G_PROTEIN_RECEP_F1_2 domain-containing protein

Overview
NameG_PROTEIN_RECEP_F1_2 domain-containing protein
Smed IDSMED30028333
Length (bp)1158
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30028333) t-SNE clustered cells

Violin plots show distribution of expression levels for G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30028333) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30028333) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30028333) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30028333

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30028333SMESG000061225.1 SmedASXL_008836SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30028333SMESG000061225.1 dd_Smed_v6_21953_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30028333SMESG000061225.1 OX_Smed_1.0.21963ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Celegans
Match: sprr-1 (Sex Peptide Receptor (Drosophila) Related [Source:UniProtKB/TrEMBL;Acc:G5EEU4])

HSP 1 Score: 106.686 bits (265), Expect = 6.170e-25
Identity = 107/391 (27.37%), Postives = 180/391 (46.04%), Query Frame = 2
Query:  182 LTKPHMISPTNVILLGMAIANLLTGLVPLPIY-----FAKLDSKFVSSISVFKAFTNYYLTVVLPTIFHTAANWLTLILAIQRYFYIKFPVVIHHFWTIKSAKICIYVVFIASTCCHCINFMAYF------MEISREGVIK-CYL--------VNEDVLVAYYML----RVSLINVLPCLVLSIFTIFLIQALGQAKRNHCRLIQASSKKTLSVQKS-DSLSNSI-------------------------------SKMXXXXXXXXXXXXXPTGA--TIAAYTVGKTFMFDLNEALFTFLITLCDVIVLISYPCNFVVYCIMSKQFRNTLR----------AVLFVQKSSDL----GFIGHKDDKIEKV--------LLNKIPNDKYEKS 1114
            L+  ++ +PTN +LL MA+  LLTGL  LP +      +   +   + +  F      Y+   LP+IFHT A WLT+ LAIQRY YI  P ++  F TI  +K  I+ +   +T  +  + MA+        +  R   +K CY         + +D+   YY +    +   ++++P ++L IFT  L+ A+  A R H  L+   S  T S ++    L+NS                                ++ML+VV++LFL+ E+P     TI   +V   F F ++      L+ + +V++++SYP  F +YC MS+QFR+ +R          A+     S+ +    G   H DDK + V        L++ +P ++ +K 
Sbjct:   54 LSHKYLRTPTNYVLLAMAVTELLTGLSCLPWFTYYYTLSGYKNDLQTGLPSFWCDMIPYMAAFLPSIFHTMAIWLTVYLAIQRYIYICVPSLVRKFCTIHRSKQVIFFIISVATIMYTPDLMAFHNKSHDVFDSKRNRTMKLCYRHRAPFMLKLGDDI---YYKVMFTTQTVAVHLIPSVLLVIFTWKLVGAIRVADRRHANLLSKYSTTTRSTRRKFSELTNSSENENKITRLFKQRDSVSVGNEPRRAHGLKQNTRMLVVVILLFLITEIPAALIFTIHVLSVSLKFSF-VDYQFLNILLIVRNVLIVVSYPFRFAIYCGMSQQFRDVVRQMFTGKMLTHAIRDKDNSTTMQLVQGVTDHSDDKRQSVVLCSANGTLVSSVPEERAKKD 440          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Celegans
Match: sprr-1 (Sex Peptide Receptor (Drosophila) Related [Source:UniProtKB/TrEMBL;Acc:G5EEU4])

HSP 1 Score: 106.686 bits (265), Expect = 6.170e-25
Identity = 107/391 (27.37%), Postives = 180/391 (46.04%), Query Frame = 2
Query:  182 LTKPHMISPTNVILLGMAIANLLTGLVPLPIY-----FAKLDSKFVSSISVFKAFTNYYLTVVLPTIFHTAANWLTLILAIQRYFYIKFPVVIHHFWTIKSAKICIYVVFIASTCCHCINFMAYF------MEISREGVIK-CYL--------VNEDVLVAYYML----RVSLINVLPCLVLSIFTIFLIQALGQAKRNHCRLIQASSKKTLSVQKS-DSLSNSI-------------------------------SKMXXXXXXXXXXXXXPTGA--TIAAYTVGKTFMFDLNEALFTFLITLCDVIVLISYPCNFVVYCIMSKQFRNTLR----------AVLFVQKSSDL----GFIGHKDDKIEKV--------LLNKIPNDKYEKS 1114
            L+  ++ +PTN +LL MA+  LLTGL  LP +      +   +   + +  F      Y+   LP+IFHT A WLT+ LAIQRY YI  P ++  F TI  +K  I+ +   +T  +  + MA+        +  R   +K CY         + +D+   YY +    +   ++++P ++L IFT  L+ A+  A R H  L+   S  T S ++    L+NS                                ++ML+VV++LFL+ E+P     TI   +V   F F ++      L+ + +V++++SYP  F +YC MS+QFR+ +R          A+     S+ +    G   H DDK + V        L++ +P ++ +K 
Sbjct:   54 LSHKYLRTPTNYVLLAMAVTELLTGLSCLPWFTYYYTLSGYKNDLQTGLPSFWCDMIPYMAAFLPSIFHTMAIWLTVYLAIQRYIYICVPSLVRKFCTIHRSKQVIFFIISVATIMYTPDLMAFHNKSHDVFDSKRNRTMKLCYRHRAPFMLKLGDDI---YYKVMFTTQTVAVHLIPSVLLVIFTWKLVGAIRVADRRHANLLSKYSTTTRSTRRKFSELTNSSENENKITRLFKQRDSVSVGNEPRRAHGLKQNTRMLVVVILLFLITEIPAALIFTIHVLSVSLKFSF-VDYQFLNILLIVRNVLIVVSYPFRFAIYCGMSQQFRDVVRQMFTGKMLTHAIRDKDNSTTMQLVQGVTDHSDDKRQSVVLCSANGTLVSSVPEERAKKD 440          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Celegans
Match: sprr-2 (Sex Peptide Receptor (Drosophila) Related [Source:UniProtKB/TrEMBL;Acc:Q93704])

HSP 1 Score: 105.916 bits (263), Expect = 6.532e-25
Identity = 95/310 (30.65%), Postives = 149/310 (48.06%), Query Frame = 2
Query:  182 LTKPHMISPTNVILLGMAIANLLTGLVPLP---IYFAKLDSKFVSSISVFKAFTNYYLTVVLPTIFHTAANWLTLILAIQRYFYIKFPVVIHHFWTIKSAKICIYVVFIASTCCHCINFMAYFME-----ISREG----VIKCYLVNEDVLVA---------YYMLRVSLINVLPCLVLSIFTIFLIQALGQAKRNHCRLIQASSKKTLSVQKSDSLSNSISKMXXXXXXXXXXXXXPTGATIAAYTVGKTFMFDLN--EALF--TFLITLCDVIVLISYPCNFVVYCIMSKQFRNTLRAVLFVQKSSDL 1036
            L+K HMI+PTNV+L  MAIA LL GLVPLP    +F+  + K    + ++  +   Y     P +FH  A WLT++LA QRY  I  P+       +K+ ++   ++ + S  C       Y  E     I   G       C ++   +L           Y+  R     +LP  +L +    LI+ + +A+R   RL++    +  + Q+    SNS S ML+ ++ +FL+V +P    +    V +TF   +   E  F   FLI   ++IV+ +YP NF +YC MS  FR T + +LF   +S L
Sbjct:   83 LSKKHMITPTNVVLKYMAIAELLVGLVPLPWTLFFFSMGNIKETHRLELWWCYLQKYSMDAFPPVFHMIAMWLTVLLAAQRYVSISHPLHSRSACNVKNVRLATMIITVTSFLCGLPKSFDYEYETVHGWIYSHGNWTYASSCVMMPTAILTNMGQTVYFNIYFWTRALGFIILPSFLLVLLNGLLIKGIRRAQRRKLRLLREKRSEEAARQRD---SNSTSLMLVAIVSIFLIVNLPQAIFMGLLCVCETFTIKIPILEGTFPAVFLIA-SNMIVIATYPINFGIYCFMSSSFRQTFK-LLFCPGASQL 387          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Celegans
Match: sprr-2 (Sex Peptide Receptor (Drosophila) Related [Source:UniProtKB/TrEMBL;Acc:Q93704])

HSP 1 Score: 105.916 bits (263), Expect = 6.532e-25
Identity = 95/310 (30.65%), Postives = 149/310 (48.06%), Query Frame = 2
Query:  182 LTKPHMISPTNVILLGMAIANLLTGLVPLP---IYFAKLDSKFVSSISVFKAFTNYYLTVVLPTIFHTAANWLTLILAIQRYFYIKFPVVIHHFWTIKSAKICIYVVFIASTCCHCINFMAYFME-----ISREG----VIKCYLVNEDVLVA---------YYMLRVSLINVLPCLVLSIFTIFLIQALGQAKRNHCRLIQASSKKTLSVQKSDSLSNSISKMXXXXXXXXXXXXXPTGATIAAYTVGKTFMFDLN--EALF--TFLITLCDVIVLISYPCNFVVYCIMSKQFRNTLRAVLFVQKSSDL 1036
            L+K HMI+PTNV+L  MAIA LL GLVPLP    +F+  + K    + ++  +   Y     P +FH  A WLT++LA QRY  I  P+       +K+ ++   ++ + S  C       Y  E     I   G       C ++   +L           Y+  R     +LP  +L +    LI+ + +A+R   RL++    +  + Q+    SNS S ML+ ++ +FL+V +P    +    V +TF   +   E  F   FLI   ++IV+ +YP NF +YC MS  FR T + +LF   +S L
Sbjct:   83 LSKKHMITPTNVVLKYMAIAELLVGLVPLPWTLFFFSMGNIKETHRLELWWCYLQKYSMDAFPPVFHMIAMWLTVLLAAQRYVSISHPLHSRSACNVKNVRLATMIITVTSFLCGLPKSFDYEYETVHGWIYSHGNWTYASSCVMMPTAILTNMGQTVYFNIYFWTRALGFIILPSFLLVLLNGLLIKGIRRAQRRKLRLLREKRSEEAARQRD---SNSTSLMLVAIVSIFLIVNLPQAIFMGLLCVCETFTIKIPILEGTFPAVFLIA-SNMIVIATYPINFGIYCFMSSSFRQTFK-LLFCPGASQL 387          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Celegans
Match: srw-111 (Serpentine Receptor, class W [Source:UniProtKB/TrEMBL;Acc:O62311])

HSP 1 Score: 47.3654 bits (111), Expect = 9.692e-6
Identity = 49/169 (28.99%), Postives = 81/169 (47.93%), Query Frame = 2
Query:  539 FMEISREGVIKCYLVNEDVLVAYYMLRVSLI--NVLPCLVLSIFTIFLIQALGQAKRNHCRLIQASSKKTLSVQKSDSLSNSISKMXXXXXXXXXXXXXPTGATIAAYTVGKTFMFDLNEALFTFLITLCDVIVLISYPCN----FVVYCIMSKQFRNTLRAVLFVQKS 1027
            F E   +GV+  Y+V++ V V      VS I  N++PCL+  IF   L++ + +A  N  RL   SSKKT+   K+       ++++    + F +   P G +     +  T      E L+   I L + IVL+ +  N    FV+Y +MS Q++NT + +     S
Sbjct:  191 FSECYPKGVLT-YIVDQKVSVKQLSSTVSAIISNIIPCLLFPIFAGLLVKEMHKATENQRRL--TSSKKTIDYNKT-------TRLVFYNTLFFFISLFPLGVSRTLLLLSST------EFLWPMFIDL-ESIVLVIFTLNTMSHFVIYMLMSSQYQNTTKELFLCGDS 342          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Fly
Match: SPR (gene:FBgn0029768 transcript:FBtr0344824)

HSP 1 Score: 102.064 bits (253), Expect = 1.250e-23
Identity = 93/337 (27.60%), Postives = 163/337 (48.37%), Query Frame = 2
Query:  182 LTKPHMISPTNVILLGMAIANLLTGLVPLP----IYFAKLDSKFVSSISVFKAFTNYYLTVVLPTIFHTAANWLTLILAIQRYFYIKFPVVIHHFWTIKSAKICI-YVVFIASTCCHCI------NFMAYFMEISREGVIKCYL-----VNEDVLV-----AYYMLRVSLINVLPCLVLSIFTIFLIQALGQAKRNHCRLIQASSKKTLSVQKSDSLSNSISKMXXXXXXXXXXXXXPTGATIAAYTVGKTFMFDLNEALFTFLITLCDVIVLISYPCNFVVYCIMSKQFRNTLRAVLFVQKSSDLGFIGHKDDKIEKVLLNKIPNDKYEKSCDETN 1129
            L+K  M +PTN +L+GMAI ++LT + P P    +Y      K +  +S+  A++ +    ++P + HT + WLTL LA+QRY Y+    +   + T+   + C  Y+  +A    H +       +M   +E +      C+L     V++ + V     +YY+ RV  +++LPC++L    I L  A+ QA+     L + + KK     +    +N  + ML+VV+ +FL+ E+P     A + V    +  L+  L    I L +  ++ SYP NF +YC MS+QFR T + +   +       +  KD   +  ++N        ++C  TN
Sbjct:  114 LSKKSMATPTNFVLMGMAICDMLTVIFPAPGLWYMYTFGNHYKPLHPVSMCLAYSIF--NEIMPAMCHTISVWLTLALAVQRYIYVCHAPMARTWCTMPRVRRCTAYIALLAFL--HQLPRFFDRTYMPLVIEWNGSPTEVCHLETSMWVHDYIGVDLYYTSYYLFRVLFVHLLPCIILVTLNILLFAAMRQAQERRKLLFRENRKKECKKLRE---TNCTTLMLIVVVSVFLLAEIPIAVVTAMHIVSSLIIEFLDYGLANICIMLTNFFLVFSYPINFGIYCGMSRQFRETFKEIFLGR------LMAKKDSSTKYSIVNG------ARTCTNTN 431          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Fly
Match: SPR (gene:FBgn0029768 transcript:FBtr0339781)

HSP 1 Score: 102.064 bits (253), Expect = 1.250e-23
Identity = 93/337 (27.60%), Postives = 163/337 (48.37%), Query Frame = 2
Query:  182 LTKPHMISPTNVILLGMAIANLLTGLVPLP----IYFAKLDSKFVSSISVFKAFTNYYLTVVLPTIFHTAANWLTLILAIQRYFYIKFPVVIHHFWTIKSAKICI-YVVFIASTCCHCI------NFMAYFMEISREGVIKCYL-----VNEDVLV-----AYYMLRVSLINVLPCLVLSIFTIFLIQALGQAKRNHCRLIQASSKKTLSVQKSDSLSNSISKMXXXXXXXXXXXXXPTGATIAAYTVGKTFMFDLNEALFTFLITLCDVIVLISYPCNFVVYCIMSKQFRNTLRAVLFVQKSSDLGFIGHKDDKIEKVLLNKIPNDKYEKSCDETN 1129
            L+K  M +PTN +L+GMAI ++LT + P P    +Y      K +  +S+  A++ +    ++P + HT + WLTL LA+QRY Y+    +   + T+   + C  Y+  +A    H +       +M   +E +      C+L     V++ + V     +YY+ RV  +++LPC++L    I L  A+ QA+     L + + KK     +    +N  + ML+VV+ +FL+ E+P     A + V    +  L+  L    I L +  ++ SYP NF +YC MS+QFR T + +   +       +  KD   +  ++N        ++C  TN
Sbjct:  114 LSKKSMATPTNFVLMGMAICDMLTVIFPAPGLWYMYTFGNHYKPLHPVSMCLAYSIF--NEIMPAMCHTISVWLTLALAVQRYIYVCHAPMARTWCTMPRVRRCTAYIALLAFL--HQLPRFFDRTYMPLVIEWNGSPTEVCHLETSMWVHDYIGVDLYYTSYYLFRVLFVHLLPCIILVTLNILLFAAMRQAQERRKLLFRENRKKECKKLRE---TNCTTLMLIVVVSVFLLAEIPIAVVTAMHIVSSLIIEFLDYGLANICIMLTNFFLVFSYPINFGIYCGMSRQFRETFKEIFLGR------LMAKKDSSTKYSIVNG------ARTCTNTN 431          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Fly
Match: SPR (gene:FBgn0029768 transcript:FBtr0070778)

HSP 1 Score: 102.064 bits (253), Expect = 1.250e-23
Identity = 93/337 (27.60%), Postives = 163/337 (48.37%), Query Frame = 2
Query:  182 LTKPHMISPTNVILLGMAIANLLTGLVPLP----IYFAKLDSKFVSSISVFKAFTNYYLTVVLPTIFHTAANWLTLILAIQRYFYIKFPVVIHHFWTIKSAKICI-YVVFIASTCCHCI------NFMAYFMEISREGVIKCYL-----VNEDVLV-----AYYMLRVSLINVLPCLVLSIFTIFLIQALGQAKRNHCRLIQASSKKTLSVQKSDSLSNSISKMXXXXXXXXXXXXXPTGATIAAYTVGKTFMFDLNEALFTFLITLCDVIVLISYPCNFVVYCIMSKQFRNTLRAVLFVQKSSDLGFIGHKDDKIEKVLLNKIPNDKYEKSCDETN 1129
            L+K  M +PTN +L+GMAI ++LT + P P    +Y      K +  +S+  A++ +    ++P + HT + WLTL LA+QRY Y+    +   + T+   + C  Y+  +A    H +       +M   +E +      C+L     V++ + V     +YY+ RV  +++LPC++L    I L  A+ QA+     L + + KK     +    +N  + ML+VV+ +FL+ E+P     A + V    +  L+  L    I L +  ++ SYP NF +YC MS+QFR T + +   +       +  KD   +  ++N        ++C  TN
Sbjct:  114 LSKKSMATPTNFVLMGMAICDMLTVIFPAPGLWYMYTFGNHYKPLHPVSMCLAYSIF--NEIMPAMCHTISVWLTLALAVQRYIYVCHAPMARTWCTMPRVRRCTAYIALLAFL--HQLPRFFDRTYMPLVIEWNGSPTEVCHLETSMWVHDYIGVDLYYTSYYLFRVLFVHLLPCIILVTLNILLFAAMRQAQERRKLLFRENRKKECKKLRE---TNCTTLMLIVVVSVFLLAEIPIAVVTAMHIVSSLIIEFLDYGLANICIMLTNFFLVFSYPINFGIYCGMSRQFRETFKEIFLGR------LMAKKDSSTKYSIVNG------ARTCTNTN 431          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Fly
Match: MsR2 (gene:FBgn0264002 transcript:FBtr0330360)

HSP 1 Score: 49.6766 bits (117), Expect = 3.972e-6
Identity = 41/133 (30.83%), Postives = 66/133 (49.62%), Query Frame = 2
Query:  182 LTKPHMISPTNVILLGMAIANLLTGLVPLP------IYFAKLDSKFVSSISVFKAFTNYYLTVVLPTIFHTAANWLTLILAIQRYFYIKFPVVIHHFWTIKSAKICI---YV--VFIASTCCHCINFMAYFME 547
            LT+  M SPTN IL G+A+A+L   L  +P      I   +L  +   S S +  F  ++   V P + HT + WLT+ LA+ RY  + +P     +  +++  I I   YV  V + S   + +  +A F+E
Sbjct:   48 LTRREMRSPTNAILTGLAVADLAVMLEYIPYTVHDYILSVRLPREEQLSYS-WACFIKFH--SVFPQVLHTISIWLTVTLAVWRYIAVSYPQRNRIWCGMRTTLITIATAYVVCVLVVSPWLYLVTAIAKFLE 177          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Fly
Match: MsR2 (gene:FBgn0264002 transcript:FBtr0330359)

HSP 1 Score: 48.521 bits (114), Expect = 6.478e-6
Identity = 41/133 (30.83%), Postives = 66/133 (49.62%), Query Frame = 2
Query:  182 LTKPHMISPTNVILLGMAIANLLTGLVPLP------IYFAKLDSKFVSSISVFKAFTNYYLTVVLPTIFHTAANWLTLILAIQRYFYIKFPVVIHHFWTIKSAKICI---YV--VFIASTCCHCINFMAYFME 547
            LT+  M SPTN IL G+A+A+L   L  +P      I   +L  +   S S +  F  ++   V P + HT + WLT+ LA+ RY  + +P     +  +++  I I   YV  V + S   + +  +A F+E
Sbjct:   48 LTRREMRSPTNAILTGLAVADLAVMLEYIPYTVHDYILSVRLPREEQLSYS-WACFIKFH--SVFPQVLHTISIWLTVTLAVWRYIAVSYPQRNRIWCGMRTTLITIATAYVVCVLVVSPWLYLVTAIAKFLE 177          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q93704|SPRR2_CAEEL (Sex peptide receptor-related protein 2 OS=Caenorhabditis elegans OX=6239 GN=sprr-2 PE=2 SV=2)

HSP 1 Score: 105.916 bits (263), Expect = 8.309e-24
Identity = 95/310 (30.65%), Postives = 149/310 (48.06%), Query Frame = 2
Query:  182 LTKPHMISPTNVILLGMAIANLLTGLVPLP---IYFAKLDSKFVSSISVFKAFTNYYLTVVLPTIFHTAANWLTLILAIQRYFYIKFPVVIHHFWTIKSAKICIYVVFIASTCCHCINFMAYFME-----ISREG----VIKCYLVNEDVLVA---------YYMLRVSLINVLPCLVLSIFTIFLIQALGQAKRNHCRLIQASSKKTLSVQKSDSLSNSISKMXXXXXXXXXXXXXPTGATIAAYTVGKTFMFDLN--EALF--TFLITLCDVIVLISYPCNFVVYCIMSKQFRNTLRAVLFVQKSSDL 1036
            L+K HMI+PTNV+L  MAIA LL GLVPLP    +F+  + K    + ++  +   Y     P +FH  A WLT++LA QRY  I  P+       +K+ ++   ++ + S  C       Y  E     I   G       C ++   +L           Y+  R     +LP  +L +    LI+ + +A+R   RL++    +  + Q+    SNS S ML+ ++ +FL+V +P    +    V +TF   +   E  F   FLI   ++IV+ +YP NF +YC MS  FR T + +LF   +S L
Sbjct:   83 LSKKHMITPTNVVLKYMAIAELLVGLVPLPWTLFFFSMGNIKETHRLELWWCYLQKYSMDAFPPVFHMIAMWLTVLLAAQRYVSISHPLHSRSACNVKNVRLATMIITVTSFLCGLPKSFDYEYETVHGWIYSHGNWTYASSCVMMPTAILTNMGQTVYFNIYFWTRALGFIILPSFLLVLLNGLLIKGIRRAQRRKLRLLREKRSEEAARQRD---SNSTSLMLVAIVSIFLIVNLPQAIFMGLLCVCETFTIKIPILEGTFPAVFLIA-SNMIVIATYPINFGIYCFMSSSFRQTFK-LLFCPGASQL 387          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8SWR3|SPR_DROME (Sex peptide receptor OS=Drosophila melanogaster OX=7227 GN=SPR PE=1 SV=1)

HSP 1 Score: 102.064 bits (253), Expect = 1.253e-22
Identity = 93/337 (27.60%), Postives = 163/337 (48.37%), Query Frame = 2
Query:  182 LTKPHMISPTNVILLGMAIANLLTGLVPLP----IYFAKLDSKFVSSISVFKAFTNYYLTVVLPTIFHTAANWLTLILAIQRYFYIKFPVVIHHFWTIKSAKICI-YVVFIASTCCHCI------NFMAYFMEISREGVIKCYL-----VNEDVLV-----AYYMLRVSLINVLPCLVLSIFTIFLIQALGQAKRNHCRLIQASSKKTLSVQKSDSLSNSISKMXXXXXXXXXXXXXPTGATIAAYTVGKTFMFDLNEALFTFLITLCDVIVLISYPCNFVVYCIMSKQFRNTLRAVLFVQKSSDLGFIGHKDDKIEKVLLNKIPNDKYEKSCDETN 1129
            L+K  M +PTN +L+GMAI ++LT + P P    +Y      K +  +S+  A++ +    ++P + HT + WLTL LA+QRY Y+    +   + T+   + C  Y+  +A    H +       +M   +E +      C+L     V++ + V     +YY+ RV  +++LPC++L    I L  A+ QA+     L + + KK     +    +N  + ML+VV+ +FL+ E+P     A + V    +  L+  L    I L +  ++ SYP NF +YC MS+QFR T + +   +       +  KD   +  ++N        ++C  TN
Sbjct:  114 LSKKSMATPTNFVLMGMAICDMLTVIFPAPGLWYMYTFGNHYKPLHPVSMCLAYSIF--NEIMPAMCHTISVWLTLALAVQRYIYVCHAPMARTWCTMPRVRRCTAYIALLAFL--HQLPRFFDRTYMPLVIEWNGSPTEVCHLETSMWVHDYIGVDLYYTSYYLFRVLFVHLLPCIILVTLNILLFAAMRQAQERRKLLFRENRKKECKKLRE---TNCTTLMLIVVVSVFLLAEIPIAVVTAMHIVSSLIIEFLDYGLANICIMLTNFFLVFSYPINFGIYCGMSRQFRETFKEIFLGR------LMAKKDSSTKYSIVNG------ARTCTNTN 431          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A193KUJ2 (GCR082 OS=Schmidtea mediterranea OX=79327 GN=gcr082 PE=2 SV=1)

HSP 1 Score: 155.606 bits (392), Expect = 8.123e-40
Identity = 114/312 (36.54%), Postives = 178/312 (57.05%), Query Frame = 2
Query:  182 LTKPHMISPTNVILLGMAIANLLTGLVPLPIY----FAKLDSKFVSSISVFKAFTNYYLTVVLPTIFHTAANWLTLILAIQRYFYIKFPVVIHHFWTIK-SAKICIYVVFIASTCCHCIN-------FMAYFMEISREG----VIKCYLVNEDVLVAYYMLRVSLINVLPCLVLSIFTIFLIQALGQAKRNHCRLIQASSKKTLSVQKSDSLSNSISKMXXXXXXXXXXXXXPTGATIAAYTVGKT-FMFDLNEALFTFLITLCDVIVLISYPCNFVVYCIMSKQFRNTLRAVLFVQKSSDLGFIGHKDDKI 1066
            L K HM SPTNVIL+ +A+A++ TG+ PLP+Y    +    +++ ++I++  A   + L VVLPTI HTA+ WLT+ILAIQRY YI  P+ + H   IK S K+ I V+F++     C N       F+ + +  S       V+KC+     +++ YY  R+ L++V PC +L  F++ LI A+ +      +L+  S K    +   D  SN+ S+ML+VV+ +FL+VE+P G  I  YT+ +  F+   ++ L   L  +C++  +ISY  NF VYC MSKQFR T + +   + S DL    H   ++
Sbjct:   67 LNKRHMRSPTNVILMSLALADMFTGVFPLPVYLINNYPTFLTQYQNNITISVAI--FVLNVVLPTICHTASIWLTVILAIQRYIYITMPLKVDHICKIKNSIKMVIAVIFLSI----CFNWPLISPQFLKFNLVCSDNSTHILVMKCHSSGSRLMIIYYFSRLLLMHVAPCALLLSFSVLLIIAMKKVAIRRRKLLNLSKKAESRMLGWD--SNTTSRMLVVVVTIFLIVELPNGIFITIYTISQMLFITIFSDELLGKLTHICNLATMISYLFNFFVYCTMSKQFRETYKTLFGFEPSFDLSRRRHSQPEL 370          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A193KUJ4 (GCR057 OS=Schmidtea mediterranea OX=79327 GN=gcr057 PE=2 SV=1)

HSP 1 Score: 152.525 bits (384), Expect = 2.113e-38
Identity = 112/295 (37.97%), Postives = 176/295 (59.66%), Query Frame = 2
Query:  182 LTKPHMISPTNVILLGMAIANLLTGLVPLPIYFAKLDSKFVSSISVFKAFTNYYLTVVLPTIFHTAANWLTLILAIQRYFYIKFPVVIHHFWTIKSAKICIYVVFIASTCCHC----INFMAYFMEISREG-----VIKCYLVNEDVLVAYYMLRVSLINVLPCLVLSIFTIFLIQALGQAKRNHCRLIQASSKKTLSVQKSDSLSNSISKMXXXXXXXXXXXXXPTGATIAAYTVGK-TFMFDLNEALFTFLITLCDVIVLISYPCNFVVYCIMSKQFRNTLRAVLFVQKSSDL 1036
            LT+ HMIS TN+IL  +AIA+ LTGL PLP Y  K  S F S  S    +  Y+  VV+PTI HT + WLT+ LA+QR+ Y+  P    +  T+K++   I  + + S   H     ++F +Y+    +       ++KC    E +L+ YY  R  L+NV+PCL+L++F + LI A+  A+++   L+Q S KK    ++S     S SKMLLVVL LFL+VE+P G  I  Y + K     + N++ +  + ++C+++++ SYP NFV+YCIMS+ FR TL+ ++ +  S+++
Sbjct:   74 LTRRHMISATNMILTAIAIADFLTGLFPLPFYVIKNFSFFSSIRSRTFGYFYYFSVVVIPTICHTISIWLTVALAVQRFIYVSLPTEAKNICTVKTSIYTILTICVLSLVFHLQLSIVSFDSYYFYPCKHQTPEFVILKCNWTVE-LLIIYYWSRTVLMNVIPCLLLTVFILSLIVAVRSAEKHRRVLLQTSQKK--ESRRSKEFY-STSKMLLVVLCLFLIVEIPNGIAITLYMIQKSFSSNNSNDSFWGKMNSICNILIIFSYPLNFVIYCIMSRNFRETLKFIIGISNSANI 364          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A193KUL2 (GCR111 OS=Schmidtea mediterranea OX=79327 GN=gcr111 PE=2 SV=1)

HSP 1 Score: 147.517 bits (371), Expect = 1.015e-36
Identity = 114/321 (35.51%), Postives = 174/321 (54.21%), Query Frame = 2
Query:  182 LTKPHMISPTNVILLGMAIANLLTGLVPLPIYFAK-LDSKFVSSISVFKAF--TNYYLTVVLPTIFHTAANWLTLILAIQRYFYIKFPVVIHHFWTIKSAKICIYVVFIASTCCHCINFMAYFMEISREG----------VIKCYLVNEDVLVAYYMLRVSLINVLPCLVLSIFTIFLIQALGQAKRNHCRLI-QAS-------SKKTLSV-----------------QKSDSLS-NSISKMXXXXXXXXXXXXXPTGATIAAYTVGKTFMFDLNEALFTFLITLCDVIVLISYPCNFVVYCIMSKQFRNTLRAVLFVQKS 1027
            LT+P MI+PTN+IL+G+A++++LTGL+PLPIY  +    +F+     +  F   NYYLT  LPT+FHT + W TL LA+QR  Y+KF   +  F T + A     +  I S+  H  +F+  F     E            IKC + ++     Y +LR++L++++PC  L++ T  LI  L Q    H  LI QAS        K++L+V                 Q S ++   S SKMLL+VLI+FL+VE+P G  I AYT+ +     LN  ++  +   C+ ++L+SYP NF +YC M  +FR T  +++  + S
Sbjct:   68 LTRPFMITPTNIILMGIALSDMLTGLLPLPIYIMRNFSYQFLELEKSYYQFLYVNYYLTSFLPTVFHTTSIWFTLQLALQRVIYVKFSNNVSRFCTTEIAWKMFIITPILSSIFHSPDFIVSFRNSFSENNNGSFGKKNFAIKCNVFSDTSFAIYTILRITLVHLIPCCSLTVLTNILIFVLRQKYHLHNLLIPQASIVQSRDPEKRSLNVLLNVSSHNEAAKRSRFKQGSRTIDIQSTSKMLLMVLIMFLLVEIPIGGVITAYTLLRLLGLKLNPVIWKQVTNTCNFVILVSYPINFFIYCAMLPKFRLTFYSLIRCKPS 388          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: V4BXC4 (G_PROTEIN_RECEP_F1_2 domain-containing protein (Fragment) OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_94766 PE=4 SV=1)

HSP 1 Score: 138.658 bits (348), Expect = 4.179e-34
Identity = 110/293 (37.54%), Postives = 160/293 (54.61%), Query Frame = 2
Query:  182 LTKPHMISPTNVILLGMAIANLLTGLVPLPIYFAKLDSKFVSSISVFKAFTNY-YLTVVLPTIFHTAANWLTLILAIQRYFYIKFPVVIHHFWTIKSA---KICIYVVFIASTCCHCINFMAYFMEISREG-------VIKCYLVNEDVLVA-------YYMLRVSLINVLPCLVLSIFTIFLIQALGQAKRNHCRLIQASSKKTLSVQKSDSLSNSISKMXXXXXXXXXXXXXPTGATIAAYTVGKTFMFD-LNEALFTFLITLCDVIVLISYPCNFVVYCIMSKQFRNTLR 1003
            L K +M SPTN +L+GMAI+++LTG+ PLPI+     +  +   + +     Y YL  +LPTIFHTA+ WLT+ LAIQRY Y+        + TI +A    I IYVV I S C     F +YF+ +  E        VI C   +ED  +A       YY  RV  I+++PC+ L +    LI A+  A+    +L++  +KK+ S +  D  SN  + ML+ V+ LFL+VE P G  +    V  TF    +++  F  L    ++ +L+SYP NF +YC MSKQFR T +
Sbjct:   31 LLKRNMRSPTNTLLVGMAISDMLTGVFPLPIFLEFFATDRLKEFTPYSWCNAYKYLAELLPTIFHTASIWLTMALAIQRYIYVCHSFKARTWCTIPNAIKGTIAIYVVAILSQCTRF--FDSYFVPVVLESAVYENRTVIGCIEEHEDWAMANILYMSIYYWFRVLFIHLIPCIFLVVMNALLIYAMRVAQVRRMQLLR-QNKKSESKKLKD--SNCTTLMLVAVVGLFLLVEFPLGIIMILLIVSNTFEVHIISKETFQILSIFSNLFILLSYPFNFFIYCGMSKQFRETFK 318          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A4E0R7X1 (G-protein coupled receptor OS=Fasciola hepatica OX=6192 GN=D915_006394 PE=4 SV=1)

HSP 1 Score: 139.043 bits (349), Expect = 6.717e-33
Identity = 110/337 (32.64%), Postives = 181/337 (53.71%), Query Frame = 2
Query:  182 LTKPHMISPTNVILLGMAIANLLTGLVPLPIYFAKLDSK-FVSSISVFKAFTNYYLTVVLPTIFHTAANWLTLILAIQRYFYIKFPV-----VIHHFWTIKSAKICIYVVFIASTCCHCI-----NFMAYFME-------------------ISREGVIKCYLVNEDVLVAYYMLRVSLINVLPCLVLSIFTIFLIQALGQAKRNHCRLIQ----ASSKKTLSVQK-------------------------SDSLSNSISKMXXXXXXXXXXXXXPTGATIAAYTVGKTFMFDLNE---ALFTFLITLCDVIVLISYPCNFVVYCIMSKQFRNTLRA 1006
            LT+P + +PTN +LLG+AIA+LLT L+PLPIY + L S  +   +++FK +   YLT +LPTIFHTAA W+T++LA+QR+ Y+++P+      I     IK + +   ++ +       I     N M++ +                    +   GV+KC  ++   +    + RV+ ++V+P ++L+I T  LI AL +  RN  +L+     + +++T+++                           S S ++S S+M+LVVL +FL+VE+PT A I +Y     F   LN     +F +++ LC+ +V++SYP NF VY  MS+ FR TLRA
Sbjct:  116 LTRPILRNPTNTLLLGIAIADLLTVLLPLPIYISSLTSNLYREQLTLFKGYAVSYLTTLLPTIFHTAAIWMTVLLAVQRFVYVQYPLKANSTCICQPGPIKWSTLLTVILALLFQLPQMIFLRYHNAMSFHVTHQITDPDVVVLPSRFGPIVLGELGVVKCTPLDPRFMFTLLLCRVAFVHVIPSVLLTILTGQLIVALHRFARNRRKLLNKFKPSGTEQTITLANSFRSTAVNGNKGRNLGRRISRINGASSSETDSTSRMMLVVLGIFLLVELPTTACICSY----AFSIILNREVSGVFFWIMELCNFLVVLSYPANFFVYLAMSRPFRETLRA 448          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Medaka
Match: nmur3 (neuromedin-U receptor 2-like [Source:NCBI gene;Acc:101165474])

HSP 1 Score: 48.9062 bits (115), Expect = 5.937e-6
Identity = 72/323 (22.29%), Postives = 142/323 (43.96%), Query Frame = 2
Query:  194 HMISPTNVILLGMAIANLLTGL--VPLPIY--FAKLDSKFVSSISVFKAFTNYYLTVVLPTIFHTAANWLTLILAIQRYFYIKFPVVIHHFWTIKSAKICIYVVFIASTCCHCINF----MAYFMEISREGVIKCYLVNEDVLVAYYMLRVSLINVLPCLVLSIFTIFLIQALGQAKRNHCRLIQ----ASSKKTLSVQKSDSLSNSISKMXXXXXXXXXXXXXP------TGATIAAYTVGKTFMFDLNEALFTFLITLCDVIVLISYPCNFVVYCIMSKQFRNTLRAVL--FVQKSSDLGFIGHKDDKIEKVLLNKIPNDK 1102
             M +PTN  L+ +A+++LL  +  +PL IY  +      F      FK F   + TV   +I +  A      L+++RY  +  P+   +  T + AK  I VV++ S  C   N     + Y  E   E  I   L    +      +  +    +P +++S+  + +   LG+ +R+  R +     +SS++ L+V+  +     + KML +V+ +F +   P        ++++ +T       DL   ++ ++  L  ++  +S   N ++Y ++S +FR   R ++   V+ SS +           K LL+  P  +
Sbjct:  120 RMRNPTNFYLVSLAVSDLLVLMFGMPLEIYDLWQNYPFPFGEGGCYFKTF--LFETVCFASILNVTA------LSVERYIAVVHPLKTRYLSTNQHAKRVITVVWVVSMVCAIPNTSLHGIFYLPEKMEESAICTVLKPLWIYNLLMQITTACFYFIPMMIISVLYLVMGIHLGRERRHARRHLGKSCYSSSRRNLTVE--NGRRRQVIKMLSIVVAVFGLCWAPFHIERVLWSSVSQWT-------DLMHNVYQYVHILSGILFYLSSAVNPIIYSLLSTRFRECFRELVCSHVEDSSSV----RDSPPFPKTLLDSSPRTQ 421          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000061225.1 (SMESG000061225.1)

HSP 1 Score: 661.759 bits (1706), Expect = 0.000e+0
Identity = 365/365 (100.00%), Postives = 365/365 (100.00%), Query Frame = 2
Query:   41 MENSSANDSHCSRVFLHQNGFEHLXXXXXXXXXXXXXXXXXXXXXXXLTKPHMISPTNVILLGMAIANLLTGLVPLPIYFAKLDSKFVSSISVFKAFTNYYLTVVLPTIFHTAANWLTLILAIQRYFYIKFPVVIHHFWTIKSAKICIYVVFIASTCCHCINFMAYFMEISREGVIKCYLVNEDVLVAYYMLRVSLINVLPCLVLSIFTIFLIQALGQAKRNHCRLIQASSKKTLSVQKSDSLSNSISKMXXXXXXXXXXXXXPTGATIAAYTVGKTFMFDLNEALFTFLITLCDVIVLISYPCNFVVYCIMSKQFRNTLRAVLFVQKSSDLGFIGHKDDKIEKVLLNKIPNDKYEKSCDETNTL 1135
            MENSSANDSHCSRVFLHQNGFEHLIKSQISPIVIIITFVTNFIVCIVLTKPHMISPTNVILLGMAIANLLTGLVPLPIYFAKLDSKFVSSISVFKAFTNYYLTVVLPTIFHTAANWLTLILAIQRYFYIKFPVVIHHFWTIKSAKICIYVVFIASTCCHCINFMAYFMEISREGVIKCYLVNEDVLVAYYMLRVSLINVLPCLVLSIFTIFLIQALGQAKRNHCRLIQASSKKTLSVQKSDSLSNSISKMLLVVLILFLVVEVPTGATIAAYTVGKTFMFDLNEALFTFLITLCDVIVLISYPCNFVVYCIMSKQFRNTLRAVLFVQKSSDLGFIGHKDDKIEKVLLNKIPNDKYEKSCDETNTL
Sbjct:    1 MENSSANDSHCSRVFLHQNGFEHLIKSQISPIVIIITFVTNFIVCIVLTKPHMISPTNVILLGMAIANLLTGLVPLPIYFAKLDSKFVSSISVFKAFTNYYLTVVLPTIFHTAANWLTLILAIQRYFYIKFPVVIHHFWTIKSAKICIYVVFIASTCCHCINFMAYFMEISREGVIKCYLVNEDVLVAYYMLRVSLINVLPCLVLSIFTIFLIQALGQAKRNHCRLIQASSKKTLSVQKSDSLSNSISKMLLVVLILFLVVEVPTGATIAAYTVGKTFMFDLNEALFTFLITLCDVIVLISYPCNFVVYCIMSKQFRNTLRAVLFVQKSSDLGFIGHKDDKIEKVLLNKIPNDKYEKSCDETNTL 365          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000005296.1 (SMESG000005296.1)

HSP 1 Score: 155.606 bits (392), Expect = 2.259e-43
Identity = 114/312 (36.54%), Postives = 178/312 (57.05%), Query Frame = 2
Query:  182 LTKPHMISPTNVILLGMAIANLLTGLVPLPIY----FAKLDSKFVSSISVFKAFTNYYLTVVLPTIFHTAANWLTLILAIQRYFYIKFPVVIHHFWTIK-SAKICIYVVFIASTCCHCIN-------FMAYFMEISREG----VIKCYLVNEDVLVAYYMLRVSLINVLPCLVLSIFTIFLIQALGQAKRNHCRLIQASSKKTLSVQKSDSLSNSISKMXXXXXXXXXXXXXPTGATIAAYTVGKT-FMFDLNEALFTFLITLCDVIVLISYPCNFVVYCIMSKQFRNTLRAVLFVQKSSDLGFIGHKDDKI 1066
            L K HM SPTNVIL+ +A+A++ TG+ PLP+Y    +    +++ ++I++  A   + L VVLPTI HTA+ WLT+ILAIQRY YI  P+ + H   IK S K+ I V+F++     C N       F+ + +  S       V+KC+     +++ YY  R+ L++V PC +L  F++ LI A+ +      +L+  S K    +   D  SN+ S+ML+VV+ +FL+VE+P G  I  YT+ +  F+   ++ L   L  +C++  +ISY  NF VYC MSKQFR T + +   + S DL    H   ++
Sbjct:   67 LNKRHMRSPTNVILMSLALADMFTGVFPLPVYLINNYPTFLTQYQNNITISVAI--FVLNVVLPTICHTASIWLTVILAIQRYIYITMPLKVDHICKIKNSIKMVIAVIFLSI----CFNWPLISPQFLKFNLVCSDNSTHILVMKCHSSGSRLMIIYYFSRLLLMHVAPCALLLSFSVLLIIAMKKVAIRRRKLLNLSKKAESRMLGWD--SNTTSRMLVVVVTIFLIVELPNGIFITIYTISQMLFITIFSDELLGKLTHICNLATMISYLFNFFVYCTMSKQFRETYKTLFGFEPSFDLSRRRHSQPEL 370          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000001877.1 (SMESG000001877.1)

HSP 1 Score: 152.525 bits (384), Expect = 5.816e-42
Identity = 112/295 (37.97%), Postives = 176/295 (59.66%), Query Frame = 2
Query:  182 LTKPHMISPTNVILLGMAIANLLTGLVPLPIYFAKLDSKFVSSISVFKAFTNYYLTVVLPTIFHTAANWLTLILAIQRYFYIKFPVVIHHFWTIKSAKICIYVVFIASTCCHC----INFMAYFMEISREG-----VIKCYLVNEDVLVAYYMLRVSLINVLPCLVLSIFTIFLIQALGQAKRNHCRLIQASSKKTLSVQKSDSLSNSISKMXXXXXXXXXXXXXPTGATIAAYTVGK-TFMFDLNEALFTFLITLCDVIVLISYPCNFVVYCIMSKQFRNTLRAVLFVQKSSDL 1036
            LT+ HMIS TN+IL  +AIA+ LTGL PLP Y  K  S F S  S    +  Y+  VV+PTI HT + WLT+ LA+QR+ Y+  P    +  T+K++   I  + + S   H     ++F +Y+    +       ++KC    E +L+ YY  R  L+NV+PCL+L++F + LI A+  A+++   L+Q S KK    ++S     S SKMLLVVL LFL+VE+P G  I  Y + K     + N++ +  + ++C+++++ SYP NFV+YCIMS+ FR TL+ ++ +  S+++
Sbjct:   74 LTRRHMISATNMILTAIAIADFLTGLFPLPFYVIKNFSFFSSIRSRTFGYFYYFSVVVIPTICHTISIWLTVALAVQRFIYVSLPTEAKNICTVKTSIYTILTICVLSLVFHLQLSIVSFDSYYFYPCKHQTPEFVILKCNWTVE-LLIIYYWSRTVLMNVIPCLLLTVFILSLIVAVRSAEKHRRVLLQTSQKK--ESRRSKEFY-STSKMLLVVLCLFLIVEIPNGIAITLYMIQKSFSSNNSNDSFWGKMNSICNILIIFSYPLNFVIYCIMSRNFRETLKFIIGISNSANI 364          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000001954.1 (SMESG000001954.1)

HSP 1 Score: 152.525 bits (384), Expect = 5.816e-42
Identity = 112/295 (37.97%), Postives = 176/295 (59.66%), Query Frame = 2
Query:  182 LTKPHMISPTNVILLGMAIANLLTGLVPLPIYFAKLDSKFVSSISVFKAFTNYYLTVVLPTIFHTAANWLTLILAIQRYFYIKFPVVIHHFWTIKSAKICIYVVFIASTCCHC----INFMAYFMEISREG-----VIKCYLVNEDVLVAYYMLRVSLINVLPCLVLSIFTIFLIQALGQAKRNHCRLIQASSKKTLSVQKSDSLSNSISKMXXXXXXXXXXXXXPTGATIAAYTVGK-TFMFDLNEALFTFLITLCDVIVLISYPCNFVVYCIMSKQFRNTLRAVLFVQKSSDL 1036
            LT+ HMIS TN+IL  +AIA+ LTGL PLP Y  K  S F S  S    +  Y+  VV+PTI HT + WLT+ LA+QR+ Y+  P    +  T+K++   I  + + S   H     ++F +Y+    +       ++KC    E +L+ YY  R  L+NV+PCL+L++F + LI A+  A+++   L+Q S KK    ++S     S SKMLLVVL LFL+VE+P G  I  Y + K     + N++ +  + ++C+++++ SYP NFV+YCIMS+ FR TL+ ++ +  S+++
Sbjct:   74 LTRRHMISATNMILTAIAIADFLTGLFPLPFYVIKNFSFFSSIRSRTFGYFYYFSVVVIPTICHTISIWLTVALAVQRFIYVSLPTEAKNICTVKTSIYTILTICVLSLVFHLQLSIVSFDSYYFYPCKHQTPEFVILKCNWTVE-LLIIYYWSRTVLMNVIPCLLLTVFILSLIVAVRSAEKHRRVLLQTSQKK--ESRRSKEFY-STSKMLLVVLCLFLIVEIPNGIAITLYMIQKSFSSNNSNDSFWGKMNSICNILIIFSYPLNFVIYCIMSRNFRETLKFIIGISNSANI 364          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000077911.1 (SMESG000077911.1)

HSP 1 Score: 147.517 bits (371), Expect = 2.822e-40
Identity = 114/321 (35.51%), Postives = 174/321 (54.21%), Query Frame = 2
Query:  182 LTKPHMISPTNVILLGMAIANLLTGLVPLPIYFAK-LDSKFVSSISVFKAF--TNYYLTVVLPTIFHTAANWLTLILAIQRYFYIKFPVVIHHFWTIKSAKICIYVVFIASTCCHCINFMAYFMEISREG----------VIKCYLVNEDVLVAYYMLRVSLINVLPCLVLSIFTIFLIQALGQAKRNHCRLI-QAS-------SKKTLSV-----------------QKSDSLS-NSISKMXXXXXXXXXXXXXPTGATIAAYTVGKTFMFDLNEALFTFLITLCDVIVLISYPCNFVVYCIMSKQFRNTLRAVLFVQKS 1027
            LT+P MI+PTN+IL+G+A++++LTGL+PLPIY  +    +F+     +  F   NYYLT  LPT+FHT + W TL LA+QR  Y+KF   +  F T + A     +  I S+  H  +F+  F     E            IKC + ++     Y +LR++L++++PC  L++ T  LI  L Q    H  LI QAS        K++L+V                 Q S ++   S SKMLL+VLI+FL+VE+P G  I AYT+ +     LN  ++  +   C+ ++L+SYP NF +YC M  +FR T  +++  + S
Sbjct:   68 LTRPFMITPTNIILMGIALSDMLTGLLPLPIYIMRNFSYQFLELEKSYYQFLYVNYYLTSFLPTVFHTTSIWFTLQLALQRVIYVKFSNNVSRFCTTEIAWKMFIITPILSSIFHSPDFIVSFRNSFSENNNGSFGKKNFAIKCNVFSDTSFAIYTILRITLVHLIPCCSLTVLTNILIFVLRQKYHLHNLLIPQASIVQSRDPEKRSLNVLLNVSSHNEAAKRSRFKQGSRTIDIQSTSKMLLMVLIMFLLVEIPIGGVITAYTLLRLLGLKLNPVIWKQVTNTCNFVILVSYPINFFIYCAMLPKFRLTFYSLIRCKPS 388          
The following BLAST results are available for this feature:
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sprr-16.170e-2527.37Sex Peptide Receptor (Drosophila) Related [Source... [more]
sprr-16.170e-2527.37Sex Peptide Receptor (Drosophila) Related [Source... [more]
sprr-26.532e-2530.65Sex Peptide Receptor (Drosophila) Related [Source... [more]
sprr-26.532e-2530.65Sex Peptide Receptor (Drosophila) Related [Source... [more]
srw-1119.692e-628.99Serpentine Receptor, class W [Source:UniProtKB/Tr... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SPR1.250e-2327.60gene:FBgn0029768 transcript:FBtr0344824[more]
SPR1.250e-2327.60gene:FBgn0029768 transcript:FBtr0339781[more]
SPR1.250e-2327.60gene:FBgn0029768 transcript:FBtr0070778[more]
MsR23.972e-630.83gene:FBgn0264002 transcript:FBtr0330360[more]
MsR26.478e-630.83gene:FBgn0264002 transcript:FBtr0330359[more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 2
Match NameE-valueIdentityDescription
sp|Q93704|SPRR2_CAEEL8.309e-2430.65Sex peptide receptor-related protein 2 OS=Caenorha... [more]
sp|Q8SWR3|SPR_DROME1.253e-2227.60Sex peptide receptor OS=Drosophila melanogaster OX... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A193KUJ28.123e-4036.54GCR082 OS=Schmidtea mediterranea OX=79327 GN=gcr08... [more]
A0A193KUJ42.113e-3837.97GCR057 OS=Schmidtea mediterranea OX=79327 GN=gcr05... [more]
A0A193KUL21.015e-3635.51GCR111 OS=Schmidtea mediterranea OX=79327 GN=gcr11... [more]
V4BXC44.179e-3437.54G_PROTEIN_RECEP_F1_2 domain-containing protein (Fr... [more]
A0A4E0R7X16.717e-3332.64G-protein coupled receptor OS=Fasciola hepatica OX... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
nmur35.937e-622.29neuromedin-U receptor 2-like [Source:NCBI gene;Acc... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000061225.10.000e+0100.00SMESG000061225.1[more]
SMESG000005296.12.259e-4336.54SMESG000005296.1[more]
SMESG000001877.15.816e-4237.97SMESG000001877.1[more]
SMESG000001954.15.816e-4237.97SMESG000001954.1[more]
SMESG000077911.12.822e-4035.51SMESG000077911.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30028333 ID=SMED30028333|Name=G_PROTEIN_RECEP_F1_2 domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1158bp
TCTTAGTTGAATTTCCAGTTTCTCTATTGAGGATCCCAAGATGGAGAATT
CATCAGCGAATGACTCGCACTGCAGTCGTGTCTTTCTGCATCAAAATGGA
TTCGAACATCTAATTAAAAGTCAAATATCTCCCATTGTTATTATTATTAC
TTTTGTCACGAATTTCATTGTCTGTATTGTTTTAACAAAACCTCACATGA
TTTCTCCAACGAACGTCATTTTGCTTGGAATGGCTATAGCAAACCTTTTG
ACTGGCTTGGTCCCTCTACCAATTTATTTCGCTAAACTTGATTCTAAGTT
TGTGTCGTCGATATCAGTTTTTAAAGCATTTACAAATTATTATCTTACAG
TTGTTTTGCCAACTATTTTTCACACTGCCGCCAACTGGTTGACTCTGATA
TTAGCTATCCAAAGATATTTTTATATAAAGTTTCCAGTGGTAATTCATCA
TTTTTGGACAATAAAATCAGCGAAAATTTGCATTTATGTTGTATTTATTG
CAAGCACTTGTTGTCATTGTATTAATTTTATGGCTTATTTTATGGAAATA
TCTCGAGAAGGCGTCATTAAGTGCTACCTTGTTAACGAAGATGTTTTGGT
TGCGTATTACATGTTAAGAGTTTCTTTAATCAACGTCCTACCATGTTTAG
TCTTGTCGATATTCACGATTTTTTTAATCCAAGCTCTCGGCCAAGCAAAA
CGCAATCATTGTAGATTAATACAAGCGTCGTCGAAAAAGACCCTTTCGGT
TCAAAAATCTGATTCCTTATCTAATTCAATATCAAAAATGTTGCTTGTTG
TATTAATTCTATTTCTCGTAGTTGAAGTTCCAACTGGTGCGACAATTGCA
GCATATACCGTTGGAAAGACCTTTATGTTTGATTTGAATGAGGCTCTATT
TACATTCCTCATTACTTTATGTGATGTTATTGTACTGATTTCGTACCCAT
GTAACTTTGTTGTCTATTGTATTATGTCCAAACAGTTTCGGAATACCCTA
CGAGCGGTTTTATTTGTACAGAAATCATCAGATTTGGGATTTATCGGTCA
TAAGGATGACAAAATCGAGAAAGTCCTTTTAAATAAAATTCCAAATGATA
AATACGAAAAGTCATGCGATGAAACTAATACATTATAATTATTGTGTTGA
CGATAGAG
back to top

protein sequence of SMED30028333-orf-1

>SMED30028333-orf-1 ID=SMED30028333-orf-1|Name=SMED30028333-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=366bp
MENSSANDSHCSRVFLHQNGFEHLIKSQISPIVIIITFVTNFIVCIVLTK
PHMISPTNVILLGMAIANLLTGLVPLPIYFAKLDSKFVSSISVFKAFTNY
YLTVVLPTIFHTAANWLTLILAIQRYFYIKFPVVIHHFWTIKSAKICIYV
VFIASTCCHCINFMAYFMEISREGVIKCYLVNEDVLVAYYMLRVSLINVL
PCLVLSIFTIFLIQALGQAKRNHCRLIQASSKKTLSVQKSDSLSNSISKM
LLVVLILFLVVEVPTGATIAAYTVGKTFMFDLNEALFTFLITLCDVIVLI
SYPCNFVVYCIMSKQFRNTLRAVLFVQKSSDLGFIGHKDDKIEKVLLNKI
PNDKYEKSCDETNTL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR000276GPCR_Rhodpsn
IPR0194277TM_GPCR_serpentine_rcpt_Srw
IPR017452GPCR_Rhodpsn_7TM
Vocabulary: biological process
TermDefinition
GO:0007186G-protein coupled receptor signaling pathway
Vocabulary: molecular function
TermDefinition
GO:0004930G-protein coupled receptor activity
GO:0008528G-protein coupled peptide receptor activity
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000276G protein-coupled receptor, rhodopsin-likePRINTSPR00237GPCRRHODOPSNcoord: 107..129
score: 20.51
coord: 57..78
score: 28.15
coord: 25..49
score: 18.03
coord: 247..271
score: 20.0
coord: 291..317
score: 20.49
NoneNo IPR availableGENE3DG3DSA:1.20.1070.10coord: 9..330
e-value: 1.8E-38
score: 134.2
NoneNo IPR availablePANTHERPTHR47023FAMILY NOT NAMEDcoord: 27..329
NoneNo IPR availableCDDcd149787tmA_FMRFamide_R-likecoord: 29..320
e-value: 3.80355E-35
score: 128.52
NoneNo IPR availableSUPERFAMILYSSF81321Family A G protein-coupled receptor-likecoord: 11..330
NoneNo IPR availableTMHMMTMhelixcoord: 194..216
NoneNo IPR availableTMHMMTMhelixcoord: 28..47
NoneNo IPR availableTMHMMTMhelixcoord: 146..168
NoneNo IPR availableTMHMMTMhelixcoord: 252..274
NoneNo IPR availableTMHMMTMhelixcoord: 59..81
NoneNo IPR availableTMHMMTMhelixcoord: 289..311
NoneNo IPR availableTMHMMTMhelixcoord: 101..123
IPR0194277TM GPCR, serpentine receptor class w (Srw)PFAMPF103247TM_GPCR_Srwcoord: 30..326
e-value: 1.2E-19
score: 70.8
IPR017452GPCR, rhodopsin-like, 7TMPROSITEPS50262G_PROTEIN_RECEP_F1_2coord: 40..309
score: 19.469