKYARWVAFASLFFILVSITTFCLETHEAFNPIINR--TDID----------------PVDNSTRIYQETETEVFLTYIEGVCVVWFTFEFLMRVTFCPDKKKFIKNTLNIIDFVAILPFYLEVGLSGLSSKEAKDVLGFLRVVRFVRILRI 319          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Sea Lamprey
Match: kcnc1a (potassium voltage-gated channel, Shaw-related subfamily, member 1a [Source:ZFIN;Acc:ZDB-GENE-061220-10])

HSP 1 Score: 107.457 bits (267), Expect = 2.497e-26
Identity = 91/323 (28.17%), Postives = 145/323 (44.89%), Query Frame = 3
Query:   18 TDPDSTVIVNVRGKRFELLWSTLKKLPDL------ENAIRIRGIYRKSLQEYFFDRDPDVFKCLLNYCRLGELHVPSTICGPIFTKELHAWGIMKVDNIEYCCLMGINNSLMRLENLRKFDNMFPESNTEIGTDYDKFVRFRL------------------FVWNILDQPTSSSFALIYAIILYLTVLGSLFVFITDSVDHPTFSTPFTDVD-YSIKYGWTSQQLSEILSWPNATKILNEKKRTIQMNAIFIATNSFLTFDMVARMIFTTKFCSFIMNPYTIIDILSLIPFYYNLIDTVSHSKRSINVAFFSQSNDLIRLLSL 911
            +D +  V++NV G R E    TL+ LP        E        Y     E+FFDR P VF  +LNY R G+LH PS +CGP+F +EL  WGI + D +E CC M         E L  F+N     N E+  D +   RF L                   +W + + P SS  A I A+   L +L S+  F  ++  H  F+T     + Y+I    T +   ++ + P    +L      + +  + +A   + +F+ + R+I       FI N   +ID ++++PFY  +  +   SK + +V  F +    +R+L +
Sbjct:   32 SDENERVVINVGGTRHETYRGTLRTLPGTRLSWLTEPDAFANFDYDAKGNEFFFDRHPTVFAHILNYYRTGKLHCPSEVCGPLFEEELIFWGIDETD-VEPCCWMNYRQHRDAEEALVSFENPDINGNDEVNEDGEVSKRFGLDERSPDGGKLGFLRRWQPRMWALFEDPYSSRAARIVALASLLFILISITTFCLET--HEAFNTVLNKTENYTINNVTTQKVYVDVETDP----VL------MYVEGVCVA---WFSFEFLVRIICCPDKKVFIKNYLNVIDFVAILPFYLEVGLSSLTSKPARDVLGFLRVVRFVRILRI 338          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008567.1 (pep scaffold:Pmarinus_7.0:GL478165:47990:49229:1 gene:ENSPMAG00000007760.1 transcript:ENSPMAT00000008567.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 77.7962 bits (190), Expect = 1.792e-17
Identity = 51/169 (30.18%), Postives = 82/169 (48.52%), Query Frame = 3
Query:   36 VIVNVRGKRFELLWSTLKKLPDLE-----------NAIRIRGIYRKSLQEYFFDRDPDVFKCLLNYCRLGELHVPSTICGPIFTKELHAWGIMKVDNIEYCCLMGINNSLMRL-ENLRKFDNMFPESNTEIGTDYDKFVRFRLFVWNILDQPTSSSFALIYAIILYLTV 506
            V +NV G   E+LW TL++LP               A  +   +     EYFFDR P  F  +LN+ R G+LH+   +C   F++EL  WG+ ++  +E CC    +    ++ E LR+  +   E + E+  D       R  +W++L++P SS  A + A +   TV
Sbjct:    7 VRLNVGGVCHEVLWRTLERLPRTRLGKLRDSSAEGEAASLCDDHSPGENEYFFDRHPGAFTSILNFYRTGKLHMMEEMCALSFSQELDYWGVDEI-YLESCCQARYHQKKEQMNEELRREADTAREMDAEV-FDGACCAEKRKKLWDLLEKPNSSVAAKVRATLTEFTV 173          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004244.1 (pep scaffold:Pmarinus_7.0:GL488450:6918:7731:1 gene:ENSPMAG00000003882.1 transcript:ENSPMAT00000004244.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 76.6406 bits (187), Expect = 2.712e-17
Identity = 50/177 (28.25%), Postives = 84/177 (47.46%), Query Frame = 3
Query:   42 VNVRGKRFELLWSTLKKLP-------------DLENAIRIRGIYRKSLQEYFFDRDPDVFKCLLNYCRLGELHVPSTICGPIFTKELHAWGIMKVDNIEYCCLMGINNSLMRL-ENLRKFDNMFPESNTEIGTDYDKFVRFRLFVWNILDQPTSSSFALIYAIILYLTVLGSLFVFI 530
            +NV G   E LW TL++LP               E  + +   Y ++  E+FFDR P  F  +LN+ R G LH+   +C   F++EL  WG+ ++  +E CC    +    ++ E LR+      E   E   D       R  +W++L++P SS  A + AI   + V+ ++ + +
Sbjct:    1 INVGGITHEALWRTLERLPRTRLGRLQACVVGSEEAIMELCDDYSRADNEFFFDRHPGAFTSILNFYRTGRLHMMEEMCALSFSQELDYWGVDEI-YLESCCQARYHQKKEQMNEELRREAESAREREGE-QFDATYCAEKRKKLWDLLEKPNSSLAAKVGAIFFIILVMAAMVILM 175          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Sea Lamprey
Match: kcnf1b (potassium voltage-gated channel, subfamily F, member 1b [Source:ZFIN;Acc:ZDB-GENE-090312-39])

HSP 1 Score: 78.9518 bits (193), Expect = 7.127e-17
Identity = 67/304 (22.04%), Postives = 123/304 (40.46%), Query Frame = 3
Query:   36 VIVNVRGKRFELLWSTLKKLPD-LENAIRIR-GIYRKSL--------QEYFFDRDPDVFKCLLNYCRLGELHVPSTICGPIFTKELHAWGIMKVDNIEYCCLMGINNSLMRLENL-RKFDNMFPESNTEIGTDYDKFVRFRLFVWNILDQPTSSSFALIYAIILYLTVLGSLFVFITDSVDHPTFSTPFTDVDYSIKYGWTSQQLSEILSWPNATKILNEKKRTIQMNAIFIATNSFLTFDMVARMIFTTKFCSFIMNPYTIIDILSLIPFYYNLIDTVSHSKRSINVAFFSQSNDLIRLLSLS 914
            + VNV G R  L    L +LPD L   + +R G  R+           E+FFDRDP  F  +L+    GE+H+  + C   F +E+  WG+   D ++ CC    +     L+ + +  +    +S T       +  R R+ VW ++++P SS  A   A+  +  ++ S  V    ++                          E+   P A     E+  TI   AI      + T +   R         F+ +P  ++D+L+++P Y+ ++         + +A   Q    +R++ ++
Sbjct:    2 LAVNVGGSRHVLRSELLARLPDSLLATLLVRPGAARRPAYDDFDPDSGEFFFDRDPRAFDRILDAYHFGEVHMDRSACPMCFKQEMDFWGV-GADCLDDCCRFRYSELQEELDEIVQMVETELRDSGTAGAAQRGRCERARVGVWQLMEKPDSSRLARSLALTSFAFIVVSSVVMCLGTI-------------------------PELQPGPGADGAAGEEHPTIA--AIETVCIGWFTVEFALRFFSAPDRVKFMSSPMNVVDLLAVLP-YFVVLALTEMGGSVMGLASMQQGVQALRIMRVA 276          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004235.1 (pep scaffold:Pmarinus_7.0:GL476413:398954:411573:-1 gene:ENSPMAG00000003870.1 transcript:ENSPMAT00000004235.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 75.485 bits (184), Expect = 1.264e-15
Identity = 74/286 (25.87%), Postives = 122/286 (42.66%), Query Frame = 3
Query:   36 VIVNVRGKRFELLWSTLKKLPDLE----NAIRIRGI-------YRKSLQEYFFDRDPDVFKCLLNYCRLGELHVPSTICGPIFTKELHAWGIMKVDNIEYCCLMGINNSLMRL-ENLRKFDNMFPESNTEIGTDYDKF-----VRFRLFVWNILDQPTSSSFALIYAIILYLTVLGSLFVFITDSVDHPTFSTPFTDVDYSIKYGWTSQQLSEILSWPNATKILNEKKRTIQMNAIFIATNSFLTFDMVARMIFTTKFCSFIMNPYTIIDILSLIPFYYNLIDTVS 842
            V +NV G   E+LW TL++LP       +A    G        Y  +  EYFFDR P  F  +LN+ R G LH+   +C   F +EL  WG+ ++  +E CC    +    ++ E LR+      E+ +    + D+F        R  +W +L+ P SS  A   AI+  L        FI  S    + +T   D+ +         + S I+  P          +  Q+ A+ IA   + T + + R +       F      +ID+++++P+Y  +  T S
Sbjct:    2 VRLNVGGLVHEVLWRTLERLPRTRLGRLHATNTHGALSELCDDYSIADNEYFFDRHPGAFASVLNFYRTGRLHMSEEMCALSFGQELDYWGVDEI-YLETCCQARYHQKKEQMSEELRR------EAESAREREGDEFEGTCCADKRRKLWELLENPNSSLAAKGMAIVSIL--------FIVLSTIALSLNT-LPDLQHK-------DEFSHIIDNP----------KLAQVEAVCIA---WFTMEYLLRFMSAPNKWKFFKGALNVIDLMAILPYYITIFLTES 251          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Nematostella
Match: EDO48066 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJZ5])

HSP 1 Score: 108.227 bits (269), Expect = 6.250e-27
Identity = 83/271 (30.63%), Postives = 122/271 (45.02%), Query Frame = 3
Query:   36 VIVNVRGKRFELLWSTLKKLPDL------ENAIRIRGIYRKSLQEYFFDRDPDVFKCLLNYCRLGELHVPSTICGPIFTKELHAWGIMKVDNIEYCCLMGINNSLMRLENLRKFDNM---FPESNTEIGTDYDKFVRFRL-FVWNILDQPTSSSFALIYAIILYLTVLGSLFVFITDSVDHPTFSTPFTDVDYSIKYGWTSQQLSEILSWPNATKILNEKKRTIQMNAIFIATNSFLTFDMVARMIFTTKFCSFIMNPYTIIDILSLIPFY 818
            VI+NV G R E   STL+ +PD       ENA + +  Y     E FFDR P VF  +LNY R G+LH P  +CGP+F +EL  WGI ++  +E CC             L+ F+ +     +S  E G    +  + ++   W +L+QP SS +A I A++  + ++ S+  F  +S+       PF D                              K+  Q+  I      + TF+ VAR I       FI N  T +D+LS+IP Y
Sbjct:    8 VILNVGGYRHETYLSTLRVVPDSRLAWIGENASK-QADYDPETNEIFFDRHPGVFANVLNYYRTGKLHCPGDVCGPLFEEELAFWGIEEL-QMEPCCWSNYTQHRDAQATLKAFEGLQKDTEDSEYEAGERLARRQKTKMQQFWALLEQPYSSKYAQILAMVSLVIIILSVTTFCIESM-------PFADA----------------------------FKKEFQILEILYCV--WFTFEFVARAIACPSKVEFIKNFMTWVDVLSIIPLY 239          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Nematostella
Match: EDO48067 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJZ6])

HSP 1 Score: 106.301 bits (264), Expect = 3.642e-26
Identity = 85/282 (30.14%), Postives = 131/282 (46.45%), Query Frame = 3
Query:   21 DPDSTVIVNVRGKRFELLWSTLKKLPDL------ENAIRIRGIYRKSLQEYFFDRDPDVFKCLLNYCRLGELHVPSTICGPIFTKELHAWGIMKVDNIEYCCLMGINNSLMRLENLRKFD--NMFPESNTEIGTDYDK-----FVRFRLFVWNILDQPTSSSFALIYA---IILYLTVLGSLFVFITDSVDHPTFSTPFTDVDYSIKYGWTSQQLSEILSWPNATKILNEKKRTIQMNAIFIATNSFLTFDMVARMIFTTKFCSFIMNPYTIIDILSLIPFY 818
            D    V++N  GKRFE   STLK + DL      EN I++   Y +   EYFFDR P VF  +LNY + G+LH P  +CGP+F +EL  WGI +   +E CC           E+L+  D    + E        YD      + R +  VW ILD+P SSS A  Y    + ++   + ++ +F  DS       T   +V  +  +G T+ +        +    +++  R + M    + T  F T + + R++F      FI+     ID++ +IP Y
Sbjct:    1 DHRDRVVINCGGKRFEPYLSTLKNITDLPLSKITENKIKLD--YDEESGEYFFDRHPAVFAQVLNYLQTGKLHCPRNVCGPLFEQELAYWGIDE-QQMESCCWSNYTKHRDAQESLKALDFRPRYDEDEERRKVHYDDPNLSWWQRHQPIVWEILDEPYSSSTAKDYTPFLVSIFTICIWTVEMFKGDS------KTVTRNVTRNATHGNTTTK--------SYYMPVSDVPRYVLMIIDSVCTGWF-TLEFLLRLVFCPSKLKFILTLQNWIDLIVIIPLY 264          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Nematostella
Match: EDO39804 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8W8])

HSP 1 Score: 104.76 bits (260), Expect = 1.297e-25
Identity = 79/297 (26.60%), Postives = 132/297 (44.44%), Query Frame = 3
Query:    9 KDLTDPDSTVIVNVRGKRFELLWSTLKKLPDL------ENAIRIRGIYRKSLQEYFFDRDPDVFKCLLNYCRLGELHVPSTICGPIFTKELHAWGIMKVDNIEYCCLMGINNSLMRLENLRKFDNMFPESNTEIGTDYDKFV-----------------RFRLFVWNILDQPTSSSFALIYAIILYLTVLGSLFVFITDSVDHPTFSTPFTDVDYSIKYGWTSQQLSEILSWPNATKILNEKKRTIQMNAIFIATNSFLTFDMVARMIFTTKFCSFIMNPYTIIDILSLIPFYYNLI 830
            ++ T+    V++NV G++ E    TLK +PD       EN  ++   +  +  E+FFDR P VF  +LN+ R G+LH P+ +CGP+F  EL  WGI ++  +E CC +          NL  FD+   +S+ E   D D  V                 +++  +W + ++P SS  A + A I    ++ S+ +F  ++V  P F  P T   + +                              + A+ +A   + T + + R+IF     SF   P   ID+ +++PFY  LI
Sbjct:    9 EEQTNAGDRVVINVGGQKHETYIGTLKNIPDTRLYWITENGTQLPE-FDPNTSEFFFDRHPGVFAQVLNFYRTGKLHCPNDVCGPLFEDELAFWGIDEL-QVEPCCWLNYKQHREAQANLDPFDHH--DSDNESVGDMDMSVYGLVADSIRQRNRTWWKKYQPRIWTMFEEPYSSIPAQVLAFITMFLIISSVCLFCLETV--PKFDNPKTSEGFVLYI----------------------------LEAVCVA---WFTLEFLFRLIFCPDKLSFFKKPMNWIDLGAILPFYLTLI 268          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Nematostella
Match: EDO42724 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0S6])

HSP 1 Score: 101.293 bits (251), Expect = 2.318e-24
Identity = 80/286 (27.97%), Postives = 127/286 (44.41%), Query Frame = 3
Query:   36 VIVNVRGKRFELLWSTLKKLPD-----LENAIRIRGIYRKSLQEYFFDRDPDVFKCLLNYCRLGELHVPSTICGPIFTKELHAWGIMKVDNIEYCCLMGINNSLMRLENLRKFDNMFPESNTE------IG---------TDYDK--FVRFRLFVWNILDQPTSSSFALIYAIILYLTVLGSLFVFITDSVDHPTFSTPFTDVDYSIKYGWTSQQLSEILSWPNATKILNEKKRTIQMNAIFIATNSFLTFDMVARMIFTTKFCSFIMNPYTIIDILSLIPFYYNL 827
            V +NV G R E   STLK +PD     +  A      +  S  EYFFDR P VF  +LNY R G+LH P  +CGP+F  EL  WGI     +E CC +         E L  F+ +  E+  E      +G         ++ DK  + R++  +W ++++P SS+ A + A      +L S+ +F  +S++            +S KY      L ++L               + +  I +    + T +++ R +F    C F       ID L+++PFY +L
Sbjct:    3 VSINVGGVRHETYKSTLKNIPDTRLSWIAEASAGAADFDPSTGEYFFDRHPGVFANVLNYYRTGKLHCPLDVCGPLFEDELGFWGIDD-QQVESCCWLTYRQHRDAQETLAAFEGVEFENEYEDDEEPDLGRYGFNFAAESEPDKTWWERYQPRIWTLMEEPHSSTLAKVIAYTTLTLILVSVGIFCLESME-----------KFSEKY------LKDLL---------------VILEGICVV---WFTLELMVRFVFCPAKCEFFKKIMNWIDFLAIVPFYVSL 252          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Nematostella
Match: EDO40233 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S7P7])

HSP 1 Score: 96.6709 bits (239), Expect = 1.186e-22
Identity = 87/302 (28.81%), Postives = 127/302 (42.05%), Query Frame = 3
Query:   27 DSTVIVNVRGKRFELLWSTLKKLPDLENAIRIRGI------YRKSLQEYFFDRDPDVFKCLLNYCRLGELHVPSTICGPIFTKELHAWGIMKVDNIEYCCLMGINNSLMRLENLRKFD-NMFPES-NTE-------------IGTDYDKFVR--FRL---FVWNILDQPTSSSFALIYAIILYLTVLGSLFVFITDSVDHPTFSTPFTDVDYSIKYGWTSQQLSEILSWPNATKILNEKKRTIQMNAIFIATNSFLTFDMVARMIFTTKFCSFIMNPYTIIDILSLIPFYYNLIDTVSHSKR 854
            D  +++NV G+R+E   STL  +PD   A  I G       Y  S  EYFFDR   +F+ +LNY R G+LH P  +C  +F +EL  WGI + + +E CC          +E+LR F+ N   ES N+E               ++  K +R  +RL    +W  L++P SS  A I AII    +L S+  F+  SV       P+      I+Y                                     S+ TF+ + R  F+         P T +DI +L+PFY      V   +R
Sbjct:   16 DRRLVINVGGRRYETFQSTLASIPDTRLAW-IAGRPHETPEYDTSHNEYFFDRHSAIFEDILNYYRTGKLHCPRGVCSAVFEEELSFWGIDE-EQMEPCCWPEYTRQRTAIEDLRIFNGNASDESLNSENTLNNADCVLPGRKASEDRKGLRGFYRLVQPIIWRTLEEPFSSCTAKITAIISLAFILLSVLDFVMSSVP----VVPYQSTPSVIEY----------------------------------VCGSWFTFEFILRTAFSPSLRRQFKKPMTWVDIGALLPFYLQFFIDVGDMER 277          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Medaka
Match: ENSORLT00000045623.1 (potassium voltage-gated channel subfamily C member 1-like [Source:NCBI gene;Acc:101168545])

HSP 1 Score: 100.908 bits (250), Expect = 1.978e-23
Identity = 80/321 (24.92%), Postives = 139/321 (43.30%), Query Frame = 3
Query:   36 VIVNVRGKRFELLWSTLKKLPDLENAIRIRGI----------YRKSLQEYFFDRDPDVFKCLLNYCRLGELHVPSTICGPIFTKELHAWGIMKVDNIEYCCLMGINNSLMRLENLRKFDNMFPESN-------------------TEIGTDYDKFVRFRLFVWNILDQPTSSSFALIYAIILYLTVLGSLFVFITDSVDHPTFSTPFTDVDYSIKYGWTSQQLSEILSWPNATKILNEKKRTIQMNAIFIATNSFLTFDMVARMIFTTKFCSFIMNPYTIIDILSLIPFYYNLIDTVSHSKRSINVAFFSQSNDLIRLLSL 911
            +++N  G R E   STLK LP      R+  +          Y     E+FFDR P  F  +LNY R G+LH PS +CGP+F +EL  WGI + D +E CC M         E L  F+   P++                     E G    ++  ++ ++W + + P SS +A   A      +L S+  F  ++  H  F+T +   +      +T +++          +++ +   T       I    + T +++AR+IF      F  +   IID ++++PFY  +  +   SK + ++  F +    +R+L +
Sbjct:   11 IVINCGGIRHETYRSTLKTLP----GTRLSWLTEPDAFSNFDYDPKSDEFFFDRHPATFAFILNYYRTGKLHCPSDVCGPLFEEELAFWGIDETD-VEACCWMNYRQHRDAEEALDSFETPEPDAPEDDPALTGCADGDLKRLCMQEDGRRATRWQVWQPWMWALFEDPYSSKYARYVAFASLFFILLSISTFCLET--HEAFNTIYNKTENVTVGNFTHEEI--------VYEVVTDGWLTYVEGVCVI----WFTIEVMARVIFCPDKAEFFRSALNIIDFVAIVPFYLEVALSGLSSKTAKDILSFLRVVRFVRILRI 312          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Medaka
Match: kcnc1b (potassium voltage-gated channel subfamily C member 1 [Source:NCBI gene;Acc:101165633])

HSP 1 Score: 99.3673 bits (246), Expect = 7.204e-23
Identity = 85/332 (25.60%), Postives = 139/332 (41.87%), Query Frame = 3
Query:   15 LTDPDSTVIVNVRGKRFELLWSTLKKLPD------LENAIRIRGIYRKSLQEYFFDRDPDVFKCLLNYCRLGELHVPSTICGPIFTKELHAWGIMKVDNIEYCCLMGINNSLMRLENLRKF------------------------DNM---FPESNTEIGTDYDKFVRFRLFVWNILDQPTSSSFALIYAIILYLTVLGSLFVFITDSVDHPTFSTPFTDVDYSIKYGWTSQQLSEILSWPNATKILNEKKRTIQMNAIFIATNSFLTFDMVARMIFTTKFCSFIMNPYTIIDILSLIPFYYNLIDTVSHSKRSINVAFFSQSNDLIRLLSL 911
            L+D    +++NV G R +   STL+ LP        E        Y   ++E+FFDR P VF  +LNY R G+LH P+ +CGP++ +EL  WGI + D +E CC M         E L  F                        D M     + ++        + R++  VW + + P SS +A   A+     +L S+  F  ++  H  F+ P  +  Y        + L  I +         E +    +  I      + TF+ + R+ F      FI N   IID ++++PFY  +  +   SK + +V  F +    +R+L +
Sbjct:    3 LSDDKDRIVINVGGIRHQTYRSTLRTLPGTRLSWLAEPDAPNHFDYDAKIEEFFFDRHPGVFAHILNYYRTGKLHCPADVCGPLYEEELAFWGIDETD-VEPCCWMTYRQHREAEEALDSFGGGGLLDLGSDDPDPEPEHTEDEVDEMTRRLAQGDSPDARSGSLWSRWQKRVWALFEDPYSSKYARWIALASLFFILVSITTFCLET--HEAFN-PIVNRTY-------VEHLDNITT----ENTYQETETAAYLTYIEGVCVVWFTFEFLMRITFCPNKFDFIRNALNIIDFVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRILRI 319          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Medaka
Match: kcnc1b (potassium voltage-gated channel subfamily C member 1 [Source:NCBI gene;Acc:101165633])

HSP 1 Score: 98.9821 bits (245), Expect = 8.321e-23
Identity = 85/332 (25.60%), Postives = 139/332 (41.87%), Query Frame = 3
Query:   15 LTDPDSTVIVNVRGKRFELLWSTLKKLPD------LENAIRIRGIYRKSLQEYFFDRDPDVFKCLLNYCRLGELHVPSTICGPIFTKELHAWGIMKVDNIEYCCLMGINNSLMRLENLRKF------------------------DNM---FPESNTEIGTDYDKFVRFRLFVWNILDQPTSSSFALIYAIILYLTVLGSLFVFITDSVDHPTFSTPFTDVDYSIKYGWTSQQLSEILSWPNATKILNEKKRTIQMNAIFIATNSFLTFDMVARMIFTTKFCSFIMNPYTIIDILSLIPFYYNLIDTVSHSKRSINVAFFSQSNDLIRLLSL 911
            L+D    +++NV G R +   STL+ LP        E        Y   ++E+FFDR P VF  +LNY R G+LH P+ +CGP++ +EL  WGI + D +E CC M         E L  F                        D M     + ++        + R++  VW + + P SS +A   A+     +L S+  F  ++  H  F+ P  +  Y        + L  I +         E +    +  I      + TF+ + R+ F      FI N   IID ++++PFY  +  +   SK + +V  F +    +R+L +
Sbjct:    3 LSDDKDRIVINVGGIRHQTYRSTLRTLPGTRLSWLAEPDAPNHFDYDAKIEEFFFDRHPGVFAHILNYYRTGKLHCPADVCGPLYEEELAFWGIDETD-VEPCCWMTYRQHREAEEALDSFGGGGLLDLGSDDPDPEPEHTEDEVDEMTRRLAQGDSPDARSGSLWSRWQKRVWALFEDPYSSKYARWIALASLFFILVSITTFCLET--HEAFN-PIVNRTY-------VEHLDNITT----ENTYQETETAAYLTYIEGVCVVWFTFEFLMRITFCPNKFDFIRNALNIIDFVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRILRI 319          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Medaka
Match: kcnc2 (potassium voltage-gated channel subfamily C member 2 [Source:NCBI gene;Acc:101159160])

HSP 1 Score: 97.0561 bits (240), Expect = 4.613e-22
Identity = 84/327 (25.69%), Postives = 138/327 (42.20%), Query Frame = 3
Query:   21 DPDSTVIVNVRGKRFELLWSTLKKLPD---------------LENAIRIRGI--YRKSLQEYFFDRDPDVFKCLLNYCRLGELHVPSTICGPIFTKELHAWGIMKVDNIEYCCLMGINNSLMRLENLRKFD-------------NMFPESNTEIGTDYDKFVRFRLFVWNILDQPTSSSFALIYAIILYLTVLGSLFVFITDSVDHPTFSTPFTDVDYSIKYGWTSQQLSEILSWPNATKILNEKKRTIQMNAIFIATNSFLTFDMVARMIFTTKFCSFIMNPYTIIDILSLIPFYYNLIDTVSHSKRSINVAFFSQSNDLIRLLSL 911
            D +  +I+NV G R E   STLK LP                L+   ++ G   Y    ++YFFDR P VF  +LNY R G+LH P+ +CGP+F +EL  WGI + D +E CC M         E L  F+                   +  +  +   + +++  +WN+ + P SS  A   A      +L S+  F  ++  H  F+T     +             EI + P  T         ++   +F     + T + + R+ F      F+ N   IID ++++PFY  +  +   SK + +V  F +    +R+L +
Sbjct:    5 DDNERIILNVGGTRHETYKSTLKTLPGTRLALLASDSDIDSVLDQLQQVPGFIEYNARTKQYFFDRHPGVFAYVLNYYRTGKLHCPADVCGPLFEEELSFWGIDETD-VEPCCWMTYRQHRDAEEALDVFELNVDNGDEDDDVGGGLGIEDVHVDGNAGLWRKWQPVIWNLFEDPYSSRAARFVAFASLFFILVSITTFCLET--HEAFNTIINKTNMRNNSCQDLVPQYEIETDPALTY--------VEGVCVF-----WFTIEFLVRVTFCPVKLEFVKNVLNIIDFVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRILRI 315          
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Medaka
Match: ENSORLT00000007744.2 (potassium voltage-gated channel subfamily C member 4 [Source:NCBI gene;Acc:101165306])

HSP 1 Score: 95.1301 bits (235), Expect = 1.633e-21
Identity = 87/314 (27.71%), Postives = 138/314 (43.95%), Query Frame = 3
Query:   36 VIVNVRGKRFELLWSTLKKLPDLENA--------IRIRGIYRK-SLQEYFFDRDPDVFKCLLNYCRLGELHVPSTICGPIFTKELHAWGIMKVDNIEYCCLMGINNSLMRLENLRKFD-----NMFPESNTEIGTDYDKFVRFRLF-------VWNILDQPTSSSFALIYAIILYLTVLGSLFVFITDSVDHPTFSTPFTD-VDYSIKYGWTSQQLSEILSWPNATKILNEKKRTIQMNAIFIATNSFLTFDMVARMIFTTKFCSFIMNPYTIIDILSLIPFYYNLIDTVSHSKRSINVAFFSQSNDLIRLLSL 911
            +++NV G R E   STL+ LP    A        +    +    S  E+F+DR P +F  +LNY R G+LH P+ +CGP+F +EL  WGI + D +E CC M           L  F+     +   E+    G + D   R R         +W + D P SS  A   A +    +L S+  F  ++ D       F + +D   +   TS +    L     +KIL+     ++   +F     + T + + R+I     C FI N   IID ++++PFY  +      SK + NV  F +    +R+L +
Sbjct:   38 IVINVGGTRHETYKSTLRTLPGTRLAWLAEPDAQVSTDSVAEPPSAAEFFYDRHPGIFAYVLNYYRTGKLHCPADVCGPLFEEELAFWGIDETD-VEPCCWMSYRQHRDAEAALEIFEPPDPDDTDDEAPRRFGIE-DCSDRSRSCCEVWQPKLWALFDDPYSSRAARGVAFVSLFFILLSITTFCLETHD------AFNEWMDKVFQGNNTSGKSKAEL---GGSKILH----GVEGVCVF-----WFTLEFLVRIICCPNKCFFIKNTLNIIDFVAILPFYLEMCLEGLSSKAAKNVLGFLRVVRFVRILRI 331          
BLAST of Potassium voltage-gated channel protein Shaw vs. Planmine SMEST
Match: SMESG000025883.1 (SMESG000025883.1)

HSP 1 Score: 629.787 bits (1623), Expect = 0.000e+0
Identity = 305/305 (100.00%), Postives = 305/305 (100.00%), Query Frame = 3
Query:    3 QQKDLTDPDSTVIVNVRGKRFELLWSTLKKLPDLENAIRIRGIYRKSLQEYFFDRDPDVFKCLLNYCRLGELHVPSTICGPIFTKELHAWGIMKVDNIEYCCLMGINNSLMRLENLRKFDNMFPESNTEIGTDYDKFVRFRLFVWNILDQPTSSSFALIYAIILYLTVLGSLFVFITDSVDHPTFSTPFTDVDYSIKYGWTSQQLSEILSWPNATKILNEKKRTIQMNAIFIATNSFLTFDMVARMIFTTKFCSFIMNPYTIIDILSLIPFYYNLIDTVSHSKRSINVAFFSQSNDLIRLLSLSI 917
            QQKDLTDPDSTVIVNVRGKRFELLWSTLKKLPDLENAIRIRGIYRKSLQEYFFDRDPDVFKCLLNYCRLGELHVPSTICGPIFTKELHAWGIMKVDNIEYCCLMGINNSLMRLENLRKFDNMFPESNTEIGTDYDKFVRFRLFVWNILDQPTSSSFALIYAIILYLTVLGSLFVFITDSVDHPTFSTPFTDVDYSIKYGWTSQQLSEILSWPNATKILNEKKRTIQMNAIFIATNSFLTFDMVARMIFTTKFCSFIMNPYTIIDILSLIPFYYNLIDTVSHSKRSINVAFFSQSNDLIRLLSLSI
Sbjct:    9 QQKDLTDPDSTVIVNVRGKRFELLWSTLKKLPDLENAIRIRGIYRKSLQEYFFDRDPDVFKCLLNYCRLGELHVPSTICGPIFTKELHAWGIMKVDNIEYCCLMGINNSLMRLENLRKFDNMFPESNTEIGTDYDKFVRFRLFVWNILDQPTSSSFALIYAIILYLTVLGSLFVFITDSVDHPTFSTPFTDVDYSIKYGWTSQQLSEILSWPNATKILNEKKRTIQMNAIFIATNSFLTFDMVARMIFTTKFCSFIMNPYTIIDILSLIPFYYNLIDTVSHSKRSINVAFFSQSNDLIRLLSLSI 313          
BLAST of Potassium voltage-gated channel protein Shaw vs. Planmine SMEST
Match: SMESG000003694.1 (SMESG000003694.1)

HSP 1 Score: 167.162 bits (422), Expect = 2.190e-49
Identity = 69/149 (46.31%), Postives = 102/149 (68.46%), Query Frame = 3
Query:   18 TDPDSTVIVNVRGKRFELLWSTLKKLPDLENAIRIRGIYRKSLQEYFFDRDPDVFKCLLNYCRLGELHVPSTICGPIFTKELHAWGIMKVDNIEYCCLMGINNSLMRLENLRKFDNMFPESNTEIGTDYDKFVRFRLFVWNILDQPTSS 464
            ++  S V +NVRG RF++ W+T+K++P L   I  +G++ K+  EYFFDRDP+VFKC+LN CRLGE+H+P TICGP+F +E+  WGI   + +E+CCLM + NS+MR++NLR F+  F + +            FR  +W +L+QPTS 
Sbjct:   19 SEESSVVKINVRGVRFKVFWNTIKEIPGLSKTILEKGLHNKTKNEYFFDRDPEVFKCVLNLCRLGEMHIPCTICGPLFNREIKEWGIRMENKVEFCCLMNLTNSMMRIKNLRNFEKFFYKKSESERNSIKCVSHFRQMIWKVLEQPTSK 167          
BLAST of Potassium voltage-gated channel protein Shaw vs. Planmine SMEST
Match: SMESG000069015.1 (SMESG000069015.1)

HSP 1 Score: 145.591 bits (366), Expect = 3.025e-39
Identity = 100/301 (33.22%), Postives = 153/301 (50.83%), Query Frame = 3
Query:   21 DPDSTVIVNVRGKRFELLWSTLKKLPDLENA-IRIRGIY-RKSLQEYFFDRDPDVFKCLLNYCRLGELHVPSTICGPIFTKELHAWGIMKVDNIEYCCLMGINNSLMRLENLRKFDNMFPESNTEIGTDYDKFVR-FRLFVWNILDQPTSSSFALIYAIILYLTVLGSLFVFITDSVDHPTFSTPFTDVDYSIKYGWTSQQLSEILSWPNATKILNEKKRT-IQMNAIFIATNSFLTFDMVARMIFTTKFCSFIMNPYTIIDILSLIPFYYNLIDTVSHSKRSINVAFFSQSNDLIRLLSL 911
            D   TV +NV G  FE L STL K+P+ + A + +  +Y R  L+EYFFDRDP++FK +LNY R+GELH+P  ICGP+  KEL  WG M    IE CC +       +  +L  F+N F E + E     D   R +  ++W   ++P+SS  A+IYAII+ + V+ S+F FI +S  HP F           K    +    E++   N  +  N      I    I      F + D+  R + T     F+ N  T+I+I+S+IP+Y ++          I ++ F +   ++R+  +
Sbjct:   68 DDIRTVRINVGGTIFETLESTLHKIPESKLAQLNVHSVYYRSQLKEYFFDRDPEIFKVVLNYHRIGELHLPLHICGPLLEKELQYWG-MPEQIIEKCCWIHYIQLKSQKYSLVDFENFFSEYDDEPN---DNCCRTWTKYLWKTFNKPSSSKLAMIYAIIVSIFVILSIFAFIAES--HPKF-----------KSNQNTSSKVELIPALNNNEFANHGNSMWIGFQYIDFCCVGFFSVDLFIRFLCTPNRMKFLSNVITVIEIISVIPYYVDIFGHYIERIYKIELSGFLKVVHVLRIFGV 351          
BLAST of Potassium voltage-gated channel protein Shaw vs. Planmine SMEST
Match: SMESG000059794.1 (SMESG000059794.1)

HSP 1 Score: 120.939 bits (302), Expect = 1.387e-30
Identity = 96/305 (31.48%), Postives = 149/305 (48.85%), Query Frame = 3
Query:   15 LTDPDSTVIVNVRGKRFELLWSTLKKLPD--LENAIRIRGIYRKSLQEYFFDRDPDVFKCLLNYCRLGELHVPSTICGPIFTKELHAWGIMKVDNIEYCCLM------GINNSLMRLENLR-KFDNMFPESNTEIGTDYDKFV--------RFRLFVWNILDQPTSSSFALIYAIILYLTVLGSLFVFITDSVDHPTFST-PFTDVDYSIKYGWTSQQLSEILSWPNATKILNEKKRTIQMNAIFIA---TNSFLTFDMVARMIFTTKFCSFIMNPYTIIDILSLIPFYYNLIDTVSHSKRSINV 866
            +TD  + VI+NV G R E   +TLKK+P   L         Y   L EYFFDR P VF  +LNY R G+LH P+ +CGP+F +EL  WG +  + +E CC M          ++  L+ L    D M  E+       Y+K++        ++R  +W +L++P SS  A I + +  + ++ S+ +F   +V  P  +T  F +  YSI    +S + S           LN +K      +IFI     N + T +++ R+  +    +FI +P  IID LSL+ FY++     S S+   NV
Sbjct:    1 MTDSANRVILNVGGIRHETYKATLKKIPATRLSRLTEALANYDPVLNEYFFDRHPHVFGQILNYYRAGKLHYPNDVCGPLFEEELDFWG-LDSNQVEPCCWMTYTIHRNTQETMAMLDKLNLDADKMSDETLYGKFGLYEKYLNNSCNIWQKYRPRLWQMLEEPYSSLSAKILSSLSVIFIILSIAIFCIKTV--PGINTVTFKNYSYSIDLTNSSSEWS--------LDPLNIQKS----QSIFIIDALCNIYFTVELITRLFISPNIVTFIQSPLNIIDTLSLMSFYFDFAFASSSSQLQYNV 290          
BLAST of Potassium voltage-gated channel protein Shaw vs. Planmine SMEST
Match: SMESG000054802.1 (SMESG000054802.1)

HSP 1 Score: 115.931 bits (289), Expect = 1.146e-28
Identity = 91/295 (30.85%), Postives = 146/295 (49.49%), Query Frame = 3
Query:   15 LTDPDSTVIVNVRGKRFELLWSTLKKLPD--LENAIRIRGIYRKSLQEYFFDRDPDVFKCLLNYCRLGELHVPSTICGPIFTKELHAWGIMKVDNIEYCCLMGINNSLMRLENLRKFDNMFPESNTEIGTDYDKFVRF-----------------RLFVWNILDQPTSSSFALIYAIILYLTVLGSLFVFITDSVDHPTFSTPFT-DVDYSIKYGWTSQQLSEILSWPNATKILNEKKRTIQMNAIFIAT----NSFLTFDMVARMIFTTKFCSFIMNPYTIIDILSLIPFYYNL 827
            +TD ++ VI+NV G R E   +TLKK+P   L         Y   L EYFFDR P VF  +LNY R G+LH P+ +CGP+F +EL  WG +  + +E CC M         + L+  D +  + +TE  ++ + + RF                 R  +W++L++P SS  A + + I    +L S+  F   +  +P +S P   +  Y++  G    Q     SW      L++K+  IQ + +F  T    N++ + +++ RMI T    SF  +   IIDI +L+ FY ++
Sbjct:    1 MTDAENRVILNVGGIRHETYKATLKKIPATRLSKLTEALANYDPMLNEYFFDRHPGVFAQILNYYRTGKLHYPTDVCGPLFEEELEFWG-LDSNQVEPCCWMTYTAHRSTQDTLQILDRI--DIDTERTSESELYKRFGLEEEFEDNELSFWQKWRPRIWSVLEEPYSSVLAKLVSGIGISIILISIISFCMKT--YPGYSIPLILNHTYNVSIGGDLFQ-----SWS-----LSQKE--IQPHTVFFYTECICNAWFSIELILRMIVTASCRSFFHDVLNIIDIFALLSFYIDV 278          
The following BLAST results are available for this feature:
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KCNC11.726e-2225.45potassium voltage-gated channel subfamily C member... [more]
KCNC11.942e-2225.45potassium voltage-gated channel subfamily C member... [more]
KCND38.987e-2025.46potassium voltage-gated channel subfamily D member... [more]
KCND38.987e-2025.46potassium voltage-gated channel subfamily D member... [more]
KCND39.568e-2025.46potassium voltage-gated channel subfamily D member... [more]
back to top
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
shw-12.506e-3230.46SHaW family of potassium channels [Source:UniProt... [more]
shw-11.870e-3029.24SHaW family of potassium channels [Source:UniProt... [more]
shw-12.986e-3028.90SHaW family of potassium channels [Source:UniProt... [more]
shw-13.652e-3028.90SHaW family of potassium channels [Source:UniProt... [more]
shw-14.080e-3029.49SHaW family of potassium channels [Source:UniProt... [more]
back to top
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Shaw3.466e-2527.99gene:FBgn0003386 transcript:FBtr0089274[more]
Shaw3.552e-2527.99gene:FBgn0003386 transcript:FBtr0332184[more]
Shaw9.083e-2527.99gene:FBgn0003386 transcript:FBtr0089275[more]
Shaw9.235e-2527.99gene:FBgn0003386 transcript:FBtr0332185[more]
Shaw9.416e-2527.99gene:FBgn0003386 transcript:FBtr0289989[more]
back to top
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kcnc21.901e-2629.79potassium voltage-gated channel, Shaw-related subf... [more]
kcnc22.810e-2629.79potassium voltage-gated channel, Shaw-related subf... [more]
kcnc3b1.633e-2426.47potassium voltage-gated channel, Shaw-related subf... [more]
kcnc1a4.696e-2325.60potassium voltage-gated channel, Shaw-related subf... [more]
kcnc1a7.804e-2325.60potassium voltage-gated channel, Shaw-related subf... [more]
back to top
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KCNC41.465e-2327.62potassium channel, voltage gated Shaw related subf... [more]
tamm413.192e-2326.85TAM41 mitochondrial translocator assembly and main... [more]
tamm413.881e-2326.85TAM41 mitochondrial translocator assembly and main... [more]
tamm414.228e-2326.85TAM41 mitochondrial translocator assembly and main... [more]
tamm414.344e-2326.85TAM41 mitochondrial translocator assembly and main... [more]
back to top
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Kcnc11.564e-2225.15potassium voltage gated channel, Shaw-related subf... [more]
Kcnc12.201e-2225.15potassium voltage gated channel, Shaw-related subf... [more]
Kcnd13.734e-2025.37potassium voltage-gated channel, Shal-related fami... [more]
Kcnd35.982e-2025.46potassium voltage-gated channel, Shal-related fami... [more]
Kcnd35.982e-2025.46potassium voltage-gated channel, Shal-related fami... [more]
back to top
BLAST of Potassium voltage-gated channel protein Shaw vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|G5EFC3|KCNAG_CAEEL1.243e-2427.65Potassium voltage-gated channel protein egl-36 OS=... [more]
sp|P17972|KCNAW_DROME3.474e-2427.99Potassium voltage-gated channel protein Shaw OS=Dr... [more]
sp|P48547|KCNC1_HUMAN8.289e-2225.45Potassium voltage-gated channel subfamily C member... [more]
sp|P15388|KCNC1_MOUSE1.094e-2125.15Potassium voltage-gated channel subfamily C member... [more]
sp|P25122|KCNC1_RAT1.539e-2125.15Potassium voltage-gated channel subfamily C member... [more]
back to top
BLAST of Potassium voltage-gated channel protein Shaw vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8F2681.974e-4133.87Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8I7R21.436e-4033.55Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8GWX84.433e-4033.66Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267H4B41.397e-3931.85BTB domain-containing protein OS=Macrostomum ligna... [more]
A0A1I8GSR21.438e-3933.66Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kcnc1b8.031e-2524.77potassium voltage-gated channel subfamily C member... [more]
kcnc1a8.343e-2525.75potassium voltage-gated channel subfamily C member... [more]
kcnc1b9.079e-2524.77potassium voltage-gated channel subfamily C member... [more]
kcnc1a1.171e-2425.75potassium voltage-gated channel subfamily C member... [more]
kcnc1a1.506e-2425.75potassium voltage-gated channel subfamily C member... [more]
back to top
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kcnc1a2.497e-2628.17potassium voltage-gated channel, Shaw-related subf... [more]
ENSPMAT00000008567.11.792e-1730.18pep scaffold:Pmarinus_7.0:GL478165:47990:49229:1 g... [more]
ENSPMAT00000004244.12.712e-1728.25pep scaffold:Pmarinus_7.0:GL488450:6918:7731:1 gen... [more]
kcnf1b7.127e-1722.04potassium voltage-gated channel, subfamily F, memb... [more]
ENSPMAT00000004235.11.264e-1525.87pep scaffold:Pmarinus_7.0:GL476413:398954:411573:-... [more]
back to top
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO480666.250e-2730.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO480673.642e-2630.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO398041.297e-2526.60Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO427242.318e-2427.97Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO402331.186e-2228.81Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Potassium voltage-gated channel protein Shaw vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000045623.11.978e-2324.92potassium voltage-gated channel subfamily C member... [more]
kcnc1b7.204e-2325.60potassium voltage-gated channel subfamily C member... [more]
kcnc1b8.321e-2325.60potassium voltage-gated channel subfamily C member... [more]
kcnc24.613e-2225.69potassium voltage-gated channel subfamily C member... [more]
ENSORLT00000007744.21.633e-2127.71potassium voltage-gated channel subfamily C member... [more]
back to top
BLAST of Potassium voltage-gated channel protein Shaw vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000025883.10.000e+0100.00SMESG000025883.1[more]
SMESG000003694.12.190e-4946.31SMESG000003694.1[more]
SMESG000069015.13.025e-3933.22SMESG000069015.1[more]
SMESG000059794.11.387e-3031.48SMESG000059794.1[more]
SMESG000054802.11.146e-2830.85SMESG000054802.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30028339 ID=SMED30028339|Name=Potassium voltage-gated channel protein Shaw|organism=Schmidtea mediterranea sexual|type=transcript|length=918bp
ATCAACAGAAAGATCTTACAGATCCAGACTCCACTGTTATTGTCAATGTT
CGTGGAAAGAGATTCGAATTGCTTTGGTCGACCTTGAAAAAACTCCCGGA
TCTGGAAAATGCGATCCGAATCCGAGGCATTTATCGCAAATCCCTGCAAG
AATATTTCTTTGATCGAGATCCCGATGTATTCAAATGTCTCTTAAATTAT
TGTCGACTTGGTGAGTTGCATGTTCCAAGCACGATTTGCGGACCGATTTT
TACAAAGGAATTACATGCTTGGGGAATCATGAAAGTTGACAATATAGAAT
ATTGTTGTTTGATGGGCATCAACAATTCTCTAATGAGATTAGAGAATTTG
AGGAAATTTGACAACATGTTTCCGGAGAGTAACACAGAAATCGGAACCGA
TTATGATAAATTTGTTCGATTTAGACTATTTGTATGGAATATTTTAGATC
AGCCTACTTCTTCTTCTTTTGCCCTTATTTATGCAATAATTCTTTATCTC
ACGGTCCTTGGGAGTTTATTCGTATTCATAACAGACTCAGTCGACCACCC
CACATTCAGTACTCCATTTACAGATGTTGACTATTCGATTAAATATGGTT
GGACTTCTCAACAGTTATCTGAGATTTTGTCATGGCCAAATGCCACAAAG
ATTTTGAACGAAAAGAAGCGAACGATACAAATGAATGCCATTTTTATAGC
AACAAATAGTTTTCTAACTTTTGACATGGTGGCTCGTATGATTTTTACGA
CAAAATTTTGTTCATTCATAATGAACCCCTACACTATCATTGATATACTT
TCACTTATACCCTTTTATTACAACCTCATTGACACAGTGTCTCACAGTAA
GAGGTCAATTAATGTTGCGTTTTTCAGTCAATCGAATGACCTCATAAGAC
TTTTAAGTTTAAGTATAG
back to top

protein sequence of SMED30028339-orf-1

>SMED30028339-orf-1 ID=SMED30028339-orf-1|Name=SMED30028339-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=305bp
QQKDLTDPDSTVIVNVRGKRFELLWSTLKKLPDLENAIRIRGIYRKSLQE
YFFDRDPDVFKCLLNYCRLGELHVPSTICGPIFTKELHAWGIMKVDNIEY
CCLMGINNSLMRLENLRKFDNMFPESNTEIGTDYDKFVRFRLFVWNILDQ
PTSSSFALIYAIILYLTVLGSLFVFITDSVDHPTFSTPFTDVDYSIKYGW
TSQQLSEILSWPNATKILNEKKRTIQMNAIFIATNSFLTFDMVARMIFTT
KFCSFIMNPYTIIDILSLIPFYYNLIDTVSHSKRSINVAFFSQSNDLIRL
LSLSI
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR003974K_chnl_volt-dep_Kv3
IPR028325VG_K_chnl
IPR000210BTB/POZ_dom
IPR027359Volt_channel_dom_sf
IPR003131T1-type_BTB
IPR011333SKP1/BTB/POZ_sf
Vocabulary: biological process
TermDefinition
GO:0006813potassium ion transport
GO:0051260protein homooligomerization
GO:0006810transport
GO:0006811ion transport
GO:0007420brain development
GO:0009636response to toxic substance
GO:0009642response to light intensity
GO:0010996response to auditory stimulus
GO:0014075response to amine
GO:0021549cerebellum development
GO:0021759globus pallidus development
GO:0034765regulation of ion transmembrane transport
GO:0034767positive regulation of ion transmembrane transport
GO:0035690cellular response to drug
GO:0035864response to potassium ion
GO:0051262protein tetramerization
GO:0055085transmembrane transport
GO:0071774response to fibroblast growth factor
GO:0071805potassium ion transmembrane transport
GO:1901379regulation of potassium ion transmembrane transport
GO:1901381positive regulation of potassium ion transmembrane transport
GO:1990089response to nerve growth factor
Vocabulary: cellular component
TermDefinition
GO:0008076voltage-gated potassium channel complex
GO:0005886plasma membrane
GO:0009986cell surface
GO:0016020membrane
GO:0016021integral component of membrane
GO:0030425dendrite
GO:0030673axolemma
GO:0032589neuron projection membrane
GO:0032590dendrite membrane
GO:0032809neuronal cell body membrane
GO:0043025neuronal cell body
Vocabulary: molecular function
TermDefinition
GO:0005249voltage-gated potassium channel activity
GO:0005515protein binding
GO:0005216ion channel activity
GO:0005244voltage-gated ion channel activity
GO:0005251delayed rectifier potassium channel activity
GO:0005267potassium channel activity
GO:0019894kinesin binding
GO:0044325ion channel binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003974Potassium channel, voltage dependent, Kv3PRINTSPR01498SHAWCHANNELcoord: 66..81
score: 56.6
coord: 51..64
score: 60.32
coord: 84..105
score: 28.54
NoneNo IPR availablePRINTSPR00169KCHANNELcoord: 255..275
score: 37.9
coord: 151..179
score: 28.79
coord: 50..69
score: 50.82
NoneNo IPR availableGENE3DG3DSA:3.30.710.10coord: 1..110
e-value: 2.5E-27
score: 97.0
NoneNo IPR availablePANTHERPTHR11537:SF252SHAW-LIKE, ISOFORM Ccoord: 10..302
NoneNo IPR availableCDDcd18379BTB_POZ_Kv3_KCNCcoord: 12..104
e-value: 3.73688E-27
score: 100.162
NoneNo IPR availableTMHMMTMhelixcoord: 254..276
NoneNo IPR availableTMHMMTMhelixcoord: 154..176
NoneNo IPR availableTMHMMTMhelixcoord: 227..249
IPR000210BTB/POZ domainSMARTSM00225BTB_4coord: 10..108
e-value: 2.1E-4
score: 30.6
IPR003131Potassium channel tetramerisation-type BTB domainPFAMPF02214BTB_2coord: 12..94
e-value: 5.0E-16
score: 58.8
IPR027359Voltage-dependent channel domain superfamilyGENE3DG3DSA:1.20.120.350coord: 134..304
e-value: 1.9E-15
score: 58.6
IPR028325Voltage-gated potassium channelPANTHERPTHR11537VOLTAGE-GATED POTASSIUM CHANNELcoord: 10..302
IPR011333SKP1/BTB/POZ domain superfamilySUPERFAMILYSSF54695POZ domaincoord: 10..104