Proline-rich protein 24

Overview
NameProline-rich protein 24
Smed IDSMED30028334
Length (bp)410
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Proline-rich protein 24 (SMED30028334) t-SNE clustered cells

Violin plots show distribution of expression levels for Proline-rich protein 24 (SMED30028334) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Proline-rich protein 24 (SMED30028334) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Proline-rich protein 24 (SMED30028334) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30028334

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30028334 dd_Smed_v4_11468_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30028334 dd_Smed_v4_11468_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30028334 dd_Smed_v4_11468_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Proline-rich protein 24 vs. Ensembl Human
Match: INAFM2 (InaF motif containing 2 [Source:HGNC Symbol;Acc:HGNC:35165])

HSP 1 Score: 54.6842 bits (130), Expect = 1.040e-9
Identity = 22/31 (70.97%), Postives = 27/31 (87.10%), Query Frame = 3
Query:  204 WLRLATVMIYIILVSLAAIVLAIYYSIIWHP 296
            W+RLATV  Y++ VSLAAIVLA+YYS+IW P
Sbjct:   33 WVRLATVFAYVLSVSLAAIVLAVYYSLIWQP 63          
BLAST of Proline-rich protein 24 vs. Ensembl Human
Match: INAFM1 (InaF motif containing 1 [Source:HGNC Symbol;Acc:HGNC:27406])

HSP 1 Score: 48.521 bits (114), Expect = 1.715e-7
Identity = 19/32 (59.38%), Postives = 24/32 (75.00%), Query Frame = 3
Query:  204 WLRLATVMIYIILVSLAAIVLAIYYSIIWHPN 299
            WLRLA V  Y + VSLAA++LA+YY +IW P 
Sbjct:   27 WLRLAPVCAYFLCVSLAAVLLAVYYGLIWVPT 58          
BLAST of Proline-rich protein 24 vs. Ensembl Zebrafish
Match: zgc:153157 (zgc:153157 [Source:ZFIN;Acc:ZDB-GENE-060825-224])

HSP 1 Score: 54.299 bits (129), Expect = 2.997e-9
Identity = 23/35 (65.71%), Postives = 28/35 (80.00%), Query Frame = 3
Query:  204 WLRLATVMIYIILVSLAAIVLAIYYSIIWHPNVKS 308
            W+RLATV  Y++ VSLAAI+LAIYYS+IW P   S
Sbjct:   25 WVRLATVFAYVLSVSLAAIILAIYYSLIWKPTSAS 59          
BLAST of Proline-rich protein 24 vs. Ensembl Zebrafish
Match: zgc:153157 (zgc:153157 [Source:ZFIN;Acc:ZDB-GENE-060825-224])

HSP 1 Score: 54.299 bits (129), Expect = 2.997e-9
Identity = 23/35 (65.71%), Postives = 28/35 (80.00%), Query Frame = 3
Query:  204 WLRLATVMIYIILVSLAAIVLAIYYSIIWHPNVKS 308
            W+RLATV  Y++ VSLAAI+LAIYYS+IW P   S
Sbjct:   25 WVRLATVFAYVLSVSLAAIILAIYYSLIWKPTSAS 59          
BLAST of Proline-rich protein 24 vs. Ensembl Zebrafish
Match: zgc:153157 (zgc:153157 [Source:ZFIN;Acc:ZDB-GENE-060825-224])

HSP 1 Score: 54.299 bits (129), Expect = 3.118e-9
Identity = 23/35 (65.71%), Postives = 28/35 (80.00%), Query Frame = 3
Query:  204 WLRLATVMIYIILVSLAAIVLAIYYSIIWHPNVKS 308
            W+RLATV  Y++ VSLAAI+LAIYYS+IW P   S
Sbjct:   34 WVRLATVFAYVLSVSLAAIILAIYYSLIWKPTSAS 68          
BLAST of Proline-rich protein 24 vs. Ensembl Xenopus
Match: ap4e1 (adaptor related protein complex 4 subunit epsilon 1 [Source:Xenbase;Acc:XB-GENE-988221])

HSP 1 Score: 51.2174 bits (121), Expect = 1.661e-8
Identity = 21/31 (67.74%), Postives = 27/31 (87.10%), Query Frame = 3
Query:  204 WLRLATVMIYIILVSLAAIVLAIYYSIIWHP 296
            W+RLATV  Y++ VS+AAI+LAIYYS+IW P
Sbjct:   34 WVRLATVFAYVLSVSMAAIILAIYYSLIWMP 64          
BLAST of Proline-rich protein 24 vs. Ensembl Mouse
Match: Inafm2 (InaF motif containing 2 [Source:MGI Symbol;Acc:MGI:1915354])

HSP 1 Score: 54.6842 bits (130), Expect = 7.318e-10
Identity = 22/31 (70.97%), Postives = 27/31 (87.10%), Query Frame = 3
Query:  204 WLRLATVMIYIILVSLAAIVLAIYYSIIWHP 296
            W+RLATV  Y++ VSLAAIVLA+YYS+IW P
Sbjct:   33 WVRLATVFAYVLSVSLAAIVLAVYYSLIWQP 63          
BLAST of Proline-rich protein 24 vs. Ensembl Mouse
Match: Inafm1 (InaF motif containing 1 [Source:MGI Symbol;Acc:MGI:1913550])

HSP 1 Score: 48.1358 bits (113), Expect = 1.731e-7
Identity = 19/32 (59.38%), Postives = 24/32 (75.00%), Query Frame = 3
Query:  204 WLRLATVMIYIILVSLAAIVLAIYYSIIWHPN 299
            WLRLA V  Y + VSLAA++LA+YY +IW P 
Sbjct:   27 WLRLAPVCAYFLCVSLAAVLLAVYYGLIWVPT 58          
BLAST of Proline-rich protein 24 vs. UniProt/SwissProt
Match: sp|P0DMQ5|INAM2_HUMAN (Putative transmembrane protein INAFM2 OS=Homo sapiens OX=9606 GN=INAFM2 PE=2 SV=1)

HSP 1 Score: 54.6842 bits (130), Expect = 4.993e-9
Identity = 22/31 (70.97%), Postives = 27/31 (87.10%), Query Frame = 3
Query:  204 WLRLATVMIYIILVSLAAIVLAIYYSIIWHP 296
            W+RLATV  Y++ VSLAAIVLA+YYS+IW P
Sbjct:   33 WVRLATVFAYVLSVSLAAIVLAVYYSLIWQP 63          
BLAST of Proline-rich protein 24 vs. UniProt/SwissProt
Match: sp|C9JVW0|INAM1_HUMAN (Putative transmembrane protein INAFM1 OS=Homo sapiens OX=9606 GN=INAFM1 PE=4 SV=1)

HSP 1 Score: 48.521 bits (114), Expect = 8.237e-7
Identity = 19/32 (59.38%), Postives = 24/32 (75.00%), Query Frame = 3
Query:  204 WLRLATVMIYIILVSLAAIVLAIYYSIIWHPN 299
            WLRLA V  Y + VSLAA++LA+YY +IW P 
Sbjct:   27 WLRLAPVCAYFLCVSLAAVLLAVYYGLIWVPT 58          
BLAST of Proline-rich protein 24 vs. TrEMBL
Match: A0A068WMV8 (Uncharacterized protein OS=Echinococcus granulosus OX=6210 GN=EgrG_000429500 PE=4 SV=1)

HSP 1 Score: 58.9214 bits (141), Expect = 7.004e-9
Identity = 26/36 (72.22%), Postives = 30/36 (83.33%), Query Frame = 3
Query:  204 WLRLATVMIYIILVSLAAIVLAIYYSIIWHPNVKSH 311
            WLRLATV +Y+I VSLAAIVLAIYYSI W P + S+
Sbjct:   33 WLRLATVFVYVISVSLAAIVLAIYYSIFWKPTISSN 68          
BLAST of Proline-rich protein 24 vs. TrEMBL
Match: A0A068XXD0 (Uncharacterized protein OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000429500 PE=4 SV=1)

HSP 1 Score: 58.9214 bits (141), Expect = 7.472e-9
Identity = 26/36 (72.22%), Postives = 30/36 (83.33%), Query Frame = 3
Query:  204 WLRLATVMIYIILVSLAAIVLAIYYSIIWHPNVKSH 311
            WLRLATV +Y+I VSLAAIVLAIYYSI W P + S+
Sbjct:   33 WLRLATVFVYVISVSLAAIVLAIYYSIFWKPTISSN 68          
BLAST of Proline-rich protein 24 vs. TrEMBL
Match: A0A0R3UII8 (Uncharacterized protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS7244 PE=4 SV=1)

HSP 1 Score: 56.9954 bits (136), Expect = 4.023e-8
Identity = 25/36 (69.44%), Postives = 30/36 (83.33%), Query Frame = 3
Query:  204 WLRLATVMIYIILVSLAAIVLAIYYSIIWHPNVKSH 311
            W+RLATV +Y+I VSLAAIVLAIYYSI W P + S+
Sbjct:   33 WVRLATVFVYVISVSLAAIVLAIYYSIFWKPTISSN 68          
BLAST of Proline-rich protein 24 vs. TrEMBL
Match: A0A0L8FMF0 (Uncharacterized protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22014942mg PE=4 SV=1)

HSP 1 Score: 56.225 bits (134), Expect = 1.195e-7
Identity = 23/35 (65.71%), Postives = 31/35 (88.57%), Query Frame = 3
Query:  204 WLRLATVMIYIILVSLAAIVLAIYYSIIWHPNVKS 308
            W+RLATV+ Y++ VSLAAIVLAIYYS++W P +K+
Sbjct:   41 WVRLATVLAYVLAVSLAAIVLAIYYSLLWKPELKT 75          
BLAST of Proline-rich protein 24 vs. TrEMBL
Match: A0A2R2MLY4 (putative transmembrane protein INAFM2 OS=Lingula unguis OX=7574 GN=LOC112041796 PE=4 SV=1)

HSP 1 Score: 56.9954 bits (136), Expect = 1.335e-7
Identity = 23/34 (67.65%), Postives = 31/34 (91.18%), Query Frame = 3
Query:  204 WLRLATVMIYIILVSLAAIVLAIYYSIIWHPNVK 305
            W+RLATV+ YI+ VSLAAIVLAIYYS++W P+++
Sbjct:   37 WVRLATVLAYILAVSLAAIVLAIYYSVLWKPDLQ 70          
BLAST of Proline-rich protein 24 vs. Ensembl Cavefish
Match: ENSAMXT00000054091.1 (pep primary_assembly:Astyanax_mexicanus-2.0:3:57405720:57409823:1 gene:ENSAMXG00000037096.1 transcript:ENSAMXT00000054091.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 52.7582 bits (125), Expect = 3.327e-9
Identity = 23/35 (65.71%), Postives = 28/35 (80.00%), Query Frame = 3
Query:  204 WLRLATVMIYIILVSLAAIVLAIYYSIIWHPNVKS 308
            W+RLATV  Y++ VSLAAI+LAIYYS+IW P   S
Sbjct:   28 WVRLATVFAYVLSVSLAAIILAIYYSLIWKPTSAS 62          
BLAST of Proline-rich protein 24 vs. Ensembl Cavefish
Match: INAFM2 (InaF motif containing 2 [Source:HGNC Symbol;Acc:HGNC:35165])

HSP 1 Score: 50.447 bits (119), Expect = 1.942e-8
Identity = 21/31 (67.74%), Postives = 27/31 (87.10%), Query Frame = 3
Query:  204 WLRLATVMIYIILVSLAAIVLAIYYSIIWHP 296
            W+RLATV  Y++ VSLAAI+LA+YYS+IW P
Sbjct:   36 WVRLATVFAYVLSVSLAAIILAVYYSLIWKP 66          
BLAST of Proline-rich protein 24 vs. Ensembl Medaka
Match: INAFM2 (InaF motif containing 2 [Source:NCBI gene;Acc:101154992])

HSP 1 Score: 53.5286 bits (127), Expect = 3.152e-9
Identity = 22/31 (70.97%), Postives = 27/31 (87.10%), Query Frame = 3
Query:  204 WLRLATVMIYIILVSLAAIVLAIYYSIIWHP 296
            W+RLATV  Y++ VSLAAI+LAIYYS+IW P
Sbjct:   34 WVRLATVFAYVLSVSLAAIILAIYYSLIWKP 64          
BLAST of Proline-rich protein 24 vs. Ensembl Medaka
Match: ENSORLT00000019708.2 (pep primary_assembly:ASM223467v1:24:12057671:12063197:-1 gene:ENSORLG00000015736.2 transcript:ENSORLT00000019708.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 50.447 bits (119), Expect = 4.841e-8
Identity = 19/31 (61.29%), Postives = 27/31 (87.10%), Query Frame = 3
Query:  204 WLRLATVMIYIILVSLAAIVLAIYYSIIWHP 296
            W+R+ TV+ Y++ VS+AAIVLA+YYS+IW P
Sbjct:   33 WVRVLTVLAYVLAVSVAAIVLAVYYSLIWEP 63          
BLAST of Proline-rich protein 24 vs. Planmine SMEST
Match: SMESG000002898.1 (SMESG000002898.1)

HSP 1 Score: 156.377 bits (394), Expect = 1.168e-50
Identity = 90/90 (100.00%), Postives = 90/90 (100.00%), Query Frame = 3
Query:   42 MFEKEMEYRLDQSFNEQNDPSNIQEDTTQCLLKRFNAETEXXXXXXXXXXXXXXWLRLATVMIYIILVSLAAIVLAIYYSIIWHPNVKSH 311
            MFEKEMEYRLDQSFNEQNDPSNIQEDTTQCLLKRFNAETENISKKTNLKSNNKKWLRLATVMIYIILVSLAAIVLAIYYSIIWHPNVKSH
Sbjct:    1 MFEKEMEYRLDQSFNEQNDPSNIQEDTTQCLLKRFNAETENISKKTNLKSNNKKWLRLATVMIYIILVSLAAIVLAIYYSIIWHPNVKSH 90          
The following BLAST results are available for this feature:
BLAST of Proline-rich protein 24 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
INAFM21.040e-970.97InaF motif containing 2 [Source:HGNC Symbol;Acc:HG... [more]
INAFM11.715e-759.38InaF motif containing 1 [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of Proline-rich protein 24 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Proline-rich protein 24 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Proline-rich protein 24 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
zgc:1531572.997e-965.71zgc:153157 [Source:ZFIN;Acc:ZDB-GENE-060825-224][more]
zgc:1531572.997e-965.71zgc:153157 [Source:ZFIN;Acc:ZDB-GENE-060825-224][more]
zgc:1531573.118e-965.71zgc:153157 [Source:ZFIN;Acc:ZDB-GENE-060825-224][more]
back to top
BLAST of Proline-rich protein 24 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ap4e11.661e-867.74adaptor related protein complex 4 subunit epsilon ... [more]
back to top
BLAST of Proline-rich protein 24 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Inafm27.318e-1070.97InaF motif containing 2 [Source:MGI Symbol;Acc:MGI... [more]
Inafm11.731e-759.38InaF motif containing 1 [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of Proline-rich protein 24 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 2
Match NameE-valueIdentityDescription
sp|P0DMQ5|INAM2_HUMAN4.993e-970.97Putative transmembrane protein INAFM2 OS=Homo sapi... [more]
sp|C9JVW0|INAM1_HUMAN8.237e-759.38Putative transmembrane protein INAFM1 OS=Homo sapi... [more]
back to top
BLAST of Proline-rich protein 24 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A068WMV87.004e-972.22Uncharacterized protein OS=Echinococcus granulosus... [more]
A0A068XXD07.472e-972.22Uncharacterized protein OS=Echinococcus multilocul... [more]
A0A0R3UII84.023e-869.44Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A0L8FMF01.195e-765.71Uncharacterized protein OS=Octopus bimaculoides OX... [more]
A0A2R2MLY41.335e-767.65putative transmembrane protein INAFM2 OS=Lingula u... [more]
back to top
BLAST of Proline-rich protein 24 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSAMXT00000054091.13.327e-965.71pep primary_assembly:Astyanax_mexicanus-2.0:3:5740... [more]
INAFM21.942e-867.74InaF motif containing 2 [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of Proline-rich protein 24 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Proline-rich protein 24 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Proline-rich protein 24 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Proline-rich protein 24 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
INAFM23.152e-970.97InaF motif containing 2 [Source:NCBI gene;Acc:1011... [more]
ENSORLT00000019708.24.841e-861.29pep primary_assembly:ASM223467v1:24:12057671:12063... [more]
back to top
BLAST of Proline-rich protein 24 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000002898.11.168e-50100.00SMESG000002898.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30028334 ID=SMED30028334|Name=Proline-rich protein 24|organism=Schmidtea mediterranea sexual|type=transcript|length=410bp
CCGTTAGACGGTCTTATCGAAATCTATATAAATCTTATATGATGTTTGAA
AAAGAAATGGAATACAGATTAGATCAGTCTTTTAATGAACAAAATGATCC
ATCTAACATTCAAGAAGACACAACTCAGTGTTTATTGAAAAGATTCAACG
CGGAAACTGAAAACATTTCAAAGAAAACAAATTTAAAGTCCAATAATAAA
AAATGGTTGCGTCTCGCAACTGTAATGATTTATATAATTCTGGTCTCTCT
AGCTGCGATTGTGTTAGCGATTTATTACAGTATTATCTGGCATCCTAATG
TTAAATCTCATTAATATCAGGAATTCTAAAGTGAATAACAACGTGATTTA
ATTTACTTTTACTTCAATACATTTAATGTTAGANNNNNANATAATTCAAT
TAGCACTTTT
back to top

protein sequence of SMED30028334-orf-1

>SMED30028334-orf-1 ID=SMED30028334-orf-1|Name=SMED30028334-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=104bp
VRRSYRNLYKSYMMFEKEMEYRLDQSFNEQNDPSNIQEDTTQCLLKRFNA
ETENISKKTNLKSNNKKWLRLATVMIYIILVSLAAIVLAIYYSIIWHPNV
KSH*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
Vocabulary: INTERPRO
TermDefinition
IPR029162InaF-motif
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR029162TRP-interacting helix, InaF motifPFAMPF15018InaF-motifcoord: 53..86
e-value: 1.8E-16
score: 59.7
NoneNo IPR availablePANTHERPTHR34929FAMILY NOT NAMEDcoord: 37..88
NoneNo IPR availableTMHMMTMhelixcoord: 61..83