SAP domain-containing protein

Overview
NameSAP domain-containing protein
Smed IDSMED30028337
Length (bp)299
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SAP domain-containing protein (SMED30028337) t-SNE clustered cells

Violin plots show distribution of expression levels for SAP domain-containing protein (SMED30028337) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SAP domain-containing protein (SMED30028337) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SAP domain-containing protein (SMED30028337) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30028337

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 16

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30028337 SmedASXL_006503SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30028337 SmedASXL_006503SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
pharynxSMED30028337 dd_Smed_v4_1181_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30028337 dd_Smed_v4_1181_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30028337 dd_Smed_v4_1181_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30028337 dd_Smed_v4_1181_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30028337 dd_Smed_v4_1181_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30028337 dd_Smed_v4_1181_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30028337 dd_Smed_v4_1181_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30028337 dd_Smed_v4_1181_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30028337 dd_Smed_v4_1181_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30028337 dd_Smed_v4_1181_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30028337 dd_Smed_v4_1181_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30028337 Contig37289newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30028337 Contig37289uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
neoblastSMED30028337 dd_Smed_v6_1181_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SAP domain-containing protein vs. Ensembl Human
Match: CCAR1 (cell division cycle and apoptosis regulator 1 [Source:HGNC Symbol;Acc:HGNC:24236])

HSP 1 Score: 73.1738 bits (178), Expect = 5.656e-16
Identity = 38/98 (38.78%), Postives = 46/98 (46.94%), Query Frame = 1
Query:    1 DPDEXPKVLINTAIXTCKQLTGIDSSPXKDWYRFIEFHYYRPADXQGANISTENDXNRXENEXDXXVETVVXXIPSIXDCMPDTXSWEDLKKKYADAL 294
            DP++ P VLI TAI  CK LTGID S    WYRF E  Y+RP +         +            VETVV   P +  C+P    WE L + Y   L
Sbjct:  512 DPEKDPSVLIKTAIRCCKALTGIDLSVCTQWYRFAEIRYHRPEETHKGRTVPAH------------VETVVLFFPDVWHCLPTRSEWETLSRGYKQQL 597          
BLAST of SAP domain-containing protein vs. Ensembl Human
Match: CCAR1 (cell division cycle and apoptosis regulator 1 [Source:HGNC Symbol;Acc:HGNC:24236])

HSP 1 Score: 73.1738 bits (178), Expect = 5.820e-16
Identity = 38/98 (38.78%), Postives = 46/98 (46.94%), Query Frame = 1
Query:    1 DPDEXPKVLINTAIXTCKQLTGIDSSPXKDWYRFIEFHYYRPADXQGANISTENDXNRXENEXDXXVETVVXXIPSIXDCMPDTXSWEDLKKKYADAL 294
            DP++ P VLI TAI  CK LTGID S    WYRF E  Y+RP +         +            VETVV   P +  C+P    WE L + Y   L
Sbjct:  497 DPEKDPSVLIKTAIRCCKALTGIDLSVCTQWYRFAEIRYHRPEETHKGRTVPAH------------VETVVLFFPDVWHCLPTRSEWETLSRGYKQQL 582          
BLAST of SAP domain-containing protein vs. Ensembl Human
Match: CCAR1 (cell division cycle and apoptosis regulator 1 [Source:HGNC Symbol;Acc:HGNC:24236])

HSP 1 Score: 72.7886 bits (177), Expect = 6.588e-16
Identity = 38/98 (38.78%), Postives = 46/98 (46.94%), Query Frame = 1
Query:    1 DPDEXPKVLINTAIXTCKQLTGIDSSPXKDWYRFIEFHYYRPADXQGANISTENDXNRXENEXDXXVETVVXXIPSIXDCMPDTXSWEDLKKKYADAL 294
            DP++ P VLI TAI  CK LTGID S    WYRF E  Y+RP +         +            VETVV   P +  C+P    WE L + Y   L
Sbjct:  317 DPEKDPSVLIKTAIRCCKALTGIDLSVCTQWYRFAEIRYHRPEETHKGRTVPAH------------VETVVLFFPDVWHCLPTRSEWETLSRGYKQQL 402          
BLAST of SAP domain-containing protein vs. Ensembl Human
Match: CCAR1 (cell division cycle and apoptosis regulator 1 [Source:HGNC Symbol;Acc:HGNC:24236])

HSP 1 Score: 69.707 bits (169), Expect = 7.098e-15
Identity = 38/98 (38.78%), Postives = 46/98 (46.94%), Query Frame = 1
Query:    1 DPDEXPKVLINTAIXTCKQLTGIDSSPXKDWYRFIEFHYYRPADXQGANISTENDXNRXENEXDXXVETVVXXIPSIXDCMPDTXSWEDLKKKYADAL 294
            DP++ P VLI TAI  CK LTGID S    WYRF E  Y+RP +         +            VETVV   P +  C+P    WE L + Y   L
Sbjct:  486 DPEKDPSVLIKTAIRCCKALTGIDLSVCTQWYRFAEIRYHRPEETHKGRTVPAH------------VETVVLFFPDVWHCLPTRSEWETLSRGYKQQL 571          
BLAST of SAP domain-containing protein vs. Ensembl Human
Match: CCAR1 (cell division cycle and apoptosis regulator 1 [Source:HGNC Symbol;Acc:HGNC:24236])

HSP 1 Score: 69.707 bits (169), Expect = 8.266e-15
Identity = 38/98 (38.78%), Postives = 46/98 (46.94%), Query Frame = 1
Query:    1 DPDEXPKVLINTAIXTCKQLTGIDSSPXKDWYRFIEFHYYRPADXQGANISTENDXNRXENEXDXXVETVVXXIPSIXDCMPDTXSWEDLKKKYADAL 294
            DP++ P VLI TAI  CK LTGID S    WYRF E  Y+RP +         +            VETVV   P +  C+P    WE L + Y   L
Sbjct:  497 DPEKDPSVLIKTAIRCCKALTGIDLSVCTQWYRFAEIRYHRPEETHKGRTVPAH------------VETVVLFFPDVWHCLPTRSEWETLSRGYKQQL 582          
BLAST of SAP domain-containing protein vs. Ensembl Zebrafish
Match: ccar1 (cell division cycle and apoptosis regulator 1 [Source:ZFIN;Acc:ZDB-GENE-030131-146])

HSP 1 Score: 64.3142 bits (155), Expect = 4.262e-13
Identity = 35/98 (35.71%), Postives = 46/98 (46.94%), Query Frame = 1
Query:    1 DPDEXPKVLINTAIXTCKQLTGIDSSPXKDWYRFIEFHYYRPADXQGANISTENDXNRXENEXDXXVETVVXXIPSIXDCMPDTXSWEDLKKKYADAL 294
            DP+    VLI TA+  CK LTGID S    WYRF E  Y+RP +         +            VETVV  +P +  C+P    WE+L +   + L
Sbjct:  516 DPEHDASVLIKTAVRCCKALTGIDLSLCTQWYRFAEIRYHRPEETHKGRTVPAH------------VETVVLFLPDVWHCLPTRSEWEELSRGLKEQL 601          
BLAST of SAP domain-containing protein vs. Ensembl Zebrafish
Match: ccar1 (cell division cycle and apoptosis regulator 1 [Source:ZFIN;Acc:ZDB-GENE-030131-146])

HSP 1 Score: 64.3142 bits (155), Expect = 4.613e-13
Identity = 35/98 (35.71%), Postives = 46/98 (46.94%), Query Frame = 1
Query:    1 DPDEXPKVLINTAIXTCKQLTGIDSSPXKDWYRFIEFHYYRPADXQGANISTENDXNRXENEXDXXVETVVXXIPSIXDCMPDTXSWEDLKKKYADAL 294
            DP+    VLI TA+  CK LTGID S    WYRF E  Y+RP +         +            VETVV  +P +  C+P    WE+L +   + L
Sbjct:  552 DPEHDASVLIKTAVRCCKALTGIDLSLCTQWYRFAEIRYHRPEETHKGRTVPAH------------VETVVLFLPDVWHCLPTRSEWEELSRGLKEQL 637          
BLAST of SAP domain-containing protein vs. Ensembl Zebrafish
Match: ccar1 (cell division cycle and apoptosis regulator 1 [Source:ZFIN;Acc:ZDB-GENE-030131-146])

HSP 1 Score: 64.3142 bits (155), Expect = 4.652e-13
Identity = 35/98 (35.71%), Postives = 46/98 (46.94%), Query Frame = 1
Query:    1 DPDEXPKVLINTAIXTCKQLTGIDSSPXKDWYRFIEFHYYRPADXQGANISTENDXNRXENEXDXXVETVVXXIPSIXDCMPDTXSWEDLKKKYADAL 294
            DP+    VLI TA+  CK LTGID S    WYRF E  Y+RP +         +            VETVV  +P +  C+P    WE+L +   + L
Sbjct:  516 DPEHDASVLIKTAVRCCKALTGIDLSLCTQWYRFAEIRYHRPEETHKGRTVPAH------------VETVVLFLPDVWHCLPTRSEWEELSRGLKEQL 601          
BLAST of SAP domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000030679.1 (cell division cycle and apoptosis regulator 1 [Source:NCBI gene;Acc:100216237])

HSP 1 Score: 70.8626 bits (172), Expect = 3.451e-15
Identity = 36/98 (36.73%), Postives = 47/98 (47.96%), Query Frame = 1
Query:    1 DPDEXPKVLINTAIXTCKQLTGIDSSPXKDWYRFIEFHYYRPADXQGANISTENDXNRXENEXDXXVETVVXXIPSIXDCMPDTXSWEDLKKKYADAL 294
            +PD+ P VLI TA+  CK LTGI+ S    WYRF E  Y+RP +         +            VETVV   P +  C+P    WE+L + Y   L
Sbjct:  517 NPDKDPSVLIRTAVRCCKALTGIELSLCTQWYRFAEIRYHRPEETHKGRTVPAH------------VETVVLFFPDVWHCLPTRSEWENLCRGYKQQL 602          
BLAST of SAP domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000015244.1 (cell division cycle and apoptosis regulator 1 [Source:NCBI gene;Acc:100216237])

HSP 1 Score: 70.4774 bits (171), Expect = 3.519e-15
Identity = 36/98 (36.73%), Postives = 47/98 (47.96%), Query Frame = 1
Query:    1 DPDEXPKVLINTAIXTCKQLTGIDSSPXKDWYRFIEFHYYRPADXQGANISTENDXNRXENEXDXXVETVVXXIPSIXDCMPDTXSWEDLKKKYADAL 294
            +PD+ P VLI TA+  CK LTGI+ S    WYRF E  Y+RP +         +            VETVV   P +  C+P    WE+L + Y   L
Sbjct:  486 NPDKDPSVLIRTAVRCCKALTGIELSLCTQWYRFAEIRYHRPEETHKGRTVPAH------------VETVVLFFPDVWHCLPTRSEWENLCRGYKQQL 571          
BLAST of SAP domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000030629.1 (cell division cycle and apoptosis regulator 1 [Source:NCBI gene;Acc:100216237])

HSP 1 Score: 70.4774 bits (171), Expect = 3.656e-15
Identity = 36/98 (36.73%), Postives = 47/98 (47.96%), Query Frame = 1
Query:    1 DPDEXPKVLINTAIXTCKQLTGIDSSPXKDWYRFIEFHYYRPADXQGANISTENDXNRXENEXDXXVETVVXXIPSIXDCMPDTXSWEDLKKKYADAL 294
            +PD+ P VLI TA+  CK LTGI+ S    WYRF E  Y+RP +         +            VETVV   P +  C+P    WE+L + Y   L
Sbjct:  471 NPDKDPSVLIRTAVRCCKALTGIELSLCTQWYRFAEIRYHRPEETHKGRTVPAH------------VETVVLFFPDVWHCLPTRSEWENLCRGYKQQL 556          
BLAST of SAP domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000030699.1 (cell division cycle and apoptosis regulator 1 [Source:NCBI gene;Acc:100216237])

HSP 1 Score: 70.4774 bits (171), Expect = 3.699e-15
Identity = 36/98 (36.73%), Postives = 47/98 (47.96%), Query Frame = 1
Query:    1 DPDEXPKVLINTAIXTCKQLTGIDSSPXKDWYRFIEFHYYRPADXQGANISTENDXNRXENEXDXXVETVVXXIPSIXDCMPDTXSWEDLKKKYADAL 294
            +PD+ P VLI TA+  CK LTGI+ S    WYRF E  Y+RP +         +            VETVV   P +  C+P    WE+L + Y   L
Sbjct:  517 NPDKDPSVLIRTAVRCCKALTGIELSLCTQWYRFAEIRYHRPEETHKGRTVPAH------------VETVVLFFPDVWHCLPTRSEWENLCRGYKQQL 602          
BLAST of SAP domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000015189.1 (cell division cycle and apoptosis regulator 1 [Source:NCBI gene;Acc:100216237])

HSP 1 Score: 70.4774 bits (171), Expect = 3.770e-15
Identity = 36/98 (36.73%), Postives = 47/98 (47.96%), Query Frame = 1
Query:    1 DPDEXPKVLINTAIXTCKQLTGIDSSPXKDWYRFIEFHYYRPADXQGANISTENDXNRXENEXDXXVETVVXXIPSIXDCMPDTXSWEDLKKKYADAL 294
            +PD+ P VLI TA+  CK LTGI+ S    WYRF E  Y+RP +         +            VETVV   P +  C+P    WE+L + Y   L
Sbjct:  508 NPDKDPSVLIRTAVRCCKALTGIELSLCTQWYRFAEIRYHRPEETHKGRTVPAH------------VETVVLFFPDVWHCLPTRSEWENLCRGYKQQL 593          
BLAST of SAP domain-containing protein vs. Ensembl Mouse
Match: Ccar1 (cell division cycle and apoptosis regulator 1 [Source:MGI Symbol;Acc:MGI:1914750])

HSP 1 Score: 68.1662 bits (165), Expect = 2.141e-14
Identity = 37/98 (37.76%), Postives = 46/98 (46.94%), Query Frame = 1
Query:    1 DPDEXPKVLINTAIXTCKQLTGIDSSPXKDWYRFIEFHYYRPADXQGANISTENDXNRXENEXDXXVETVVXXIPSIXDCMPDTXSWEDLKKKYADAL 294
            +P++ P VLI TAI  CK LTGID S    WYRF E  Y+RP +         +            VETVV   P +  C+P    WE L + Y   L
Sbjct:  509 NPEKDPSVLIKTAIRCCKALTGIDLSVCTQWYRFAEIRYHRPEETHKGRTVPAH------------VETVVLFFPDVWHCLPTRSEWETLSRGYKQQL 594          
BLAST of SAP domain-containing protein vs. Ensembl Mouse
Match: Ccar1 (cell division cycle and apoptosis regulator 1 [Source:MGI Symbol;Acc:MGI:1914750])

HSP 1 Score: 68.1662 bits (165), Expect = 2.141e-14
Identity = 37/98 (37.76%), Postives = 46/98 (46.94%), Query Frame = 1
Query:    1 DPDEXPKVLINTAIXTCKQLTGIDSSPXKDWYRFIEFHYYRPADXQGANISTENDXNRXENEXDXXVETVVXXIPSIXDCMPDTXSWEDLKKKYADAL 294
            +P++ P VLI TAI  CK LTGID S    WYRF E  Y+RP +         +            VETVV   P +  C+P    WE L + Y   L
Sbjct:  509 NPEKDPSVLIKTAIRCCKALTGIDLSVCTQWYRFAEIRYHRPEETHKGRTVPAH------------VETVVLFFPDVWHCLPTRSEWETLSRGYKQQL 594          
BLAST of SAP domain-containing protein vs. Ensembl Mouse
Match: Ccar2 (cell cycle activator and apoptosis regulator 2 [Source:MGI Symbol;Acc:MGI:2444228])

HSP 1 Score: 51.2174 bits (121), Expect = 1.605e-8
Identity = 30/95 (31.58%), Postives = 41/95 (43.16%), Query Frame = 1
Query:    1 DPDEXPKVLINTAIXTCKQLTGIDSSPXKDWYRFIEFHYYRPADXQGANISTENDXNRXENEXDXXVETVVXXIPSIXDCMPDTXSWEDLKKKYA 285
            DP   P+VL+ TAI   +  TGID S    W+RF EF Y +P   +                    + TVV  +P +   MP    WE L ++ A
Sbjct:  372 DPQADPQVLVRTAIRCAQAQTGIDLSTCTKWWRFAEFQYLQPGPPR-------------------QLHTVVVYLPDVWTIMPTLEEWEALCQQKA 447          
BLAST of SAP domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8IX12|CCAR1_HUMAN (Cell division cycle and apoptosis regulator protein 1 OS=Homo sapiens OX=9606 GN=CCAR1 PE=1 SV=2)

HSP 1 Score: 73.1738 bits (178), Expect = 2.716e-15
Identity = 38/98 (38.78%), Postives = 46/98 (46.94%), Query Frame = 1
Query:    1 DPDEXPKVLINTAIXTCKQLTGIDSSPXKDWYRFIEFHYYRPADXQGANISTENDXNRXENEXDXXVETVVXXIPSIXDCMPDTXSWEDLKKKYADAL 294
            DP++ P VLI TAI  CK LTGID S    WYRF E  Y+RP +         +            VETVV   P +  C+P    WE L + Y   L
Sbjct:  512 DPEKDPSVLIKTAIRCCKALTGIDLSVCTQWYRFAEIRYHRPEETHKGRTVPAH------------VETVVLFFPDVWHCLPTRSEWETLSRGYKQQL 597          
BLAST of SAP domain-containing protein vs. UniProt/SwissProt
Match: sp|Q641G3|CCAR1_XENLA (Cell division cycle and apoptosis regulator protein 1 OS=Xenopus laevis OX=8355 GN=ccar1 PE=2 SV=1)

HSP 1 Score: 69.3218 bits (168), Expect = 5.498e-14
Identity = 36/98 (36.73%), Postives = 46/98 (46.94%), Query Frame = 1
Query:    1 DPDEXPKVLINTAIXTCKQLTGIDSSPXKDWYRFIEFHYYRPADXQGANISTENDXNRXENEXDXXVETVVXXIPSIXDCMPDTXSWEDLKKKYADAL 294
            +PD+ P VLI TA+  CK LTGI+ S    WYRF E  Y+RP +         +            VETVV   P +  C+P    WE+L   Y   L
Sbjct:  519 NPDKDPSVLIRTAVRCCKALTGIELSLCTQWYRFAEIRYHRPEETHKGRTVPAH------------VETVVLFFPDVWHCLPTRSEWENLCHGYKQQL 604          
BLAST of SAP domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8CH18|CCAR1_MOUSE (Cell division cycle and apoptosis regulator protein 1 OS=Mus musculus OX=10090 GN=Ccar1 PE=1 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 1.498e-13
Identity = 37/98 (37.76%), Postives = 46/98 (46.94%), Query Frame = 1
Query:    1 DPDEXPKVLINTAIXTCKQLTGIDSSPXKDWYRFIEFHYYRPADXQGANISTENDXNRXENEXDXXVETVVXXIPSIXDCMPDTXSWEDLKKKYADAL 294
            +P++ P VLI TAI  CK LTGID S    WYRF E  Y+RP +         +            VETVV   P +  C+P    WE L + Y   L
Sbjct:  509 NPEKDPSVLIKTAIRCCKALTGIDLSVCTQWYRFAEIRYHRPEETHKGRTVPAH------------VETVVLFFPDVWHCLPTRSEWETLSRGYKQQL 594          
BLAST of SAP domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8N163|CCAR2_HUMAN (Cell cycle and apoptosis regulator protein 2 OS=Homo sapiens OX=9606 GN=CCAR2 PE=1 SV=2)

HSP 1 Score: 51.9878 bits (123), Expect = 5.904e-8
Identity = 32/98 (32.65%), Postives = 45/98 (45.92%), Query Frame = 1
Query:    1 DPDEXPKVLINTAIXTCKQLTGIDSSPXKDWYRFIEFHYYRPADXQGANISTENDXNRXENEXDXXVETVVXXIPSIXDCMPDTXSWEDL-KKKYADA 291
            DP   P+VL+ TAI   +  TGID S    W+RF EF Y +P   +                    ++TVV  +P +   MP    WE L ++K A+A
Sbjct:  372 DPQADPQVLVRTAIRCAQAQTGIDLSGCTKWWRFAEFQYLQPGPPR-------------------RLQTVVVYLPDVWTIMPTLEEWEALCQQKAAEA 450          
BLAST of SAP domain-containing protein vs. UniProt/SwissProt
Match: sp|Q5R8S0|CCAR2_PONAB (Cell cycle and apoptosis regulator protein 2 OS=Pongo abelii OX=9601 GN=CCAR2 PE=2 SV=1)

HSP 1 Score: 51.9878 bits (123), Expect = 6.318e-8
Identity = 32/98 (32.65%), Postives = 45/98 (45.92%), Query Frame = 1
Query:    1 DPDEXPKVLINTAIXTCKQLTGIDSSPXKDWYRFIEFHYYRPADXQGANISTENDXNRXENEXDXXVETVVXXIPSIXDCMPDTXSWEDL-KKKYADA 291
            DP   P+VL+ TAI   +  TGID S    W+RF EF Y +P   +                    ++TVV  +P +   MP    WE L ++K A+A
Sbjct:  372 DPQADPQVLVRTAIRCAQAQTGIDLSGCTKWWRFAEFQYLQPGPPR-------------------RLQTVVVYLPDVWTIMPTLEEWEALCQQKAAEA 450          
BLAST of SAP domain-containing protein vs. TrEMBL
Match: A0A034VLI0 (DBIRD complex subunit KIAA1967-like protein OS=Bactrocera dorsalis OX=27457 GN=K1967 PE=4 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 2.307e-16
Identity = 39/98 (39.80%), Postives = 55/98 (56.12%), Query Frame = 1
Query:    1 DPDEXPKVLINTAIXTCKQLTGIDSSPXKDWYRFIEFHYYRPADXQGANISTENDXNRXENEXDXXVETVVXXIPSIXDCMPDTXSWEDLKKKYADAL 294
            +PD+ P VLI TAI TCK LTGID S    WYRF+E HY+R               +  + +    +ETVV  +P +  CMP+T  W++L + Y +A+
Sbjct:  476 NPDKDPAVLIRTAIRTCKALTGIDLSQCTQWYRFVELHYHR--------------QDHKKKDAPPRIETVVMYLPDVHSCMPNTTQWQELNQVYKNAV 559          
BLAST of SAP domain-containing protein vs. TrEMBL
Match: A0A0K8VKY8 (Protein KIAA1967 (Fragment) OS=Bactrocera latifrons OX=174628 GN=K1967_2 PE=4 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 2.432e-16
Identity = 39/98 (39.80%), Postives = 55/98 (56.12%), Query Frame = 1
Query:    1 DPDEXPKVLINTAIXTCKQLTGIDSSPXKDWYRFIEFHYYRPADXQGANISTENDXNRXENEXDXXVETVVXXIPSIXDCMPDTXSWEDLKKKYADAL 294
            +PD+ P VLI TAI TCK LTGID S    WYRF+E HY+R               +  + +    +ETVV  +P +  CMP+T  W++L + Y +A+
Sbjct:  472 NPDKDPAVLIRTAIRTCKALTGIDLSQCTQWYRFVELHYHR--------------QDHKKKDAPPRIETVVMYLPDVHSCMPNTAQWQELNQVYKNAV 555          
BLAST of SAP domain-containing protein vs. TrEMBL
Match: A0A034VPZ1 (DBIRD complex subunit KIAA1967-like protein (Fragment) OS=Bactrocera dorsalis OX=27457 GN=K1967 PE=4 SV=1)

HSP 1 Score: 82.8037 bits (203), Expect = 2.612e-16
Identity = 39/98 (39.80%), Postives = 55/98 (56.12%), Query Frame = 1
Query:    1 DPDEXPKVLINTAIXTCKQLTGIDSSPXKDWYRFIEFHYYRPADXQGANISTENDXNRXENEXDXXVETVVXXIPSIXDCMPDTXSWEDLKKKYADAL 294
            +PD+ P VLI TAI TCK LTGID S    WYRF+E HY+R               +  + +    +ETVV  +P +  CMP+T  W++L + Y +A+
Sbjct:  476 NPDKDPAVLIRTAIRTCKALTGIDLSQCTQWYRFVELHYHR--------------QDHKKKDAPPRIETVVMYLPDVHSCMPNTTQWQELNQVYKNAV 559          
BLAST of SAP domain-containing protein vs. TrEMBL
Match: A0A0A1WXG4 (Protein KIAA1967 homolog OS=Zeugodacus cucurbitae OX=28588 GN=K1967_1 PE=4 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 2.098e-15
Identity = 37/98 (37.76%), Postives = 54/98 (55.10%), Query Frame = 1
Query:    1 DPDEXPKVLINTAIXTCKQLTGIDSSPXKDWYRFIEFHYYRPADXQGANISTENDXNRXENEXDXXVETVVXXIPSIXDCMPDTXSWEDLKKKYADAL 294
            +PD+ P VLI TAI TCK LTG+D S    WYRF+E HY+R               +  + +    +ETVV  +P +  CMP+   W++L + Y +A+
Sbjct:  472 NPDKDPAVLIRTAIRTCKALTGVDLSQCTQWYRFVELHYHR--------------QDHKKKDAPPRIETVVIYLPDVHSCMPNAAQWQELSQVYKNAV 555          
BLAST of SAP domain-containing protein vs. TrEMBL
Match: A0A0K8UZN3 (Protein KIAA1967 OS=Bactrocera latifrons OX=174628 GN=K1967_4 PE=4 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 2.796e-15
Identity = 39/98 (39.80%), Postives = 55/98 (56.12%), Query Frame = 1
Query:    1 DPDEXPKVLINTAIXTCKQLTGIDSSPXKDWYRFIEFHYYRPADXQGANISTENDXNRXENEXDXXVETVVXXIPSIXDCMPDTXSWEDLKKKYADAL 294
            +PD+ P VLI TAI TCK LTGID S    WYRF+E HY+R               +  + +    +ETVV  +P +  CMP+T  W++L + Y +A+
Sbjct:  472 NPDKDPAVLIRTAIRTCKALTGIDLSQCTQWYRFVELHYHR--------------QDHKKKDAPPRIETVVMYLPDVHSCMPNTAQWQELNQVYKNAV 555          
BLAST of SAP domain-containing protein vs. Ensembl Cavefish
Match: ccar1 (cell division cycle and apoptosis regulator 1 [Source:ZFIN;Acc:ZDB-GENE-030131-146])

HSP 1 Score: 54.6842 bits (130), Expect = 8.315e-10
Identity = 35/98 (35.71%), Postives = 44/98 (44.90%), Query Frame = 1
Query:    1 DPDEXPKVLINTAIXTCKQLTGIDSSPXKDWYRFIEFHYYRPADXQGANISTENDXNRXENEXDXXVETVVXXIPSIXDCMPDTXSWEDLKKKYADAL 294
            DP+    VLI TAI  CK LTGID S     YRF E  Y+RP +         +            VETVV  +P +  C+P    WE L +   + L
Sbjct:  500 DPENDASVLIKTAIRCCKALTGIDLSLCTQ-YRFAEIRYHRPEETHKGRTVPAH------------VETVVLFLPDVWHCLPTRSEWEGLSRGLKEQL 584          
BLAST of SAP domain-containing protein vs. Ensembl Sea Lamprey
Match: ccar1 (cell division cycle and apoptosis regulator 1 [Source:ZFIN;Acc:ZDB-GENE-030131-146])

HSP 1 Score: 64.3142 bits (155), Expect = 6.501e-14
Identity = 36/99 (36.36%), Postives = 47/99 (47.47%), Query Frame = 1
Query:    1 DPDEXPKVLINTAIXTCKQLTGIDSSPXKDWYRFIEFHYYRPAD-XQGANISTENDXNRXENEXDXXVETVVXXIPSIXDCMPDTXSWEDLKKKYADAL 294
            +PD  P VLI TA+   + LTGID S    WYRF E  Y+RP +  +G  ++               VETVV  +P +  C P    WE L + Y   L
Sbjct:  513 NPDMDPSVLIKTAVRCTRALTGIDLSTCTQWYRFAEIRYHRPEELHKGRKVAAR-------------VETVVIFLPDVWHCTPTRLEWEALSRGYKQQL 598          
BLAST of SAP domain-containing protein vs. Ensembl Sea Lamprey
Match: ccar1 (cell division cycle and apoptosis regulator 1 [Source:ZFIN;Acc:ZDB-GENE-030131-146])

HSP 1 Score: 64.3142 bits (155), Expect = 7.171e-14
Identity = 36/99 (36.36%), Postives = 47/99 (47.47%), Query Frame = 1
Query:    1 DPDEXPKVLINTAIXTCKQLTGIDSSPXKDWYRFIEFHYYRPAD-XQGANISTENDXNRXENEXDXXVETVVXXIPSIXDCMPDTXSWEDLKKKYADAL 294
            +PD  P VLI TA+   + LTGID S    WYRF E  Y+RP +  +G  ++               VETVV  +P +  C P    WE L + Y   L
Sbjct:  525 NPDMDPSVLIKTAVRCTRALTGIDLSTCTQWYRFAEIRYHRPEELHKGRKVAAR-------------VETVVIFLPDVWHCTPTRLEWEALSRGYKQQL 610          
BLAST of SAP domain-containing protein vs. Planmine SMEST
Match: SMESG000052430.1 (SMESG000052430.1)

HSP 1 Score: 92.8189 bits (229), Expect = 2.251e-23
Identity = 47/103 (45.63%), Postives = 59/103 (57.28%), Query Frame = 1
Query:    1 DPDEXPKVLINTAIXTCKQLTGIDSSPXKDWYRFIEFHYYRPADXQGANISTENDXNRXE-----NEXDXXVETVVXXIPSIXDCMPDTXSWEDLKKKYADAL 294
            +PDE   VL+NTAI  CK LTGID S  K WY+F+E HYYRPAD QG  I    D  + E     +E +  VE VV  IP I  CMP+   W +++  +   L
Sbjct:  239 NPDEDSSVLVNTAIRNCKALTGIDLSKCKKWYKFLEIHYYRPADRQG--IVQSGDGEKEESHQVISETEARVEKVVIFIPEIWSCMPNEIEWAEIRATFEKKL 339          
BLAST of SAP domain-containing protein vs. Planmine SMEST
Match: SMESG000034433.1 (SMESG000034433.1)

HSP 1 Score: 82.0333 bits (201), Expect = 1.431e-19
Identity = 45/109 (41.28%), Postives = 57/109 (52.29%), Query Frame = 1
Query:    1 DPDEXPKVLINTAIXTCKQLTGIDSSPXKDWYRFIEFHYYRPADXQGANISTENDX----NRXENEXDX-------XVETVVXXIPSIXDCMPDTXSWEDLKKKYADAL 294
            DPD  P+VLINTAI TCK LTGID S    W +F+E HYYRP            D     N+ E E +         +ETVV  +P I +C+P   SW D+ + Y + L
Sbjct:  427 DPDTNPRVLINTAIRTCKNLTGIDLSGCSSWPKFLEIHYYRPLQKIQRKTDGGQDMAKCDNKMETESEERFEYIEPRMETVVYYVPDIWNCVPSQESWNDIVRMYKEQL 535          
The following BLAST results are available for this feature:
BLAST of SAP domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CCAR15.656e-1638.78cell division cycle and apoptosis regulator 1 [Sou... [more]
CCAR15.820e-1638.78cell division cycle and apoptosis regulator 1 [Sou... [more]
CCAR16.588e-1638.78cell division cycle and apoptosis regulator 1 [Sou... [more]
CCAR17.098e-1538.78cell division cycle and apoptosis regulator 1 [Sou... [more]
CCAR18.266e-1538.78cell division cycle and apoptosis regulator 1 [Sou... [more]
back to top
BLAST of SAP domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SAP domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SAP domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ccar14.262e-1335.71cell division cycle and apoptosis regulator 1 [Sou... [more]
ccar14.613e-1335.71cell division cycle and apoptosis regulator 1 [Sou... [more]
ccar14.652e-1335.71cell division cycle and apoptosis regulator 1 [Sou... [more]
back to top
BLAST of SAP domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000030679.13.451e-1536.73cell division cycle and apoptosis regulator 1 [Sou... [more]
ENSXETT00000015244.13.519e-1536.73cell division cycle and apoptosis regulator 1 [Sou... [more]
ENSXETT00000030629.13.656e-1536.73cell division cycle and apoptosis regulator 1 [Sou... [more]
ENSXETT00000030699.13.699e-1536.73cell division cycle and apoptosis regulator 1 [Sou... [more]
ENSXETT00000015189.13.770e-1536.73cell division cycle and apoptosis regulator 1 [Sou... [more]
back to top
BLAST of SAP domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Ccar12.141e-1437.76cell division cycle and apoptosis regulator 1 [Sou... [more]
Ccar12.141e-1437.76cell division cycle and apoptosis regulator 1 [Sou... [more]
Ccar21.605e-831.58cell cycle activator and apoptosis regulator 2 [So... [more]
back to top
BLAST of SAP domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8IX12|CCAR1_HUMAN2.716e-1538.78Cell division cycle and apoptosis regulator protei... [more]
sp|Q641G3|CCAR1_XENLA5.498e-1436.73Cell division cycle and apoptosis regulator protei... [more]
sp|Q8CH18|CCAR1_MOUSE1.498e-1337.76Cell division cycle and apoptosis regulator protei... [more]
sp|Q8N163|CCAR2_HUMAN5.904e-832.65Cell cycle and apoptosis regulator protein 2 OS=Ho... [more]
sp|Q5R8S0|CCAR2_PONAB6.318e-832.65Cell cycle and apoptosis regulator protein 2 OS=Po... [more]
back to top
BLAST of SAP domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A034VLI02.307e-1639.80DBIRD complex subunit KIAA1967-like protein OS=Bac... [more]
A0A0K8VKY82.432e-1639.80Protein KIAA1967 (Fragment) OS=Bactrocera latifron... [more]
A0A034VPZ12.612e-1639.80DBIRD complex subunit KIAA1967-like protein (Fragm... [more]
A0A0A1WXG42.098e-1537.76Protein KIAA1967 homolog OS=Zeugodacus cucurbitae ... [more]
A0A0K8UZN32.796e-1539.80Protein KIAA1967 OS=Bactrocera latifrons OX=174628... [more]
back to top
BLAST of SAP domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ccar18.315e-1035.71cell division cycle and apoptosis regulator 1 [Sou... [more]
back to top
BLAST of SAP domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ccar16.501e-1436.36cell division cycle and apoptosis regulator 1 [Sou... [more]
ccar17.171e-1436.36cell division cycle and apoptosis regulator 1 [Sou... [more]
back to top
BLAST of SAP domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SAP domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SAP domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SAP domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000052430.12.251e-2345.63SMESG000052430.1[more]
SMESG000034433.11.431e-1941.28SMESG000034433.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30028337 ID=SMED30028337|Name=SAP domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=299bp
GATCCGGACGAANACCCTAAAGTTCTAATTAATACAGCTATTANAACATG
CAAGCAGCTTACTGGCATTGACTCATCGCCTNGCAAAGATTGGTATAGAT
TTATTGAATTCCATTACTATCGTCCTGCCGATANACAGGGAGCAAATATC
TCGACTGAAAACGATGANAATCGTANTGAAAATGAGTNGGATNTCNNAGT
TGAAACGGTNGTATNATNNATACCTTCCATTNGGGATTGCATGCCCGATA
CANAAAGTTGGGAGGATTTAAAAAAAAAATACGCGGATGCNCTTGANAA
back to top

protein sequence of SMED30028337-orf-1

>SMED30028337-orf-1 ID=SMED30028337-orf-1|Name=SMED30028337-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=99bp
DPDEXPKVLINTAIXTCKQLTGIDSSPXKDWYRFIEFHYYRPADXQGANI
STENDXNRXENEXDXXVETXVXXIPSIXDCMPDTXSWEDLKKKYADXLX
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR025954DBC1/CARP1_inactive_NUDIX_dom
Vocabulary: biological process
TermDefinition
GO:0000398mRNA splicing, via spliceosome
GO:0006351transcription, DNA-templated
GO:0030335positive regulation of cell migration
GO:1903507negative regulation of nucleic acid-templated transcription
GO:0006355regulation of transcription, DNA-templated
GO:0006915apoptotic process
GO:0007049cell cycle
GO:0008284positive regulation of cell proliferation
Vocabulary: molecular function
TermDefinition
GO:0001047core promoter binding
GO:0003713transcription coactivator activity
GO:0003714transcription corepressor activity
GO:0003723RNA binding
GO:0005515protein binding
GO:0030374ligand-dependent nuclear receptor transcription coactivator activity
Vocabulary: cellular component
TermDefinition
GO:0005654nucleoplasm
GO:0005737cytoplasm
GO:0048471perinuclear region of cytoplasm