SMED30028321

Overview
NameSMED30028321
Smed IDSMED30028321
Length (bp)1303
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30028321 (SMED30028321) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30028321 (SMED30028321) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30028321 (SMED30028321) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30028321 (SMED30028321) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30028321

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermisSMED30028321h1SMcG0010501 dd_Smed_v4_17406_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 2 cellSMED30028321h1SMcG0010501 dd_Smed_v4_17406_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30028321h1SMcG0010501 SMED_28519_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30028321h1SMcG0010501 SMED_28519_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Alignments
SMED30028321 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.000909:101239..102541 +6416
Homology
BLAST of SMED30028321 vs. Ensembl Human
Match: SYT1 (synaptotagmin 1 [Source:HGNC Symbol;Acc:HGNC:11509])

HSP 1 Score: 53.5286 bits (127), Expect = 4.402e-7
Identity = 58/244 (23.77%), Postives = 112/244 (45.90%), Query Frame = 2
Query:  506 DCYLVMFVRHGKSQLYPSQRTKTALNDLYPNFNEHFKFKI--RNMNNNILQFELYD-ENLSGNDILIRQGEMMLKDISEKKFQDYFQNFVIHLDKPSELKGLGDVAVILTGNPPI--LRITILEAKGLAQKENLNSNSLYSFHAEVKVFVNKHLVKHFKTKKIRHISNPYFQETFSLKVLSKMWDKILIKIELFR----SGFRRIGKAYIGYKESNSKVNYLGNLHWENTCNDRKMSKAIWHTL 1210
            D Y+ +F+   K + + ++  +  LN   P FNE F FK+    +    L   +YD +  S +DI I + ++ +  +      + +++  +   +  E + LGD+   L   P    L + ILEAK L   + ++   L   + ++ +  N   +K  KT   ++  NPY+ E+FS +V  +   K+ + + +           IGK ++GY  + +++      HW +   + +   A WHTL
Sbjct:  176 DPYVKVFLLPDKKKKFETKVHRKTLN---PVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDI-IGEFKVPMNTVDFGHVTEEWRD--LQSAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNL---KKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELR-----HWSDMLANPRRPIAQWHTL 405          
BLAST of SMED30028321 vs. Ensembl Human
Match: SYT1 (synaptotagmin 1 [Source:HGNC Symbol;Acc:HGNC:11509])

HSP 1 Score: 53.5286 bits (127), Expect = 4.548e-7
Identity = 58/244 (23.77%), Postives = 112/244 (45.90%), Query Frame = 2
Query:  506 DCYLVMFVRHGKSQLYPSQRTKTALNDLYPNFNEHFKFKI--RNMNNNILQFELYD-ENLSGNDILIRQGEMMLKDISEKKFQDYFQNFVIHLDKPSELKGLGDVAVILTGNPPI--LRITILEAKGLAQKENLNSNSLYSFHAEVKVFVNKHLVKHFKTKKIRHISNPYFQETFSLKVLSKMWDKILIKIELFR----SGFRRIGKAYIGYKESNSKVNYLGNLHWENTCNDRKMSKAIWHTL 1210
            D Y+ +F+   K + + ++  +  LN   P FNE F FK+    +    L   +YD +  S +DI I + ++ +  +      + +++  +   +  E + LGD+   L   P    L + ILEAK L   + ++   L   + ++ +  N   +K  KT   ++  NPY+ E+FS +V  +   K+ + + +           IGK ++GY  + +++      HW +   + +   A WHTL
Sbjct:  179 DPYVKVFLLPDKKKKFETKVHRKTLN---PVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDI-IGEFKVPMNTVDFGHVTEEWRD--LQSAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNL---KKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELR-----HWSDMLANPRRPIAQWHTL 408          
BLAST of SMED30028321 vs. Ensembl Human
Match: SYT1 (synaptotagmin 1 [Source:HGNC Symbol;Acc:HGNC:11509])

HSP 1 Score: 53.5286 bits (127), Expect = 4.548e-7
Identity = 58/244 (23.77%), Postives = 112/244 (45.90%), Query Frame = 2
Query:  506 DCYLVMFVRHGKSQLYPSQRTKTALNDLYPNFNEHFKFKI--RNMNNNILQFELYD-ENLSGNDILIRQGEMMLKDISEKKFQDYFQNFVIHLDKPSELKGLGDVAVILTGNPPI--LRITILEAKGLAQKENLNSNSLYSFHAEVKVFVNKHLVKHFKTKKIRHISNPYFQETFSLKVLSKMWDKILIKIELFR----SGFRRIGKAYIGYKESNSKVNYLGNLHWENTCNDRKMSKAIWHTL 1210
            D Y+ +F+   K + + ++  +  LN   P FNE F FK+    +    L   +YD +  S +DI I + ++ +  +      + +++  +   +  E + LGD+   L   P    L + ILEAK L   + ++   L   + ++ +  N   +K  KT   ++  NPY+ E+FS +V  +   K+ + + +           IGK ++GY  + +++      HW +   + +   A WHTL
Sbjct:  179 DPYVKVFLLPDKKKKFETKVHRKTLN---PVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDI-IGEFKVPMNTVDFGHVTEEWRD--LQSAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNL---KKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELR-----HWSDMLANPRRPIAQWHTL 408          
BLAST of SMED30028321 vs. Ensembl Human
Match: SYT1 (synaptotagmin 1 [Source:HGNC Symbol;Acc:HGNC:11509])

HSP 1 Score: 53.5286 bits (127), Expect = 4.548e-7
Identity = 58/244 (23.77%), Postives = 112/244 (45.90%), Query Frame = 2
Query:  506 DCYLVMFVRHGKSQLYPSQRTKTALNDLYPNFNEHFKFKI--RNMNNNILQFELYD-ENLSGNDILIRQGEMMLKDISEKKFQDYFQNFVIHLDKPSELKGLGDVAVILTGNPPI--LRITILEAKGLAQKENLNSNSLYSFHAEVKVFVNKHLVKHFKTKKIRHISNPYFQETFSLKVLSKMWDKILIKIELFR----SGFRRIGKAYIGYKESNSKVNYLGNLHWENTCNDRKMSKAIWHTL 1210
            D Y+ +F+   K + + ++  +  LN   P FNE F FK+    +    L   +YD +  S +DI I + ++ +  +      + +++  +   +  E + LGD+   L   P    L + ILEAK L   + ++   L   + ++ +  N   +K  KT   ++  NPY+ E+FS +V  +   K+ + + +           IGK ++GY  + +++      HW +   + +   A WHTL
Sbjct:  179 DPYVKVFLLPDKKKKFETKVHRKTLN---PVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDI-IGEFKVPMNTVDFGHVTEEWRD--LQSAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNL---KKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELR-----HWSDMLANPRRPIAQWHTL 408          
BLAST of SMED30028321 vs. Ensembl Human
Match: SYT2 (synaptotagmin 2 [Source:HGNC Symbol;Acc:HGNC:11510])

HSP 1 Score: 53.1434 bits (126), Expect = 5.115e-7
Identity = 59/244 (24.18%), Postives = 109/244 (44.67%), Query Frame = 2
Query:  506 DCYLVMFVRHGKSQLYPSQRTKTALNDLYPNFNEHFKFKI--RNMNNNILQFELYD-ENLSGNDILIRQGEMMLKDISEKKFQDYFQNFVIHLDKPSELKGLGDVAVILTGNPPI--LRITILEAKGLAQKENLNSNSLYSFHAEVKVFVNKHLVKHFKTKKIRHISNPYFQETFSLKVLSKMWDKILIKIELFR----SGFRRIGKAYIGYKESNSKVNYLGNLHWENTCNDRKMSKAIWHTL 1210
            D Y+ +F+   K + Y ++  +  LN   P FNE F FK+  + +    L   +YD +  S +DI+   GE+ +   +    Q   +   +   +  E + LGD+   L   P    L + ILEAK L +   ++   L   + ++ +  N   +K  KT   +   NPYF E+FS ++  +   K+ + + +           IGK ++G   + +++      HW +   + +   A WH+L
Sbjct:  176 DPYVKVFLLPDKKKKYETKVHRKTLN---PAFNETFTFKVPYQELGGKTLVMAIYDFDRFSKHDII---GEVKVPMNTVDLGQPIEEWRDLQGGEKEEPEKLGDICTSLRYVPTAGKLTVCILEAKNLKK---MDVGGLSDPYVKIHLMQNGKRLKKKKTTVKKKTLNPYFNESFSFEIPFEQIQKVQVVVTVLDYDKLGKNEAIGKIFVGSNATGTELR-----HWSDMLANPRRPIAQWHSL 405          
BLAST of SMED30028321 vs. Ensembl Celegans
Match: snt-2 (Synaptotagmin 2 [Source:UniProtKB/Swiss-Prot;Acc:K8FE10])

HSP 1 Score: 49.6766 bits (117), Expect = 2.296e-6
Identity = 61/258 (23.64%), Postives = 116/258 (44.96%), Query Frame = 2
Query:  479 LEFNSMKKPDCYLVMFVRHGKSQLYPSQRTKTALNDLYPNFNEHFKFKI--RNMNNNILQFELYDENLSGNDILIRQGEMMLKDISEKKFQDYFQNFVIHLDKPSELKG-LGDVAVILTGNPPI--LRITILEAKGLAQKENLNSNSLYSFHAEVKVFVN--KHLVKHFKTKKIRHISNPYFQETFSLKVLSKMWDKILIKIELF------RSGFRRIGKAYIGYKESN-SKVNYLGNLHWENTCNDRKMSKAIWHTL 1210
            ++ N M  P  Y+ ++V   + Q +    T+   N L P +NE F+F I    +++  L   +YD +    D  + Q  + L+ I      D  +  +   +K  E +  LGD+       P    + +TI+EA+ L + +   S+  Y     VK++++  + L+   KT +     NPY+ E+F  K+   M +K+ + + ++      ++ F  IG+  +G K  N  ++ +  +  W      R+     WHTL
Sbjct:  113 MDRNGMSDP--YVKVYVLPERKQKF---ETRIIRNTLNPTYNETFQFSIPFNELHSKTLMLVVYDYDRLSKDDKMGQLSVPLESIDFGITTD-IERPLQKPEKDDEKECRLGDICFSTRYRPATGTVTLTIMEARNLKKMDVGGSSDPY-----VKIYLHHGRKLLSKKKTSRKYKTLNPYYNESFQFKIEPHMIEKVHLIVSVWDYDKMSKNDF--IGEVTLGSKHLNLPQITHACSEQWAEMMTSRR-PVVQWHTL 356          
BLAST of SMED30028321 vs. Ensembl Celegans
Match: snt-6 (SyNapTotagmin [Source:UniProtKB/TrEMBL;Acc:A0A0S4XQZ9])

HSP 1 Score: 48.521 bits (114), Expect = 6.078e-6
Identity = 56/249 (22.49%), Postives = 105/249 (42.17%), Query Frame = 2
Query:  506 DCYLVMFVRHGKSQLYPSQRTKTALNDLYPNFNEHFKFK---IRNMNNNILQFELYDENLSGNDILIRQGEMMLKDISEKKFQDYFQNFVIHLDKPSELK-GLGDVAVILTGNPPILRIT--ILEAKGLAQKENLNSNSLYSFHAEVKVFVNKHLVKHFKTKKIRHISNPYFQETFSLKVLSKMWDKILIKIELFRSGFR--------RIGKAYIGYKESNSKVNYLGNLHWENTCNDRKMSKAIWHTL 1210
            D Y+  F+     Q   S+R+K    +L P FNE   F+   ++ +++  L  ++ D +   +D  I +  + LK +  +    Y++    HL +P+  K   G++ + L   P   +IT  I++A+ L  K+       Y  + ++ +    + ++  KT    H  +P F E+F+  +  K    +L ++ L  +            IG   +G   S       G  HW    N  +   A+WH L
Sbjct:  138 DPYVRAFLLQDPGQ---SERSKVHRRNLNPTFNETLSFRGHSMKKLHDMTLVLQVMDYDRFSSDDPIGEILLPLKHVKFESSPVYWK----HLQRPTVSKDACGEIMISLCYLPTSGKITVSIIKARDLHAKDRTRH---YDTYVKMWMVQQGNKLEKRKTSVKPHTPSPIFNESFAFSIPVK--QVLLAEVNLVLTAMEYDVIGSNEEIGHVIVGGLGSEH-----GQRHWSECVNHPEQPVAMWHKL 369          
BLAST of SMED30028321 vs. Ensembl Zebrafish
Match: syt5a (synaptotagmin Va [Source:ZFIN;Acc:ZDB-GENE-040718-110])

HSP 1 Score: 58.9214 bits (141), Expect = 4.759e-9
Identity = 57/223 (25.56%), Postives = 101/223 (45.29%), Query Frame = 2
Query:  566 TKTALNDLYPNFNEHFKFKI--RNMNNNILQFELYDENLSGNDILIRQGEMMLKDISEKKFQDYFQNFVIHLDKPSELKGLGDVAVILTGNPPI--LRITILEAKGLAQKENLNSNSLYSFHAEVKVFVNKHLVKHFKTKKIRHISNPYFQETFSLKVLSKMWDKILIKIELFR----SGFRRIGKAYIGYKESNSKVNYLGNLHWENTCNDRKMSKAIWHTL 1210
            TK    +L P FNE F FKI   ++    L  +++D +  G   +I + ++ +  I   +    +++ V    +  E + LGD+ + L   P    L + I+EAK L   + ++   L     ++ +  N   +K  KT   ++  NPYF E+FS ++      K+ + I ++          IGK +IG+  S      +G  HW +   + +   A WHTL
Sbjct:  183 TKVQRKNLCPVFNETFIFKIPFNDLAGQTLVLQVFDFDRFGKHDVIGEIKIPMNSIDLGQPIHEYKDLV--GGEKEEQEKLGDICISLRYVPTSGKLTVCIMEAKNL---KKMDVGGLSDPFVKIVLQHNGKRIKKKKTTVKQNTLNPYFNESFSFEIPFAQIQKVQVLITVYDYDKLGSNDPIGKCWIGFGASG-----VGLRHWSDMLANPRRPVAQWHTL 395          
BLAST of SMED30028321 vs. Ensembl Zebrafish
Match: syt2a (synaptotagmin IIa [Source:ZFIN;Acc:ZDB-GENE-060503-315])

HSP 1 Score: 57.7658 bits (138), Expect = 1.202e-8
Identity = 67/253 (26.48%), Postives = 110/253 (43.48%), Query Frame = 2
Query:  479 LEFNSMKKPDCYLVMFVRHGKSQLYPSQRTKTALNDLYPNFNEHFKFKI--RNMNNNILQFELYD-ENLSGNDILIRQGEMMLKDISEKKFQDYFQNFVIHLDKPSELKGLGDVAVILTGNPPI--LRITILEAKGLAQKENLNSNSLYSFHAEVKVFVNKHLVKHFKTKKIRHISNPYFQETFSLKVLSKMWDKILIKIELFR----SGFRRIGKAYIGYKESNSKVNYLGNLHWENTCNDRKMSKAIWHTL 1210
            L  +S    D Y+ +F+   K + Y ++  K  LN   P FNE F FKI    M    L   +YD +  S +D++   GE+ +   +    Q   Q   +   +  E + LGD+ + L   P    L I ILEAK L   + ++   L   + ++ +  N   +K  KT   ++  NPY+ E+FS ++      KI   I +           IGK ++G K   +++      HW +   + +   A WH L
Sbjct:  175 LSMDSGGTSDPYVKVFILPDKKKKYDTKVHKKTLN---PVFNETFHFKIPFTEMGGKTLVMSVYDFDRFSKHDVI---GEVKIPMNTLDLAQPIEQWRDLDSAEKEEPEKLGDICISLRYVPTAGKLTICILEAKNL---KKMDVGGLSDPYVKIHLLQNGKRLKKKKTTVKKNTLNPYYNESFSFEIPQDQMQKIQAVITVLDYDKIGKNDAIGKIWVGSKAQGTELR-----HWSDMLANPRRPIAQWHPL 413          
BLAST of SMED30028321 vs. Ensembl Zebrafish
Match: syt2a (synaptotagmin IIa [Source:ZFIN;Acc:ZDB-GENE-060503-315])

HSP 1 Score: 57.7658 bits (138), Expect = 1.202e-8
Identity = 67/253 (26.48%), Postives = 110/253 (43.48%), Query Frame = 2
Query:  479 LEFNSMKKPDCYLVMFVRHGKSQLYPSQRTKTALNDLYPNFNEHFKFKI--RNMNNNILQFELYD-ENLSGNDILIRQGEMMLKDISEKKFQDYFQNFVIHLDKPSELKGLGDVAVILTGNPPI--LRITILEAKGLAQKENLNSNSLYSFHAEVKVFVNKHLVKHFKTKKIRHISNPYFQETFSLKVLSKMWDKILIKIELFR----SGFRRIGKAYIGYKESNSKVNYLGNLHWENTCNDRKMSKAIWHTL 1210
            L  +S    D Y+ +F+   K + Y ++  K  LN   P FNE F FKI    M    L   +YD +  S +D++   GE+ +   +    Q   Q   +   +  E + LGD+ + L   P    L I ILEAK L   + ++   L   + ++ +  N   +K  KT   ++  NPY+ E+FS ++      KI   I +           IGK ++G K   +++      HW +   + +   A WH L
Sbjct:  175 LSMDSGGTSDPYVKVFILPDKKKKYDTKVHKKTLN---PVFNETFHFKIPFTEMGGKTLVMSVYDFDRFSKHDVI---GEVKIPMNTLDLAQPIEQWRDLDSAEKEEPEKLGDICISLRYVPTAGKLTICILEAKNL---KKMDVGGLSDPYVKIHLLQNGKRLKKKKTTVKKNTLNPYYNESFSFEIPQDQMQKIQAVITVLDYDKIGKNDAIGKIWVGSKAQGTELR-----HWSDMLANPRRPIAQWHPL 413          
BLAST of SMED30028321 vs. Ensembl Zebrafish
Match: syt5b (synaptotagmin Vb [Source:ZFIN;Acc:ZDB-GENE-050522-134])

HSP 1 Score: 49.6766 bits (117), Expect = 4.770e-6
Identity = 58/224 (25.89%), Postives = 99/224 (44.20%), Query Frame = 2
Query:  563 RTKTALNDLYPNFNEHFKFKI--RNMNNNILQFELYDENLSGNDILIRQGEMMLKDISEKKFQDYFQNFVIHLDKPSELKGLGDVAVILTGNPPILRIT--ILEAKGLAQKENLNSNSLYSFHAEVKVFVNKHLVKHFKTKKIRHISNPYFQETFSLKVLSKMWDKILIKIELFR----SGFRRIGKAYIGYKESNSKVNYLGNLHWENTCNDRKMSKAIWHTL 1210
             TK    +L P FNE F FKI    +    L  +++D +  G   +I Q ++ +  +           +    +   E + LGDV + L   P   ++T  I+EAK L   + ++   L   + ++ +  N   +K  KT   ++  NPYF E+FS +V  +   K+ + I ++          IGK +IGY  +      +G  HW +   + +   A WHTL
Sbjct:  186 ETKVQRKNLCPVFNETFIFKIPYAELGGKTLVLQVFDFDRFGKHDVIGQIKIPMNCVD---LAQPLHEWRELENGEKEEEKLGDVCISLRYVPTAGKLTVNIMEAKNL---KKMDVGGLSDPYVKIVLQHNGKRLKKKKTTVKKNTLNPYFNESFSFEVPFEQIQKVQLLITVYDYDKLGSNDPIGKTFIGYGATG-----VGLRHWSDMLANPRRPVAQWHTL 398          
BLAST of SMED30028321 vs. Ensembl Zebrafish
Match: syt5b (synaptotagmin Vb [Source:ZFIN;Acc:ZDB-GENE-050522-134])

HSP 1 Score: 49.6766 bits (117), Expect = 5.403e-6
Identity = 58/223 (26.01%), Postives = 99/223 (44.39%), Query Frame = 2
Query:  566 TKTALNDLYPNFNEHFKFKI--RNMNNNILQFELYDENLSGNDILIRQGEMMLKDISEKKFQDYFQNFVIHLDKPSELKGLGDVAVILTGNPPILRIT--ILEAKGLAQKENLNSNSLYSFHAEVKVFVNKHLVKHFKTKKIRHISNPYFQETFSLKVLSKMWDKILIKIELFR----SGFRRIGKAYIGYKESNSKVNYLGNLHWENTCNDRKMSKAIWHTL 1210
            TK    +L P FNE F FKI    +    L  +++D +  G   +I Q ++ +  +           +    +   E + LGDV + L   P   ++T  I+EAK L   + ++   L   + ++ +  N   +K  KT   ++  NPYF E+FS +V  +   K+ + I ++          IGK +IGY  +      +G  HW +   + +   A WHTL
Sbjct:  220 TKVQRKNLCPVFNETFIFKIPYAELGGKTLVLQVFDFDRFGKHDVIGQIKIPMNCVD---LAQPLHEWRELENGEKEEEKLGDVCISLRYVPTAGKLTVNIMEAKNL---KKMDVGGLSDPYVKIVLQHNGKRLKKKKTTVKKNTLNPYFNESFSFEVPFEQIQKVQLLITVYDYDKLGSNDPIGKTFIGYGATG-----VGLRHWSDMLANPRRPVAQWHTL 431          
BLAST of SMED30028321 vs. Ensembl Xenopus
Match: e2f4 (E2F transcription factor 4 [Source:Xenbase;Acc:XB-GENE-482721])

HSP 1 Score: 54.299 bits (129), Expect = 2.297e-7
Identity = 58/244 (23.77%), Postives = 111/244 (45.49%), Query Frame = 2
Query:  506 DCYLVMFVRHGKSQLYPSQRTKTALNDLYPNFNEHFKFKI--RNMNNNILQFELYD-ENLSGNDILIRQGEMMLKDISEKKFQDYFQNFVIHLDKPSELKGLGDVAVILTGNPPI--LRITILEAKGLAQKENLNSNSLYSFHAEVKVFVNKHLVKHFKTKKIRHISNPYFQETFSLKVLSKMWDKILIKIELFR----SGFRRIGKAYIGYKESNSKVNYLGNLHWENTCNDRKMSKAIWHTL 1210
            D Y+ +F+   K + + ++  +  LN   P FNE F FK+    +    L   +YD +  S +D+ I   ++ +  +      + +++ V    +  E + LGD+   L   P    L + ILEAK L +   ++   L   + ++ +  N   +K  KT   ++  NPY+ E+FS +V  +   K+ + + +           IGK ++GY  + +++      HW +   + +   A WHTL
Sbjct:  182 DPYVKLFLMPDKKKKFETKVHRKTLN---PVFNEQFTFKVPYAELGGKTLVLTVYDFDRFSKHDV-IGDVKVPMNTVDFGHVTEEWRDLVSA--EKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKK---MDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELR-----HWSDMLANPRRPIAQWHTL 411          
BLAST of SMED30028321 vs. Ensembl Xenopus
Match: luzp2 (leucine zipper protein 2 [Source:Xenbase;Acc:XB-GENE-940667])

HSP 1 Score: 52.373 bits (124), Expect = 8.034e-7
Identity = 61/244 (25.00%), Postives = 108/244 (44.26%), Query Frame = 2
Query:  506 DCYLVMFVRHGKSQLYPSQRTKTALNDLYPNFNEHFKFKI--RNMNNNILQFELYD-ENLSGNDILIRQGEMMLKDISEKKFQDYFQNFVIHLDKPSELKGLGDVAVILTGNPPI--LRITILEAKGLAQKENLNSNSLYSFHAEVKVFVNKHLVKHFKTKKIRHISNPYFQETFSLKVLSKMWDKILIKIELFR----SGFRRIGKAYIGYKESNSKVNYLGNLHWENTCNDRKMSKAIWHTL 1210
            D Y+ +F    K + + ++  +  LN   P FNE F FKI  + +    L   +YD +  S +DI+   GE+ +   +    Q   +   +   +  E + LGD+ + L   P    L + ILEAK L   + ++   L   + ++ +  N   +K  KT   +   NPYF E+FS ++  +   K+ + I +           IGK ++G   S +++      HW +   + +   A WH L
Sbjct:  182 DPYVKVFFLPDKKKKHETKVHRKTLN---PIFNETFTFKIPYQELGGKTLCMSIYDFDRFSKHDII---GEVKVPMNTVDLGQPIEEWRDLQSAEKEEPEKLGDICISLRYVPTAGKLTVCILEAKNL---KKMDVGGLSDPYVKIHLMQNGKRLKKKKTTVKKKTLNPYFNESFSFEIPFEQIQKVQVVITVLDYDKLGKNEAIGKIFVGCNASGTELR-----HWSDMLANPRRPIAQWHPL 411          
BLAST of SMED30028321 vs. Ensembl Xenopus
Match: syt8 (synaptotagmin 8 [Source:NCBI gene;Acc:100037878])

HSP 1 Score: 50.0618 bits (118), Expect = 4.581e-6
Identity = 62/245 (25.31%), Postives = 113/245 (46.12%), Query Frame = 2
Query:  506 DCYLVMFVRHGKSQLYPSQRTKTALNDLYPNFNEHFKFKI--RNMNNNILQFELYDEN-LSGNDILIRQGEMMLKDISEKKFQDYFQNFV-IHLDKPSELKGLGDVAVILTGNPPI--LRITILEAKGLAQKENLNSNSLYSFHAEVKVFVNKHLVKHFKTKKIRHISNPYFQETFSLKV-LSKM--WDKILIKIELFRSGF-RRIGKAYIGYKESNSKVNYLGNLHWENTCNDRKMSKAIWHTL 1210
            D Y +++V +   + + ++  +  LN   P FNE F FK+    +       +++D N    +D++   GEM++  + E   Q   +++  +     +E + LGD+   L   P    L I ILEAK L   + ++S+     + +V + +N+   K  KT   +    PYF E+F+  V L +M   D I+   +  + G   +IGK ++G + S + +      HW +     +   A WH L
Sbjct:  142 DPYAIVYVTNDTRKKFETKVNRKTLN---PVFNESFVFKVTQEEVPRTTAVVQIFDFNRFLKHDVI---GEMVIP-LGEVNLQHVIEDWKDLGPAGKTEHEHLGDICFSLRYVPSSGKLTIIILEAKNL---KRMDSDGFSDPYVKVHLALNRKKWKRKKTAVKKSTLKPYFNESFTFDVSLEQMKNLDLIISVWDHDKVGKNEQIGKLFLGCRASGNALR-----HWSDMLAHPRRPIAQWHKL 371          
BLAST of SMED30028321 vs. Ensembl Xenopus
Match: SYT5 (synaptotagmin 5 [Source:NCBI gene;Acc:100493612])

HSP 1 Score: 49.2914 bits (116), Expect = 9.803e-6
Identity = 54/248 (21.77%), Postives = 113/248 (45.56%), Query Frame = 2
Query:  506 DCYLVMFVRHGKSQLYPSQRTKTALNDLYPNFNEHFKFKI-------RNMNNNILQFELYDENLSGNDILIRQGEMMLKDISEKKFQDYFQNFVIHLDKPSELKGLGDVAVILTGNPPILRITI--LEAKGLAQKENLNSNSLYSFHAEVKVFVNKHLVKHFKTKKIRHISNPYFQETFSLKVLSKMWDKILIKIELFR----SGFRRIGKAYIGYKESNSKVNYLGNLHWENTCNDRKMSKAIWHTL 1210
            D Y+ +++   K + Y ++  +  LN   P FNE F FK+       + +  ++  F+ + ++ +  ++ +    + L  + E+ +QD      +   +  E + LGD+   L   P   ++T+  LEAK L   + ++   L   + ++ +  N   +K  KT   ++  NPY+ E+FS +V  +   K+ + + +           IGK ++G   + +++      HW +   + +   A WHTL
Sbjct:  172 DPYVKVYLLPDKKKKYETKVHRKTLN---PTFNESFTFKVPYAELGGKTLVMSVYDFDRFSKHDAIGEVRVHMNTVDLAHVIEE-WQD------LQSAEKEEQEKLGDICFSLRYVPTAGKLTVIVLEAKNL---KKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVLTVLDYDKLGKNEAIGKIFVGCNATGTELR-----HWSDMLANPRRPIAQWHTL 401          
BLAST of SMED30028321 vs. Ensembl Mouse
Match: Syt1 (synaptotagmin I [Source:MGI Symbol;Acc:MGI:99667])

HSP 1 Score: 53.5286 bits (127), Expect = 2.828e-7
Identity = 58/244 (23.77%), Postives = 112/244 (45.90%), Query Frame = 2
Query:  506 DCYLVMFVRHGKSQLYPSQRTKTALNDLYPNFNEHFKFKI--RNMNNNILQFELYD-ENLSGNDILIRQGEMMLKDISEKKFQDYFQNFVIHLDKPSELKGLGDVAVILTGNPPI--LRITILEAKGLAQKENLNSNSLYSFHAEVKVFVNKHLVKHFKTKKIRHISNPYFQETFSLKVLSKMWDKILIKIELFR----SGFRRIGKAYIGYKESNSKVNYLGNLHWENTCNDRKMSKAIWHTL 1210
            D Y+ +F+   K + + ++  +  LN   P FNE F FK+    +    L   +YD +  S +DI I + ++ +  +      + +++  +   +  E + LGD+   L   P    L + ILEAK L   + ++   L   + ++ +  N   +K  KT   ++  NPY+ E+FS +V  +   K+ + + +           IGK ++GY  + +++      HW +   + +   A WHTL
Sbjct:  178 DPYVKVFLLPDKKKKFETKVHRKTLN---PVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDI-IGEFKVPMNTVDFGHVTEEWRD--LQSAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNL---KKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELR-----HWSDMLANPRRPIAQWHTL 407          
BLAST of SMED30028321 vs. Ensembl Mouse
Match: Syt1 (synaptotagmin I [Source:MGI Symbol;Acc:MGI:99667])

HSP 1 Score: 53.5286 bits (127), Expect = 2.828e-7
Identity = 58/244 (23.77%), Postives = 112/244 (45.90%), Query Frame = 2
Query:  506 DCYLVMFVRHGKSQLYPSQRTKTALNDLYPNFNEHFKFKI--RNMNNNILQFELYD-ENLSGNDILIRQGEMMLKDISEKKFQDYFQNFVIHLDKPSELKGLGDVAVILTGNPPI--LRITILEAKGLAQKENLNSNSLYSFHAEVKVFVNKHLVKHFKTKKIRHISNPYFQETFSLKVLSKMWDKILIKIELFR----SGFRRIGKAYIGYKESNSKVNYLGNLHWENTCNDRKMSKAIWHTL 1210
            D Y+ +F+   K + + ++  +  LN   P FNE F FK+    +    L   +YD +  S +DI I + ++ +  +      + +++  +   +  E + LGD+   L   P    L + ILEAK L   + ++   L   + ++ +  N   +K  KT   ++  NPY+ E+FS +V  +   K+ + + +           IGK ++GY  + +++      HW +   + +   A WHTL
Sbjct:  178 DPYVKVFLLPDKKKKFETKVHRKTLN---PVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDI-IGEFKVPMNTVDFGHVTEEWRD--LQSAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNL---KKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELR-----HWSDMLANPRRPIAQWHTL 407          
BLAST of SMED30028321 vs. Ensembl Mouse
Match: Syt2 (synaptotagmin II [Source:MGI Symbol;Acc:MGI:99666])

HSP 1 Score: 53.1434 bits (126), Expect = 3.692e-7
Identity = 59/244 (24.18%), Postives = 109/244 (44.67%), Query Frame = 2
Query:  506 DCYLVMFVRHGKSQLYPSQRTKTALNDLYPNFNEHFKFKI--RNMNNNILQFELYD-ENLSGNDILIRQGEMMLKDISEKKFQDYFQNFVIHLDKPSELKGLGDVAVILTGNPPI--LRITILEAKGLAQKENLNSNSLYSFHAEVKVFVNKHLVKHFKTKKIRHISNPYFQETFSLKVLSKMWDKILIKIELFR----SGFRRIGKAYIGYKESNSKVNYLGNLHWENTCNDRKMSKAIWHTL 1210
            D Y+ +F+   K + Y ++  +  LN   P FNE F FK+  + +    L   +YD +  S +DI+   GE+ +   +    Q   +   +   +  E + LGD+   L   P    L + ILEAK L +   ++   L   + ++ +  N   +K  KT   +   NPYF E+FS ++  +   K+ + + +           IGK ++G   + +++      HW +   + +   A WH+L
Sbjct:  179 DPYVKVFLLPDKKKKYETKVHRKTLN---PAFNETFTFKVPYQELGGKTLVMAIYDFDRFSKHDII---GEVKVPMNTVDLGQPIEEWRDLQGGEKEEPEKLGDICTSLRYVPTAGKLTVCILEAKNLKK---MDVGGLSDPYVKIHLMQNGKRLKKKKTTVKKKTLNPYFNESFSFEIPFEQIQKVQVVVTVLDYDKLGKNEAIGKIFVGSNATGTELR-----HWSDMLANPRRPIAQWHSL 408          
BLAST of SMED30028321 vs. Ensembl Mouse
Match: Syt2 (synaptotagmin II [Source:MGI Symbol;Acc:MGI:99666])

HSP 1 Score: 53.1434 bits (126), Expect = 3.692e-7
Identity = 59/244 (24.18%), Postives = 109/244 (44.67%), Query Frame = 2
Query:  506 DCYLVMFVRHGKSQLYPSQRTKTALNDLYPNFNEHFKFKI--RNMNNNILQFELYD-ENLSGNDILIRQGEMMLKDISEKKFQDYFQNFVIHLDKPSELKGLGDVAVILTGNPPI--LRITILEAKGLAQKENLNSNSLYSFHAEVKVFVNKHLVKHFKTKKIRHISNPYFQETFSLKVLSKMWDKILIKIELFR----SGFRRIGKAYIGYKESNSKVNYLGNLHWENTCNDRKMSKAIWHTL 1210
            D Y+ +F+   K + Y ++  +  LN   P FNE F FK+  + +    L   +YD +  S +DI+   GE+ +   +    Q   +   +   +  E + LGD+   L   P    L + ILEAK L +   ++   L   + ++ +  N   +K  KT   +   NPYF E+FS ++  +   K+ + + +           IGK ++G   + +++      HW +   + +   A WH+L
Sbjct:  179 DPYVKVFLLPDKKKKYETKVHRKTLN---PAFNETFTFKVPYQELGGKTLVMAIYDFDRFSKHDII---GEVKVPMNTVDLGQPIEEWRDLQGGEKEEPEKLGDICTSLRYVPTAGKLTVCILEAKNLKK---MDVGGLSDPYVKIHLMQNGKRLKKKKTTVKKKTLNPYFNESFSFEIPFEQIQKVQVVVTVLDYDKLGKNEAIGKIFVGSNATGTELR-----HWSDMLANPRRPIAQWHSL 408          
BLAST of SMED30028321 vs. UniProt/SwissProt
Match: sp|Q5R4J5|SYT1_PONAB (Synaptotagmin-1 OS=Pongo abelii OX=9601 GN=SYT1 PE=2 SV=1)

HSP 1 Score: 57.7658 bits (138), Expect = 8.844e-8
Identity = 57/244 (23.36%), Postives = 112/244 (45.90%), Query Frame = 2
Query:  506 DCYLVMFVRHGKSQLYPSQRTKTALNDLYPNFNEHFKFKI--RNMNNNILQFELYD-ENLSGNDILIRQGEMMLKDISEKKFQDYFQNFVIHLDKPSELKGLGDVAVILTGNPPI--LRITILEAKGLAQKENLNSNSLYSFHAEVKVFVNKHLVKHFKTKKIRHISNPYFQETFSLKVLSKMWDKILIKIELFR----SGFRRIGKAYIGYKESNSKVNYLGNLHWENTCNDRKMSKAIWHTL 1210
            D Y+ +F+   K + + ++  +  LN   P FNE F FK+    +    L   +YD +  S +DI I + ++ +  +      + +++  +   +  E + LGD+   L   P    L + ILEAK L   + ++   L   + ++ +  N   +K  +T   ++  NPY+ E+FS +V  +   K+ + + +           IGK ++GY  + +++      HW +   + +   A WHTL
Sbjct:  176 DPYVKVFLLPDKKKKFETKVHRKTLN---PVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDI-IGEFKVPMNTVDFGHVTEEWRD--LQSAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNL---KKMDVGGLSDPYVKIHLMQNGKRLKKKETTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELR-----HWSDMLANPRRPIAQWHTL 405          
BLAST of SMED30028321 vs. UniProt/SwissProt
Match: sp|P47191|SYT1_CHICK (Synaptotagmin-1 OS=Gallus gallus OX=9031 GN=SYT1 PE=2 SV=1)

HSP 1 Score: 56.225 bits (134), Expect = 3.285e-7
Identity = 60/244 (24.59%), Postives = 112/244 (45.90%), Query Frame = 2
Query:  506 DCYLVMFVRHGKSQLYPSQRTKTALNDLYPNFNEHFKFKI--RNMNNNILQFELYD-ENLSGNDILIRQGEMMLKDISEKKFQDYFQNFVIHLDKPSELKGLGDVAVILTGNPPI--LRITILEAKGLAQKENLNSNSLYSFHAEVKVFVNKHLVKHFKTKKIRHISNPYFQETFSLKVLSKMWDKILIKIELFR----SGFRRIGKAYIGYKESNSKVNYLGNLHWENTCNDRKMSKAIWHTL 1210
            D Y+ +F+   K + Y ++  +  LN   P FNE F FK+    +    L   +YD +  S +DI I + ++ +  +      + +++  +   +  E + LGD+   L   P    L + ILEAK L +   ++   L   + ++ +  N   +K  KT   ++  NPY+ E+FS +V  +   K+ I + +           IGK ++GY  + +++      HW +   + +   A WHTL
Sbjct:  181 DPYVKVFLLPDKKKKYETKVHRKTLN---PVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDI-IGEYKVAMNTVDFGHVTEEWRD--LQSAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKK---MDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQIVVTVLDYDKIGKNDAIGKVFVGYNSTGAELR-----HWSDMLANPRRPIAQWHTL 410          
BLAST of SMED30028321 vs. UniProt/SwissProt
Match: sp|A0A075F932|SYT1_ANSCY (Synaptotagmin-1 OS=Anser cygnoid OX=8845 GN=SYT1 PE=2 SV=1)

HSP 1 Score: 55.8398 bits (133), Expect = 3.793e-7
Identity = 60/244 (24.59%), Postives = 112/244 (45.90%), Query Frame = 2
Query:  506 DCYLVMFVRHGKSQLYPSQRTKTALNDLYPNFNEHFKFKI--RNMNNNILQFELYD-ENLSGNDILIRQGEMMLKDISEKKFQDYFQNFVIHLDKPSELKGLGDVAVILTGNPPI--LRITILEAKGLAQKENLNSNSLYSFHAEVKVFVNKHLVKHFKTKKIRHISNPYFQETFSLKVLSKMWDKILIKIELFR----SGFRRIGKAYIGYKESNSKVNYLGNLHWENTCNDRKMSKAIWHTL 1210
            D Y+ +F+   K + Y ++  +  LN   P FNE F FK+    +    L   +YD +  S +DI I + ++ +  +      + +++  +   +  E + LGD+   L   P    L + ILEAK L +   ++   L   + ++ +  N   +K  KT   ++  NPY+ E+FS +V  +   K+ I + +           IGK ++GY  + +++      HW +   + +   A WHTL
Sbjct:  178 DPYVKVFLLPDKKKKYETKVHRKTLN---PVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDI-IGEYKVAMNTVDFGHVTEEWRD--LQSAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKK---MDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQIVVTVLDYDKIGKNDAIGKVFVGYNSTGAELR-----HWSDMLANPRRPIAQWHTL 407          
BLAST of SMED30028321 vs. UniProt/SwissProt
Match: sp|P24506|SY62_DIPOM (Synaptotagmin-B OS=Diplobatis ommata OX=1870830 GN=P65-B PE=1 SV=1)

HSP 1 Score: 55.8398 bits (133), Expect = 3.903e-7
Identity = 58/244 (23.77%), Postives = 111/244 (45.49%), Query Frame = 2
Query:  506 DCYLVMFVRHGKSQLYPSQRTKTALNDLYPNFNEHFKFKI--RNMNNNILQFELYD-ENLSGNDILIRQGEMMLKDISEKKFQDYFQNFVIHLDKPSELKGLGDVAVILTGNPPI--LRITILEAKGLAQKENLNSNSLYSFHAEVKVFVNKHLVKHFKTKKIRHISNPYFQETFSLKVLSKMWDKILIKIELFR----SGFRRIGKAYIGYKESNSKVNYLGNLHWENTCNDRKMSKAIWHTL 1210
            D Y+ +F+   K + Y ++  K  LN   P FNE F FK+  + +    L   +YD +  S +D + +   +M K    ++ +++        ++P +L   GD+   L   P    L + ILEAK L   + ++   L   + ++ +  N   +K  KT   ++  NPY+ E+FS ++  +   K+ + + +           IGK ++G   S +++      HW +   + +   A WH+L
Sbjct:  196 DPYVKVFLLPDKKKKYETKVQKKTLN---PTFNESFVFKVPYQELGGKTLMMAVYDFDRFSKHDCIGQVTVLMTKVDLGQQLEEWRDLESAEKEEPEKL---GDICTSLRYVPTAGKLTVCILEAKNL---KKMDVGGLSDPYVKIHLLQNGKRLKKKKTTVKKNTLNPYYNESFSFEIPFEQIQKVQVCVTVLDYDKIGKNDAIGKIFVGSNASGTELR-----HWSDMLANPRRPIAQWHSL 425          
BLAST of SMED30028321 vs. UniProt/SwissProt
Match: sp|P24505|SY61_DIPOM (Synaptotagmin-A OS=Diplobatis ommata OX=1870830 GN=P65-A PE=2 SV=1)

HSP 1 Score: 55.8398 bits (133), Expect = 4.197e-7
Identity = 60/244 (24.59%), Postives = 112/244 (45.90%), Query Frame = 2
Query:  506 DCYLVMFVRHGKSQLYPSQRTKTALNDLYPNFNEHFKFKI--RNMNNNILQFELYD-ENLSGNDILIRQGEMMLKDISEKKFQDYFQNFVIHLDKPSELKGLGDVAVILTGNPPI--LRITILEAKGLAQKENLNSNSLYSFHAEVKVFVNKHLVKHFKTKKIRHISNPYFQETFSLKVLSKMWDKILIKIELFR----SGFRRIGKAYIGYKESNSKVNYLGNLHWENTCNDRKMSKAIWHTL 1210
            D Y+ +FV   K + Y ++  +  LN   P FNE F FKI    +    L   +YD +  S +D+ I + ++ +  +      + +++  +   +  E + LGD+   L   P    L + ILEAK L   + ++   L   + ++ +  N   +K  KT   ++  NPY+ E+FS +V  +   K+ + + +           IGK ++GY  + +++      HW +   + +   A WHTL
Sbjct:  184 DPYVKVFVLPDKKKKYETKVHRKTLN---PVFNESFIFKIPYSELGGKTLVMAVYDFDRFSKHDV-IGEAKVPMNTVDFGHVTEEWRD--LQGAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNL---KKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTAAELR-----HWSDMLANPRRPIAQWHTL 413          
BLAST of SMED30028321 vs. TrEMBL
Match: A0A2D0SEY3 (synaptotagmin-1-like OS=Ictalurus punctatus OX=7998 GN=LOC108275171 PE=4 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 8.764e-9
Identity = 68/256 (26.56%), Postives = 128/256 (50.00%), Query Frame = 2
Query:  479 LEFNSMKKPDCYLVMFVRHGKSQLYPSQRTKTALNDLYPNFNEHFKFKI--RNMNNNILQFELYDEN-LSGNDILIRQGEMMLKDISEKKFQDYFQNFVIHLDKPS--ELKGLGDVAVILTGNPPI--LRITILEAKGLAQKENLNSNSLYSFHAEVKVFVNKHLVKHFKTKKIRHISNPYFQETFSLKVLSKMWDKILIKIELFR----SGFRRIGKAYIGYKESNSKVNYLGNLHWENTCNDRKMSKAIWHTLV 1213
            +  +S    D Y+ +++R  K + Y ++  +  LN   P FNEHFK++I  ++++ +IL  ++YD N  S +D++   GE+ L ++S   +    + +   L+ PS  E + LG++   L   P    L + ILEAK L   +   S+  Y    ++++ ++K   K  KT   +   NPYF E+F+  V      ++ + I ++     S    IGK ++G   + +++      HW +  ++ +   A WHTL+
Sbjct:  210 MAMDSSGTSDPYVKVYIRPNKFKTYETKVFRKTLN---PVFNEHFKYQISQKDLSESILMMQVYDFNRFSKHDVI---GELRL-ELSTVDWNHVIEEWT-DLNAPSKNEQEHLGEICFSLRYVPTASKLTVVILEAKNLKDMDIGGSSDPY---VKIQLVLDKKKWKKKKTSVKKQTLNPYFNESFTFDVSFDQIQRVQLVISVWDHDKVSRNDAIGKIFLGCDATGNQLR-----HWADMLSNPRRPVAQWHTLL 449          
BLAST of SMED30028321 vs. TrEMBL
Match: A0A4W4ERP2 (Synaptotagmin 8 OS=Electrophorus electricus OX=8005 GN=SYT8 PE=4 SV=1)

HSP 1 Score: 65.855 bits (159), Expect = 2.678e-8
Identity = 68/253 (26.88%), Postives = 126/253 (49.80%), Query Frame = 2
Query:  488 NSMKKPDCYLVMFVRHGKSQLYPSQRTKTALNDLYPNFNEHFKFKI--RNMNNNILQFELYDEN-LSGNDILIRQGEMMLKDISEKKFQDYFQNFVIHLDKPS--ELKGLGDVAVILTGNPPI--LRITILEAKGLAQKENLNSNSLYSFHAEVKVFVNKHLVKHFKTKKIRHISNPYFQETFSLKVLSKMWDKILIKIELFR----SGFRRIGKAYIGYKESNSKVNYLGNLHWENTCNDRKMSKAIWHTLV 1213
            +S    D Y+ +++   KS+ + ++  +  LN   P FNE FK++I  + ++ + L  ++YD N  S +D++   GE+ L ++S   +    + +   L +PS  E + LGD+   L   P    L + ILEAK L + ++  S+  Y    +V++ ++K   K  KT   +   NPYF E+F+ +V      ++ + I ++     S    IGK ++G   S +++      HW +  +  +   A WHTL+
Sbjct:   20 DSTGTSDPYVKVYILPNKSKTFETKVFRKTLN---PVFNEQFKYRIPQKELSESTLVMQVYDFNRFSKHDVI---GELRL-ELSSVDWNHVIEEWR-DLSEPSKYEQENLGDICFSLRYVPTASKLTVVILEAKNLKKMDDGGSSDPY---VKVQLILDKKKWKKKKTSVKKETLNPYFNESFTFEVSFDQIQRVQLVISVWDHDKMSRNNAIGKIFLGCDASGNQLR-----HWADMLSTPRRPVAQWHTLL 256          
BLAST of SMED30028321 vs. TrEMBL
Match: A0A5N5NGA7 (Uncharacterized protein OS=Pangasianodon hypophthalmus OX=310915 GN=PHYPO_G00243050 PE=4 SV=1)

HSP 1 Score: 67.0106 bits (162), Expect = 3.328e-8
Identity = 71/260 (27.31%), Postives = 127/260 (48.85%), Query Frame = 2
Query:  479 LEFNSMKKPDCYLVMFVRHGKSQLYPSQRTKTALNDLYPNFNEHFKFKI--RNMNNNILQFELYDEN-LSGNDILIRQGEMMLKDISEKKFQDYFQNFVIH----LDKPS--ELKGLGDVAVILTGNPPI--LRITILEAKGLAQKENLNSNSLYSFHAEVKVFVNKHLVKHFKTKKIRHISNPYFQETFSLKVLSKMWDKILIKIELFR----SGFRRIGKAYIGYKESNSKVNYLGNLHWENTCNDRKMSKAIWHTLV 1213
            +  +S    D Y+ +++   KS+ + ++  +  LN   P FNEHFK++I  ++++ + L  ++YD N  S +D++   GE+ L    E    D+  N VI     L  PS  E + LG++   L   P    L + ILEAK L Q +   S+  Y    ++++ ++K   K  KT   +   NPYF E+F+  V      ++ + I ++     S    IGK ++G   + +++      HW +  ++ +   A WHTL+
Sbjct:  195 MAMDSSGTSDPYVKVYILPNKSKTFETKVFRKTLN---PVFNEHFKYQISQKDLSESTLVVQVYDFNRFSKHDVI---GELRL----ELSAVDW--NHVIEEWRDLSAPSKHEQEHLGEICFSLRYVPTASKLTVVILEAKNLKQMDIGGSSDPY---VKIQLVLDKKKWKRKKTSVKKQTLNPYFNESFTFDVSFDQIQRVQLVISVWDHDKVSRNDAIGKIFLGCDATGNQLR-----HWADMLSNPRRPVAQWHTLL 434          
BLAST of SMED30028321 vs. TrEMBL
Match: A0A4W4ERU5 (Synaptotagmin 8 OS=Electrophorus electricus OX=8005 GN=SYT8 PE=4 SV=1)

HSP 1 Score: 65.4698 bits (158), Expect = 6.914e-8
Identity = 68/252 (26.98%), Postives = 124/252 (49.21%), Query Frame = 2
Query:  485 FNSMKKPDCYLVMFVRHGKSQLYPSQRTKTALNDLYPNFNEHFKFKIRNMNNNILQFELYDEN-LSGNDILIRQGEMMLKDISEKKFQDYFQNFVIHLDKPS--ELKGLGDVAVILTGNPPI--LRITILEAKGLAQKENLNSNSLYSFHAEVKVFVNKHLVKHFKTKKIRHISNPYFQETFSLKVLSKMWDKILIKIELF----RSGFRRIGKAYIGYKESNSKVNYLGNLHWENTCNDRKMSKAIWHTLV 1213
             +S    D Y+ +++   KS+ + ++  +  LN   P FNE FK+  R ++ + L  ++YD N  S +D++   GE+ L ++S   +    + +   L +PS  E + LGD+   L   P    L + ILEAK L + ++  S+  Y    +V++ ++K   K  KT   +   NPYF E+F+ +V      ++ + I ++     S    IGK ++G   S +++      HW +  +  +   A WHTL+
Sbjct:   89 MDSTGTSDPYVKVYILPNKSKTFETKVFRKTLN---PVFNEQFKY--RELSESTLVMQVYDFNRFSKHDVI---GELRL-ELSSVDWNHVIEEWR-DLSEPSKYEQENLGDICFSLRYVPTASKLTVVILEAKNLKKMDDGGSSDPY---VKVQLILDKKKWKKKKTSVKKETLNPYFNESFTFEVSFDQIQRVQLVISVWDHDKMSRNNAIGKIFLGCDASGNQLR-----HWADMLSTPRRPVAQWHTLL 322          
BLAST of SMED30028321 vs. TrEMBL
Match: A0A075A497 (C2 domain-containing protein OS=Opisthorchis viverrini OX=6198 GN=T265_03149 PE=4 SV=1)

HSP 1 Score: 65.0846 bits (157), Expect = 9.306e-8
Identity = 55/224 (24.55%), Postives = 101/224 (45.09%), Query Frame = 2
Query:  563 RTKTALNDLYPNFNEHFKFKI--RNMNNNILQFELYDENLSGNDILIRQGEMMLKDISEKKF--QDYFQNFVIHLDKPSELKGLGDVAVILTGN--PPILRITILEAKGLAQKENLNSNSLYSFHAEVKVFVNKHLVKHFKTKKIRHISNPYFQETFSLKVLSKMWDKILIKIELFRSGFRR--IGKAYIGYKESNSKVNYLGNLHWENTCNDRKMSKAIWHTL 1210
            +T    N   PN+ + F ++I    +    + FE++D +  G DI I   ++ LK++ E ++  Q   +   +   +P  ++G+G++ + L  N     + +TI EA+ L   + L+S    S    + +  NK  + H+ TK    + NPYF E  +  V S   D  ++  +L  +  R+  +G   +G   ++S     G  HWE        +   WH L
Sbjct:  154 KTVVRKNSTSPNWQQTFAYQIPESELKCITVVFEVFDYDSIGQDICIGHLDVPLKEVDEGEYAGQILERTGWLKCGEPM-MEGIGELCIGLCCNNTGSQIDVTIYEARQLTVADQLSSKRGSSVFVHLVLKHNKKRMGHYNTKPKPELINPYFNERHTFTVKSGNLDSCVLLCKLKSNSGRKKTLGHTQLGVDATSST----GAKHWEEMIKGPGKTHVFWHML 372          
BLAST of SMED30028321 vs. Ensembl Cavefish
Match: ENSAMXT00000017640.2 (synaptotagmin-1-like [Source:NCBI gene;Acc:103035847])

HSP 1 Score: 61.6178 bits (148), Expect = 6.461e-10
Identity = 67/247 (27.13%), Postives = 124/247 (50.20%), Query Frame = 2
Query:  506 DCYLVMFVRHGKSQLYPSQRTKTALNDLYPNFNEHFKFKI--RNMNNNILQFELYDEN-LSGNDILIRQGEMMLKDISEKKFQDYFQNFVIHLDKPS--ELKGLGDVAVILTGNPPILRIT--ILEAKGLAQKENLNSNSLYSFHAEVKVFVNKHLVKHFKTKKIRHISNPYFQETFSLKVLSKMWDKILIKIELFR----SGFRRIGKAYIGYKESNSKVNYLGNLHWENTCNDRKMSKAIWHTLV 1213
            D Y+ ++V   KS+ + ++  +  LN   P FNE FK++I  + +  + L  ++YD N  S +D++   GE+ L ++S   +    + +   L KPS  E + LG++   L   P   ++T  ILEAK L + ++   +  Y    +V++ ++K   K  KT   +   NPYF E+F+  V  +   K+ + I ++     S    IGK ++G   + +++      HW +  ++ +   A WHTL+
Sbjct:  172 DPYVKVYVLPSKSKTFETKVFRKTLN---PVFNESFKYQISQKELGESTLVIQVYDFNRFSKHDVI---GELRL-ELSAVDWNHVIEEWR-DLSKPSKHEQEHLGEICFSLRYVPTASKLTVVILEAKNLKKMDHGGYSDPY---VKVQLILDKRKWKKKKTSVKKQTLNPYFNESFTFDVSFEQIQKVQLVISVWDHDKMSRNDAIGKIFLGCDATGNQLR-----HWADMLSNPRRPVAQWHTLL 402          
BLAST of SMED30028321 vs. Ensembl Cavefish
Match: syt5a (synaptotagmin-2-like [Source:NCBI gene;Acc:103027827])

HSP 1 Score: 60.8474 bits (146), Expect = 1.070e-9
Identity = 60/224 (26.79%), Postives = 101/224 (45.09%), Query Frame = 2
Query:  563 RTKTALNDLYPNFNEHFKFKI--RNMNNNILQFELYDENLSGNDILIRQGEMMLKDISEKKFQDYFQNFVIHLDKPSELKGLGDVAVILTGNPPI--LRITILEAKGLAQKENLNSNSLYSFHAEVKVFVNKHLVKHFKTKKIRHISNPYFQETFSLKVLSKMWDKILIKIELFR----SGFRRIGKAYIGYKESNSKVNYLGNLHWENTCNDRKMSKAIWHTL 1210
             TK    +L P FNE F FKI   ++    L  +++D +  G   +I + ++ +  I   +    +++ V    +  E + LGD+ + L   P    L + I+EAK L   + ++   L     +V +  N   +K  KT   ++  NPYF E+FS ++      KI + I ++          IGK +IGY  S      +G  HW +   + +   A WHTL
Sbjct:  181 ETKVQRKNLCPVFNETFIFKIPFNDLAGQTLVLQVFDFDRFGKHDVIGEIKIAMNSIDLGQPIHEWKDLV--GGEKEEQEKLGDICISLRYVPTSGKLTVCIMEAKNL---KKMDVGGLSDPFVKVVLQHNGKRLKKKKTTVKQNTLNPYFNESFSFEIPFAQIQKIQVLITVYDYDKLGSNDAIGKCWIGYGASG-----VGLRHWSDMLANPRRPVAQWHTL 394          
BLAST of SMED30028321 vs. Ensembl Cavefish
Match: syt5a (synaptotagmin-2-like [Source:NCBI gene;Acc:103027827])

HSP 1 Score: 60.8474 bits (146), Expect = 1.083e-9
Identity = 60/224 (26.79%), Postives = 101/224 (45.09%), Query Frame = 2
Query:  563 RTKTALNDLYPNFNEHFKFKI--RNMNNNILQFELYDENLSGNDILIRQGEMMLKDISEKKFQDYFQNFVIHLDKPSELKGLGDVAVILTGNPPI--LRITILEAKGLAQKENLNSNSLYSFHAEVKVFVNKHLVKHFKTKKIRHISNPYFQETFSLKVLSKMWDKILIKIELFR----SGFRRIGKAYIGYKESNSKVNYLGNLHWENTCNDRKMSKAIWHTL 1210
             TK    +L P FNE F FKI   ++    L  +++D +  G   +I + ++ +  I   +    +++ V    +  E + LGD+ + L   P    L + I+EAK L   + ++   L     +V +  N   +K  KT   ++  NPYF E+FS ++      KI + I ++          IGK +IGY  S      +G  HW +   + +   A WHTL
Sbjct:  176 ETKVQRKNLCPVFNETFIFKIPFNDLAGQTLVLQVFDFDRFGKHDVIGEIKIAMNSIDLGQPIHEWKDLV--GGEKEEQEKLGDICISLRYVPTSGKLTVCIMEAKNL---KKMDVGGLSDPFVKVVLQHNGKRLKKKKTTVKQNTLNPYFNESFSFEIPFAQIQKIQVLITVYDYDKLGSNDAIGKCWIGYGASG-----VGLRHWSDMLANPRRPVAQWHTL 389          
BLAST of SMED30028321 vs. Ensembl Cavefish
Match: syt2a (synaptotagmin-2-like [Source:NCBI gene;Acc:103042251])

HSP 1 Score: 58.9214 bits (141), Expect = 5.118e-9
Identity = 68/253 (26.88%), Postives = 111/253 (43.87%), Query Frame = 2
Query:  479 LEFNSMKKPDCYLVMFVRHGKSQLYPSQRTKTALNDLYPNFNEHFKFKI--RNMNNNILQFELYD-ENLSGNDILIRQGEMMLKDISEKKFQDYFQNFVIHLDKPSELKGLGDVAVILTGNPPI--LRITILEAKGLAQKENLNSNSLYSFHAEVKVFVNKHLVKHFKTKKIRHISNPYFQETFSLKVLSKMWDKILIKIELFR----SGFRRIGKAYIGYKESNSKVNYLGNLHWENTCNDRKMSKAIWHTL 1210
            L  +S    D Y+ +F+   K + Y ++  K  LN   P FNE F FKI  + M    L   +YD +  S +D++   GE+ +   +    Q   Q   +   +  E + LGD+ V L   P    L I ILEAK L   + ++   L   + ++ +  N   +K  KT   ++  NPY+ E+FS ++      KI   I +           IGK ++G K   + +      HW +  ++ +   A WH L
Sbjct:  176 LSMDSGGTSDPYVKVFILPDKKKKYDTKVHKKTLN---PVFNETFCFKIPFQEMGGKTLVMSVYDFDRFSKHDVI---GEVKIPMNTLDLAQPIEQWRDLDSAEKEEPERLGDICVSLRYVPTAGKLTICILEAKNL---KKMDVGGLSDPYVKIHLLQNGKRLKKKKTTVKKNTLNPYYNESFSFEIPQDQMQKIQAVITVLDYDKIGKNDAIGKIWVGNKSQGTALR-----HWSDMVSNPRRPIAQWHPL 414          
BLAST of SMED30028321 vs. Ensembl Cavefish
Match: syt1b (synaptotagmin Ib [Source:ZFIN;Acc:ZDB-GENE-060503-166])

HSP 1 Score: 55.4546 bits (132), Expect = 6.324e-8
Identity = 55/248 (22.18%), Postives = 112/248 (45.16%), Query Frame = 2
Query:  506 DCYLVMFVRHGKSQLYPSQRTKTALNDLYPNFNEHFKFKI-------RNMNNNILQFELYDENLSGNDILIRQGEMMLKDISEKKFQDYFQNFVIHLDKPSELKGLGDVAVILTGNPPI--LRITILEAKGLAQKENLNSNSLYSFHAEVKVFVNKHLVKHFKTKKIRHISNPYFQETFSLKVLSKMWDKILIKIELFR----SGFRRIGKAYIGYKESNSKVNYLGNLHWENTCNDRKMSKAIWHTL 1210
            D Y+ +++   K + + ++  +  LN   P FNEHF FK+       + +   +  F+ + ++ +  D+ ++  ++    ++E       +  V+   +  E + LGD+ + L   P    L + +LEAK L +   ++   L   + ++ +  N   +K  KT   +H  NPY+ E+FS +V S+   K+ + + +           IGK ++G   S ++       HW +   + +   A WH L
Sbjct:  174 DPYVKLYLLPDKKKKFETKVHRKTLN---PTFNEHFTFKVPYSELGGKTLVMTVYDFDRFSKHDAIGDVRVQMNKVDFSQVTE-------EWRVLQKAEKEEQEKLGDICLSLRYVPTAGKLTVVVLEAKNLKK---MDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKHTLNPYYNESFSFEVPSEQIQKVQVVVTVLDYDKIGKNDAIGKVFMGLHSSGTE-----QRHWADMLANPRRPIAQWHAL 403          
BLAST of SMED30028321 vs. Ensembl Nematostella
Match: EDO31746 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SX17])

HSP 1 Score: 50.8322 bits (120), Expect = 5.310e-7
Identity = 64/248 (25.81%), Postives = 110/248 (44.35%), Query Frame = 2
Query:  506 DCYLVMFVRHGKSQLYPSQRTKTALNDLYPNFNEHFKFK---IRNMNNNILQFELYDENLSGNDILIRQGEMMLKDISEKKFQDYFQNFVIHLDKPSELKG-------LGDVAVILTGNPPI--LRITILEAKGLAQKENLNSNSLYSFHAEVKVFVNKHLVKHFKTKKIRHISNPYFQETFSLKVLSKMWDKILIKIELFRSGFRRIGKAYIGYKESNSKVNYLGNL-HWENTCNDRKMSKAIWHTL 1210
            D Y+ + +   K + Y ++  +  LN   P FNE F FK      + N IL  EL+D +      LI +  + L D+      + ++     L  PS   G       LGD+   L   P    L+ITI+EAK L   ++++       + ++ +      +K  KT   +   NPY+ ETF+  V  +  ++  + I +    + R+GK+ +  K    +++   +L HW +     + S A WHTL
Sbjct:  120 DPYVKIMLLPDKKKKYETKVHRKTLN---PVFNEQFVFKNIPYSEITNRILLMELFDFDRFSRHDLIGEARLPLIDVDLASNINEWRV----LTPPSGSGGAGHSKSDLGDICFSLRYVPSSGKLQITIVEAKSL---KSMDLTGYSDPYVKIALVQEGRKIKKKKTTVKKRTLNPYYNETFTFTVAFEKIEQTSLIISVL--DYDRVGKSEMIGKCVVGELSSGADLRHWADMLASPRRSVAQWHTL 355          
BLAST of SMED30028321 vs. Ensembl Medaka
Match: syt5a (synaptotagmin-1 [Source:NCBI gene;Acc:101166053])

HSP 1 Score: 61.6178 bits (148), Expect = 5.727e-10
Identity = 59/225 (26.22%), Postives = 102/225 (45.33%), Query Frame = 2
Query:  563 RTKTALNDLYPNFNEHFKFKI--RNMNNNILQFELYDENLSGNDILIRQGEMMLKDISEKKFQDYFQNFVIHLDKPSELKGLGDVAVILTGNPPILRIT--ILEAKGLAQKENLNSNSLYSFHAEVKVFVNKHLVKHFKTKKIRHISNPYFQETFSLKVLSKMWDKILIKIELFR----SGFRRIGKAYIGYKESNSKVNYLGNLHWENTCNDRKMSKAIWHTLV 1213
             TK    +L P FNE F FKI    +    L  +++D +  G   +I + ++ +  I   +    +++ V    +  E + LGD+ + L   P   ++T  I+EAK L   + ++   L     +V +  N   +K  KT   ++  NPYF E+FS ++      K+ + I ++          IGK +IGY  S      +G  HW +   + +   A WHTL+
Sbjct:  168 ETKVQRKNLCPVFNETFTFKIPYSELGGQTLVLQVFDFDRFGKHDVIGEIKIPMNSIDLGQPIHEWKDLV--GGEKEEQEKLGDICISLRYVPTAGKLTVNIMEAKNL---KKMDVGGLSDPFVKVVLQHNGKRLKKKKTSVKQNTLNPYFNESFSFEIPFSQIQKVQVLITVYDYDKLGSNDPIGKCWIGYGASG-----VGLRHWSDMLANPRRPVAQWHTLL 382          
BLAST of SMED30028321 vs. Ensembl Medaka
Match: ENSORLT00000008980.2 (synaptotagmin-2-like [Source:NCBI gene;Acc:101157206])

HSP 1 Score: 59.3066 bits (142), Expect = 3.533e-9
Identity = 63/250 (25.20%), Postives = 117/250 (46.80%), Query Frame = 2
Query:  479 LEFNSMKKPDCYLVMFVRHGKSQLYPSQRTKTALNDLYPNFNEHFKFKI--RNMNNNILQFELYD-ENLSGNDILIRQGEMMLKDISEKKFQDYFQNFVIHLDKPSELKGLGDVAVILTGNPPI--LRITILEAKGLAQKENLNSNSLYSFHAEVKVFVNKHLVKHFKTKKIRHISNPYFQETFSLKVLSKMWDKILIKIELFRSGFRRIGK-AYIGYKESNSKVNYLGNLHWENTCNDRKMSKAIWHTL 1210
            +  +S    D Y+ + +   K + + ++  K  LN   P FNE F FK+    +    L   +YD +  S +D+ I + ++ +  I   +  + +++  +      E + LGD+ + L   P    L + ILEAK L   + +++  L   + ++++      +K  KT   ++  NPY+ E+FS ++  +   KIL+ + +F   + +IGK   IG     SK   LG  HW +   + +   A WH L
Sbjct:  151 MSMDSGGTSDPYVRVLLLPDKKKKFDTKVHKKTLN---PVFNETFVFKVPYEELGGKTLCLSVYDYDRFSKHDV-IGEVKLAMNTIDLGRPIEEWRD--LESADQEEPEKLGDICISLRYVPTAGKLTVCILEAKNL---KKMDACGLSDPYVKIQLLQGGKRLKKKKTTVKKNTLNPYYNESFSFEIPLEQMQKILVAVTVFD--YDKIGKNDAIGKIFVGSKATGLGLKHWSDMLANPRRPIAQWHVL 389          
BLAST of SMED30028321 vs. Ensembl Medaka
Match: ENSORLT00000042397.1 (synaptotagmin-2-like [Source:NCBI gene;Acc:101157206])

HSP 1 Score: 58.5362 bits (140), Expect = 5.899e-9
Identity = 63/250 (25.20%), Postives = 117/250 (46.80%), Query Frame = 2
Query:  479 LEFNSMKKPDCYLVMFVRHGKSQLYPSQRTKTALNDLYPNFNEHFKFKI--RNMNNNILQFELYD-ENLSGNDILIRQGEMMLKDISEKKFQDYFQNFVIHLDKPSELKGLGDVAVILTGNPPI--LRITILEAKGLAQKENLNSNSLYSFHAEVKVFVNKHLVKHFKTKKIRHISNPYFQETFSLKVLSKMWDKILIKIELFRSGFRRIGK-AYIGYKESNSKVNYLGNLHWENTCNDRKMSKAIWHTL 1210
            +  +S    D Y+ + +   K + + ++  K  LN   P FNE F FK+    +    L   +YD +  S +D+ I + ++ +  I   +  + +++  +      E + LGD+ + L   P    L + ILEAK L +   +++  L   + ++++      +K  KT   ++  NPY+ E+FS ++  +   KIL+ + +F   + +IGK   IG     SK   LG  HW +   + +   A WH L
Sbjct:  175 MSMDSGGTSDPYVRVLLLPDKKKKFDTKVHKKTLN---PVFNETFVFKVPYEELGGKTLCLSVYDYDRFSKHDV-IGEVKLAMNTIDLGRPIEEWRD--LESADQEEPEKLGDICISLRYVPTAGKLTVCILEAKNLKK---MDACGLSDPYVKIQLLQGGKRLKKKKTTVKKNTLNPYYNESFSFEIPLEQMQKILVAVTVFD--YDKIGKNDAIGKIFVGSKATGLGLKHWSDMLANPRRPIAQWHVL 413          
BLAST of SMED30028321 vs. Ensembl Medaka
Match: syt2a (synaptotagmin-2 [Source:NCBI gene;Acc:101161806])

HSP 1 Score: 57.7658 bits (138), Expect = 9.641e-9
Identity = 72/258 (27.91%), Postives = 112/258 (43.41%), Query Frame = 2
Query:  479 LEFNSMKKPDCYLVMFVRHGKSQLYPSQRTKTALNDLYPNFNEHFKFKI--RNMNNNILQFELYD-ENLSGNDILIRQGEM--------MLKDISEKKFQDYFQNFVIHLDKPSELKGLGDVAVILTGNPPI--LRITILEAKGLAQKENLNSNSLYSFHAEVKVFVNKHLVKHFKTKKIRHISNPYFQETFSLKVLSKMWDKILIKIELFRSGFRRIGK-AYIGYKESNSKVNYLGNLHWENTCNDRKMSKAIWHTL 1210
            L  +S    D Y+ +FV   K + + ++  K  LN   P FNE F FKI  + M    L   +YD +  S +D++   GE+        + K I E +  D             E + LGD+ + L   P    L I ILEAK L +   ++   L   + ++ +  N   +K  KT   ++  NPY+ E+FS ++  +   KI   I +    + +IGK   IG     SK    G  HW +   + +   A WH L
Sbjct:  177 LSMDSGGTSDPYVKVFVLPDKKKKFDTKVHKKTLN---PVFNETFTFKIPFQEMGGKTLVMSVYDFDRFSKHDVI---GEIKIPMNTLDLAKPIEEWRDLDSADQ--------EEPEKLGDICISLRYVPTAGKLTICILEAKNLKK---MDVGGLSDPYVKINLLQNGKRLKKKKTTVKKNTLNPYYNESFSFEIPLEQMQKIQAVITVLD--YDKIGKNDAIGKIWVGSKSTGAGLKHWSDMLANPRRPIAQWHPL 415          
BLAST of SMED30028321 vs. Ensembl Medaka
Match: syt2a (synaptotagmin-2 [Source:NCBI gene;Acc:101161806])

HSP 1 Score: 57.7658 bits (138), Expect = 9.641e-9
Identity = 72/258 (27.91%), Postives = 112/258 (43.41%), Query Frame = 2
Query:  479 LEFNSMKKPDCYLVMFVRHGKSQLYPSQRTKTALNDLYPNFNEHFKFKI--RNMNNNILQFELYD-ENLSGNDILIRQGEM--------MLKDISEKKFQDYFQNFVIHLDKPSELKGLGDVAVILTGNPPI--LRITILEAKGLAQKENLNSNSLYSFHAEVKVFVNKHLVKHFKTKKIRHISNPYFQETFSLKVLSKMWDKILIKIELFRSGFRRIGK-AYIGYKESNSKVNYLGNLHWENTCNDRKMSKAIWHTL 1210
            L  +S    D Y+ +FV   K + + ++  K  LN   P FNE F FKI  + M    L   +YD +  S +D++   GE+        + K I E +  D             E + LGD+ + L   P    L I ILEAK L +   ++   L   + ++ +  N   +K  KT   ++  NPY+ E+FS ++  +   KI   I +    + +IGK   IG     SK    G  HW +   + +   A WH L
Sbjct:  177 LSMDSGGTSDPYVKVFVLPDKKKKFDTKVHKKTLN---PVFNETFTFKIPFQEMGGKTLVMSVYDFDRFSKHDVI---GEIKIPMNTLDLAKPIEEWRDLDSADQ--------EEPEKLGDICISLRYVPTAGKLTICILEAKNLKK---MDVGGLSDPYVKINLLQNGKRLKKKKTTVKKNTLNPYYNESFSFEIPLEQMQKIQAVITVLD--YDKIGKNDAIGKIWVGSKSTGAGLKHWSDMLANPRRPIAQWHPL 415          
BLAST of SMED30028321 vs. Planmine SMEST
Match: SMESG000002889.1 (SMESG000002889.1)

HSP 1 Score: 719.539 bits (1856), Expect = 0.000e+0
Identity = 387/394 (98.22%), Postives = 391/394 (99.24%), Query Frame = 2
Query:   35 MCKICSDKYKDIFIINHSTITIDSVRPLNSLIVMYNNVTIRNVNQTSVLGTYFNNLLKLWNISPLQGMFISXXXXXXXXXXXXXXXYCVRKSVEGEDTKRSRLSNLKKHLPVNSSSSEIDTPHGYIEASVXXXXXXXXXXXXXXXXXXLEFNSMKKPDCYLVMFVRHGKSQLYPSQRTKTALNDLYPNFNEHFKFKIRNMNNNILQFELYDENLSGNDILIRQGEMMLKDISEKKFQDYFQNFVIHLDKPSELKGLGDVAVILTGNPPILRITILEAKGLAQKENLNSNSLYSFHAEVKVFVNKHLVKHFKTKKIRHISNPYFQETFSLKVLSKMWDKILIKIELFRSGFRRIGKAYIGYKESNSKVNYLGNLHWENTCNDRKMSKAIWHTLVK 1216
            MCKICSDKYKDIFIINHSTITI SVRPLNSLIVMYNNVTIRNVNQTSVLGTYFN++LKLWNISPLQGMFISVGLLLAVVLTVAIIIYCVRKSVEGEDTKRSRLSNLKKHLPVNSSSSEIDTPHGYIEASVKYKKKQKEIEIQDIQIYKLEFNSMKKPDCYLVMFVRHGKSQLYPSQRTKTALNDLYPNFNEHFKFKIRN+NNNILQFELYDENLSGNDILIRQGEMMLKDISEKKFQDYFQNFVI LDKPSELKGLGDVAVILTGNPPILRITILEAKGLAQKENLNSNSLYSFHAEVKVFVNKHLVKHFKTKKIRHISNPYFQETFSLKV SKMW+KILIKIELFRSGFRRIGKAYIGYKESNSKVNYLGNLHWENTCNDRKMSKAIWHTLVK
Sbjct:    1 MCKICSDKYKDIFIINHSTITIYSVRPLNSLIVMYNNVTIRNVNQTSVLGTYFNSILKLWNISPLQGMFISVGLLLAVVLTVAIIIYCVRKSVEGEDTKRSRLSNLKKHLPVNSSSSEIDTPHGYIEASVKYKKKQKEIEIQDIQIYKLEFNSMKKPDCYLVMFVRHGKSQLYPSQRTKTALNDLYPNFNEHFKFKIRNINNNILQFELYDENLSGNDILIRQGEMMLKDISEKKFQDYFQNFVIRLDKPSELKGLGDVAVILTGNPPILRITILEAKGLAQKENLNSNSLYSFHAEVKVFVNKHLVKHFKTKKIRHISNPYFQETFSLKVFSKMWEKILIKIELFRSGFRRIGKAYIGYKESNSKVNYLGNLHWENTCNDRKMSKAIWHTLVK 394          
BLAST of SMED30028321 vs. Planmine SMEST
Match: SMESG000002888.1 (SMESG000002888.1)

HSP 1 Score: 173.326 bits (438), Expect = 9.256e-50
Identity = 120/358 (33.52%), Postives = 202/358 (56.42%), Query Frame = 2
Query:  158 NVNQTSVLGTYFNNLLKLWNISPLQGMFISXXXXXXXXXXXXXXXYCVRKSVEGEDTKRSRLSNLKKHLPVNSSSSE-IDTPHGYIEASVXXXXXXXXXXXXXXXXXXLEFNSMKKPDCYLVMFVRHGKSQLYPSQRTKTALNDLYPNFNEHFKFKIRNMNNNILQFELYDENLSGNDILIRQGEMMLKDISEKKFQDYFQNFVIHLDKPSELKGLGDVAVILTGNPPILRITILEAKGLAQKENLNSNSLYSFHAEVKVFVNKHLVKHFKTKKIRHISNPYFQETFSLKVLSKMWDKILIKIELFRSGF----RRIGKAYIGYKESNSKVNYLGNLHWENTCNDRKMSKAIWHTLVK 1216
            NV  +S +  Y  ++ K WNIS ++ + I +  L  V++ +   +    +   G+ TK+S     +  +P N    E  D+P GYI+ +V Y KK+K+++IQ++ +  +       PDC++ +F++    +    + TKT  ++L P F E F   + N++  I+ F+++DENL+GND  +  GE++L  + ++ F  +     + L  P+E+ G GDV VILT +PP L+I+ILEAK ++ +     N L S +  VKVFVN H  K FK++ + +  NPY  ETF++ +LSK ++  +IK+E+  +      +RIGK  IG +  N  +N LG  H +    D K   A+WH+L+K
Sbjct:   19 NVTASSSILGYLGSIAKYWNIS-VRTLVIILVALGLVIIIIIFALIFWIQKKRGQ-TKKSWKYKKEPQIPFNDDDFEKYDSPFGYIDMNVMYDKKKKKLKIQNLTVCNISVIGTDIPDCFIKIFLKGKDGKRLQQKMTKTIDDNLNPTFPEIFSLNVENLDTEIVYFQVFDENLNGNDYPMGDGELVLNKLPQENFVGFVYPTYVILKAPTEVLGCGDVCVILTFSPPKLKISILEAKNISFQYG-TKNHLPSVYCVVKVFVNGHKKKTFKSRSVSNTKNPYLMETFTMNMLSKDFEVAVIKVEMHETIAGRIPKRIGKLCIGNQFFNPFINELGVQHHKTVLKDWKKPHAMWHSLIK 373          
BLAST of SMED30028321 vs. Planmine SMEST
Match: SMESG000011583.1 (SMESG000011583.1)

HSP 1 Score: 77.411 bits (189), Expect = 2.780e-15
Identity = 71/246 (28.86%), Postives = 119/246 (48.37%), Query Frame = 2
Query:  506 DCYLVMFVRHGKSQLYPSQRTKTALNDLYPNFNEHFKFKIRN--MNNNILQFELYDENLSGNDILIRQGEMMLKDISEKKFQDYFQNFVIHLDKPSEL-KGLGDVAVILTGNPPI-LRITILEAKGLAQKENLNSNSLYSFHAEVKVFVNKHLVKHFKTKKIRHISN------PYFQETFSLKVLSKMWDKILIKIELFRSGFRRIGKAYIGYKESNSKVNYL-GNLHWENTCNDRKMSKAIWHTL 1210
            D Y+V+ V+     L   ++TK     + P FNE F FKI +  +N++ + F+++D +  G D L+ Q  +  KD++     +    F   L +  +  +G+G V +IL  N    L +TILEAK L  KEN++ + ++     VK+   KH  K FKT   +   +      PYF ETF            L+ ++++ S   ++    IGY    S++N   G +HW++  +  +   A WH L
Sbjct:  136 DPYVVVQVK--SKSLTEEKKTKIKYKHIDPVFNEKFTFKILHPELNDSEIFFKVFDYDKFGADSLLGQLALNFKDLNPSSIINMLSEFSKDLKEGEDTSEGMGQVCIILNSNGQAGLLVTILEAKNLRVKENMSYSHIF---VTVKIKSRKHGNK-FKTHSKKRTKDAHCGPFPYFNETFLFPKPHGTISDCLVSVKIWISRMFKM-PICIGYVSLGSEMNMTSGAIHWQSMLDSPRHPVAKWHVL 374          
BLAST of SMED30028321 vs. Planmine SMEST
Match: SMESG000041533.1 (SMESG000041533.1)

HSP 1 Score: 60.077 bits (144), Expect = 1.127e-9
Identity = 57/220 (25.91%), Postives = 110/220 (50.00%), Query Frame = 2
Query:  593 PNFNEHFKFKI--RNMNNNILQFELYDENLSGN-DILIRQGEMMLKDISEKKFQDYFQNFVIHLDKPSEL-KGLGDVAVILTGNP--PILRITILEAKGLAQKENLNSNSLYSFHAEVKVFVNKHLVKHFKTKKIRHISNPYFQETFS--LKVLSKMWDKILIKIELFRS---GFRR-IGKAYIGYKESNSKVNYLGNLHWENTCNDRKMSKAIWHTLVK 1216
            P F++ F+F+I    + N ++  E++D +++G  D ++      +  ++ ++FQ+      + LD P+E  +G G++ ++L   P   +L++T+LE K L  K   +   +   +  V+ +    L++   T    +  +PYF ETF   LK +   +  +L K+  F+    G ++ +GK  IG   SNS      N HW +     +++K+ WH L K
Sbjct:  146 PTFSKKFQFRILKSELENAVVILEVFDHDIAGAADSMLGIMRFPISLMTHEEFQNLPCEKKLPLDPPTESHEGNGEICIVLRHFPIEHLLKVTVLEIKRLHFK---SKTKILPIYVSVEFYFKNELLETKYTTTKYNTRDPYFSETFEYHLKPVKAPYVYLLFKV--FQKPTIGLKKCLGKLEIG---SNSPTLSAQN-HWMDMVAYPRVAKSCWHALSK 356          
The following BLAST results are available for this feature:
BLAST of SMED30028321 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SYT14.402e-723.77synaptotagmin 1 [Source:HGNC Symbol;Acc:HGNC:11509... [more]
SYT14.548e-723.77synaptotagmin 1 [Source:HGNC Symbol;Acc:HGNC:11509... [more]
SYT14.548e-723.77synaptotagmin 1 [Source:HGNC Symbol;Acc:HGNC:11509... [more]
SYT14.548e-723.77synaptotagmin 1 [Source:HGNC Symbol;Acc:HGNC:11509... [more]
SYT25.115e-724.18synaptotagmin 2 [Source:HGNC Symbol;Acc:HGNC:11510... [more]
back to top
BLAST of SMED30028321 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
snt-22.296e-623.64Synaptotagmin 2 [Source:UniProtKB/Swiss-Prot;Acc:... [more]
snt-66.078e-622.49SyNapTotagmin [Source:UniProtKB/TrEMBL;Acc:A0A0S4... [more]
back to top
BLAST of SMED30028321 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30028321 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
syt5a4.759e-925.56synaptotagmin Va [Source:ZFIN;Acc:ZDB-GENE-040718-... [more]
syt2a1.202e-826.48synaptotagmin IIa [Source:ZFIN;Acc:ZDB-GENE-060503... [more]
syt2a1.202e-826.48synaptotagmin IIa [Source:ZFIN;Acc:ZDB-GENE-060503... [more]
syt5b4.770e-625.89synaptotagmin Vb [Source:ZFIN;Acc:ZDB-GENE-050522-... [more]
syt5b5.403e-626.01synaptotagmin Vb [Source:ZFIN;Acc:ZDB-GENE-050522-... [more]
back to top
BLAST of SMED30028321 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
e2f42.297e-723.77E2F transcription factor 4 [Source:Xenbase;Acc:XB-... [more]
luzp28.034e-725.00leucine zipper protein 2 [Source:Xenbase;Acc:XB-GE... [more]
syt84.581e-625.31synaptotagmin 8 [Source:NCBI gene;Acc:100037878][more]
SYT59.803e-621.77synaptotagmin 5 [Source:NCBI gene;Acc:100493612][more]
back to top
BLAST of SMED30028321 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Syt12.828e-723.77synaptotagmin I [Source:MGI Symbol;Acc:MGI:99667][more]
Syt12.828e-723.77synaptotagmin I [Source:MGI Symbol;Acc:MGI:99667][more]
Syt23.692e-724.18synaptotagmin II [Source:MGI Symbol;Acc:MGI:99666][more]
Syt23.692e-724.18synaptotagmin II [Source:MGI Symbol;Acc:MGI:99666][more]
back to top
BLAST of SMED30028321 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5R4J5|SYT1_PONAB8.844e-823.36Synaptotagmin-1 OS=Pongo abelii OX=9601 GN=SYT1 PE... [more]
sp|P47191|SYT1_CHICK3.285e-724.59Synaptotagmin-1 OS=Gallus gallus OX=9031 GN=SYT1 P... [more]
sp|A0A075F932|SYT1_ANSCY3.793e-724.59Synaptotagmin-1 OS=Anser cygnoid OX=8845 GN=SYT1 P... [more]
sp|P24506|SY62_DIPOM3.903e-723.77Synaptotagmin-B OS=Diplobatis ommata OX=1870830 GN... [more]
sp|P24505|SY61_DIPOM4.197e-724.59Synaptotagmin-A OS=Diplobatis ommata OX=1870830 GN... [more]
back to top
BLAST of SMED30028321 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2D0SEY38.764e-926.56synaptotagmin-1-like OS=Ictalurus punctatus OX=799... [more]
A0A4W4ERP22.678e-826.88Synaptotagmin 8 OS=Electrophorus electricus OX=800... [more]
A0A5N5NGA73.328e-827.31Uncharacterized protein OS=Pangasianodon hypophtha... [more]
A0A4W4ERU56.914e-826.98Synaptotagmin 8 OS=Electrophorus electricus OX=800... [more]
A0A075A4979.306e-824.55C2 domain-containing protein OS=Opisthorchis viver... [more]
back to top
BLAST of SMED30028321 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000017640.26.461e-1027.13synaptotagmin-1-like [Source:NCBI gene;Acc:1030358... [more]
syt5a1.070e-926.79synaptotagmin-2-like [Source:NCBI gene;Acc:1030278... [more]
syt5a1.083e-926.79synaptotagmin-2-like [Source:NCBI gene;Acc:1030278... [more]
syt2a5.118e-926.88synaptotagmin-2-like [Source:NCBI gene;Acc:1030422... [more]
syt1b6.324e-822.18synaptotagmin Ib [Source:ZFIN;Acc:ZDB-GENE-060503-... [more]
back to top
BLAST of SMED30028321 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30028321 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30028321 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO317465.310e-725.81Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30028321 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
syt5a5.727e-1026.22synaptotagmin-1 [Source:NCBI gene;Acc:101166053][more]
ENSORLT00000008980.23.533e-925.20synaptotagmin-2-like [Source:NCBI gene;Acc:1011572... [more]
ENSORLT00000042397.15.899e-925.20synaptotagmin-2-like [Source:NCBI gene;Acc:1011572... [more]
syt2a9.641e-927.91synaptotagmin-2 [Source:NCBI gene;Acc:101161806][more]
syt2a9.641e-927.91synaptotagmin-2 [Source:NCBI gene;Acc:101161806][more]
back to top
BLAST of SMED30028321 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000002889.10.000e+098.22SMESG000002889.1[more]
SMESG000002888.19.256e-5033.52SMESG000002888.1[more]
SMESG000011583.12.780e-1528.86SMESG000011583.1[more]
SMESG000041533.11.127e-925.91SMESG000041533.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30028321 ID=SMED30028321|Name=SMED30028321|organism=Schmidtea mediterranea sexual|type=transcript|length=1303bp
TTTAATTGTGAGTGTATAATTAATTCATTAATAAATGTGCAAAATATGTT
CAGACAAGTATAAAGATATATTCATTATTAACCATTCAACCATAACAATA
GATTCTGTAAGGCCTCTAAATTCTCTGATTGTCATGTATAACAATGTAAC
AATTCGAAATGTAAACCAAACATCAGTTCTTGGAACTTATTTCAATAACC
TATTAAAGTTATGGAACATAAGTCCATTACAAGGAATGTTCATATCCGTC
GGACTTTTGCTTGCTGTCGTTCTGACAGTGGCTATCATTATATATTGTGT
TAGAAAATCAGTCGAGGGTGAAGATACCAAAAGGAGTCGACTTTCAAATC
TTAAGAAACATCTTCCAGTGAACAGTTCGTCATCAGAGATTGATACTCCA
CATGGGTATATTGAAGCATCAGTCAAGTATAAAAAAAAGCAGAAAGAGAT
TGAAATTCAAGACATTCAAATTTACAAATTAGAATTTAACTCAATGAAAA
AGCCGGATTGTTATTTAGTAATGTTTGTAAGGCATGGGAAATCTCAGTTG
TATCCTTCCCAAAGAACGAAAACTGCTTTGAATGATTTGTATCCAAATTT
CAATGAACACTTTAAGTTTAAAATAAGAAATATGAACAACAATATTCTCC
AATTTGAACTTTACGACGAAAATCTATCGGGAAATGACATTCTCATTCGT
CAGGGAGAAATGATGTTGAAAGATATCAGCGAAAAGAAATTCCAGGATTA
TTTTCAGAATTTTGTAATCCACTTGGACAAGCCTTCAGAATTAAAAGGTC
TCGGTGATGTCGCTGTGATTCTGACTGGAAATCCACCAATTTTGAGAATA
ACAATTCTTGAAGCAAAAGGATTGGCACAAAAAGAAAATCTTAACTCCAA
TTCTTTGTACAGTTTTCACGCAGAAGTTAAAGTTTTCGTCAATAAACATT
TAGTAAAACATTTCAAAACGAAAAAAATTCGTCATATTTCCAATCCGTAT
TTCCAGGAAACATTTTCATTAAAAGTTTTGTCAAAAATGTGGGATAAAAT
TTTAATAAAAATTGAATTATTCCGATCGGGATTTCGTAGAATCGGAAAGG
CTTATATCGGTTACAAAGAGTCCAATTCGAAAGTTAATTATTTGGGGAAC
TTGCATTGGGAGAATACTTGCAATGACCGTAAAATGTCGAAAGCGATTTG
GCATACGTTGGTCAAATAGGTTGCATATTTCCCTTTGCGGTCTGATTCTT
GATGACCCTCACTCTATTCTGACTATAATCAAAATCTTGTTCAATCTTAT
TAT
back to top

protein sequence of SMED30028321-orf-1

>SMED30028321-orf-1 ID=SMED30028321-orf-1|Name=SMED30028321-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=395bp
MCKICSDKYKDIFIINHSTITIDSVRPLNSLIVMYNNVTIRNVNQTSVLG
TYFNNLLKLWNISPLQGMFISVGLLLAVVLTVAIIIYCVRKSVEGEDTKR
SRLSNLKKHLPVNSSSSEIDTPHGYIEASVKYKKKQKEIEIQDIQIYKLE
FNSMKKPDCYLVMFVRHGKSQLYPSQRTKTALNDLYPNFNEHFKFKIRNM
NNNILQFELYDENLSGNDILIRQGEMMLKDISEKKFQDYFQNFVIHLDKP
SELKGLGDVAVILTGNPPILRITILEAKGLAQKENLNSNSLYSFHAEVKV
FVNKHLVKHFKTKKIRHISNPYFQETFSLKVLSKMWDKILIKIELFRSGF
RRIGKAYIGYKESNSKVNYLGNLHWENTCNDRKMSKAIWHTLVK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000028Category 2 cell
PLANA:0000429neoblast
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR035892C2_domain_sf
IPR000008C2_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0005509calcium ion binding
GO:0005544calcium-dependent phospholipid binding
GO:0005546phosphatidylinositol-4,5-bisphosphate binding
GO:0017075syntaxin-1 binding
GO:0019905syntaxin binding
GO:0030276clathrin binding
GO:0046872metal ion binding
GO:0048306calcium-dependent protein binding
GO:0050750low-density lipoprotein particle receptor binding
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005794Golgi apparatus
GO:0005886plasma membrane
GO:0008021synaptic vesicle
GO:0016020membrane
GO:0016021integral component of membrane
GO:0030054cell junction
GO:0030141secretory granule
GO:0030424axon
GO:0030658transport vesicle membrane
GO:0030672synaptic vesicle membrane
GO:0031045dense core granule
GO:0031410cytoplasmic vesicle
GO:0042584chromaffin granule membrane
GO:0042734presynaptic membrane
GO:0043005neuron projection
GO:0045202synapse
Vocabulary: biological process
TermDefinition
GO:0006906vesicle fusion
GO:0007269neurotransmitter secretion
GO:0014059regulation of dopamine secretion
GO:0016079synaptic vesicle exocytosis
GO:0017158regulation of calcium ion-dependent exocytosis
GO:0030154cell differentiation
GO:0048488synaptic vesicle endocytosis
GO:0048791calcium ion-regulated exocytosis of neurotransmitter
GO:0050806positive regulation of synaptic transmission
GO:0051966regulation of synaptic transmission, glutamatergic
GO:0098746fast, calcium ion-dependent exocytosis of neurotransmitter
GO:1903861positive regulation of dendrite extension
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000008C2 domainSMARTSM00239C2_3ccoord: 269..372
e-value: 1.1E-4
score: 31.6
coord: 133..240
e-value: 4.7E-5
score: 32.8
IPR000008C2 domainPFAMPF00168C2coord: 269..364
e-value: 1.3E-6
score: 28.6
coord: 153..230
e-value: 2.4E-7
score: 31.0
IPR000008C2 domainPROSITEPS50004C2coord: 270..374
score: 8.577
IPR035892C2 domain superfamilyGENE3DG3DSA:2.60.40.150coord: 121..243
e-value: 6.7E-14
score: 53.8
IPR035892C2 domain superfamilyGENE3DG3DSA:2.60.40.150coord: 257..394
e-value: 2.9E-12
score: 48.6
NoneNo IPR availablePANTHERPTHR10024:SF227SYNAPTOTAGMIN 1coord: 71..393
NoneNo IPR availablePANTHERPTHR10024SYNAPTOTAGMINcoord: 71..393
NoneNo IPR availableCDDcd00030C2coord: 155..235
e-value: 2.04572E-9
score: 52.4543
NoneNo IPR availableSUPERFAMILYSSF49562C2 domain (Calcium/lipid-binding domain, CaLB)coord: 268..392
NoneNo IPR availableSUPERFAMILYSSF49562C2 domain (Calcium/lipid-binding domain, CaLB)coord: 122..231
NoneNo IPR availableTMHMMTMhelixcoord: 67..89
NoneNo IPR availableTMHMMTMhelixcoord: 13..35