SJCHGC09193 protein

Overview
NameSJCHGC09193 protein
Smed IDSMED30028319
Length (bp)911
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SJCHGC09193 protein (SMED30028319) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SJCHGC09193 protein (SMED30028319) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30028319

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymaSMED30028319SMESG000004630.1 dd_Smed_v4_1530_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30028319SMESG000004630.1 OX_Smed_1.0.16253ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SJCHGC09193 protein vs. Ensembl Human
Match: CRISP1 (cysteine rich secretory protein 1 [Source:HGNC Symbol;Acc:HGNC:304])

HSP 1 Score: 51.2174 bits (121), Expect = 6.059e-7
Identity = 46/170 (27.06%), Postives = 69/170 (40.59%), Query Frame = 1
Query:  235 FSKCKVSQPKVTVKEVESILEIVNNIRSK--EPALRMAKIRWNTELALTAQYLSDQCKIKSSNPNLCSSALPMGQISFMTMSSSPQPKKWNQFIQDVFNQKPSYNFDK--NKCKSKNCNGYKQLVNAKTTDIGCGVTSCNRPGEYIDYYYCHFF----TPAYLDRPYEKG 720
            F+K     P V     E I+ I N +R +   PA  M K+ W+ E A  A+  S  C +  SNP      LP        M  +  P  W+  I   +++  S+   +          + Y Q+V A +  IGC + SC + G     Y CH+      P   + PY+ G
Sbjct:   30 FNKLVTDLPNVQ----EEIVNIHNALRRRVVPPASNMLKMSWSEEAAQNARIFSKYCDMTESNP--LERRLP-NTFCGENMHMTSYPVSWSSVIGVWYSESTSFKHGEWTTTDDDITTDHYTQIVWATSYLIGCAIASCRQQGSPRYLYVCHYCHEGNDPETKNEPYKTG 192          
BLAST of SJCHGC09193 protein vs. Ensembl Human
Match: CRISP1 (cysteine rich secretory protein 1 [Source:HGNC Symbol;Acc:HGNC:304])

HSP 1 Score: 51.2174 bits (121), Expect = 6.059e-7
Identity = 46/170 (27.06%), Postives = 69/170 (40.59%), Query Frame = 1
Query:  235 FSKCKVSQPKVTVKEVESILEIVNNIRSK--EPALRMAKIRWNTELALTAQYLSDQCKIKSSNPNLCSSALPMGQISFMTMSSSPQPKKWNQFIQDVFNQKPSYNFDK--NKCKSKNCNGYKQLVNAKTTDIGCGVTSCNRPGEYIDYYYCHFF----TPAYLDRPYEKG 720
            F+K     P V     E I+ I N +R +   PA  M K+ W+ E A  A+  S  C +  SNP      LP        M  +  P  W+  I   +++  S+   +          + Y Q+V A +  IGC + SC + G     Y CH+      P   + PY+ G
Sbjct:   30 FNKLVTDLPNVQ----EEIVNIHNALRRRVVPPASNMLKMSWSEEAAQNARIFSKYCDMTESNP--LERRLP-NTFCGENMHMTSYPVSWSSVIGVWYSESTSFKHGEWTTTDDDITTDHYTQIVWATSYLIGCAIASCRQQGSPRYLYVCHYCHEGNDPETKNEPYKTG 192          
BLAST of SJCHGC09193 protein vs. Ensembl Human
Match: CRISP1 (cysteine rich secretory protein 1 [Source:HGNC Symbol;Acc:HGNC:304])

HSP 1 Score: 49.6766 bits (117), Expect = 9.304e-7
Identity = 42/154 (27.27%), Postives = 63/154 (40.91%), Query Frame = 1
Query:  232 DFSKCKVSQPKVTVKEVESILEIVNNIRSK--EPALRMAKIRWNTELALTAQYLSDQCKIKSSNPNLCSSALPMGQISFMTMSSSPQPKKWNQFIQDVFNQKPSYNFDK--NKCKSKNCNGYKQLVNAKTTDIGCGVTSCNRPGEYIDYYYCHF 681
             F+K     P V     E I+ I N +R +   PA  M K+ W+ E A  A+  S  C +  SNP      LP        M  +  P  W+  I   +++  S+   +          + Y Q+V A +  IGC + SC + G     Y CH+
Sbjct:   29 QFNKLVTDLPNVQ----EEIVNIHNALRRRVVPPASNMLKMSWSEEAAQNARIFSKYCDMTESNP--LERRLP-NTFCGENMHMTSYPVSWSSVIGVWYSESTSFKHGEWTTTDDDITTDHYTQIVWATSYLIGCAIASCRQQGSPRYLYVCHY 175          
BLAST of SJCHGC09193 protein vs. Ensembl Human
Match: CRISP1 (cysteine rich secretory protein 1 [Source:HGNC Symbol;Acc:HGNC:304])

HSP 1 Score: 49.6766 bits (117), Expect = 9.304e-7
Identity = 42/154 (27.27%), Postives = 63/154 (40.91%), Query Frame = 1
Query:  232 DFSKCKVSQPKVTVKEVESILEIVNNIRSK--EPALRMAKIRWNTELALTAQYLSDQCKIKSSNPNLCSSALPMGQISFMTMSSSPQPKKWNQFIQDVFNQKPSYNFDK--NKCKSKNCNGYKQLVNAKTTDIGCGVTSCNRPGEYIDYYYCHF 681
             F+K     P V     E I+ I N +R +   PA  M K+ W+ E A  A+  S  C +  SNP      LP        M  +  P  W+  I   +++  S+   +          + Y Q+V A +  IGC + SC + G     Y CH+
Sbjct:   29 QFNKLVTDLPNVQ----EEIVNIHNALRRRVVPPASNMLKMSWSEEAAQNARIFSKYCDMTESNP--LERRLP-NTFCGENMHMTSYPVSWSSVIGVWYSESTSFKHGEWTTTDDDITTDHYTQIVWATSYLIGCAIASCRQQGSPRYLYVCHY 175          
BLAST of SJCHGC09193 protein vs. Ensembl Human
Match: CRISP2 (cysteine rich secretory protein 2 [Source:HGNC Symbol;Acc:HGNC:12024])

HSP 1 Score: 49.6766 bits (117), Expect = 1.765e-6
Identity = 39/144 (27.08%), Postives = 68/144 (47.22%), Query Frame = 1
Query:  325 PALRMAKIRWNTELALTAQYLSDQCKIKSSNPNLCSSALPMGQISFMTMSSSPQPKKWNQFIQDVFNQKPSYNFDKN-KCKSKNCNGYKQLVNAKTTDIGCGVTSCNRPGEYIDYYYCHFFTPA--YLDR---PYEKGN--KGC 732
            PA  M K+ W+ E+   AQ  +++C ++ S+P    ++   G+  +M    S  P  W+  IQ  +++   + +    K  +     Y QLV   T  +GCG+  C    + + YYY   + PA   ++R   PY++G    GC
Sbjct:   54 PASNMLKMEWSREVTTNAQRWANKCTLQHSDPEDRKTSTRCGENLYM----SSDPTSWSSAIQSWYDEILDFVYGVGPKSPNAVVGHYTQLVWYSTYQVGCGIAYCPN-QDSLKYYYVCQYCPAGNNMNRKNTPYQQGTPCAGC 192          
BLAST of SJCHGC09193 protein vs. Ensembl Celegans
Match: scl-21 (SCP-Like extracellular protein [Source:UniProtKB/TrEMBL;Acc:Q9XWX3])

HSP 1 Score: 46.595 bits (109), Expect = 5.154e-6
Identity = 40/150 (26.67%), Postives = 66/150 (44.00%), Query Frame = 1
Query:  307 NIRSKEPALRMAKIRWNTELALTAQYLSDQC--KIKSSNPNLCSSALPMGQISFMTMSSSPQPKKWNQFIQDVFNQKPSYNFDKNKCKSKNCNGYKQLVNAKTTDIGCGVTSCNRPGEYIDYY--YCHFFTPAYLDR-PYEKGNKGCNTC 741
            ++ +  PA  M K+ WN+ LA+ AQ L+  C   ++SS+P +    +    +  +  ++      W   +   +N K SYN         N  G  QL+ AK++ +GCG + C    +   +Y   C F     + R P  K  K C  C
Sbjct:   48 DVETLPPASDMLKMTWNSTLAVAAQKLAKTCFIAVESSSPGIADKRIVAANVVTVAKNALGH---WKHSLNKEWNLK-SYN--------SNYIGI-QLIWAKSSSVGCGFSPCEIDSQGRRWYKVVCSFEKKGGITREPVYKKGKACEAC 184          
BLAST of SJCHGC09193 protein vs. Ensembl Fly
Match: CG8483 (gene:FBgn0038126 transcript:FBtr0082782)

HSP 1 Score: 56.6102 bits (135), Expect = 1.008e-8
Identity = 49/181 (27.07%), Postives = 77/181 (42.54%), Query Frame = 1
Query:  247 KVSQPKVTVKEVESILEIVNNIR---------SKEPALRMAKIRWNTELALTAQYLSDQCKIKSSNPNLCSSALPMGQISFMTMSSSPQPKKWNQF---IQDVFNQKPSYNFDKNKCKSKNCNGYKQLVNAKTTDIGCGVTSCNRPGEYIDYYYCHFFTPAYLD--RPYEKGNKGCNTCNL 747
            K+    +T +E   IL+  N +R          +  A  M +I W+ ELA  AQ  +D C+ +  +P+   +   MGQ   +  S++P       F   IQ  FN+   Y+F      S     Y QLV  +T+ +GCG        +Y   Y C++     +    PYE G   C+T  +
Sbjct:   26 KIIASGITAEERSIILQEHNRLRQIVATGRYPGQPGAENMREIVWDDELAARAQKWADNCQFRH-DPHRTINRFTMGQNLAIIWSTAPLDADDGDFPSRIQSWFNEVQKYSF--GDAWSPKTGHYSQLVWGETSLVGCGYAEYKDTSKYNKLYVCNYGPGGNVVGYNPYEVGKPSCSTYGM 203          
BLAST of SJCHGC09193 protein vs. Ensembl Zebrafish
Match: CU914487.1 (peptidase inhibitor 16-like [Source:NCBI gene;Acc:101883528])

HSP 1 Score: 50.8322 bits (120), Expect = 2.059e-7
Identity = 45/153 (29.41%), Postives = 69/153 (45.10%), Query Frame = 1
Query:  352 WNTELALTAQYLSDQCKIKSSNPNLCSSALPMGQISFMTMSSSPQPKKWNQFIQDVFNQKPSYNFDKNKC-KSKNCNGYKQLVNAKTTDIGCGVTSCNRPG----EYIDYYYCHFFTPAYLD--RPYEKGNKGCNTCNLLNEKYVFKCNNNLC 789
            W+  + L A+  + +C I   NP+L    L MG+  F+       P    + + D FN+   YN++ N C + K C  Y QLV A TT IGC    C+       E      C ++    ++  +PYE G + C+ C         +C NN+C
Sbjct:    9 WDETIRLVAEGYAAKC-IWDHNPDL--EHLTMGENLFV----GTGPFNATKAVMDWFNENLDYNYNTNDCAEDKMCGHYTQLVWANTTKIGCASYFCDTLEKLHFEKATLLICDYYPQGNIEGQKPYESG-ESCSKCPE-------ECENNIC 146          
BLAST of SJCHGC09193 protein vs. Ensembl Xenopus
Match: R3HDML (R3H domain containing-like [Source:NCBI gene;Acc:100492715])

HSP 1 Score: 48.9062 bits (115), Expect = 3.666e-6
Identity = 46/194 (23.71%), Postives = 81/194 (41.75%), Query Frame = 1
Query:  265 VTVKEVESILEIVNNIRSK--EPALRMAKIRWNTELALTAQYLSDQCKIKSSNPNLCSSALPMGQISFMTMSSSPQPKKWNQFIQDVFNQKPSYNFDK---------NKCKSKNCNGYKQLVNAKTTDIGCGVTSCNRPGEY------IDYYYCHFFTPAYL--DRPYEKGNKGCNTCNLLNEKYVFKCNNNLC 789
            ++ +++ ++L+  N +RSK   PA  M  + W+  LA +A+  ++QCK       L      M  I       S + +     ++  ++++  Y+F           NKC    C  Y Q+V A +  IGC V  C     +        Y  C++        + PY+ G + C+ C      Y   C+NN+C
Sbjct:   53 ISPRDMSALLDYHNQVRSKVFPPAANMEYMVWDERLAKSAESWANQCKWDHGPNQL------MRYIGQNLSVHSGRYRSIVDLVKGWYDERQHYSFPHPRECNPSCPNKCTGAVCTHYTQMVWASSNRIGCAVNICTNINVWGSTWRQASYLVCNYSIKGNWIGEAPYKLG-RPCSAC---PPSYGGVCSNNMC 236          
BLAST of SJCHGC09193 protein vs. Ensembl Xenopus
Match: R3HDML (R3H domain containing-like [Source:NCBI gene;Acc:100492715])

HSP 1 Score: 48.521 bits (114), Expect = 4.987e-6
Identity = 46/194 (23.71%), Postives = 81/194 (41.75%), Query Frame = 1
Query:  265 VTVKEVESILEIVNNIRSK--EPALRMAKIRWNTELALTAQYLSDQCKIKSSNPNLCSSALPMGQISFMTMSSSPQPKKWNQFIQDVFNQKPSYNFDK---------NKCKSKNCNGYKQLVNAKTTDIGCGVTSCNRPGEY------IDYYYCHFFTPAYL--DRPYEKGNKGCNTCNLLNEKYVFKCNNNLC 789
            ++ +++ ++L+  N +RSK   PA  M  + W+  LA +A+  ++QCK       L      M  I       S + +     ++  ++++  Y+F           NKC    C  Y Q+V A +  IGC V  C     +        Y  C++        + PY+ G + C+ C      Y   C+NN+C
Sbjct:   58 ISPRDMSALLDYHNQVRSKVFPPAANMEYMVWDERLAKSAESWANQCKWDHGPNQL------MRYIGQNLSVHSGRYRSIVDLVKGWYDERQHYSFPHPRECNPSCPNKCTGAVCTHYTQMVWASSNRIGCAVNICTNINVWGSTWRQASYLVCNYSIKGNWIGEAPYKLG-RPCSAC---PPSYGGVCSNNMC 241          
BLAST of SJCHGC09193 protein vs. Ensembl Mouse
Match: Glipr1l3 (GLI pathogenesis-related 1 like 3 [Source:MGI Symbol;Acc:MGI:3620621])

HSP 1 Score: 60.4622 bits (145), Expect = 2.983e-10
Identity = 55/190 (28.95%), Postives = 89/190 (46.84%), Query Frame = 1
Query:  274 KEVESILEIVNNIRSK--EPALRMAKIRWNTELALTAQYLSDQCKIKSSNP------------NLCSSALPMGQISFMTMSSSPQPKKWNQFIQDVFNQKPSYNFDKNKCKSKNCNGYKQLVNAKTTDIGCGVTSCNRPGEYIDYYYCHFFTPA--YLD-RPYEKGNKGCNTCNLLNEKYVFKCNNNLCE 792
            K +++ L I N +R K   PA  M ++ W+ +LA  A+  + +CK+   NP            +     + +G+I         QP+     + + +N+   YNF  N C SK C  Y Q+  AKT  IGC V++C     Y    +   ++P   +LD RPY KG+     C++  ++   KC N+LC 
Sbjct:   40 KFIDAFLNIHNELRRKVQPPAADMNQVIWDQKLAKLAKAWTRECKL-GHNPCTSKQYGCLLDYDFIGENIYLGEIE-------TQPE---DVVNNWYNENTDYNFVDNTC-SKICRNYTQVFWAKTFKIGCAVSNCPNLTRYSAGLFVCNYSPTGNFLDFRPYRKGDP----CSMCGQR---KCENSLCR 210          
BLAST of SJCHGC09193 protein vs. Ensembl Mouse
Match: Glipr1l1 (GLI pathogenesis-related 1 like 1 [Source:MGI Symbol;Acc:MGI:1916536])

HSP 1 Score: 60.4622 bits (145), Expect = 2.983e-10
Identity = 55/191 (28.80%), Postives = 95/191 (49.74%), Query Frame = 1
Query:  274 KEVESILEIVNNIRSK--EPALRMAKIRWNTELALTAQYLSDQCKIKSSNP------------NLCSSALPMGQISFMTMSSSPQPKKWNQFIQDVFNQKPSYNFDKNKCKSKNCNGYKQLVNAKTTDIGCGVTSC-NRPGEYIDYYYCHFFTPA--YLD-RPYEKGNKGCNTCNLLNEKYVFKCNNNLCE 792
            K +++ L I N +R K   PA  M ++ W+ +LA  A+  + +CK+ + NP            +     + +G+I         QP+     + + +N+   +NFD N C S+ C  Y Q+V AKT  IGC V++C N  G     + C+ ++PA  ++  RPY +G    ++C++  +K    C N+LC 
Sbjct:   40 KFIDAFLNIHNELRRKVQPPAADMNQLFWDQQLAKLAKAWTRECKL-AHNPCIKQRYECLEDYDFIGENIYLGRIE-------TQPE---DVVINWYNESKYFNFDFNTC-SEMCGHYTQVVWAKTVKIGCAVSNCPNLKGFSAGLFVCN-YSPAGNFIGFRPYTRG----DSCSMCGQK---TCENSLCR 210          
BLAST of SJCHGC09193 protein vs. Ensembl Mouse
Match: Clec18a (C-type lectin domain family 18, member A [Source:MGI Symbol;Acc:MGI:2672935])

HSP 1 Score: 56.6102 bits (135), Expect = 1.775e-8
Identity = 56/228 (24.56%), Postives = 90/228 (39.47%), Query Frame = 1
Query:  202 GSVGHCANVQDFSKCKVSQPKVTVKEVESILEIVNNIRSK--EPALRMAKIRWNTELALTAQYLSDQCKIKSSNPNLCSS------------ALPMGQISFMTMSSSPQPKKWNQFIQDVFNQKPSYNFDKNKC-KSKNCNGYKQLVNAKTTDIGCGVTSCNRPGEYIDYYYCHFFTPAYLD------RPYEKGNKGCNTCNLLNEKY-----VFKCNNNLCEIVDSP 807
            G+ GH  N+  +       P ++ KE   IL   N +RS+   PA  M ++ W+  LA  A+  +  C + S  PNL S+             +PMG  SF+            + +   F +   Y     +C  +  C  Y QLV A ++ +GCG   C    E ++ + C +      D       PY+KG      C+L   +       +     LCE+  +P
Sbjct:  115 GASGHRPNLLSWP------PALSRKESFLILTAHNRLRSRVHPPAANMQRMDWSESLAQLAEARAALC-VTSVTPNLASTPGHNSHVGWNVQLMPMGSASFV------------EVVNLWFAEGLQYRHGDAECAHNATCAHYTQLVWATSSQLGCGRQPCFVDQEAMEAFVCAYSPGGNWDINGKTVAPYKKG----TWCSLCTARVSGCFKAWDHAGGLCEVPRNP 319          
BLAST of SJCHGC09193 protein vs. Ensembl Mouse
Match: Clec18a (C-type lectin domain family 18, member A [Source:MGI Symbol;Acc:MGI:2672935])

HSP 1 Score: 56.6102 bits (135), Expect = 1.775e-8
Identity = 56/228 (24.56%), Postives = 90/228 (39.47%), Query Frame = 1
Query:  202 GSVGHCANVQDFSKCKVSQPKVTVKEVESILEIVNNIRSK--EPALRMAKIRWNTELALTAQYLSDQCKIKSSNPNLCSS------------ALPMGQISFMTMSSSPQPKKWNQFIQDVFNQKPSYNFDKNKC-KSKNCNGYKQLVNAKTTDIGCGVTSCNRPGEYIDYYYCHFFTPAYLD------RPYEKGNKGCNTCNLLNEKY-----VFKCNNNLCEIVDSP 807
            G+ GH  N+  +       P ++ KE   IL   N +RS+   PA  M ++ W+  LA  A+  +  C + S  PNL S+             +PMG  SF+            + +   F +   Y     +C  +  C  Y QLV A ++ +GCG   C    E ++ + C +      D       PY+KG      C+L   +       +     LCE+  +P
Sbjct:  115 GASGHRPNLLSWP------PALSRKESFLILTAHNRLRSRVHPPAANMQRMDWSESLAQLAEARAALC-VTSVTPNLASTPGHNSHVGWNVQLMPMGSASFV------------EVVNLWFAEGLQYRHGDAECAHNATCAHYTQLVWATSSQLGCGRQPCFVDQEAMEAFVCAYSPGGNWDINGKTVAPYKKG----TWCSLCTARVSGCFKAWDHAGGLCEVPRNP 319          
BLAST of SJCHGC09193 protein vs. Ensembl Mouse
Match: Clec18a (C-type lectin domain family 18, member A [Source:MGI Symbol;Acc:MGI:2672935])

HSP 1 Score: 52.373 bits (124), Expect = 2.825e-7
Identity = 51/207 (24.64%), Postives = 82/207 (39.61%), Query Frame = 1
Query:  265 VTVKEVESILEIVNNIRSK--EPALRMAKIRWNTELALTAQYLSDQCKIKSSNPNLCSS------------ALPMGQISFMTMSSSPQPKKWNQFIQDVFNQKPSYNFDKNKCK-SKNCNGYKQLVNAKTTDIGCGVTSCNRPGEYIDYYYCHFFTPAYLD------RPYEKGNKGCNTCNLLNEKY-----VFKCNNNLCEIVDSP 807
            ++ KE   IL   N +RS+   PA  M ++ W+  LA  A+  +  C + S  PNL S+             +PMG  SF+            + +   F +   Y     +C  +  C  Y QLV A ++ +GCG   C    E ++ + C +      D       PY+KG      C+L   +       +     LCE+  +P
Sbjct:   69 LSRKESFLILTAHNRLRSRVHPPAANMQRMDWSESLAQLAEARAALC-VTSVTPNLASTPGHNSHVGWNVQLMPMGSASFV------------EVVNLWFAEGLQYRHGDAECAHNATCAHYTQLVWATSSQLGCGRQPCFVDQEAMEAFVCAYSPGGNWDINGKTVAPYKKG----TWCSLCTARVSGCFKAWDHAGGLCEVPRNP 258          
BLAST of SJCHGC09193 protein vs. UniProt/SwissProt
Match: sp|Q9DAG6|GPRL1_MOUSE (GLIPR1-like protein 1 OS=Mus musculus OX=10090 GN=Glipr1l1 PE=1 SV=1)

HSP 1 Score: 60.4622 bits (145), Expect = 2.086e-9
Identity = 55/191 (28.80%), Postives = 95/191 (49.74%), Query Frame = 1
Query:  274 KEVESILEIVNNIRSK--EPALRMAKIRWNTELALTAQYLSDQCKIKSSNP------------NLCSSALPMGQISFMTMSSSPQPKKWNQFIQDVFNQKPSYNFDKNKCKSKNCNGYKQLVNAKTTDIGCGVTSC-NRPGEYIDYYYCHFFTPA--YLD-RPYEKGNKGCNTCNLLNEKYVFKCNNNLCE 792
            K +++ L I N +R K   PA  M ++ W+ +LA  A+  + +CK+ + NP            +     + +G+I         QP+     + + +N+   +NFD N C S+ C  Y Q+V AKT  IGC V++C N  G     + C+ ++PA  ++  RPY +G    ++C++  +K    C N+LC 
Sbjct:   40 KFIDAFLNIHNELRRKVQPPAADMNQLFWDQQLAKLAKAWTRECKL-AHNPCIKQRYECLEDYDFIGENIYLGRIE-------TQPE---DVVINWYNESKYFNFDFNTC-SEMCGHYTQVVWAKTVKIGCAVSNCPNLKGFSAGLFVCN-YSPAGNFIGFRPYTRG----DSCSMCGQK---TCENSLCR 210          
BLAST of SJCHGC09193 protein vs. UniProt/SwissProt
Match: sp|Q60477|CRIS2_CAVPO (Cysteine-rich secretory protein 2 OS=Cavia porcellus OX=10141 GN=CRISP2 PE=1 SV=1)

HSP 1 Score: 55.4546 bits (132), Expect = 1.111e-7
Identity = 34/120 (28.33%), Postives = 55/120 (45.83%), Query Frame = 1
Query:  325 PALRMAKIRWNTELALTAQYLSDQCKIKSSNPNLCSSALPMGQISFMTMSSSPQPKKWNQFIQDVFNQKPSYNFDKN-KCKSKNCNGYKQLVNAKTTDIGCGVTSCNRPGEYIDYYYCHF 681
            PA  M K+ W+ E A+ AQ  +++C +  SNP+   ++   G+  +M    S  P  W+  IQ  F++   + F    K  +     Y QLV   +  +GCG+  C        YY C +
Sbjct:   55 PASNMLKMEWSREAAVNAQKWANRCTLVHSNPDDRKTSTKCGENLYM----SSDPSSWSDAIQSWFDESQDFTFGVGPKSHNAVVGHYTQLVWYSSYLVGCGIAYCPNQDSLKYYYVCQY 170          
BLAST of SJCHGC09193 protein vs. UniProt/SwissProt
Match: sp|Q7TSQ1|CL18A_MOUSE (C-type lectin domain family 18 member A OS=Mus musculus OX=10090 GN=Clec18a PE=2 SV=1)

HSP 1 Score: 56.6102 bits (135), Expect = 1.241e-7
Identity = 56/228 (24.56%), Postives = 90/228 (39.47%), Query Frame = 1
Query:  202 GSVGHCANVQDFSKCKVSQPKVTVKEVESILEIVNNIRSK--EPALRMAKIRWNTELALTAQYLSDQCKIKSSNPNLCSS------------ALPMGQISFMTMSSSPQPKKWNQFIQDVFNQKPSYNFDKNKC-KSKNCNGYKQLVNAKTTDIGCGVTSCNRPGEYIDYYYCHFFTPAYLD------RPYEKGNKGCNTCNLLNEKY-----VFKCNNNLCEIVDSP 807
            G+ GH  N+  +       P ++ KE   IL   N +RS+   PA  M ++ W+  LA  A+  +  C + S  PNL S+             +PMG  SF+            + +   F +   Y     +C  +  C  Y QLV A ++ +GCG   C    E ++ + C +      D       PY+KG      C+L   +       +     LCE+  +P
Sbjct:  115 GASGHRPNLLSWP------PALSRKESFLILTAHNRLRSRVHPPAANMQRMDWSESLAQLAEARAALC-VTSVTPNLASTPGHNSHVGWNVQLMPMGSASFV------------EVVNLWFAEGLQYRHGDAECAHNATCAHYTQLVWATSSQLGCGRQPCFVDQEAMEAFVCAYSPGGNWDINGKTVAPYKKG----TWCSLCTARVSGCFKAWDHAGGLCEVPRNP 319          
BLAST of SJCHGC09193 protein vs. UniProt/SwissProt
Match: sp|Q58D34|PI16_BOVIN (Peptidase inhibitor 16 OS=Bos taurus OX=9913 GN=PI16 PE=2 SV=1)

HSP 1 Score: 53.9138 bits (128), Expect = 7.194e-7
Identity = 49/187 (26.20%), Postives = 83/187 (44.39%), Query Frame = 1
Query:  274 KEVESILEIVNNIRSK--EPALRMAKIRWNTELALTAQYLSDQCKIKSSNPNLCSSALPMGQISFMTMSSSPQPKKWNQFIQDVFNQKPSYNFDKNKCKS-KNCNGYKQLVNAKTTDIGCGVTSCNR----PGEYIDYYYCHFFTPAYL--DRPYEKGNKGCNTCNLLNEKYVFKCNNNLCEIVDSP 807
            +E   ++E+ N  R++   PA  M ++RW+ ELA  A+  + QC +   N         +  I+   +      ++W+       +++  YN     C + + C  Y Q+V AKT  IGCG   C +        I    C++  P  +   RPY++G   C+ C L      + C N+LCE +  P
Sbjct:   31 EEKHVMVELHNLYRTQVSPPATNMLQMRWDEELAAFAKAYAQQC-VWGHNKERGRRGENLFAITGEGLDVPLAMEEWH-------HEREHYNLSAISCAAGQMCGHYTQVVWAKTERIGCGSHFCEKLQGVEETNIHLLVCNYEPPGNVKGQRPYQEGTP-CSQCPL-----GYHCKNSLCEPIRGP 203          
BLAST of SJCHGC09193 protein vs. UniProt/SwissProt
Match: sp|P35786|VA5_VESSQ (Venom allergen 5 OS=Vespula squamosa OX=30214 PE=1 SV=1)

HSP 1 Score: 51.2174 bits (121), Expect = 1.885e-6
Identity = 60/214 (28.04%), Postives = 83/214 (38.79%), Query Frame = 1
Query:  109 DFCKIPFEKNGKVYHDCGTDRGKKPWCQNSKGSVGHCANVQDFSKCKVSQPKVTVKEVESILEIVNNIRSK--------------EPALRMAKIRWNTELALTAQYLSDQCKIKSSNPNLCSSALPMGQISFMTMSSSPQP---------KKWNQFIQDVFNQKPSYNFDKNKCKSKNCNGYKQLVNAKTTDIGCGVTSCNRPGEYIDYYYCHF 681
            D+CKI   K G V+  C      KP C N                  V    VT  E + IL+I N+ R+K               PA  M  + WN ELA  AQ  + QCK      + C           + +SSS            K W   ++D FN  P+ ++++N+ K      Y Q+V AKT +IGCG         Y  Y  C++
Sbjct:    2 DYCKIKCLKGG-VHTACKYGTSTKPNCGN----------------MVVKSYGVTQAEKQEILKIHNDFRNKVARGLETRGNPGPQPPAKNMNNLVWNNELANIAQIWASQCKYGH---DTCKDTTKYNVGQNIAVSSSTAAVYENVGNLVKAWENEVKD-FN--PTISWEQNEFKK--IGHYTQMVWAKTKEIGCGSIKYVDNNWYTHYLVCNY 190          
BLAST of SJCHGC09193 protein vs. TrEMBL
Match: T1FIX7 (SCP domain-containing protein OS=Helobdella robusta OX=6412 GN=20208776 PE=3 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 5.212e-14
Identity = 44/131 (33.59%), Postives = 69/131 (52.67%), Query Frame = 1
Query:  262 KVTVKEVESILEIVNNIRSKEPALRMAKIRWNTELALTAQYLSDQCKIKSSNPNLCSSALPMGQISFMTMSSSPQPKKWNQFIQDVFNQKPSYNFDKNKC-KSKNCNGYKQLVNAKTTDIGCGVTSCNRPG 651
            K+T  ++  +L+I N +R  E A  M  +RWN  LA  A   S++C  +  NP++  S   +GQ +    S +P+   +   ++  F++K +YN     C K K C  Y Q+V AKTTD+GC    C + G
Sbjct:   20 KLTDDQIAEVLKIHNKLRKNEGASDMKVLRWNGALAEKADAWSEKCVFEHGNPDMPKSNFYIGQ-NLYASSQAPETVNYESVVRYWFSEKENYNLSTRTCAKDKICGHYTQVVWAKTTDLGCAHAVCQKLG 149          
BLAST of SJCHGC09193 protein vs. TrEMBL
Match: T1FNF5 (SCP domain-containing protein OS=Helobdella robusta OX=6412 GN=20210352 PE=3 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 2.609e-12
Identity = 43/143 (30.07%), Postives = 74/143 (51.75%), Query Frame = 1
Query:  226 VQDFSKCKVSQPKVTVKEVESILEIVNNIRSKEPALRMAKIRWNTELALTAQYLSDQCKIKSSNPNLCSSALPMGQISFMTMSSSPQPKKWNQFIQDVFNQKPSYNFDKNKC-KSKNCNGYKQLVNAKTTDIGCGVTSCNRPG 651
            V+ F  C+   P  +  E++ I++  N +RS+E + +M  ++W+ +LA  A   +  C+ K   P    S   +GQ  +++   SP    ++  +Q+ +N+KP YN   N C   K C  Y Q+V A TT++GC    C+  G
Sbjct:   12 VEAFVACRAGVP--SAAELQQIVDKHNKLRSQEGSSKMQPMKWSDKLAGYAATWAKGCQFKHGQPPEAGSG-HIGQNLYVSTVKSP---NYDGAVQNWYNEKPDYNLAANSCTHGKMCGHYTQIVWATTTEVGCAAQVCDSIG 148          
BLAST of SJCHGC09193 protein vs. TrEMBL
Match: T1FCL9 (SCP domain-containing protein OS=Helobdella robusta OX=6412 GN=20206568 PE=3 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 4.498e-12
Identity = 44/145 (30.34%), Postives = 76/145 (52.41%), Query Frame = 1
Query:  268 TVKEVESILEIVNNIRSKEPALRMAKIRWNTELALTAQYLSDQCKIKSSNPNLCSSALPMGQISFMTMSSSPQPKKWNQFIQDVFNQKPSYNFDKNKCKS-KNCNGYKQLVNAKTTDIGCGVTSCNRPGEYIDYYYCHFFTPAYL 699
            +  +V+ I++  N +R KE + +M  I+W+++LA  A   +  C  +   P    +   +GQ  +   +SS     +   IQ+ +++KP Y++D N C+S K C  Y Q+V A TT++GC V  CN+  E + +   H     YL
Sbjct:   23 SASDVKKIVDKHNLLRKKEGSSKMLPIKWSSKLANYASAWAQNCAFEHGQPAEAQNEDDIGQNLY---ASSTSNVDYESAIQNWYDEKPDYSYDSNSCRSGKMCGHYTQVVWATTTEVGCAVQMCNKGIEGLPWPRGHIIVCNYL 164          
BLAST of SJCHGC09193 protein vs. TrEMBL
Match: G4LUX1 (Venom allergen-like (VAL) 14 protein OS=Schistosoma mansoni OX=6183 GN=Smp_078490 PE=4 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 4.858e-11
Identity = 55/167 (32.93%), Postives = 75/167 (44.91%), Query Frame = 1
Query:  310 IRSKEPALRMAKIRWNTELALTAQYLSDQCKIKSSNPNLCSSALPMGQISFMTMSSSPQPKKWNQFIQDVFNQKPSYNFDKNKCKSKNCNGYKQLVNAKTTDIGCGVTSCNRPGEYIDYYYCHFFTPAYLDRPYEKGNKGCNTCNLLNEKYVFKCNNNLCEIVDSPP 810
            +  + PA  M+K++WN +LA  AQ L+  C ++   P           I+F +  +S         +   FN+   YN+  N C    C  YKQ+V AKTTDIGCGV +C R G  +  YY               G  G    N +NEK      +NLC IV S P
Sbjct:   43 VNGQPPAEYMSKLKWNYDLAQQAQSLASYCILRQGKPRSKKFTWVGQNIAFFSTINSA--------VDAWFNEHKLYNYSVNNCPK--CVHYKQMVWAKTTDIGCGVANCQRYGLSVVCYY---------------GPGG----NWINEKPYKVKPHNLCPIVQSIP 180          
BLAST of SJCHGC09193 protein vs. TrEMBL
Match: R7TUH4 (ShKT domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_167763 PE=3 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 7.202e-11
Identity = 46/130 (35.38%), Postives = 66/130 (50.77%), Query Frame = 1
Query:  256 QPKVTVKEVESILEIVNNIRSKEPALRMAKIRWNTELALTAQYLSDQCKIKSSNPNLCSSALPMGQISFMTMSSSPQPK-KWNQFIQDVFNQKPSYNFDKNKCK-SKNCNGYKQLVNAKTTDIGCGVTSC 639
            + K+T  E    L + N +R +E A  MAK+ +N ELA  AQ LSD C         C     +GQ  ++   SS  P    ++ I   +N+K  YN+  + C   K C  Y QL  AK+T++GCGV+ C
Sbjct:  147 RSKMTASEAAKSLSLHNTLRGQEGASNMAKLTYNQELADRAQQLSDTCVWDHGLLETCDGE-GLGQNMYIASGSSGFPDLDLDKAITGWYNEKHDYNYYSDYCTPGKMCGHYTQLAWAKSTEMGCGVSHC 275          
BLAST of SJCHGC09193 protein vs. Ensembl Cavefish
Match: ENSAMXT00000031557.1 (peptidase inhibitor 16 [Source:NCBI gene;Acc:103029846])

HSP 1 Score: 57.7658 bits (138), Expect = 1.911e-9
Identity = 40/122 (32.79%), Postives = 65/122 (53.28%), Query Frame = 1
Query:  283 ESILEIVNNIRS--KEPALRMAKIRWNTELALTAQYLSDQCKIKSSNPNLCSSALPMGQISFMTMSSSPQPKKWNQFIQDVFNQKPSYNFDKNKC-KSKNCNGYKQLVNAKTTDIGCGVTSC 639
            + I+ + N+ RS  + PA  M  ++W+ ELAL A+  + +C I   NP+   S   MG+  F+T      P    + + D F +   Y++D N C +++ C  Y Q+V AKT ++GCG   C
Sbjct:   31 QRIVNLHNHHRSTVEPPAADMIHMKWSGELALIAKEYATKC-IWEHNPD---SQNIMGENLFITTG----PLDIEKALSDWFMEHKHYSYDNNTCAENEMCGHYTQMVWAKTKEVGCGSHLC 144          
BLAST of SJCHGC09193 protein vs. Ensembl Cavefish
Match: ENSAMXT00000036030.1 (peptidase inhibitor 16 [Source:NCBI gene;Acc:103029846])

HSP 1 Score: 57.7658 bits (138), Expect = 2.087e-9
Identity = 40/122 (32.79%), Postives = 65/122 (53.28%), Query Frame = 1
Query:  283 ESILEIVNNIRS--KEPALRMAKIRWNTELALTAQYLSDQCKIKSSNPNLCSSALPMGQISFMTMSSSPQPKKWNQFIQDVFNQKPSYNFDKNKC-KSKNCNGYKQLVNAKTTDIGCGVTSC 639
            + I+ + N+ RS  + PA  M  ++W+ ELAL A+  + +C I   NP+   S   MG+  F+T      P    + + D F +   Y++D N C +++ C  Y Q+V AKT ++GCG   C
Sbjct:   31 QRIVNLHNHHRSTVEPPAADMIHMKWSGELALIAKEYATKC-IWEHNPD---SQNIMGENLFITTG----PLDIEKALSDWFMEHKHYSYDNNTCAENEMCGHYTQMVWAKTKEVGCGSHLC 144          
BLAST of SJCHGC09193 protein vs. Ensembl Cavefish
Match: ENSAMXT00000029824.1 (peptidase inhibitor 16 [Source:NCBI gene;Acc:103029846])

HSP 1 Score: 57.3806 bits (137), Expect = 3.608e-9
Identity = 40/122 (32.79%), Postives = 65/122 (53.28%), Query Frame = 1
Query:  283 ESILEIVNNIRS--KEPALRMAKIRWNTELALTAQYLSDQCKIKSSNPNLCSSALPMGQISFMTMSSSPQPKKWNQFIQDVFNQKPSYNFDKNKC-KSKNCNGYKQLVNAKTTDIGCGVTSC 639
            + I+ + N+ RS  + PA  M  ++W+ ELAL A+  + +C I   NP+   S   MG+  F+T      P    + + D F +   Y++D N C +++ C  Y Q+V AKT ++GCG   C
Sbjct:   31 QRIVNLHNHHRSTVEPPAADMIHMKWSGELALIAKEYATKC-IWEHNPD---SQNIMGENLFITTG----PLDIEKALSDWFMEHKHYSYDNNTCAENEMCGHYTQMVWAKTKEVGCGSHLC 144          
BLAST of SJCHGC09193 protein vs. Ensembl Cavefish
Match: r3hdml (R3H domain containing like [Source:NCBI gene;Acc:103046222])

HSP 1 Score: 49.2914 bits (116), Expect = 1.310e-6
Identity = 37/129 (28.68%), Postives = 67/129 (51.94%), Query Frame = 1
Query:  265 VTVKEVESILEIVNNIRSK--EPALRMAKIRWNTELALTAQYLSDQCKIKSSNPNLCSSALPMGQ-ISFMTMSSSPQPKKWNQFIQDVFNQKPSYNFDKNKCKSKNCNGYKQLVNAKTTDIGCGVTSCN 642
            V+ +++ ++LE  N +RS+   PA  M  + W+  LA +A+  + QC I    P+       MGQ +S     SS + +   + ++   ++K S+++  N+C    C+ Y Q+V A T  IGC +  C+
Sbjct:   62 VSSRDMTALLEYHNRVRSQVFPPAANMEYMVWDERLAKSAESWASQC-IWDHGPSHVMKY--MGQNLSI----SSGRYRSVIELVRSWHDEKNSFSYP-NRCTGSVCSHYTQMVWASTNRIGCAINRCS 182          
BLAST of SJCHGC09193 protein vs. Ensembl Sea Lamprey
Match: CRISP3 (cysteine rich secretory protein 3 [Source:HGNC Symbol;Acc:HGNC:16904])

HSP 1 Score: 50.0618 bits (118), Expect = 1.787e-7
Identity = 48/178 (26.97%), Postives = 75/178 (42.13%), Query Frame = 1
Query:  289 ILEIVNNIRS--KEPALRMAKIRWNTELALTAQYLSDQCKIKSS-NPNLCSSALPMGQISFMTMSSSPQPKKWNQFIQDVFNQ--KPSYNFDKNKCKSKNCNGYKQLVNAKTTDIGCGVTSCNR-PGEYIDYYYCHFFTPAYL----DRPYEKGNKGCNTCNLLNEKYVFKCNNNLCE 792
            I+++ N++R      A  M ++ W  E  L A   ++ C    S +    ++    G+  FM    S  P  WN  I+D +N+   P + +D     +     Y QLV   +  +GC V  C + PG     Y CH+     L    +RPY+ G   C +C          C NNLC+
Sbjct:   47 IVDLHNDLRRNVTPSAGNMLQMMWKKEAYLNALSWANNCTFGHSPDARRKTTQWTCGENIFM----SSAPFTWNYAIRDWYNEVISPGFQYDVGSTTTGAVGHYTQLVWYNSFQLGCAVNYCPKNPGVAKYLYVCHYCPMGNLNTRINRPYDLGTS-CASCPK-------NCVNNLCD 212          
BLAST of SJCHGC09193 protein vs. Ensembl Medaka
Match: ENSORLT00000020676.2 (cysteine-rich venom protein pseudecin-like [Source:NCBI gene;Acc:101157728])

HSP 1 Score: 53.5286 bits (127), Expect = 4.395e-8
Identity = 45/165 (27.27%), Postives = 71/165 (43.03%), Query Frame = 1
Query:  259 PKVTVKEVESILEIVNNIRS--KEPALRMAKIRWNTELALTAQYLSDQCKIKSSNPNLCSSALPMGQISFMTMSSSPQPKKWNQFIQDVFNQKPSYNFDKNKCKSKNCNGYKQLVNAKTTDIGCGVTSCNRPGEYIDYYYCHFFTPAYLDR--PYEKGNKGCNTC 741
            P+ T  + E I+++ N  R   + PA  M  + ++ ELA++AQ   D+C +    P   SS +  G      +  S  P  W   I   + +   + F       K    Y Q+V   +  +GCGVT C+     I  Y CH++      R  PY+ G   C +C
Sbjct:   10 PEDTAVQAE-IVDVHNAFRRAVEPPAADMLMMSYSEELAVSAQAWVDKCVLDHGPP---SSRMLNGYELGENLFYSTSPMLWKSIINAWYKEVSHFAFPNASTNGKPVGHYTQVVWNSSYKVGCGVTLCS---NNIYLYGCHYYRAGNFKRWPPYKVGTP-CASC 166          
BLAST of SJCHGC09193 protein vs. Ensembl Medaka
Match: ENSORLT00000020674.2 (cysteine-rich venom protein pseudecin-like [Source:NCBI gene;Acc:101157728])

HSP 1 Score: 53.1434 bits (126), Expect = 6.983e-8
Identity = 45/165 (27.27%), Postives = 71/165 (43.03%), Query Frame = 1
Query:  259 PKVTVKEVESILEIVNNIRS--KEPALRMAKIRWNTELALTAQYLSDQCKIKSSNPNLCSSALPMGQISFMTMSSSPQPKKWNQFIQDVFNQKPSYNFDKNKCKSKNCNGYKQLVNAKTTDIGCGVTSCNRPGEYIDYYYCHFFTPAYLDR--PYEKGNKGCNTC 741
            P+ T  + E I+++ N  R   + PA  M  + ++ ELA++AQ   D+C +    P   SS +  G      +  S  P  W   I   + +   + F       K    Y Q+V   +  +GCGVT C+     I  Y CH++      R  PY+ G   C +C
Sbjct:   25 PEDTAVQAE-IVDVHNAFRRAVEPPAADMLMMSYSEELAVSAQAWVDKCVLDHGPP---SSRMLNGYELGENLFYSTSPMLWKSIINAWYKEVSHFAFPNASTNGKPVGHYTQVVWNSSYKVGCGVTLCS---NNIYLYGCHYYRAGNFKRWPPYKVGTP-CASC 181          
BLAST of SJCHGC09193 protein vs. Ensembl Medaka
Match: CLEC18A (C-type lectin domain family 18 member A [Source:HGNC Symbol;Acc:HGNC:30388])

HSP 1 Score: 52.373 bits (124), Expect = 1.008e-7
Identity = 37/149 (24.83%), Postives = 68/149 (45.64%), Query Frame = 1
Query:  265 VTVKEVESILEIVNNIRSKE--PALRMAKIRWNTELALTAQYLSDQCKIKSSNPNLCSSALPMGQISFMTMSSSPQPKKWNQFIQDVFNQKPSYNFDKNKCK-SKNCNGYKQLVNAKTTDIGCGVTSCNRPGEYIDYYYCHFFTPAYLD 702
            + +K+   I+ + N +RS+    A  M K+ W+  +A+ A+  + +C    S  N   S      I + T  S+ +   ++  I   F +   + F   KC+ +  C  Y QLV A ++ +GC    C R G+  + + C ++ P   D
Sbjct:    1 LGIKQRSVIVALHNRLRSRVRPMAANMQKMEWDGRMAILAEKQAMRCGADLSPQNGPFSR----HIGWNTHLSTHRIASFSDIIHAWFEEGNDFFFLSGKCRENAACQHYTQLVWATSSHVGCASQLCLRDGDIWEIFVCAYY-PGLWD 144          
BLAST of SJCHGC09193 protein vs. Ensembl Medaka
Match: ENSORLT00000023160.2 (peptidase inhibitor 16 [Source:NCBI gene;Acc:101164782])

HSP 1 Score: 51.2174 bits (121), Expect = 4.875e-7
Identity = 48/190 (25.26%), Postives = 87/190 (45.79%), Query Frame = 1
Query:  265 VTVKEVESILEIVNNIRSK--EPALRMAKIRWNTELALTAQYLSDQC------KIKSSNPNLCSSALPMGQISFMTMSSSPQPKKWNQFIQDVFNQKPSYNFDKNKC-KSKNCNGYKQLVNAKTTDIGCGVTSCNRPGEY----IDYYYCHFFTPAYLD--RPYEKGNKGCNTCNLLNEKYVFKCNNNLC 789
            +T ++ E ++E+ N+ R +    A  M  ++W+  L L A+  + +C      +++ +  NL +     G++       S   +KW       F ++  Y+++ N C + K C  Y Q+V A T  +GC V  CN         + Y  C++F     D  RPY +G+  C+ C     + +  C N+LC
Sbjct:   57 LTDQQEEMLVELHNHYRGQVSPSAAAMLPLKWDGNLKLVAEGYAAKCIWEHNTELEDTGENLFAGT---GKLDL-----SEAVEKW-------FLERLDYSYENNSCDEDKMCGHYTQMVWADTHRVGCAVHFCNTIENLDWNNVSYLVCNYFPAGNYDDERPYVEGD-WCSRC----PEDLDVCQNHLC 226          
BLAST of SJCHGC09193 protein vs. Ensembl Medaka
Match: CLEC18A (C-type lectin domain family 18 member A [Source:HGNC Symbol;Acc:HGNC:30388])

HSP 1 Score: 51.2174 bits (121), Expect = 5.437e-7
Identity = 37/147 (25.17%), Postives = 66/147 (44.90%), Query Frame = 1
Query:  274 KEVESILEIVNNIRSKE--PALRMAKIRWNTELALTAQYLSDQCKIKSSNPNLCSSALPMGQISFMTMSSSPQPKKWNQFIQDVFNQKPSYNFDKNKCK-SKNCNGYKQLVNAKTTDIGCGVTSCNRPGEYIDYYYCHFFTPAYLDR 705
            K+   I+ + N +RS+    A  M K+ W+  +A+ A+  + +C    S  N   S      I + T  S+ +   ++  I   F +   + F   KC+ +  C  Y QLV A ++ +GC    C R G+  + + C ++ P   D 
Sbjct:    1 KQRSVIVALHNRLRSRVRPMAANMQKMEWDGRMAILAEKQAMRCGADLSPQNGPFSR----HIGWNTHLSTHRIASFSDIIHAWFEEGNDFFFLSGKCRENAACQHYTQLVWATSSHVGCASQLCLRDGDIWEIFVCAYY-PGLWDH 142          
BLAST of SJCHGC09193 protein vs. Planmine SMEST
Match: SMESG000004630.1 (SMESG000004630.1)

HSP 1 Score: 553.518 bits (1425), Expect = 0.000e+0
Identity = 268/268 (100.00%), Postives = 268/268 (100.00%), Query Frame = 1
Query:   22 MIKFTNLILLSLCSLIFANSPYRPKTDKGDFCKIPFEKNGKVYHDCGTDRGKKPWCQNSKGSVGHCANVQDFSKCKVSQPKVTVKEVESILEIVNNIRSKEPALRMAKIRWNTELALTAQYLSDQCKIKSSNPNLCSSALPMGQISFMTMSSSPQPKKWNQFIQDVFNQKPSYNFDKNKCKSKNCNGYKQLVNAKTTDIGCGVTSCNRPGEYIDYYYCHFFTPAYLDRPYEKGNKGCNTCNLLNEKYVFKCNNNLCEIVDSPPSKFKG 825
            MIKFTNLILLSLCSLIFANSPYRPKTDKGDFCKIPFEKNGKVYHDCGTDRGKKPWCQNSKGSVGHCANVQDFSKCKVSQPKVTVKEVESILEIVNNIRSKEPALRMAKIRWNTELALTAQYLSDQCKIKSSNPNLCSSALPMGQISFMTMSSSPQPKKWNQFIQDVFNQKPSYNFDKNKCKSKNCNGYKQLVNAKTTDIGCGVTSCNRPGEYIDYYYCHFFTPAYLDRPYEKGNKGCNTCNLLNEKYVFKCNNNLCEIVDSPPSKFKG
Sbjct:    1 MIKFTNLILLSLCSLIFANSPYRPKTDKGDFCKIPFEKNGKVYHDCGTDRGKKPWCQNSKGSVGHCANVQDFSKCKVSQPKVTVKEVESILEIVNNIRSKEPALRMAKIRWNTELALTAQYLSDQCKIKSSNPNLCSSALPMGQISFMTMSSSPQPKKWNQFIQDVFNQKPSYNFDKNKCKSKNCNGYKQLVNAKTTDIGCGVTSCNRPGEYIDYYYCHFFTPAYLDRPYEKGNKGCNTCNLLNEKYVFKCNNNLCEIVDSPPSKFKG 268          
BLAST of SJCHGC09193 protein vs. Planmine SMEST
Match: SMESG000004629.1 (SMESG000004629.1)

HSP 1 Score: 370.548 bits (950), Expect = 4.953e-129
Identity = 169/268 (63.06%), Postives = 208/268 (77.61%), Query Frame = 1
Query:   22 MIKFTNLILLSLCSLIFANSPYRPKTDKGDFCKIPFEKNGKVYHDCGTDRGKKPWCQNSKGSVGHCANVQDFSKCKVSQPKVTVKEVESILEIVNNIRSKEPALRMAKIRWNTELALTAQYLSDQCKIKSSNPNLCSSALPMGQISFMTMSSSPQPKKWNQFIQDVFNQKPSYNFDKNKCKSKNCNGYKQLVNAKTTDIGCGVTSCNRPGEYIDYYYCHFFTPAYLDRPYEKGNKGCNTCNLLNEKYVFKCNNNLCEIVDSPPSKFKG 825
            MI+F NL LL +CS++F  + YRPKT+ G+FCKIPFEKN KVYHDC  +   KPWC+NS+  V +CANV DFS C V  P  +V EV+S+LE+VNNIR+KEPA+RMAKIRWNTELA+ AQY+SDQC++ S N NLCSS  PMGQISFM+MS+ PQPKKW+QFI + +NQK SYNFD N+C  K CNGYKQLVN+KTTDIGC VTSCN  G Y DYY+C+F+ P Y+ +PYEKG   C +C  LN+ Y ++CN  LCEI D+P +  KG
Sbjct:    1 MIEFRNLFLLGICSMVFVEALYRPKTENGEFCKIPFEKNDKVYHDCTKEEDSKPWCKNSEDVVSYCANVTDFSNCNVGTPTTSVAEVKSVLELVNNIRTKEPAVRMAKIRWNTELAIRAQYMSDQCQVGSDNTNLCSSDSPMGQISFMSMSTDPQPKKWSQFILEFYNQKSSYNFDTNECNGKYCNGYKQLVNSKTTDIGCAVTSCNLDGVYSDYYFCNFYPPVYMGKPYEKGEGNCESCYKLNDNYSYRCNGKLCEICDAPSNDCKG 268          
BLAST of SJCHGC09193 protein vs. Planmine SMEST
Match: SMESG000004629.1 (SMESG000004629.1)

HSP 1 Score: 351.288 bits (900), Expect = 1.018e-121
Identity = 160/254 (62.99%), Postives = 197/254 (77.56%), Query Frame = 1
Query:   64 LIFANSPYRPKTDKGDFCKIPFEKNGKVYHDCGTDRGKKPWCQNSKGSVGHCANVQDFSKCKVSQPKVTVKEVESILEIVNNIRSKEPALRMAKIRWNTELALTAQYLSDQCKIKSSNPNLCSSALPMGQISFMTMSSSPQPKKWNQFIQDVFNQKPSYNFDKNKCKSKNCNGYKQLVNAKTTDIGCGVTSCNRPGEYIDYYYCHFFTPAYLDRPYEKGNKGCNTCNLLNEKYVFKCNNNLCEIVDSPPSKFKG 825
            ++F  + YRPKT+ G+FCKIPFEKN KVYHDC  +   KPWC+NS+  V +CANV DFS C V  P  +V EV+S+LE+VNNIR+KEPA+RMAKIRWNTELA+ AQY+SDQC++ S N NLCSS  PMGQISFM+MS+ PQPKKW+QFI + +NQK SYNFD N+C  K CNGYKQLVN+KTTDIGC VTSCN  G Y DYY+C+F+ P Y+ +PYEKG   C +C  LN+ Y ++CN  LCEI D+P +  KG
Sbjct:    1 MVFVEALYRPKTENGEFCKIPFEKNDKVYHDCTKEEDSKPWCKNSEDVVSYCANVTDFSNCNVGTPTTSVAEVKSVLELVNNIRTKEPAVRMAKIRWNTELAIRAQYMSDQCQVGSDNTNLCSSDSPMGQISFMSMSTDPQPKKWSQFILEFYNQKSSYNFDTNECNGKYCNGYKQLVNSKTTDIGCAVTSCNLDGVYSDYYFCNFYPPVYMGKPYEKGEGNCESCYKLNDNYSYRCNGKLCEICDAPSNDCKG 254          
BLAST of SJCHGC09193 protein vs. Planmine SMEST
Match: SMESG000004631.1 (SMESG000004631.1)

HSP 1 Score: 313.153 bits (801), Expect = 2.064e-106
Identity = 148/295 (50.17%), Postives = 202/295 (68.47%), Query Frame = 1
Query:   22 MIKFTNLILLSL-CSLIFANSPYRPKTDKGDFCKIPFEKNGKVYHDCGTDRGKKPWCQNSKGSVGHCANVQDFSKCKVSQPKVTVKEVESILEIVNNIRSKEPALRMAKIRWNTELALTAQYLSDQCKIKSSNPNLCSSALPMGQISFMTMSSSPQPKKWNQFIQDVFNQKPSYNFDKNKCKSKNCNGYKQLVNAKTTDIGCGVTSCNRPGEYIDYYYCHFFTPAYLDRPYEKGNKGCNTCNLLNEKYVFKCNNNLCEIVDSPPSKFKG*NYTIFNTKV-LLDQIQPN-CEINKN 897
            MI F    L +L CS+      YRPKT+ G+FC IPFE  GK++HDC T+   K WC+ +    G+C+N  DFSKC+V+ P  ++ +V+ IL+++NNIR KEPALRM+KIRWNTELA  AQY+S+QC++ S N NLC+SA PMGQIS+ TMSS  Q  KW QFI + +NQK  YN+D N C SK CNGYKQLVNA+TT+IGC V++C +   + DYY+C+F+ P Y  RPYEKG   C++C  L++ Y+++C  +LCEI DS  S  +G        +  L + ++P  CE+N +
Sbjct:    1 MINFQVAFLFALACSVAQCQYAYRPKTENGEFCMIPFEYQGKIFHDCTTEGDSKAWCRPASDKWGYCSNTSDFSKCQVAAPTSSISDVKLILDLLNNIRMKEPALRMSKIRWNTELAQRAQYMSNQCRLGSDNTNLCTSASPMGQISYATMSSEKQSLKWTQFILEFYNQKSGYNYDTNTCTSKYCNGYKQLVNARTTEIGCAVSNCKKGETFADYYFCNFYPPIYQHRPYEKGETKCDSCYKLDDNYLYRCTKDLCEICDSQSSDCQGKEVLKLAIEAGLCEDLEPGFCELNAS 295          
BLAST of SJCHGC09193 protein vs. Planmine SMEST
Match: SMESG000050444.1 (SMESG000050444.1)

HSP 1 Score: 125.946 bits (315), Expect = 2.489e-33
Identity = 83/266 (31.20%), Postives = 129/266 (48.50%), Query Frame = 1
Query:   31 FTNLILLSLCSLIFANSPYRPKTDKGDFCKIPFEKNGKVYHDCGTDRGKKPWCQNSKG--SVGHCA-NVQDFSKCKVSQPKVTVKEVESILEIVNNIRSKEPALRMAKIRWNTELALTAQYLSDQCKIKSSNPNLCSSALPMGQISFMTMSSSPQPK--KWNQFIQDVFNQKPSYNFDKNKCK-SKNCNGYKQLVNAKTTDIGCGVTSCNRPGE------YIDYYYCHFFTPAYL--DRPYEKGN-KGCNTCNLLNEKYVFKCNNN 783
            F  L+ L+   L    + Y+ +T  G  C IPF   GK+YHDC T+    PWC   K      +C  + +++  C++  P VT+++VE IL + N  RSK PALRM K+ WN+ELA  AQ  +D+C     +  LC    P+GQ  F + +    P    W   I     ++ +Y+ D + C   K C  +  +    T  +GCG   C   GE      Y   YYC+++    +   +P+ K   + C  C+L N+   F+C+ +
Sbjct:   22 FHGLVDLAQGQL----TIYKAETTTGQRCTIPFVYKGKIYHDCITEGSDSPWCYVDKEFKKWEYCKPHPKEYDGCQIRNPNVTLEDVEEILRVHNKFRSKLPALRMKKLEWNSELAQIAQKAADKCAHVHIDVTLCGDREPVGQNLFYSYNDDDYPGLLSWTDIIGHWSGEEKNYDIDTHSCLPGKLCGHFTAVATDYTNLVGCGRNFCY--GELLGKKRYSIQYYCNYYEAGNVGGQKPFIKSTGEKCKDCHLFNQNERFRCDED 281          
The following BLAST results are available for this feature:
BLAST of SJCHGC09193 protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CRISP16.059e-727.06cysteine rich secretory protein 1 [Source:HGNC Sym... [more]
CRISP16.059e-727.06cysteine rich secretory protein 1 [Source:HGNC Sym... [more]
CRISP19.304e-727.27cysteine rich secretory protein 1 [Source:HGNC Sym... [more]
CRISP19.304e-727.27cysteine rich secretory protein 1 [Source:HGNC Sym... [more]
CRISP21.765e-627.08cysteine rich secretory protein 2 [Source:HGNC Sym... [more]
back to top
BLAST of SJCHGC09193 protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
scl-215.154e-626.67SCP-Like extracellular protein [Source:UniProtKB/... [more]
back to top
BLAST of SJCHGC09193 protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CG84831.008e-827.07gene:FBgn0038126 transcript:FBtr0082782[more]
back to top
BLAST of SJCHGC09193 protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CU914487.12.059e-729.41peptidase inhibitor 16-like [Source:NCBI gene;Acc:... [more]
back to top
BLAST of SJCHGC09193 protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
R3HDML3.666e-623.71R3H domain containing-like [Source:NCBI gene;Acc:1... [more]
R3HDML4.987e-623.71R3H domain containing-like [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of SJCHGC09193 protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Glipr1l32.983e-1028.95GLI pathogenesis-related 1 like 3 [Source:MGI Symb... [more]
Glipr1l12.983e-1028.80GLI pathogenesis-related 1 like 1 [Source:MGI Symb... [more]
Clec18a1.775e-824.56C-type lectin domain family 18, member A [Source:M... [more]
Clec18a1.775e-824.56C-type lectin domain family 18, member A [Source:M... [more]
Clec18a2.825e-724.64C-type lectin domain family 18, member A [Source:M... [more]
back to top
BLAST of SJCHGC09193 protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9DAG6|GPRL1_MOUSE2.086e-928.80GLIPR1-like protein 1 OS=Mus musculus OX=10090 GN=... [more]
sp|Q60477|CRIS2_CAVPO1.111e-728.33Cysteine-rich secretory protein 2 OS=Cavia porcell... [more]
sp|Q7TSQ1|CL18A_MOUSE1.241e-724.56C-type lectin domain family 18 member A OS=Mus mus... [more]
sp|Q58D34|PI16_BOVIN7.194e-726.20Peptidase inhibitor 16 OS=Bos taurus OX=9913 GN=PI... [more]
sp|P35786|VA5_VESSQ1.885e-628.04Venom allergen 5 OS=Vespula squamosa OX=30214 PE=1... [more]
back to top
BLAST of SJCHGC09193 protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
T1FIX75.212e-1433.59SCP domain-containing protein OS=Helobdella robust... [more]
T1FNF52.609e-1230.07SCP domain-containing protein OS=Helobdella robust... [more]
T1FCL94.498e-1230.34SCP domain-containing protein OS=Helobdella robust... [more]
G4LUX14.858e-1132.93Venom allergen-like (VAL) 14 protein OS=Schistosom... [more]
R7TUH47.202e-1135.38ShKT domain-containing protein OS=Capitella teleta... [more]
back to top
BLAST of SJCHGC09193 protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSAMXT00000031557.11.911e-932.79peptidase inhibitor 16 [Source:NCBI gene;Acc:10302... [more]
ENSAMXT00000036030.12.087e-932.79peptidase inhibitor 16 [Source:NCBI gene;Acc:10302... [more]
ENSAMXT00000029824.13.608e-932.79peptidase inhibitor 16 [Source:NCBI gene;Acc:10302... [more]
r3hdml1.310e-628.68R3H domain containing like [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of SJCHGC09193 protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CRISP31.787e-726.97cysteine rich secretory protein 3 [Source:HGNC Sym... [more]
back to top
BLAST of SJCHGC09193 protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SJCHGC09193 protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SJCHGC09193 protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000020676.24.395e-827.27cysteine-rich venom protein pseudecin-like [Source... [more]
ENSORLT00000020674.26.983e-827.27cysteine-rich venom protein pseudecin-like [Source... [more]
CLEC18A1.008e-724.83C-type lectin domain family 18 member A [Source:HG... [more]
ENSORLT00000023160.24.875e-725.26peptidase inhibitor 16 [Source:NCBI gene;Acc:10116... [more]
CLEC18A5.437e-725.17C-type lectin domain family 18 member A [Source:HG... [more]
back to top
BLAST of SJCHGC09193 protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000004630.10.000e+0100.00SMESG000004630.1[more]
SMESG000004629.14.953e-12963.06SMESG000004629.1[more]
SMESG000004629.11.018e-12162.99SMESG000004629.1[more]
SMESG000004631.12.064e-10650.17SMESG000004631.1[more]
SMESG000050444.12.489e-3331.20SMESG000050444.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30028319 ID=SMED30028319|Name=SJCHGC09193 protein|organism=Schmidtea mediterranea sexual|type=transcript|length=911bp
CGATCTAAAATTTTGACATAAATGATTAAATTTACCAATTTAATACTTCT
GAGTCTGTGTTCTCTGATTTTCGCAAACAGCCCATATAGACCTAAAACTG
ACAAGGGAGATTTTTGTAAGATTCCTTTTGAAAAAAATGGAAAAGTCTAT
CATGATTGTGGGACGGACAGAGGCAAAAAACCTTGGTGCCAAAACTCTAA
AGGCTCAGTAGGACACTGTGCAAATGTTCAAGATTTTAGTAAATGCAAAG
TTAGTCAACCAAAAGTAACAGTAAAGGAAGTCGAATCTATACTAGAAATA
GTAAACAATATTCGTTCAAAAGAACCTGCATTGAGGATGGCAAAGATTCG
TTGGAATACAGAATTAGCCTTAACAGCACAATATCTGAGTGATCAATGTA
AAATAAAAAGCAGTAATCCGAATTTATGCTCATCAGCTTTACCAATGGGT
CAAATCAGTTTCATGACAATGTCTTCCAGTCCACAGCCCAAAAAATGGAA
TCAATTTATTCAAGACGTTTTCAATCAAAAACCTTCATATAATTTTGATA
AAAATAAATGCAAAAGTAAAAATTGCAATGGATACAAACAACTTGTCAAC
GCAAAGACCACAGATATAGGATGCGGTGTAACAAGTTGCAATCGTCCTGG
AGAATATATAGACTATTATTACTGCCATTTCTTTACTCCCGCCTATTTGG
ACAGACCATATGAAAAAGGCAATAAAGGCTGCAACACCTGTAACTTGTTG
AATGAAAAATATGTATTTAAATGCAACAACAATTTATGTGAAATCGTTGA
CTCTCCTCCATCAAAATTTAAGGGATAAAATTATACAATTTTCAATACAA
AAGTGTTACTCGACCAGATCCAGCCGAACTGTGAAATAAATAAAAATTAT
TTGTTGATTGC
back to top

protein sequence of SMED30028319-orf-1

>SMED30028319-orf-1 ID=SMED30028319-orf-1|Name=SMED30028319-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=269bp
MIKFTNLILLSLCSLIFANSPYRPKTDKGDFCKIPFEKNGKVYHDCGTDR
GKKPWCQNSKGSVGHCANVQDFSKCKVSQPKVTVKEVESILEIVNNIRSK
EPALRMAKIRWNTELALTAQYLSDQCKIKSSNPNLCSSALPMGQISFMTM
SSSPQPKKWNQFIQDVFNQKPSYNFDKNKCKSKNCNGYKQLVNAKTTDIG
CGVTSCNRPGEYIDYYYCHFFTPAYLDRPYEKGNKGCNTCNLLNEKYVFK
CNNNLCEIVDSPPSKFKG*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR035940CAP_sf
IPR036943FN_type2_sf
IPR001283CRISP-related
IPR014044CAP_domain
IPR000562FN_type2_dom
IPR013806Kringle-like
Vocabulary: cellular component
TermDefinition
GO:0005576extracellular region
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR014044CAP domainSMARTSM00198SCP_3coord: 85..227
e-value: 2.2E-8
score: 29.7
IPR014044CAP domainPFAMPF00188CAPcoord: 91..220
e-value: 3.3E-15
score: 57.1
IPR000562Fibronectin type II domainPFAMPF00040fn2coord: 32..57
e-value: 8.2E-6
score: 26.0
IPR035940CAP superfamilyGENE3DG3DSA:3.40.33.10coord: 74..261
e-value: 4.4E-29
score: 103.4
IPR035940CAP superfamilySUPERFAMILYSSF55797PR-1-likecoord: 78..233
IPR036943Fibronectin type II domain superfamilyGENE3DG3DSA:2.10.10.10coord: 23..73
e-value: 1.1E-5
score: 27.2
NoneNo IPR availablePANTHERPTHR10334:SF344AT27079P-RELATEDcoord: 73..241
NoneNo IPR availableCDDcd05380CAP_eukcoord: 90..220
e-value: 1.75745E-22
score: 88.2803
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..18
score: 0.845
IPR001283Cysteine-rich secretory protein-relatedPANTHERPTHR10334CYSTEINE-RICH SECRETORY PROTEIN-RELATEDcoord: 73..241
IPR013806Kringle-like foldSUPERFAMILYSSF57440Kringle-likecoord: 24..59