Guanylate cyclase

Overview
NameGuanylate cyclase
Smed IDSMED30028336
Length (bp)416
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Guanylate cyclase (SMED30028336) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Guanylate cyclase (SMED30028336) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of Guanylate cyclase vs. Ensembl Human
Match: GUCY2F (guanylate cyclase 2F, retinal [Source:HGNC Symbol;Acc:HGNC:4691])

HSP 1 Score: 112.849 bits (281), Expect = 2.470e-29
Identity = 54/116 (46.55%), Postives = 73/116 (62.93%), Query Frame = 3
Query:    6 NGARHVVETAEFALNILKKIKDIRFTLFSEIEVLLKTGIHSGTVVAGIIGNLMPRYCLFGDTVNTTSRMKTYCHENRIHVSKTFANLAERFTI-YNVEYRGIVDIKGKGKMNTFWL 350
            NG+RH  E A  +L+IL  +   +     E+ V ++ G+HSG VVAG++G  MPRYCLFGDTVNT SRM++     RIHVS +   + +  +  Y VE RG  ++KGKG   TFWL
Sbjct:  945 NGSRHAAEIANMSLDILSSVGTFKMRHMPEVPVRIRIGLHSGPVVAGVVGLTMPRYCLFGDTVNTASRMESTGLPYRIHVSLSTVTILQNLSEGYEVELRGRTELKGKGTEETFWL 1060          
BLAST of Guanylate cyclase vs. Ensembl Human
Match: NPR2 (natriuretic peptide receptor 2 [Source:HGNC Symbol;Acc:HGNC:7944])

HSP 1 Score: 111.694 bits (278), Expect = 6.358e-29
Identity = 52/115 (45.22%), Postives = 71/115 (61.74%), Query Frame = 3
Query:    6 NGARHVVETAEFALNILKKIKDIRFTLFSEIEVLLKTGIHSGTVVAGIIGNLMPRYCLFGDTVNTTSRMKTYCHENRIHVSKTFANLAERFTIYNVEYRGIVDIKGKGKMNTFWL 350
            NG RH  E A  AL +L  +   R       ++ L+ G+H+G V AG++G  MPRYCLFGDTVNT SRM++     +IHVS T  +  +    + +E RG V++KGKGKM T+WL
Sbjct:  922 NGQRHAPEIARMALALLDAVSSFRIRHRPHDQLRLRIGVHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGQALKIHVSSTTKDALDELGCFQLELRGDVEMKGKGKMRTYWL 1036          
BLAST of Guanylate cyclase vs. Ensembl Human
Match: GUCY2D (guanylate cyclase 2D, retinal [Source:HGNC Symbol;Acc:HGNC:4689])

HSP 1 Score: 110.538 bits (275), Expect = 1.619e-28
Identity = 56/119 (47.06%), Postives = 72/119 (60.50%), Query Frame = 3
Query:    6 NGARHVVETAEFALNILKKIKDIRFTLFSEIEVLLKTGIHSGTVVAGIIGNLMPRYCLFGDTVNTTSRMKTYCHENRIHVS-KTFANLAERFTIYNVEYRGIVDIKGKGKMNTFWLNSR 359
            NG RH  E A  +L+IL  +   R     E+ V ++ G+HSG  VAG++G  MPRYCLFGDTVNT SRM++     RIHV+  T   L    + Y VE RG  ++KGKG  +TFWL  R
Sbjct:  941 NGQRHAAEIANMSLDILSAVGTFRMRHMPEVPVRIRIGLHSGPCVAGVVGLTMPRYCLFGDTVNTASRMESTGLPYRIHVNLSTVGILRALDSGYQVELRGRTELKGKGAEDTFWLVGR 1059          
BLAST of Guanylate cyclase vs. Ensembl Human
Match: NPR1 (natriuretic peptide receptor 1 [Source:HGNC Symbol;Acc:HGNC:7943])

HSP 1 Score: 108.227 bits (269), Expect = 1.037e-27
Identity = 51/115 (44.35%), Postives = 72/115 (62.61%), Query Frame = 3
Query:    6 NGARHVVETAEFALNILKKIKDIRFTLFSEIEVLLKTGIHSGTVVAGIIGNLMPRYCLFGDTVNTTSRMKTYCHENRIHVSKTFANLAERFTIYNVEYRGIVDIKGKGKMNTFWL 350
            NG  H  E A  AL +L  ++  R     + ++ L+ GIH+G V AG++G  MPRYCLFGDTVNT SRM++     +IH+S     + E F  + +E RG V++KGKGK+ T+WL
Sbjct:  937 NGRLHACEVARMALALLDAVRSFRIRHRPQEQLRLRIGIHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGEALKIHLSSETKAVLEEFGGFELELRGDVEMKGKGKVRTYWL 1051          
BLAST of Guanylate cyclase vs. Ensembl Human
Match: GUCY2C (guanylate cyclase 2C [Source:HGNC Symbol;Acc:HGNC:4688])

HSP 1 Score: 93.9745 bits (232), Expect = 1.120e-22
Identity = 50/127 (39.37%), Postives = 69/127 (54.33%), Query Frame = 3
Query:    6 NGARHVVETAEFALNILKKIKDIRFTLFSEIEVLLKTGIHSGTVVAGIIGNLMPRYCLFGDTVNTTSRMKTYCHENRIHVS-KTFANLAERFTIYNVEYRGIVDIKGKGKMNTFWLNSRIEESSQRP 383
            NG RH ++ A+ AL IL  +          + + ++ G+HSG   AG++G  MPRYCLFGDTVNT SRM++     RIHVS  T A L      +  E RG   +KG+G   T+WL    ++    P
Sbjct:  885 NGNRHAIDIAKMALEILSFMGTFELEHLPGLPIWIRIGVHSGPCAAGVVGIKMPRYCLFGDTVNTASRMESTGLPLRIHVSGSTIAILKRTECQFLYEVRGETYLKGRGNETTYWLTGMKDQKFNLP 1011          
BLAST of Guanylate cyclase vs. Ensembl Celegans
Match: gcy-13 (Receptor-type guanylate cyclase gcy-13 [Source:UniProtKB/Swiss-Prot;Acc:Q19768])

HSP 1 Score: 105.531 bits (262), Expect = 4.076e-27
Identity = 53/124 (42.74%), Postives = 74/124 (59.68%), Query Frame = 3
Query:    6 NGARHVVETAEFALNILKKIKDIRFTLFSEIEVLLKTGIHSGTVVAGIIGNLMPRYCLFGDTVNTTSRMKTYCHENRIHVSK-TFANLAERFTIYNVEYRGIVDIKGKGKMNTFWLNSRIEESS 374
            NG  HV   A  +L ++  ++  +     + +V ++ G+HSG+ VAG++G  MPRYCLFGDTVNT SRM++      IH+S   +  L   +  YN E RG V IKGKG M T+WL    EES+
Sbjct:  905 NGTEHVANIANMSLELMDSLQAFKIPHLPQEKVQIRIGMHSGSCVAGVVGLTMPRYCLFGDTVNTASRMESNGKPGFIHLSSDCYDLLTSLYKEYNTESRGEVIIKGKGVMQTYWLLGMKEESA 1028          
BLAST of Guanylate cyclase vs. Ensembl Celegans
Match: gcy-28 (Receptor-type guanylate cyclase gcy-28 [Source:UniProtKB/Swiss-Prot;Acc:Q86GV3])

HSP 1 Score: 101.679 bits (252), Expect = 9.535e-26
Identity = 47/111 (42.34%), Postives = 75/111 (67.57%), Query Frame = 3
Query:   18 HVVETAEFALNILKKIKDIRFTLFSEIEVLLKTGIHSGTVVAGIIGNLMPRYCLFGDTVNTTSRMKTYCHENRIHVSKTFANLAERFTIYNVEYRGIVDIKGKGKMNTFWL 350
            H  + A+ +L++L K+K+         ++ L+ G+HSG+VVAG++G+ MPRYCLFGDTVNT+SRM++     +IHVS+   ++  +   + +E RG V++KGKG   T+WL
Sbjct: 1091 HANQIAQMSLSLLHKVKNFVIRHRPHEQLKLRIGMHSGSVVAGVVGSKMPRYCLFGDTVNTSSRMESNGLPLKIHVSQQTYDILMQEAGFKLELRGSVEMKGKGMQTTYWL 1201          
BLAST of Guanylate cyclase vs. Ensembl Celegans
Match: gcy-28 (Receptor-type guanylate cyclase gcy-28 [Source:UniProtKB/Swiss-Prot;Acc:Q86GV3])

HSP 1 Score: 101.679 bits (252), Expect = 9.546e-26
Identity = 47/111 (42.34%), Postives = 75/111 (67.57%), Query Frame = 3
Query:   18 HVVETAEFALNILKKIKDIRFTLFSEIEVLLKTGIHSGTVVAGIIGNLMPRYCLFGDTVNTTSRMKTYCHENRIHVSKTFANLAERFTIYNVEYRGIVDIKGKGKMNTFWL 350
            H  + A+ +L++L K+K+         ++ L+ G+HSG+VVAG++G+ MPRYCLFGDTVNT+SRM++     +IHVS+   ++  +   + +E RG V++KGKG   T+WL
Sbjct: 1112 HANQIAQMSLSLLHKVKNFVIRHRPHEQLKLRIGMHSGSVVAGVVGSKMPRYCLFGDTVNTSSRMESNGLPLKIHVSQQTYDILMQEAGFKLELRGSVEMKGKGMQTTYWL 1222          
BLAST of Guanylate cyclase vs. Ensembl Celegans
Match: gcy-28 (Receptor-type guanylate cyclase gcy-28 [Source:UniProtKB/Swiss-Prot;Acc:Q86GV3])

HSP 1 Score: 101.679 bits (252), Expect = 9.565e-26
Identity = 47/111 (42.34%), Postives = 75/111 (67.57%), Query Frame = 3
Query:   18 HVVETAEFALNILKKIKDIRFTLFSEIEVLLKTGIHSGTVVAGIIGNLMPRYCLFGDTVNTTSRMKTYCHENRIHVSKTFANLAERFTIYNVEYRGIVDIKGKGKMNTFWL 350
            H  + A+ +L++L K+K+         ++ L+ G+HSG+VVAG++G+ MPRYCLFGDTVNT+SRM++     +IHVS+   ++  +   + +E RG V++KGKG   T+WL
Sbjct: 1150 HANQIAQMSLSLLHKVKNFVIRHRPHEQLKLRIGMHSGSVVAGVVGSKMPRYCLFGDTVNTSSRMESNGLPLKIHVSQQTYDILMQEAGFKLELRGSVEMKGKGMQTTYWL 1260          
BLAST of Guanylate cyclase vs. Ensembl Celegans
Match: gcy-21 (Receptor-type guanylate cyclase gcy-21 [Source:UniProtKB/Swiss-Prot;Acc:O16715])

HSP 1 Score: 100.908 bits (250), Expect = 1.524e-25
Identity = 50/116 (43.10%), Postives = 72/116 (62.07%), Query Frame = 3
Query:    3 PNGARHVVETAEFALNILKKIKDIRFTLFSEIEVLLKTGIHSGTVVAGIIGNLMPRYCLFGDTVNTTSRMKTYCHENRIHVSKTFANLAERFTIYNVEYRGIVDIKGKGKMNTFWL 350
            PNG  H  E A   L +LK ++  +       +V L+ G++SG  VAG++G  MPRYCLFGDTVNT SRM++     RI+ S T   + ++   Y +E RGIV++KGKGK  T+++
Sbjct:  900 PNGNHHAGEIASLGLALLKAVESFKIRHLPNEKVRLRIGMNSGPCVAGVVGLKMPRYCLFGDTVNTASRMESNGIPLRINCSGTAKEILDQLGGYEIEERGIVEMKGKGKQMTYFV 1015          
BLAST of Guanylate cyclase vs. Ensembl Fly
Match: CG3216 (gene:FBgn0034568 transcript:FBtr0273397)

HSP 1 Score: 120.168 bits (300), Expect = 3.459e-32
Identity = 54/127 (42.52%), Postives = 80/127 (62.99%), Query Frame = 3
Query:    3 PNGARHVVETAEFALNILKKIKDIRFTLFSEIEVLLKTGIHSGTVVAGIIGNLMPRYCLFGDTVNTTSRMKTYCHENRIHVSKTFANLAERFTIYNVEYRGIVDIKGKGKMNTFWLNSRIEESSQRP 383
            PNG +H  E A  AL+IL+ +         E ++ ++ G+HSG+V AG++G  MP YCLFGDTVNT SRM++     +IHVS     + ++F  + +E RG V++KGKG + T+WLNS  E  ++ P
Sbjct:  949 PNGDKHAREIALMALDILRAVSSFNLRHKPEYKIQIRIGMHSGSVCAGVVGKKMPHYCLFGDTVNTASRMESTGQPGKIHVSSATKAILDKFGTFQMEQRGDVELKGKGTVTTYWLNSTSEGEARPP 1075          
BLAST of Guanylate cyclase vs. Ensembl Fly
Match: CG3216 (gene:FBgn0034568 transcript:FBtr0273396)

HSP 1 Score: 120.168 bits (300), Expect = 3.542e-32
Identity = 54/127 (42.52%), Postives = 80/127 (62.99%), Query Frame = 3
Query:    3 PNGARHVVETAEFALNILKKIKDIRFTLFSEIEVLLKTGIHSGTVVAGIIGNLMPRYCLFGDTVNTTSRMKTYCHENRIHVSKTFANLAERFTIYNVEYRGIVDIKGKGKMNTFWLNSRIEESSQRP 383
            PNG +H  E A  AL+IL+ +         E ++ ++ G+HSG+V AG++G  MP YCLFGDTVNT SRM++     +IHVS     + ++F  + +E RG V++KGKG + T+WLNS  E  ++ P
Sbjct: 1014 PNGDKHAREIALMALDILRAVSSFNLRHKPEYKIQIRIGMHSGSVCAGVVGKKMPHYCLFGDTVNTASRMESTGQPGKIHVSSATKAILDKFGTFQMEQRGDVELKGKGTVTTYWLNSTSEGEARPP 1140          
BLAST of Guanylate cyclase vs. Ensembl Fly
Match: CG33958 (gene:FBgn0053958 transcript:FBtr0099994)

HSP 1 Score: 110.923 bits (276), Expect = 5.223e-29
Identity = 49/118 (41.53%), Postives = 76/118 (64.41%), Query Frame = 3
Query:    6 NGARHVVETAEFALNILKKIKDIRFTLFSEIEVLLKTGIHSGTVVAGIIGNLMPRYCLFGDTVNTTSRMKTYCHENRIHVSKTFANLAERFTIYNVEYRGIVDIKGKGKMNTFWLNSR 359
            NG +H+ E A  AL++L      R     +  V ++ G+H+G VVAGI+G  MPRYCLFGDTVNT SRM++     +IH+++   +  ++   +  E+RG++D+KGKG M+T+WL  +
Sbjct:  555 NGNKHISEIATMALDLLDASSVFRIPRAGDEFVQIRCGVHTGPVVAGIVGTKMPRYCLFGDTVNTASRMESTGEAQKIHITEEMHDSLQQVGGFRTEHRGLIDVKGKGLMSTYWLTCK 672          
BLAST of Guanylate cyclase vs. Ensembl Fly
Match: Gyc32E (gene:FBgn0010197 transcript:FBtr0112856)

HSP 1 Score: 110.538 bits (275), Expect = 7.501e-29
Identity = 55/127 (43.31%), Postives = 75/127 (59.06%), Query Frame = 3
Query:    6 NGARHVVETAEFALNILKKIKDIRFTLFSEIEVLLKTGIHSGTVVAGIIGNLMPRYCLFGDTVNTTSRMKTYCHENRIHVSKTFANLAERFTIYNVEYRGIVDIKGKGKMNTFWLNSRIEESSQRPE 386
            NG+RH  E A  AL++L+ + +++        V L+ G+HSG   AG++G  MPRYCLFGDTVNT SRM++     RIH+S+    L +    Y    RG+  IKGKG M T+WL  R     Q+PE
Sbjct:  962 NGSRHAGEIASLALHLLETVGNLKIRHKPTETVQLRIGVHSGPCAAGVVGQKMPRYCLFGDTVNTASRMESTGDSMRIHISEATYQLLQVIGSYVCIERGLTSIKGKGDMRTYWLTKR-----QQPE 1083          
BLAST of Guanylate cyclase vs. Ensembl Fly
Match: Gyc32E (gene:FBgn0010197 transcript:FBtr0343625)

HSP 1 Score: 110.538 bits (275), Expect = 7.784e-29
Identity = 55/127 (43.31%), Postives = 75/127 (59.06%), Query Frame = 3
Query:    6 NGARHVVETAEFALNILKKIKDIRFTLFSEIEVLLKTGIHSGTVVAGIIGNLMPRYCLFGDTVNTTSRMKTYCHENRIHVSKTFANLAERFTIYNVEYRGIVDIKGKGKMNTFWLNSRIEESSQRPE 386
            NG+RH  E A  AL++L+ + +++        V L+ G+HSG   AG++G  MPRYCLFGDTVNT SRM++     RIH+S+    L +    Y    RG+  IKGKG M T+WL  R     Q+PE
Sbjct:  934 NGSRHAGEIASLALHLLETVGNLKIRHKPTETVQLRIGVHSGPCAAGVVGQKMPRYCLFGDTVNTASRMESTGDSMRIHISEATYQLLQVIGSYVCIERGLTSIKGKGDMRTYWLTKR-----QQPE 1055          
BLAST of Guanylate cyclase vs. Ensembl Zebrafish
Match: si:ch211-215j19.12 (si:ch211-215j19.12 [Source:ZFIN;Acc:ZDB-GENE-141212-103])

HSP 1 Score: 107.842 bits (268), Expect = 3.597e-30
Identity = 48/115 (41.74%), Postives = 71/115 (61.74%), Query Frame = 3
Query:    6 NGARHVVETAEFALNILKKIKDIRFTLFSEIEVLLKTGIHSGTVVAGIIGNLMPRYCLFGDTVNTTSRMKTYCHENRIHVSKTFANLAERFTIYNVEYRGIVDIKGKGKMNTFWL 350
            NG RH  E A+ +L+++  ++ +         + L+ GIH+G  VAG++G  MPRYCLFGDTVNT SRM++     +IH S        +   Y ++ RG V++KGKGKM+T+WL
Sbjct:   63 NGDRHADEIAKMSLDLVAAVRQVPIPHMPTKRLQLRAGIHTGPCVAGVVGYKMPRYCLFGDTVNTASRMESTSLPQKIHASSATYLALMKDNAYELQLRGEVEVKGKGKMDTYWL 177          
BLAST of Guanylate cyclase vs. Ensembl Zebrafish
Match: CABZ01078606.1 (atrial natriuretic peptide receptor 1-like [Source:NCBI gene;Acc:100333871])

HSP 1 Score: 109.383 bits (272), Expect = 4.292e-30
Identity = 51/126 (40.48%), Postives = 74/126 (58.73%), Query Frame = 3
Query:    6 NGARHVVETAEFALNILKKIKDIRFTLFSEIEVLLKTGIHSGTVVAGIIGNLMPRYCLFGDTVNTTSRMKTYCHENRIHVSKTFANLAERFTIYNVEYRGIVDIKGKGKMNTFWLNSRIEESSQRP 383
            NG  H  E A  AL+++   K  R     + ++ ++ GIHSG VVAG++G  MPRYCLFGDTVNT SRM++     +I  S +   L E    Y +  RG++ +KGKG M T+WL  +  +  ++P
Sbjct:   86 NGILHASEIANMALDLVSVCKTFRIPHRPQTQLQIRAGIHSGPVVAGVVGTKMPRYCLFGDTVNTASRMESTSEALKIQCSSSAFYLLEEIGGYLLTCRGLLQVKGKGDMVTYWLEGKCSKDMKKP 211          
BLAST of Guanylate cyclase vs. Ensembl Zebrafish
Match: npr1a (natriuretic peptide receptor 1a [Source:ZFIN;Acc:ZDB-GENE-060503-539])

HSP 1 Score: 111.694 bits (278), Expect = 4.293e-29
Identity = 52/123 (42.28%), Postives = 76/123 (61.79%), Query Frame = 3
Query:    6 NGARHVVETAEFALNILKKIKDIRFTLFSEIEVLLKTGIHSGTVVAGIIGNLMPRYCLFGDTVNTTSRMKTYCHENRIHVSKTFANLAERFTIYNVEYRGIVDIKGKGKMNTFWLNSRIEESS 374
            NG  H  E A  +L +L+ +   R      +++ L+ GIHSG V AG++G  MPRYCLFGDTVNT SRM++     +IHVS+    + + F  + +E RG V++KGKG+M T+WL   I  ++
Sbjct:  944 NGKLHAREIARMSLALLEAVHSFRIRHRPNLQLRLRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGEALKIHVSEATRAVLQEFNCFQLELRGDVEMKGKGRMRTYWLLGEISSNN 1066          
BLAST of Guanylate cyclase vs. Ensembl Zebrafish
Match: npr1a (natriuretic peptide receptor 1a [Source:ZFIN;Acc:ZDB-GENE-060503-539])

HSP 1 Score: 111.694 bits (278), Expect = 4.293e-29
Identity = 52/123 (42.28%), Postives = 76/123 (61.79%), Query Frame = 3
Query:    6 NGARHVVETAEFALNILKKIKDIRFTLFSEIEVLLKTGIHSGTVVAGIIGNLMPRYCLFGDTVNTTSRMKTYCHENRIHVSKTFANLAERFTIYNVEYRGIVDIKGKGKMNTFWLNSRIEESS 374
            NG  H  E A  +L +L+ +   R      +++ L+ GIHSG V AG++G  MPRYCLFGDTVNT SRM++     +IHVS+    + + F  + +E RG V++KGKG+M T+WL   I  ++
Sbjct:  944 NGKLHAREIARMSLALLEAVHSFRIRHRPNLQLRLRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGEALKIHVSEATRAVLQEFNCFQLELRGDVEMKGKGRMRTYWLLGEISSNN 1066          
BLAST of Guanylate cyclase vs. Ensembl Zebrafish
Match: npr1b (natriuretic peptide receptor 1b [Source:ZFIN;Acc:ZDB-GENE-100805-4])

HSP 1 Score: 110.153 bits (274), Expect = 1.462e-28
Identity = 52/115 (45.22%), Postives = 74/115 (64.35%), Query Frame = 3
Query:    6 NGARHVVETAEFALNILKKIKDIRFTLFSEIEVLLKTGIHSGTVVAGIIGNLMPRYCLFGDTVNTTSRMKTYCHENRIHVSKTFANLAERFTIYNVEYRGIVDIKGKGKMNTFWL 350
            NG  H  E A  +L +L+ +K  +     + ++ L+ GIHSG V AG++G  MPRYCLFGDTVNT+SRM++     +IHVS     + + F  + +E RG V++KGKGKM T+WL
Sbjct:  695 NGKLHGREIARMSLALLEAVKTFKIRHRPDEQLKLRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTSSRMESNGEPLKIHVSSATRAVLQEFNCFQLELRGDVEMKGKGKMRTYWL 809          
BLAST of Guanylate cyclase vs. Ensembl Xenopus
Match: ENSXETT00000003411.1 (retinal guanylyl cyclase 2-like [Source:NCBI gene;Acc:100489435])

HSP 1 Score: 108.227 bits (269), Expect = 1.149e-27
Identity = 54/119 (45.38%), Postives = 73/119 (61.34%), Query Frame = 3
Query:    6 NGARHVVETAEFALNILKKIKDIRFTLFSEIEVLLKTGIHSGTVVAGIIGNLMPRYCLFGDTVNTTSRMKTYCHENRIHVSKTFA----NLAERFTIYNVEYRGIVDIKGKGKMNTFWL 350
            NG RH  E A  +L+IL  +   +     ++ V ++ G+HSG  VAG++G  MPRYCLFGDTVNT SRM++     RIHV+++ A     L ER   Y +E RG  ++KGKG   TFWL
Sbjct:  888 NGNRHTAEIANMSLDILSSVGSFQMRHMPDVPVRIRIGLHSGPCVAGVVGLTMPRYCLFGDTVNTASRMESTGLPYRIHVNQSTAAILRTLNER---YKIELRGKTELKGKGVEETFWL 1003          
BLAST of Guanylate cyclase vs. Ensembl Xenopus
Match: ENSXETT00000003039.1 (retinal guanylyl cyclase 2-like [Source:NCBI gene;Acc:100489435])

HSP 1 Score: 108.227 bits (269), Expect = 1.151e-27
Identity = 54/119 (45.38%), Postives = 73/119 (61.34%), Query Frame = 3
Query:    6 NGARHVVETAEFALNILKKIKDIRFTLFSEIEVLLKTGIHSGTVVAGIIGNLMPRYCLFGDTVNTTSRMKTYCHENRIHVSKTFA----NLAERFTIYNVEYRGIVDIKGKGKMNTFWL 350
            NG RH  E A  +L+IL  +   +     ++ V ++ G+HSG  VAG++G  MPRYCLFGDTVNT SRM++     RIHV+++ A     L ER   Y +E RG  ++KGKG   TFWL
Sbjct:  895 NGNRHTAEIANMSLDILSSVGSFQMRHMPDVPVRIRIGLHSGPCVAGVVGLTMPRYCLFGDTVNTASRMESTGLPYRIHVNQSTAAILRTLNER---YKIELRGKTELKGKGVEETFWL 1010          
BLAST of Guanylate cyclase vs. Ensembl Xenopus
Match: ENSXETT00000003361.1 (retinal guanylyl cyclase 2-like [Source:NCBI gene;Acc:100489435])

HSP 1 Score: 108.227 bits (269), Expect = 1.153e-27
Identity = 54/119 (45.38%), Postives = 73/119 (61.34%), Query Frame = 3
Query:    6 NGARHVVETAEFALNILKKIKDIRFTLFSEIEVLLKTGIHSGTVVAGIIGNLMPRYCLFGDTVNTTSRMKTYCHENRIHVSKTFA----NLAERFTIYNVEYRGIVDIKGKGKMNTFWL 350
            NG RH  E A  +L+IL  +   +     ++ V ++ G+HSG  VAG++G  MPRYCLFGDTVNT SRM++     RIHV+++ A     L ER   Y +E RG  ++KGKG   TFWL
Sbjct:  920 NGNRHTAEIANMSLDILSSVGSFQMRHMPDVPVRIRIGLHSGPCVAGVVGLTMPRYCLFGDTVNTASRMESTGLPYRIHVNQSTAAILRTLNER---YKIELRGKTELKGKGVEETFWL 1035          
BLAST of Guanylate cyclase vs. Ensembl Xenopus
Match: ENSXETT00000003372.1 (retinal guanylyl cyclase 2-like [Source:NCBI gene;Acc:100489435])

HSP 1 Score: 108.227 bits (269), Expect = 1.154e-27
Identity = 54/119 (45.38%), Postives = 73/119 (61.34%), Query Frame = 3
Query:    6 NGARHVVETAEFALNILKKIKDIRFTLFSEIEVLLKTGIHSGTVVAGIIGNLMPRYCLFGDTVNTTSRMKTYCHENRIHVSKTFA----NLAERFTIYNVEYRGIVDIKGKGKMNTFWL 350
            NG RH  E A  +L+IL  +   +     ++ V ++ G+HSG  VAG++G  MPRYCLFGDTVNT SRM++     RIHV+++ A     L ER   Y +E RG  ++KGKG   TFWL
Sbjct:  942 NGNRHTAEIANMSLDILSSVGSFQMRHMPDVPVRIRIGLHSGPCVAGVVGLTMPRYCLFGDTVNTASRMESTGLPYRIHVNQSTAAILRTLNER---YKIELRGKTELKGKGVEETFWL 1057          
BLAST of Guanylate cyclase vs. Ensembl Xenopus
Match: ENSXETT00000002882.1 (retinal guanylyl cyclase 2-like [Source:NCBI gene;Acc:100489435])

HSP 1 Score: 108.227 bits (269), Expect = 1.155e-27
Identity = 54/119 (45.38%), Postives = 73/119 (61.34%), Query Frame = 3
Query:    6 NGARHVVETAEFALNILKKIKDIRFTLFSEIEVLLKTGIHSGTVVAGIIGNLMPRYCLFGDTVNTTSRMKTYCHENRIHVSKTFA----NLAERFTIYNVEYRGIVDIKGKGKMNTFWL 350
            NG RH  E A  +L+IL  +   +     ++ V ++ G+HSG  VAG++G  MPRYCLFGDTVNT SRM++     RIHV+++ A     L ER   Y +E RG  ++KGKG   TFWL
Sbjct:  945 NGNRHTAEIANMSLDILSSVGSFQMRHMPDVPVRIRIGLHSGPCVAGVVGLTMPRYCLFGDTVNTASRMESTGLPYRIHVNQSTAAILRTLNER---YKIELRGKTELKGKGVEETFWL 1060          
BLAST of Guanylate cyclase vs. Ensembl Mouse
Match: Gucy2d (guanylate cyclase 2d [Source:MGI Symbol;Acc:MGI:106030])

HSP 1 Score: 107.071 bits (266), Expect = 7.932e-30
Identity = 52/120 (43.33%), Postives = 72/120 (60.00%), Query Frame = 3
Query:    6 NGARHVVETAEFALNILKKIKDIRFTLFSEIEVLLKTGIHSGTVVAGIIGNLMPRYCLFGDTVNTTSRMKTYCHENRIHVSK-TFANLAERFTIYNVEYRGIVDIKGKGKMNTFWLNSRI 362
            NG RH  E A  AL+IL    + R     ++ + ++ G+HSG  VAG++G  MPRYCLFGDTVNT SRM++     RIHVS+ T   L      Y ++ RG  ++KGKG   T+WL  ++
Sbjct:   44 NGNRHAAEIANLALDILSYAGNFRMRHAPDVPIRVRAGLHSGPCVAGVVGLTMPRYCLFGDTVNTASRMESTGLPYRIHVSQSTVQALLSLDEGYKIDVRGQTELKGKGLEETYWLTGKV 163          
BLAST of Guanylate cyclase vs. Ensembl Mouse
Match: Gucy2f (guanylate cyclase 2f [Source:MGI Symbol;Acc:MGI:105119])

HSP 1 Score: 112.849 bits (281), Expect = 2.140e-29
Identity = 54/116 (46.55%), Postives = 73/116 (62.93%), Query Frame = 3
Query:    6 NGARHVVETAEFALNILKKIKDIRFTLFSEIEVLLKTGIHSGTVVAGIIGNLMPRYCLFGDTVNTTSRMKTYCHENRIHVSKTFANLAERFTI-YNVEYRGIVDIKGKGKMNTFWL 350
            NG+RH  E A  +L+IL  +   +     E+ V ++ G+HSG VVAG++G  MPRYCLFGDTVNT SRM++     RIHVS +   + +  +  Y VE RG  ++KGKG   TFWL
Sbjct:  945 NGSRHAAEIANMSLDILSSVGTFKMRHMPEVPVRIRIGLHSGPVVAGVVGLTMPRYCLFGDTVNTASRMESTGLPYRIHVSLSTVTILQTLSEGYEVELRGRTELKGKGTEETFWL 1060          
BLAST of Guanylate cyclase vs. Ensembl Mouse
Match: Npr2 (natriuretic peptide receptor 2 [Source:MGI Symbol;Acc:MGI:97372])

HSP 1 Score: 111.694 bits (278), Expect = 3.704e-29
Identity = 52/115 (45.22%), Postives = 71/115 (61.74%), Query Frame = 3
Query:    6 NGARHVVETAEFALNILKKIKDIRFTLFSEIEVLLKTGIHSGTVVAGIIGNLMPRYCLFGDTVNTTSRMKTYCHENRIHVSKTFANLAERFTIYNVEYRGIVDIKGKGKMNTFWL 350
            NG RH  E A  AL +L  +   R       ++ L+ G+H+G V AG++G  MPRYCLFGDTVNT SRM++     +IHVS T  +  +    + +E RG V++KGKGKM T+WL
Sbjct:  488 NGQRHAPEIARMALALLDAVSSFRIRHRPHDQLRLRIGVHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGQALKIHVSSTTKDALDELGCFQLELRGDVEMKGKGKMRTYWL 602          
BLAST of Guanylate cyclase vs. Ensembl Mouse
Match: Npr2 (natriuretic peptide receptor 2 [Source:MGI Symbol;Acc:MGI:97372])

HSP 1 Score: 111.694 bits (278), Expect = 4.365e-29
Identity = 52/115 (45.22%), Postives = 71/115 (61.74%), Query Frame = 3
Query:    6 NGARHVVETAEFALNILKKIKDIRFTLFSEIEVLLKTGIHSGTVVAGIIGNLMPRYCLFGDTVNTTSRMKTYCHENRIHVSKTFANLAERFTIYNVEYRGIVDIKGKGKMNTFWL 350
            NG RH  E A  AL +L  +   R       ++ L+ G+H+G V AG++G  MPRYCLFGDTVNT SRM++     +IHVS T  +  +    + +E RG V++KGKGKM T+WL
Sbjct:  922 NGQRHAPEIARMALALLDAVSSFRIRHRPHDQLRLRIGVHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGQALKIHVSSTTKDALDELGCFQLELRGDVEMKGKGKMRTYWL 1036          
BLAST of Guanylate cyclase vs. Ensembl Mouse
Match: Npr1 (natriuretic peptide receptor 1 [Source:MGI Symbol;Acc:MGI:97371])

HSP 1 Score: 109.383 bits (272), Expect = 2.781e-28
Identity = 52/115 (45.22%), Postives = 72/115 (62.61%), Query Frame = 3
Query:    6 NGARHVVETAEFALNILKKIKDIRFTLFSEIEVLLKTGIHSGTVVAGIIGNLMPRYCLFGDTVNTTSRMKTYCHENRIHVSKTFANLAERFTIYNVEYRGIVDIKGKGKMNTFWL 350
            NG  H  E A  AL +L  ++  R     + ++ L+ GIH+G V AG++G  MPRYCLFGDTVNT SRM++     RIH+S     + E F  + +E RG V++KGKGK+ T+WL
Sbjct:  933 NGQLHAREVARMALALLDAVRSFRIRHRPQEQLRLRIGIHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGEALRIHLSSETKAVLEEFDGFELELRGDVEMKGKGKVRTYWL 1047          
BLAST of Guanylate cyclase vs. UniProt/SwissProt
Match: sp|P51841|GUC2F_HUMAN (Retinal guanylyl cyclase 2 OS=Homo sapiens OX=9606 GN=GUCY2F PE=1 SV=2)

HSP 1 Score: 112.849 bits (281), Expect = 1.186e-28
Identity = 54/116 (46.55%), Postives = 73/116 (62.93%), Query Frame = 3
Query:    6 NGARHVVETAEFALNILKKIKDIRFTLFSEIEVLLKTGIHSGTVVAGIIGNLMPRYCLFGDTVNTTSRMKTYCHENRIHVSKTFANLAERFTI-YNVEYRGIVDIKGKGKMNTFWL 350
            NG+RH  E A  +L+IL  +   +     E+ V ++ G+HSG VVAG++G  MPRYCLFGDTVNT SRM++     RIHVS +   + +  +  Y VE RG  ++KGKG   TFWL
Sbjct:  945 NGSRHAAEIANMSLDILSSVGTFKMRHMPEVPVRIRIGLHSGPVVAGVVGLTMPRYCLFGDTVNTASRMESTGLPYRIHVSLSTVTILQNLSEGYEVELRGRTELKGKGTEETFWL 1060          
BLAST of Guanylate cyclase vs. UniProt/SwissProt
Match: sp|Q5SDA5|GUC2F_MOUSE (Retinal guanylyl cyclase 2 OS=Mus musculus OX=10090 GN=Gucy2f PE=1 SV=1)

HSP 1 Score: 112.849 bits (281), Expect = 1.497e-28
Identity = 54/116 (46.55%), Postives = 73/116 (62.93%), Query Frame = 3
Query:    6 NGARHVVETAEFALNILKKIKDIRFTLFSEIEVLLKTGIHSGTVVAGIIGNLMPRYCLFGDTVNTTSRMKTYCHENRIHVSKTFANLAERFTI-YNVEYRGIVDIKGKGKMNTFWL 350
            NG+RH  E A  +L+IL  +   +     E+ V ++ G+HSG VVAG++G  MPRYCLFGDTVNT SRM++     RIHVS +   + +  +  Y VE RG  ++KGKG   TFWL
Sbjct:  945 NGSRHAAEIANMSLDILSSVGTFKMRHMPEVPVRIRIGLHSGPVVAGVVGLTMPRYCLFGDTVNTASRMESTGLPYRIHVSLSTVTILQTLSEGYEVELRGRTELKGKGTEETFWL 1060          
BLAST of Guanylate cyclase vs. UniProt/SwissProt
Match: sp|P16067|ANPRB_RAT (Atrial natriuretic peptide receptor 2 OS=Rattus norvegicus OX=10116 GN=Npr2 PE=1 SV=1)

HSP 1 Score: 111.694 bits (278), Expect = 3.053e-28
Identity = 52/115 (45.22%), Postives = 71/115 (61.74%), Query Frame = 3
Query:    6 NGARHVVETAEFALNILKKIKDIRFTLFSEIEVLLKTGIHSGTVVAGIIGNLMPRYCLFGDTVNTTSRMKTYCHENRIHVSKTFANLAERFTIYNVEYRGIVDIKGKGKMNTFWL 350
            NG RH  E A  AL +L  +   R       ++ L+ G+H+G V AG++G  MPRYCLFGDTVNT SRM++     +IHVS T  +  +    + +E RG V++KGKGKM T+WL
Sbjct:  922 NGQRHAPEIARMALALLDAVSSFRIRHRPHDQLRLRIGVHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGQALKIHVSSTTKDALDELGCFQLELRGDVEMKGKGKMRTYWL 1036          
BLAST of Guanylate cyclase vs. UniProt/SwissProt
Match: sp|Q6VVW5|ANPRB_MOUSE (Atrial natriuretic peptide receptor 2 OS=Mus musculus OX=10090 GN=Npr2 PE=1 SV=2)

HSP 1 Score: 111.694 bits (278), Expect = 3.053e-28
Identity = 52/115 (45.22%), Postives = 71/115 (61.74%), Query Frame = 3
Query:    6 NGARHVVETAEFALNILKKIKDIRFTLFSEIEVLLKTGIHSGTVVAGIIGNLMPRYCLFGDTVNTTSRMKTYCHENRIHVSKTFANLAERFTIYNVEYRGIVDIKGKGKMNTFWL 350
            NG RH  E A  AL +L  +   R       ++ L+ G+H+G V AG++G  MPRYCLFGDTVNT SRM++     +IHVS T  +  +    + +E RG V++KGKGKM T+WL
Sbjct:  922 NGQRHAPEIARMALALLDAVSSFRIRHRPHDQLRLRIGVHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGQALKIHVSSTTKDALDELGCFQLELRGDVEMKGKGKMRTYWL 1036          
BLAST of Guanylate cyclase vs. UniProt/SwissProt
Match: sp|P20594|ANPRB_HUMAN (Atrial natriuretic peptide receptor 2 OS=Homo sapiens OX=9606 GN=NPR2 PE=1 SV=1)

HSP 1 Score: 111.694 bits (278), Expect = 3.053e-28
Identity = 52/115 (45.22%), Postives = 71/115 (61.74%), Query Frame = 3
Query:    6 NGARHVVETAEFALNILKKIKDIRFTLFSEIEVLLKTGIHSGTVVAGIIGNLMPRYCLFGDTVNTTSRMKTYCHENRIHVSKTFANLAERFTIYNVEYRGIVDIKGKGKMNTFWL 350
            NG RH  E A  AL +L  +   R       ++ L+ G+H+G V AG++G  MPRYCLFGDTVNT SRM++     +IHVS T  +  +    + +E RG V++KGKGKM T+WL
Sbjct:  922 NGQRHAPEIARMALALLDAVSSFRIRHRPHDQLRLRIGVHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGQALKIHVSSTTKDALDELGCFQLELRGDVEMKGKGKMRTYWL 1036          
BLAST of Guanylate cyclase vs. TrEMBL
Match: R7VIV0 (Guanylate cyclase domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_148998 PE=4 SV=1)

HSP 1 Score: 128.257 bits (321), Expect = 3.803e-34
Identity = 62/124 (50.00%), Postives = 81/124 (65.32%), Query Frame = 3
Query:    6 NGARHVVETAEFALNILKKIKDIRFTLFSEIEVLLKTGIHSGTVVAGIIGNLMPRYCLFGDTVNTTSRMKTYCHENRIHVSKTFANLAERFTIYNVEYRGIVDIKGKGKMNTFWLNSRIEESSQ 377
            NG RHVVE A  A++IL+  +D          + L+ GIHSG+  AG++GN MPRYCLFGDT+NT SRM++Y    +IHVSK   +L E    + VE RG +DIKGKG M TFWL S+I   ++
Sbjct:   86 NGQRHVVEIANLAVDILQVTEDFVIPHMPLRPLRLRIGIHSGSCCAGVVGNKMPRYCLFGDTINTASRMQSYGLPGKIHVSKGTRDLLEEVGGFVVEPRGRIDIKGKGDMATFWLVSKINPKNE 209          
BLAST of Guanylate cyclase vs. TrEMBL
Match: T1G4Y1 (Guanylate cyclase domain-containing protein OS=Helobdella robusta OX=6412 GN=20216129 PE=4 SV=1)

HSP 1 Score: 119.783 bits (299), Expect = 7.032e-31
Identity = 57/118 (48.31%), Postives = 83/118 (70.34%), Query Frame = 3
Query:    6 NGARHVVETAEFALNILKKIKDIRFTLFSEIEVLLKTGIHSGTVVAGIIGNLMPRYCLFGDTVNTTSRMKTYCHENRIHVSKTFANLAERFTIYNVEYRGIVDIKGKGKMNTFWLNSR 359
            NG +HVVE A+ +L+IL  I++  F+ F++ ++ L+ GIH+G  VAG++GN M RYCLFGDTVNT SRM++    +RIH+S+      + F  YN++ RG ++IKGKG M T+WL  R
Sbjct:  108 NGQQHVVEVADMSLDILANIEEQNFSGFTK-KIELRIGIHTGPCVAGVVGNKMTRYCLFGDTVNTASRMQSTGSASRIHLSEETHKELKEFKRYNLKKRGTIEIKGKGMMTTYWLVGR 224          
BLAST of Guanylate cyclase vs. TrEMBL
Match: C3YIV7 (Guanylate cyclase OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_86656 PE=3 SV=1)

HSP 1 Score: 125.176 bits (313), Expect = 2.047e-30
Identity = 56/121 (46.28%), Postives = 84/121 (69.42%), Query Frame = 3
Query:    6 NGARHVVETAEFALNILKKIKDIRFTLFSEIEVLLKTGIHSGTVVAGIIGNLMPRYCLFGDTVNTTSRMKTYCHENRIHVSKTFANLAERFTIYNVEYRGIVDIKGKGKMNTFWLNSRIEE 368
            NG RHV E A+ AL +L+ +   R +  ++ ++ L+ GIH+G VVAG++G  MPRYCLFGDTVNT+SRM++     RIHVS T A +  +  +Y++  RG + +KGKGKM T+WL  ++++
Sbjct:  922 NGDRHVTEIADMALTLLRDVHSFRISHKADQKLQLRIGIHTGPVVAGVVGLTMPRYCLFGDTVNTSSRMESTGAPLRIHVSGTTAKMLAQHKVYDLVLRGEIQVKGKGKMTTYWLLDKVKK 1042          
BLAST of Guanylate cyclase vs. TrEMBL
Match: A0A1S3GXB0 (atrial natriuretic peptide receptor 2-like OS=Dipodomys ordii OX=10020 GN=LOC106002597 PE=3 SV=1)

HSP 1 Score: 114.39 bits (285), Expect = 6.143e-30
Identity = 52/115 (45.22%), Postives = 71/115 (61.74%), Query Frame = 3
Query:    6 NGARHVVETAEFALNILKKIKDIRFTLFSEIEVLLKTGIHSGTVVAGIIGNLMPRYCLFGDTVNTTSRMKTYCHENRIHVSKTFANLAERFTIYNVEYRGIVDIKGKGKMNTFWL 350
            NG RH  E A  AL +L  +   R       ++ L+ G+H+G V AG++G  MPRYCLFGDTVNT SRM++     +IHVS T  +  +    + +E RG V++KGKGKM T+WL
Sbjct:   10 NGQRHAPEIARMALALLDAVSSFRIRHRPHDQLRLRIGVHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGQALKIHVSSTTKDALDELGCFQLELRGDVEMKGKGKMRTYWL 124          
BLAST of Guanylate cyclase vs. TrEMBL
Match: A0A1I8AX29 (Guanylate cyclase domain-containing protein OS=Steinernema glaseri OX=37863 PE=3 SV=1)

HSP 1 Score: 115.546 bits (288), Expect = 6.311e-30
Identity = 56/118 (47.46%), Postives = 73/118 (61.86%), Query Frame = 3
Query:    6 NGARHVVETAEFALNILKKIKDIRFTLFSEIEVLLKTGIHSGTVVAGIIGNLMPRYCLFGDTVNTTSRMKTYCHENRIHVSKTFANLAERFTIYNVEYRGIVDIKGKGKMNTFWLNSR 359
            NG RHV E A+ +L  +  ++  R        V ++ G+H+G+VVAG++G  MPRYCLFGDTVNT SRM++    N IH+S T     ++F  Y  E RG V IKGKG M TFWL  R
Sbjct:   53 NGERHVKEIADMSLAFIASLQRFRIPHIPAETVQIRIGMHTGSVVAGVVGLTMPRYCLFGDTVNTASRMESNSKPNHIHMSATAYQAIQKFPGYTTESRGDVIIKGKGVMETFWLLGR 170          
BLAST of Guanylate cyclase vs. Ensembl Cavefish
Match: gucy2g (guanylate cyclase 2G-like [Source:NCBI gene;Acc:103039360])

HSP 1 Score: 113.62 bits (283), Expect = 8.298e-30
Identity = 54/119 (45.38%), Postives = 78/119 (65.55%), Query Frame = 3
Query:    6 NGARHVVETAEFALNILKKIKDIRFTLFSEIEVLLKTGIHSGTVVAGIIGNLMPRYCLFGDTVNTTSRMKTYCHENRIHVSKTFANLAERFTIYNVEYRGIVDIKGKGKMNTFWLNSRI 362
            NG RH  + +  AL+ L  IK          ++ L+ GI+SG VVAG++G+ MPRYCLFGDTVNT SRM++     RIH+S++ A++  +   Y +E RG V++KGKG   T+WLN++I
Sbjct:  954 NGNRHAEDISIMALHFLNAIKRFSIRHLPNQKLALRIGINSGPVVAGVVGSTMPRYCLFGDTVNTASRMESNSLPLRIHISQSTADILLKIGSYELEERGEVELKGKGLQKTYWLNNKI 1072          
BLAST of Guanylate cyclase vs. Ensembl Cavefish
Match: gucy2g (guanylate cyclase 2G-like [Source:NCBI gene;Acc:103039360])

HSP 1 Score: 113.62 bits (283), Expect = 8.309e-30
Identity = 54/119 (45.38%), Postives = 78/119 (65.55%), Query Frame = 3
Query:    6 NGARHVVETAEFALNILKKIKDIRFTLFSEIEVLLKTGIHSGTVVAGIIGNLMPRYCLFGDTVNTTSRMKTYCHENRIHVSKTFANLAERFTIYNVEYRGIVDIKGKGKMNTFWLNSRI 362
            NG RH  + +  AL+ L  IK          ++ L+ GI+SG VVAG++G+ MPRYCLFGDTVNT SRM++     RIH+S++ A++  +   Y +E RG V++KGKG   T+WLN++I
Sbjct:  954 NGNRHAEDISIMALHFLNAIKRFSIRHLPNQKLALRIGINSGPVVAGVVGSTMPRYCLFGDTVNTASRMESNSLPLRIHISQSTADILLKIGSYELEERGEVELKGKGLQKTYWLNNKI 1072          
BLAST of Guanylate cyclase vs. Ensembl Cavefish
Match: npr1b (atrial natriuretic peptide receptor 1-like [Source:NCBI gene;Acc:103022666])

HSP 1 Score: 112.079 bits (279), Expect = 2.415e-29
Identity = 52/115 (45.22%), Postives = 74/115 (64.35%), Query Frame = 3
Query:    6 NGARHVVETAEFALNILKKIKDIRFTLFSEIEVLLKTGIHSGTVVAGIIGNLMPRYCLFGDTVNTTSRMKTYCHENRIHVSKTFANLAERFTIYNVEYRGIVDIKGKGKMNTFWL 350
            NG  H  E A  +L +L  +K  +     + ++ L+ GIHSG V AG++G  MPRYCLFGDTVNT+SRM++     +IHVS    ++ + F  + +E RG V++KGKGKM T+WL
Sbjct:  908 NGKLHAREIARMSLALLDAVKTFKIRHRPDQQLKLRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTSSRMESNGEPLKIHVSSASHDILQEFNCFQLELRGDVEMKGKGKMRTYWL 1022          
BLAST of Guanylate cyclase vs. Ensembl Cavefish
Match: npr1b (atrial natriuretic peptide receptor 1-like [Source:NCBI gene;Acc:103022666])

HSP 1 Score: 112.079 bits (279), Expect = 2.422e-29
Identity = 52/115 (45.22%), Postives = 74/115 (64.35%), Query Frame = 3
Query:    6 NGARHVVETAEFALNILKKIKDIRFTLFSEIEVLLKTGIHSGTVVAGIIGNLMPRYCLFGDTVNTTSRMKTYCHENRIHVSKTFANLAERFTIYNVEYRGIVDIKGKGKMNTFWL 350
            NG  H  E A  +L +L  +K  +     + ++ L+ GIHSG V AG++G  MPRYCLFGDTVNT+SRM++     +IHVS    ++ + F  + +E RG V++KGKGKM T+WL
Sbjct:  946 NGKLHAREIARMSLALLDAVKTFKIRHRPDQQLKLRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTSSRMESNGEPLKIHVSSASHDILQEFNCFQLELRGDVEMKGKGKMRTYWL 1060          
BLAST of Guanylate cyclase vs. Ensembl Cavefish
Match: npr1b (atrial natriuretic peptide receptor 1-like [Source:NCBI gene;Acc:103022666])

HSP 1 Score: 112.079 bits (279), Expect = 2.423e-29
Identity = 52/115 (45.22%), Postives = 74/115 (64.35%), Query Frame = 3
Query:    6 NGARHVVETAEFALNILKKIKDIRFTLFSEIEVLLKTGIHSGTVVAGIIGNLMPRYCLFGDTVNTTSRMKTYCHENRIHVSKTFANLAERFTIYNVEYRGIVDIKGKGKMNTFWL 350
            NG  H  E A  +L +L  +K  +     + ++ L+ GIHSG V AG++G  MPRYCLFGDTVNT+SRM++     +IHVS    ++ + F  + +E RG V++KGKGKM T+WL
Sbjct:  950 NGKLHAREIARMSLALLDAVKTFKIRHRPDQQLKLRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTSSRMESNGEPLKIHVSSASHDILQEFNCFQLELRGDVEMKGKGKMRTYWL 1064          
BLAST of Guanylate cyclase vs. Ensembl Sea Lamprey
Match: NPR1 (natriuretic peptide receptor 1 [Source:HGNC Symbol;Acc:HGNC:7943])

HSP 1 Score: 112.464 bits (280), Expect = 2.330e-30
Identity = 53/115 (46.09%), Postives = 71/115 (61.74%), Query Frame = 3
Query:    6 NGARHVVETAEFALNILKKIKDIRFTLFSEIEVLLKTGIHSGTVVAGIIGNLMPRYCLFGDTVNTTSRMKTYCHENRIHVSKTFANLAERFTIYNVEYRGIVDIKGKGKMNTFWL 350
            NG RH +E A  AL +L  ++           +LL+ GIH+G V AG++G  MPRYCLFGDTVNT SRM+     +RIH+S T   + + +  + V+  G VDIKGKG M T+WL
Sbjct:  386 NGTRHAIEVARMALALLSAVRCFHIRHRPAQRLLLRIGIHTGPVCAGVVGLKMPRYCLFGDTVNTASRMEAKGEAHRIHLSSTTKAILDEYGGFVVQLHGDVDIKGKGTMRTYWL 500          
BLAST of Guanylate cyclase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008942.1 (pep scaffold:Pmarinus_7.0:GL476454:59555:94399:-1 gene:ENSPMAG00000008084.1 transcript:ENSPMAT00000008942.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 113.235 bits (282), Expect = 2.446e-30
Identity = 52/118 (44.07%), Postives = 78/118 (66.10%), Query Frame = 3
Query:    6 NGARHVVETAEFALNILKKIKDIRFTLFSEIEVLLKTGIHSGTVVAGIIGNLMPRYCLFGDTVNTTSRMKTYCHENRIHVSKTFANLAERFTIYNVEYRGIVDIKGKGKMNTFWLNSR 359
            NG RHV E +  +L+ L  I + R     + ++ ++ G++SG+VVAG++GN MPRYCLFGDTVN  SRM++  +  RIHVS++ A+L +    Y +  RG + +KGKG   T+WLN +
Sbjct:  935 NGVRHVEEISIMSLHFLSSIINFRIRHLPKEQLKIRIGVNSGSVVAGVVGNTMPRYCLFGDTVNVASRMESTGYPLRIHVSESTASLLKSIGGYELVERGAIQLKGKGSQLTYWLNGK 1052          
BLAST of Guanylate cyclase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006352.1 (pep scaffold:Pmarinus_7.0:GL477176:19246:83539:-1 gene:ENSPMAG00000005587.1 transcript:ENSPMAT00000006352.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 112.464 bits (280), Expect = 4.271e-30
Identity = 54/124 (43.55%), Postives = 79/124 (63.71%), Query Frame = 3
Query:    6 NGARHVVETAEFALNILKKIKDIRFTLFSEIEVLLKTGIHSGTVVAGIIGNLMPRYCLFGDTVNTTSRMKTYCHENRIHVSKTFANLAERFTIYNVEYRGIVDIKGKGKMNTFWLNSRIEESSQ 377
            NG  +  E A  +L +L  +K  +     E ++ L+ GIH+G V AG++G  MPR+CLFGDTVNT SRM++     +IHVS+T   + + F  + +E RG V++KGKGKM T+WL   IEE+ +
Sbjct:  703 NGKLNAKEIARMSLALLDAVKTFKIRHRQEDKLKLRIGIHTGPVCAGVVGLKMPRFCLFGDTVNTASRMESNGEALKIHVSQTTKEVLDEFGCFRLELRGDVEMKGKGKMRTYWLLGEIEENPE 826          
BLAST of Guanylate cyclase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008986.1 (pep scaffold:Pmarinus_7.0:GL476454:105373:128493:-1 gene:ENSPMAG00000008096.1 transcript:ENSPMAT00000008986.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 110.923 bits (276), Expect = 1.071e-29
Identity = 53/118 (44.92%), Postives = 74/118 (62.71%), Query Frame = 3
Query:    6 NGARHVVETAEFALNILKKIKDIRFTLFSEIEVLLKTGIHSGTVVAGIIGNLMPRYCLFGDTVNTTSRMKTYCHENRIHVSKTFANLAERFTIYNVEYRGIVDIKGKGKMNTFWLNSR 359
            NG RHV E A  +L+ L  I + R     + ++ L+ GI+SG VVAG++GN MPRYCLFGDTVN  SRM++      IHVS+   NL ++   Y +  RG +++KGKG   T+WL  +
Sbjct:  511 NGVRHVEEIATMSLHFLSSIMNFRIRHLPQEQLKLRIGINSGPVVAGVVGNTMPRYCLFGDTVNVASRMESTGFPLHIHVSEATTNLLKQIGGYFLVERGTINLKGKGNQLTYWLKGK 628          
BLAST of Guanylate cyclase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008976.1 (pep scaffold:Pmarinus_7.0:GL476454:105373:131710:-1 gene:ENSPMAG00000008096.1 transcript:ENSPMAT00000008976.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 111.309 bits (277), Expect = 1.151e-29
Identity = 53/118 (44.92%), Postives = 74/118 (62.71%), Query Frame = 3
Query:    6 NGARHVVETAEFALNILKKIKDIRFTLFSEIEVLLKTGIHSGTVVAGIIGNLMPRYCLFGDTVNTTSRMKTYCHENRIHVSKTFANLAERFTIYNVEYRGIVDIKGKGKMNTFWLNSR 359
            NG RHV E A  +L+ L  I + R     + ++ L+ GI+SG VVAG++GN MPRYCLFGDTVN  SRM++      IHVS+   NL ++   Y +  RG +++KGKG   T+WL  +
Sbjct:  600 NGVRHVEEIATMSLHFLSSIMNFRIRHLPQEQLKLRIGINSGPVVAGVVGNTMPRYCLFGDTVNVASRMESTGFPLHIHVSEATTNLLKQIGGYFLVERGTINLKGKGNQLTYWLKGK 717          
BLAST of Guanylate cyclase vs. Ensembl Nematostella
Match: EDO45306 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSZ0])

HSP 1 Score: 104.76 bits (260), Expect = 4.313e-29
Identity = 46/116 (39.66%), Postives = 77/116 (66.38%), Query Frame = 3
Query:    6 NGARHVVETAEFALNILKKIKDIRF-TLFSEIEVLLKTGIHSGTVVAGIIGNLMPRYCLFGDTVNTTSRMKTYCHENRIHVSKTFANLAERFTIYNVEYRGIVDIKGKGKMNTFWL 350
            NG  H  E    +L++++  +     ++    +++++ GIH+G  V+G++G  MPRYCLFGDTVNT SRM+T     ++H+S+T  +L  +F  +++EYRG +++KGKG M T+WL
Sbjct:   94 NGTSHADEIGRMSLDLVRLTETTTLDSVPKGKKLMVRVGIHTGPCVSGVVGYKMPRYCLFGDTVNTASRMQTTGIPQKVHISETTYDLLTKFNTFHMEYRGTLEVKGKGLMRTYWL 209          
BLAST of Guanylate cyclase vs. Ensembl Nematostella
Match: EDO36182 (Guanylate cyclase [Source:UniProtKB/TrEMBL;Acc:A7SJA4])

HSP 1 Score: 108.997 bits (271), Expect = 6.002e-29
Identity = 53/118 (44.92%), Postives = 75/118 (63.56%), Query Frame = 3
Query:    6 NGARHVVETAEFALNILKKIKDIRFTLFSEIEVLLKTGIHSGTVVAGIIGNLMPRYCLFGDTVNTTSRMKTYCHENRIHVSKTFANLAERFTIYNVEYRGIVDIKGKGKMNTFWLNSR 359
            NG RH  E A  ALN+L +++D +       +V L+ GIHSG+ VAG++G  MPRYCLFGDTVN  SRM++     RIHVS     + +R   Y+++ RG V +KGKG + T++L  +
Sbjct:  352 NGERHAGEVASMALNLLSEVRDFQIPHIPSRKVQLRIGIHSGSCVAGVVGLKMPRYCLFGDTVNYASRMESSGLALRIHVSPECKEVLDRLGGYHLDERGPVTMKGKGTIVTYFLTGK 469          
BLAST of Guanylate cyclase vs. Ensembl Nematostella
Match: EDO30985 (Guanylate cyclase [Source:UniProtKB/TrEMBL;Acc:A7SZ80])

HSP 1 Score: 103.99 bits (258), Expect = 4.743e-27
Identity = 52/125 (41.60%), Postives = 79/125 (63.20%), Query Frame = 3
Query:    6 NGARHVVETAEFALNILKKIKD---IRFTLFSEIEVLLKTGIHSGTVVAGIIGNLMPRYCLFGDTVNTTSRMKTYCHENRIHVSKTFANLAERFTIYNVEYRGIVDIKGKGKMNTFWLNSRIEES 371
            NG RH  E A+ AL+++  +     +R     E ++ L+ G H+G VVAG++GN M RYCLFGDTVNT SRM++     RIH+S+   ++ +    + V+ RG V +KGKG + TFWL S ++++
Sbjct:  378 NGRRHAGEIAKMALHLVDAVSHNFIVRHK--PEYKLQLRVGCHTGPVVAGVVGNTMARYCLFGDTVNTASRMESNGEPLRIHISQQTKDVLDELGTFVVKSRGKVHLKGKGTVETFWLVSTVDKN 500          
BLAST of Guanylate cyclase vs. Ensembl Nematostella
Match: EDO34275 (Guanylate cyclase [Source:UniProtKB/TrEMBL;Acc:A7SPS9])

HSP 1 Score: 102.834 bits (255), Expect = 1.296e-26
Identity = 49/115 (42.61%), Postives = 73/115 (63.48%), Query Frame = 3
Query:    6 NGARHVVETAEFALNILKKIKDIRFTLFSEIEVLLKTGIHSGTVVAGIIGNLMPRYCLFGDTVNTTSRMKTYCHENRIHVSKTFANLAERFTIYNVEYRGIVDIKGKGKMNTFWL 350
            NG +H  E A  AL++L++I   +       ++ L+ GIHSG+ VAG++G  MPRYCLFGDTVNT SRM++     +IH+S +   + +    Y+++ RG V +KGKG   T+WL
Sbjct:  400 NGHQHAGEIATMALHMLREIDSFKIRHRPNDKLKLRIGIHSGSCVAGVVGKKMPRYCLFGDTVNTASRMESNGEALKIHISPSTKRILDELGGYHIQKRGKVFLKGKGTWITYWL 514          
BLAST of Guanylate cyclase vs. Ensembl Nematostella
Match: EDO27923 (Guanylate cyclase [Source:UniProtKB/TrEMBL;Acc:A7T7X3])

HSP 1 Score: 97.8265 bits (242), Expect = 5.829e-25
Identity = 48/105 (45.71%), Postives = 66/105 (62.86%), Query Frame = 3
Query:    6 NGARHVVETAEFALNILKKIKDIRFTLFSEIEVLLKTGIHSGTVVAGIIGNLMPRYCLFGDTVNTTSRMKTYCHENRIHVSKTFANLAERFTIYNVEYRGIVDIK 320
            NG RH  E A  ALN+L +++D +       +V L+ GIHSG+ VAG++G  MPRYCLFGDTVN  SRM++     RIHVS     + +R   Y+++ RG V +K
Sbjct:  325 NGERHAGEVASMALNLLSEVRDFQIPHIPSRKVQLRIGIHSGSCVAGVVGLKMPRYCLFGDTVNYASRMESSGLALRIHVSPECKEVLDRLGGYHLDERGPVTMK 429          
BLAST of Guanylate cyclase vs. Ensembl Medaka
Match: olgc2 (membrane guanylyl cyclase [Source:NCBI gene;Acc:100125799])

HSP 1 Score: 114.005 bits (284), Expect = 5.623e-30
Identity = 55/115 (47.83%), Postives = 73/115 (63.48%), Query Frame = 3
Query:    6 NGARHVVETAEFALNILKKIKDIRFTLFSEIEVLLKTGIHSGTVVAGIIGNLMPRYCLFGDTVNTTSRMKTYCHENRIHVSKTFANLAERFTIYNVEYRGIVDIKGKGKMNTFWL 350
            NG  H  E A  AL +L  ++  R     E ++ L+ GIHSG V AG++G  MPRYCLFGDTVNT+SRM++     +IHVS    ++   F  + +E RG +DIKGKGKM T+WL
Sbjct:  942 NGKLHGREIARMALALLDTVRTFRIRHRPEQQLKLRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTSSRMESSGEALKIHVSAATRDVLIEFNSFQLELRGDIDIKGKGKMTTYWL 1056          
BLAST of Guanylate cyclase vs. Ensembl Medaka
Match: olgc5 (guanylate cyclase OlGC5 [Source:NCBI gene;Acc:100125800])

HSP 1 Score: 112.849 bits (281), Expect = 1.448e-29
Identity = 51/116 (43.97%), Postives = 76/116 (65.52%), Query Frame = 3
Query:    6 NGARHVVETAEFALNILKKIKDIRFTLFSEIEVLLKTGIHSGTVVAGIIGNLMPRYCLFGDTVNTTSRMKTYCHENRIHVSKTFANLAERFTI-YNVEYRGIVDIKGKGKMNTFWL 350
            NG RH  E A  +L+IL  I   +     ++++ ++ G+HSG VVAG++G  MPRYCLFGDTVNTTSRM++     R+HV+++  NL     + Y ++ RG+ ++KGKG   T+WL
Sbjct:  992 NGNRHAAEIANMSLDILHCIGTFKARHMPDLKIRIRIGLHSGPVVAGVVGLTMPRYCLFGDTVNTTSRMESTSSPYRVHVNQSTVNLLNSLKLGYKIDVRGLTELKGKGIETTYWL 1107          
BLAST of Guanylate cyclase vs. Ensembl Medaka
Match: npr2 (natriuretic peptide receptor 2 [Source:NCBI gene;Acc:100049183])

HSP 1 Score: 112.849 bits (281), Expect = 1.563e-29
Identity = 52/115 (45.22%), Postives = 74/115 (64.35%), Query Frame = 3
Query:    6 NGARHVVETAEFALNILKKIKDIRFTLFSEIEVLLKTGIHSGTVVAGIIGNLMPRYCLFGDTVNTTSRMKTYCHENRIHVSKTFANLAERFTIYNVEYRGIVDIKGKGKMNTFWL 350
            NG  H  E A  +L +L+++K  +       ++ L+ GIH+G V AG++G  MPRYCLFGDTVNT SRM++     +IHVS     + + F  +N+E RG V++KGKGKM T+WL
Sbjct:  879 NGKLHAREIASMSLALLEQVKTFKIRHRPNDQLRLRIGIHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGEALKIHVSSATKEVLDEFCYFNLELRGDVEMKGKGKMRTYWL 993          
BLAST of Guanylate cyclase vs. Ensembl Medaka
Match: npr2 (natriuretic peptide receptor 2 [Source:NCBI gene;Acc:100049183])

HSP 1 Score: 112.849 bits (281), Expect = 1.570e-29
Identity = 52/115 (45.22%), Postives = 74/115 (64.35%), Query Frame = 3
Query:    6 NGARHVVETAEFALNILKKIKDIRFTLFSEIEVLLKTGIHSGTVVAGIIGNLMPRYCLFGDTVNTTSRMKTYCHENRIHVSKTFANLAERFTIYNVEYRGIVDIKGKGKMNTFWL 350
            NG  H  E A  +L +L+++K  +       ++ L+ GIH+G V AG++G  MPRYCLFGDTVNT SRM++     +IHVS     + + F  +N+E RG V++KGKGKM T+WL
Sbjct:  931 NGKLHAREIASMSLALLEQVKTFKIRHRPNDQLRLRIGIHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGEALKIHVSSATKEVLDEFCYFNLELRGDVEMKGKGKMRTYWL 1045          
BLAST of Guanylate cyclase vs. Ensembl Medaka
Match: olgc7 (membrane guanylyl cyclase [Source:NCBI gene;Acc:100125819])

HSP 1 Score: 107.071 bits (266), Expect = 1.486e-27
Identity = 49/115 (42.61%), Postives = 71/115 (61.74%), Query Frame = 3
Query:    6 NGARHVVETAEFALNILKKIKDIRFTLFSEIEVLLKTGIHSGTVVAGIIGNLMPRYCLFGDTVNTTSRMKTYCHENRIHVSKTFANLAERFTIYNVEYRGIVDIKGKGKMNTFWL 350
            NG  H  E A  AL +L  +K  +       ++ L+ G+HSG V AG++G  MPRYCLFGDTVNT SRM++     +IHVS+    + + F  + ++ RG +++KGKG M T+WL
Sbjct:  874 NGKLHGREVARMALALLDAVKSFKIRHRPSQQLRLRIGVHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESTGEALKIHVSEATRQVLQEFNTFQLQPRGEIEVKGKGHMRTYWL 988          
BLAST of Guanylate cyclase vs. Planmine SMEST
Match: SMESG000060260.1 (SMESG000060260.1)

HSP 1 Score: 266.929 bits (681), Expect = 1.267e-93
Identity = 128/129 (99.22%), Postives = 128/129 (99.22%), Query Frame = 3
Query:    3 PNGARHVVETAEFALNILKKIKDIRFTLFSEIEVLLKTGIHSGTVVAGIIGNLMPRYCLFGDTVNTTSRMKTYCHENRIHVSKTFANLAERFTIYNVEYRGIVDIKGKGKMNTFWLNSRIEESSQRPES 389
            PNGARHVVETAEFALNILKKIKDIRFTLFSEIEVLLKTGIHSGTVVAGIIGNLMPRYCLFGDTVNT SRMKTYCHENRIHVSKTFANLAERFTIYNVEYRGIVDIKGKGKMNTFWLNSRIEESSQRPES
Sbjct:    9 PNGARHVVETAEFALNILKKIKDIRFTLFSEIEVLLKTGIHSGTVVAGIIGNLMPRYCLFGDTVNTASRMKTYCHENRIHVSKTFANLAERFTIYNVEYRGIVDIKGKGKMNTFWLNSRIEESSQRPES 137          
BLAST of Guanylate cyclase vs. Planmine SMEST
Match: SMESG000060260.1 (SMESG000060260.1)

HSP 1 Score: 271.937 bits (694), Expect = 1.011e-88
Identity = 128/129 (99.22%), Postives = 128/129 (99.22%), Query Frame = 3
Query:    3 PNGARHVVETAEFALNILKKIKDIRFTLFSEIEVLLKTGIHSGTVVAGIIGNLMPRYCLFGDTVNTTSRMKTYCHENRIHVSKTFANLAERFTIYNVEYRGIVDIKGKGKMNTFWLNSRIEESSQRPES 389
            PNGARHVVETAEFALNILKKIKDIRFTLFSEIEVLLKTGIHSGTVVAGIIGNLMPRYCLFGDTVNT SRMKTYCHENRIHVSKTFANLAERFTIYNVEYRGIVDIKGKGKMNTFWLNSRIEESSQRPES
Sbjct:  558 PNGARHVVETAEFALNILKKIKDIRFTLFSEIEVLLKTGIHSGTVVAGIIGNLMPRYCLFGDTVNTASRMKTYCHENRIHVSKTFANLAERFTIYNVEYRGIVDIKGKGKMNTFWLNSRIEESSQRPES 686          
BLAST of Guanylate cyclase vs. Planmine SMEST
Match: SMESG000054505.1 (SMESG000054505.1)

HSP 1 Score: 103.605 bits (257), Expect = 5.677e-29
Identity = 47/118 (39.83%), Postives = 77/118 (65.25%), Query Frame = 3
Query:    6 NGARHVVETAEFALNILKKIKDIRFTLFSEIEVLLKTGIHSGTVVAGIIGNLMPRYCLFGDTVNTTSRMKTYCHENRIHVSKTFANLAERFTIYNVEYRGIVDIKGKGKMNTFWLNSR 359
            NG +H++E  EF+L I++ +++I     ++ ++ ++ GIH+G+VVAG++GN MPR+CLFGDTVNT SRM++     +I  S+    L   +  Y    RG +++KGKG   T++L  R
Sbjct:   40 NGIQHLIEICEFSLGIVESVRNIYRIPHNDKQIAVRIGIHTGSVVAGVVGNKMPRFCLFGDTVNTASRMESTGVAMKIQASEKAYILINEYNKYTFTCRGQIEVKGKGSQTTYFLEGR 157          
BLAST of Guanylate cyclase vs. Planmine SMEST
Match: SMESG000056474.1 (SMESG000056474.1)

HSP 1 Score: 103.219 bits (256), Expect = 2.567e-26
Identity = 49/115 (42.61%), Postives = 72/115 (62.61%), Query Frame = 3
Query:    6 NGARHVVETAEFALNILKKIKDIRFTLFSEIEVLLKTGIHSGTVVAGIIGNLMPRYCLFGDTVNTTSRMKTYCHENRIHVSKTFANLAERFTIYNVEYRGIVDIKGKGKMNTFWL 350
            NG RH  E A  AL++L +    +     +I + L+ G+H+G  V G++G  MPRYCLFGDTVNT SRM++     RIHVS     + +    Y++E RG V++KGKG ++++WL
Sbjct:  889 NGRRHAGEIATMALDLLSQCGTFKIRHMPDIPLRLRIGLHTGPCVTGVVGLTMPRYCLFGDTVNTASRMESSGSAFRIHVSPFTKVVLDELGGYHLELRGKVELKGKGIVDSYWL 1003          
BLAST of Guanylate cyclase vs. Planmine SMEST
Match: SMESG000079311.1 (SMESG000079311.1)

HSP 1 Score: 101.679 bits (252), Expect = 7.163e-26
Identity = 51/115 (44.35%), Postives = 76/115 (66.09%), Query Frame = 3
Query:   33 AEFALNILKKIKDIRFTLFSEIEVL-LKTGIHSGTVVAGIIGNLMPRYCLFGDTVNTTSRMKTYCHENRIHVSKTFANLAERFTIYNVEYRGIVDIKGKGKMNTFWLNSRIEESS 374
            AE AL ++ KI  I+    +EIE L ++ GIH+GTVVAG++G  MPRYCLFGDTVNT SRM++     +I +S +         +Y +  RG+V++KGKG ++T+WL   +++ S
Sbjct:  452 AEMALEMIDKICTIK-NPANEIESLKIRVGIHTGTVVAGVVGIKMPRYCLFGDTVNTASRMESTGETQKIQISSSTQKKLMMHNVYQIVERGVVEVKGKGNVSTYWLEKHLDKQS 565          
The following BLAST results are available for this feature:
BLAST of Guanylate cyclase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GUCY2F2.470e-2946.55guanylate cyclase 2F, retinal [Source:HGNC Symbol;... [more]
NPR26.358e-2945.22natriuretic peptide receptor 2 [Source:HGNC Symbol... [more]
GUCY2D1.619e-2847.06guanylate cyclase 2D, retinal [Source:HGNC Symbol;... [more]
NPR11.037e-2744.35natriuretic peptide receptor 1 [Source:HGNC Symbol... [more]
GUCY2C1.120e-2239.37guanylate cyclase 2C [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of Guanylate cyclase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gcy-134.076e-2742.74Receptor-type guanylate cyclase gcy-13 [Source:Un... [more]
gcy-289.535e-2642.34Receptor-type guanylate cyclase gcy-28 [Source:Un... [more]
gcy-289.546e-2642.34Receptor-type guanylate cyclase gcy-28 [Source:Un... [more]
gcy-289.565e-2642.34Receptor-type guanylate cyclase gcy-28 [Source:Un... [more]
gcy-211.524e-2543.10Receptor-type guanylate cyclase gcy-21 [Source:Un... [more]
back to top
BLAST of Guanylate cyclase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG32163.459e-3242.52gene:FBgn0034568 transcript:FBtr0273397[more]
CG32163.542e-3242.52gene:FBgn0034568 transcript:FBtr0273396[more]
CG339585.223e-2941.53gene:FBgn0053958 transcript:FBtr0099994[more]
Gyc32E7.501e-2943.31gene:FBgn0010197 transcript:FBtr0112856[more]
Gyc32E7.784e-2943.31gene:FBgn0010197 transcript:FBtr0343625[more]
back to top
BLAST of Guanylate cyclase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch211-215j19.123.597e-3041.74si:ch211-215j19.12 [Source:ZFIN;Acc:ZDB-GENE-14121... [more]
CABZ01078606.14.292e-3040.48atrial natriuretic peptide receptor 1-like [Source... [more]
npr1a4.293e-2942.28natriuretic peptide receptor 1a [Source:ZFIN;Acc:Z... [more]
npr1a4.293e-2942.28natriuretic peptide receptor 1a [Source:ZFIN;Acc:Z... [more]
npr1b1.462e-2845.22natriuretic peptide receptor 1b [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of Guanylate cyclase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000003411.11.149e-2745.38retinal guanylyl cyclase 2-like [Source:NCBI gene;... [more]
ENSXETT00000003039.11.151e-2745.38retinal guanylyl cyclase 2-like [Source:NCBI gene;... [more]
ENSXETT00000003361.11.153e-2745.38retinal guanylyl cyclase 2-like [Source:NCBI gene;... [more]
ENSXETT00000003372.11.154e-2745.38retinal guanylyl cyclase 2-like [Source:NCBI gene;... [more]
ENSXETT00000002882.11.155e-2745.38retinal guanylyl cyclase 2-like [Source:NCBI gene;... [more]
back to top
BLAST of Guanylate cyclase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Gucy2d7.932e-3043.33guanylate cyclase 2d [Source:MGI Symbol;Acc:MGI:10... [more]
Gucy2f2.140e-2946.55guanylate cyclase 2f [Source:MGI Symbol;Acc:MGI:10... [more]
Npr23.704e-2945.22natriuretic peptide receptor 2 [Source:MGI Symbol;... [more]
Npr24.365e-2945.22natriuretic peptide receptor 2 [Source:MGI Symbol;... [more]
Npr12.781e-2845.22natriuretic peptide receptor 1 [Source:MGI Symbol;... [more]
back to top
BLAST of Guanylate cyclase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P51841|GUC2F_HUMAN1.186e-2846.55Retinal guanylyl cyclase 2 OS=Homo sapiens OX=9606... [more]
sp|Q5SDA5|GUC2F_MOUSE1.497e-2846.55Retinal guanylyl cyclase 2 OS=Mus musculus OX=1009... [more]
sp|P16067|ANPRB_RAT3.053e-2845.22Atrial natriuretic peptide receptor 2 OS=Rattus no... [more]
sp|Q6VVW5|ANPRB_MOUSE3.053e-2845.22Atrial natriuretic peptide receptor 2 OS=Mus muscu... [more]
sp|P20594|ANPRB_HUMAN3.053e-2845.22Atrial natriuretic peptide receptor 2 OS=Homo sapi... [more]
back to top
BLAST of Guanylate cyclase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
R7VIV03.803e-3450.00Guanylate cyclase domain-containing protein OS=Cap... [more]
T1G4Y17.032e-3148.31Guanylate cyclase domain-containing protein OS=Hel... [more]
C3YIV72.047e-3046.28Guanylate cyclase OS=Branchiostoma floridae OX=773... [more]
A0A1S3GXB06.143e-3045.22atrial natriuretic peptide receptor 2-like OS=Dipo... [more]
A0A1I8AX296.311e-3047.46Guanylate cyclase domain-containing protein OS=Ste... [more]
back to top
BLAST of Guanylate cyclase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gucy2g8.298e-3045.38guanylate cyclase 2G-like [Source:NCBI gene;Acc:10... [more]
gucy2g8.309e-3045.38guanylate cyclase 2G-like [Source:NCBI gene;Acc:10... [more]
npr1b2.415e-2945.22atrial natriuretic peptide receptor 1-like [Source... [more]
npr1b2.422e-2945.22atrial natriuretic peptide receptor 1-like [Source... [more]
npr1b2.423e-2945.22atrial natriuretic peptide receptor 1-like [Source... [more]
back to top
BLAST of Guanylate cyclase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NPR12.330e-3046.09natriuretic peptide receptor 1 [Source:HGNC Symbol... [more]
ENSPMAT00000008942.12.446e-3044.07pep scaffold:Pmarinus_7.0:GL476454:59555:94399:-1 ... [more]
ENSPMAT00000006352.14.271e-3043.55pep scaffold:Pmarinus_7.0:GL477176:19246:83539:-1 ... [more]
ENSPMAT00000008986.11.071e-2944.92pep scaffold:Pmarinus_7.0:GL476454:105373:128493:-... [more]
ENSPMAT00000008976.11.151e-2944.92pep scaffold:Pmarinus_7.0:GL476454:105373:131710:-... [more]
back to top
BLAST of Guanylate cyclase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Guanylate cyclase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO453064.313e-2939.66Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO361826.002e-2944.92Guanylate cyclase [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO309854.743e-2741.60Guanylate cyclase [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO342751.296e-2642.61Guanylate cyclase [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO279235.829e-2545.71Guanylate cyclase [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Guanylate cyclase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
olgc25.623e-3047.83membrane guanylyl cyclase [Source:NCBI gene;Acc:10... [more]
olgc51.448e-2943.97guanylate cyclase OlGC5 [Source:NCBI gene;Acc:1001... [more]
npr21.563e-2945.22natriuretic peptide receptor 2 [Source:NCBI gene;A... [more]
npr21.570e-2945.22natriuretic peptide receptor 2 [Source:NCBI gene;A... [more]
olgc71.486e-2742.61membrane guanylyl cyclase [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Guanylate cyclase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000060260.11.267e-9399.22SMESG000060260.1[more]
SMESG000060260.11.011e-8899.22SMESG000060260.1[more]
SMESG000054505.15.677e-2939.83SMESG000054505.1[more]
SMESG000056474.12.567e-2642.61SMESG000056474.1[more]
SMESG000079311.17.163e-2644.35SMESG000079311.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30028336 ID=SMED30028336|Name=Guanylate cyclase|organism=Schmidtea mediterranea sexual|type=transcript|length=416bp
GACCGAACGGAGCACGACACGTCGTTGAGACTGCAGAATTTGCATTGAAT
ATTCTAAAGAAGATCAAAGATATTAGATTCACTTTGTTTTCTGAAATAGA
AGTTCTTTTAAAAACAGGAATTCATTCAGGAACTGTGGTTGCTGGGATAA
TTGGAAATCTGATGCCACGCTATTGTCTGTTTGGTGACACCGTCAATACG
ACTTCGAGAATGAAGACATATTGTCATGAAAATAGAATCCATGTTTCGAA
GACATTCGCCAATCTCGCTGAAAGGTTTACAATCTACAATGTCGAATACA
GAGGAATCGTCGATATCAAGGGCAAAGGAAAGATGAATACGTTTTGGTTA
AATTCTAGAATTGAGGAGAGTAGCCAACGCCCCGAATCATAGCGAAATTT
GTATAAAGAATTGCAC
back to top

protein sequence of SMED30028336-orf-1

>SMED30028336-orf-1 ID=SMED30028336-orf-1|Name=SMED30028336-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=130bp
PNGARHVVETAEFALNILKKIKDIRFTLFSEIEVLLKTGIHSGTVVAGII
GNLMPRYCLFGDTVNTTSRMKTYCHENRIHVSKTFANLAERFTIYNVEYR
GIVDIKGKGKMNTFWLNSRIEESSQRPES*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000074oocyte
PLANA:0000231vitelline gland
Vocabulary: INTERPRO
TermDefinition
IPR001054A/G_cyclase
IPR029787Nucleotide_cyclase
Vocabulary: biological process
TermDefinition
GO:0009190cyclic nucleotide biosynthetic process
GO:0035556intracellular signal transduction
GO:0006182cGMP biosynthetic process
GO:0006468protein phosphorylation
GO:0007165signal transduction
Vocabulary: molecular function
TermDefinition
GO:0016849phosphorus-oxygen lyase activity
GO:0000166nucleotide binding
GO:0004383guanylate cyclase activity
GO:0004672protein kinase activity
GO:0005524ATP binding
GO:0016829lyase activity
Vocabulary: cellular component
TermDefinition
GO:0005886plasma membrane
GO:0008074guanylate cyclase complex, soluble
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001054Adenylyl cyclase class-3/4/guanylyl cyclasePFAMPF00211Guanylate_cyccoord: 4..117
e-value: 2.7E-28
score: 98.8
IPR001054Adenylyl cyclase class-3/4/guanylyl cyclasePROSITEPS50125GUANYLATE_CYCLASE_2coord: 1..71
score: 22.574
IPR029787Nucleotide cyclaseGENE3DG3DSA:3.30.70.1230coord: 1..121
e-value: 3.9E-35
score: 123.3
IPR029787Nucleotide cyclaseSUPERFAMILYSSF55073Nucleotide cyclasecoord: 5..116
NoneNo IPR availablePANTHERPTHR11920:SF335GUANYLATE CYCLASEcoord: 2..118
NoneNo IPR availablePANTHERPTHR11920ADENYLATE AND GUANYLATE CYCLASEScoord: 2..118
NoneNo IPR availableCDDcd07302CHDcoord: 4..116
e-value: 3.89532E-32
score: 109.591