Protein tyrosine phosphatase receptor type D

Overview
NameProtein tyrosine phosphatase receptor type D
Smed IDSMED30028312
Length (bp)5953
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein tyrosine phosphatase receptor type D (SMED30028312) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein tyrosine phosphatase receptor type D (SMED30028312) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein tyrosine phosphatase receptor type D (SMED30028312) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein tyrosine phosphatase receptor type D (SMED30028312) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30028312

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 16

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30028312SMESG000053906.1 Contig4677uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30028312SMESG000053906.1 Contig4677newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30028312SMESG000026093.1 Contig4677uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30028312SMESG000026093.1 Contig4677newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
nervous systemSMED30028312SMESG000053906.1 dd_Smed_v4_12545_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30028312SMESG000053906.1 dd_Smed_v4_12545_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30028312SMESG000053906.1 dd_Smed_v4_12545_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30028312SMESG000053906.1 dd_Smed_v4_12545_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30028312SMESG000053906.1 dd_Smed_v4_12545_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30028312SMESG000053906.1 dd_Smed_v4_12545_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30028312SMESG000053906.1 dd_Smed_v4_38917_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30028312SMESG000053906.1 dd_Smed_v4_38917_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30028312SMESG000053906.1 dd_Smed_v4_38917_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30028312SMESG000063632.1 SMESG000060519.1 SMESG000053906.1 SMESG000051773.1 SMESG000046455.1 SMESG000040998.1 Contig30862uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30028312SMESG000063632.1 SMESG000060519.1 SMESG000053906.1 SMESG000051773.1 SMESG000046455.1 SMESG000040998.1 Contig30862newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
dorsal-ventral muscle cellSMED30028312SMESG000053906.1 dd_Smed_v4_12545_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein tyrosine phosphatase receptor type D vs. Ensembl Human
Match: PTPRS (protein tyrosine phosphatase receptor type S [Source:HGNC Symbol;Acc:HGNC:9681])

HSP 1 Score: 720.694 bits (1859), Expect = 0.000e+0
Identity = 341/635 (53.70%), Postives = 449/635 (70.71%), Query Frame = 1
Query: 3928 KSIPDLVNADS---VQMCQDGTKLSPVLVSDSIKLRIGSQKSENISDRPSISICNLYQYVTDLKANDCTLLQAEFETLNTNLDDRFTWQRSNIDSNKSKNRYANVVAYDHTSVLLTPVDDVIGSDYINANYIDGYQRQNAYIATQGPLPDTTDDFWRMVWEQRSNCIVMMTRLEERSGIKCHQYWPNRGFICYGQMIVSHIDTFVLAYYTIRLFEIRHSKYSEKREIQHFQFTAWPDHGVPKLSTPLLMFIRRVRSIGKIESCPKIVHCSAGVGRTGAFIVVDAQLERIKQEKNIDVFNYVSKIRCQRNYMVQTQAQYQFILETLLEAVEDGNTEVMACNFHAHVTKLSQIGISGSNQLSGFEMEFSKLNSLASNRGRHGVMLADFVKAAGNQAVNMTKNRVRNIIPYEWNRVVLNAIRGIEGSDYINASYIDGYRDRRAYIAAQSPIPSTVEDFWRMLWDQHCGVVIVLNQPHE---DKSHIYWPINKSIRYQFFVVDPVVEYNMPNYILREFKVTDARDGEFRALRQFQFTQWPNHGCPKESESILDFIRQVHKTKEQFGHMEPMVIHCNTGSGRTGVFIALSIVLDRLQQESVVDMYQTVKLLHKQRIGLVQTEEQYEFCYMAVLDYLSNYE 5814
            K+ PD    DS    +   +   L+P    D +++R  + ++  +   P I I ++ ++   LKAND   L  E+E+++     +FTW+ SN++ NK KNRYANV+AYDH+ V+L P++ ++GSDYINANY+DGY+ QNAYIATQGPLP+T  DFWRMVWEQRS  IVMMTRLEE+S IKC QYWPNRG   YG + V+ +DT  LA + +R F +  +  SEKRE++ FQFTAWPDHGVP+  TP L F+RRV++    ++ P +VHCSAGVGRTG FIV+DA LERIK EK +DV+ +V+ +R QRNYMVQT+ QY FI E LLEAV  GNTEV A + +A++ KL+Q  +     ++G E+EF +L +  ++  R       F+ A  N   N  KNR+ NI+PYE  RV L  IRG+EGSDYINAS+IDGYR ++AYIA Q P+  T EDFWRMLW+ +  +V++L +  E   +K H YWP  +S RYQ+FVVDP+ EYNMP YILREFKVTDARDG+ R +RQFQFT WP  G PK  E  +DFI QVHKTKEQFG   P+ +HC+ G GRTGVFI LSIVL+R++ E VVD++QTVK+L  QR  +VQTE++Y+FCY A L+YL +++
Sbjct: 1285 KNKPDSKRKDSEPRTKCLLNNADLAPHHPKDPVEMRRINFQTPGMLSHPPIPIADMAEHTERLKANDSLKLSQEYESIDPG--QQFTWEHSNLEVNKPKNRYANVIAYDHSRVILQPIEGIMGSDYINANYVDGYRCQNAYIATQGPLPETFGDFWRMVWEQRSATIVMMTRLEEKSRIKCDQYWPNRGTETYGFIQVTLLDTIELATFCVRTFSLHKNGSSEKREVRQFQFTAWPDHGVPEYPTPFLAFLRRVKTCNPPDAGPIVVHCSAGVGRTGCFIVIDAMLERIKPEKTVDVYGHVTLMRSQRNYMVQTEDQYSFIHEALLEAVGCGNTEVPARSLYAYIQKLAQ--VEPGEHVTGMELEFKRLANSKAHTSR-------FISA--NLPCNKFKNRLVNIMPYESTRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWENNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDEYQFCYQAALEYLGSFD 1906          

HSP 2 Score: 205.297 bits (521), Expect = 4.172e-52
Identity = 105/262 (40.08%), Postives = 151/262 (57.63%), Query Frame = 1
Query: 5092 NQAVNMTKNRVRNIIPYEWNRVVLNAIRGIEGSDYINASYIDGYRDRRAYIAAQSPIPSTVEDFWRMLWDQHCGVVIVLNQPHEDKSHI----YWPINKSIRYQFFVVDPVVEYNMPNYILREFKVTDARDGEFRALRQFQFTQWPNHGCPKESESILDFIRQVHKTKEQFGHMEPMVIHCNTGSGRTGVFIALSIVLDRLQQESVVDMYQTVKLLHKQRIGLVQTEEQYEFCYMAVLDYLSNYEKILEKSHLY*TYQDLSE 5865
            N  VN  KNR  N+I Y+ +RV+L  I GI GSDYINA+Y+DGYR + AYIA Q P+P T  DFWRM+W+Q    ++++ +  E+KS I    YWP   +  Y F  V  +    +  + +R F +      E R +RQFQFT WP+HG P+     L F+R+V           P+V+HC+ G GRTG FI +  +L+R++ E  VD+Y  V L+  QR  +VQTE+QY F + A+L+ +      +    LY   Q L++
Sbjct: 1374 NLEVNKPKNRYANVIAYDHSRVILQPIEGIMGSDYINANYVDGYRCQNAYIATQGPLPETFGDFWRMVWEQRSATIVMMTR-LEEKSRIKCDQYWPNRGTETYGFIQVTLLDTIELATFCVRTFSLHKNGSSEKREVRQFQFTAWPDHGVPEYPTPFLAFLRRVKTCNPP--DAGPIVVHCSAGVGRTGCFIVIDAMLERIKPEKTVDVYGHVTLMRSQRNYMVQTEDQYSFIHEALLEAVGCGNTEVPARSLYAYIQKLAQ 1632          

HSP 3 Score: 160.614 bits (405), Expect = 1.451e-38
Identity = 223/951 (23.45%), Postives = 376/951 (39.54%), Query Frame = 1
Query:  370 LACSSTGHPVPSISW-----KINESPIEELKSPLKKLQNPPRIFSIKNYQNSVLVITQLIESDSNSVLICEAENNAGFDSRQQQLKVISTETDIPSGFPVFQNNFFPIIKPYNSNVTLVCQAYGNPPPLIQWFKNYELINESFT--KIKILNDGNLLLVQVTREDKGIYHCQAQNTNGLRLSDPSTLDITSYPISPNSLII----ERFASDNVEIS------------WRSGLNDVTEQENFILHYREVPENITEKQIMSKFVYLTISEKKSIYKYNLKDLFPFTTYCIWMESENPLGVSPPTIALTVKTLPTSPQLSPRSITATSISNTAILVAWRPPERKFGKFKYYQIIYTNNDGFLPQHWRQFAVKDDNVMLTHLIAS----ELYHIRVKIVNEIGHGPLSKTISIKTIAGTLSQCP-DFKITEIFQSHIKLQWGTPDPVKLFKLIQYNLLCWDVRLKIVNATAKSSTLFPILN---HNLSMNEMEYVLYLKNEKEIKCRLSAINSDGKG-MPTEIQASTVNKGVNYQNL-IHIDKIGSTYITFQWRPPSKFSFDYFLWIYQIFDSEKLDRAVKLPKIKINISDSASAENGWFVYNYTNAFS-SSRYILGLRYLCRDSTDILREYVHRSDLVSTMKSVPSDSPKDLVVKEIDSNSALVSWKPLDQVHSNGIITHYEVRYYAPKKEESTERFIN---VSETSAILSNL-KYFHYVIYVRAFTKVGGGSWSNPKNYYRQNLEEFP--IPTTIKGERKSETEINISWELPVLSEKNLAHAAIEGFIILYAPVESS----PKWIKYTVQSKNLSAVIKGLEPDLRYQFQIAATNYAGFNGNFSE----IVQEMPKNFPNLNLKTVPDLRCSVQSSNRLKVEWSSPSISTDLLKFEIRYSGNLSYITEIGLKKSEFIDMESKSVNFETLVNRYDVTLENLQSNALYKIAVRA 3078
              C +TG P P ++W     K+N    E ++                    +VL I  L      +V  C A+N+ G  +   +L V+  E  +PSGFP         +       T++C A GNP P I WFK++  ++ S +  +IK L  G L +      D+G Y C A N+ G+R S P+ L +    ++P   I+    E     NV I+            W  G  D+T +++       V  N+ E         LT          ++KD   +T  C+ M S   LGV      +TVK+LP +P     +   T  + T+I + W           YY I Y +     P     + +K+D     + I        Y I V  VN IG GP S+++  +T     +  P + +   +  + + +QW   +PV+   LI+   + + +  +            P+ N   HN+  + +  V  L  ++    R+ A  S G G +   IQ  T  +GV  Q + +  +    T IT  W PP + S   +  +++  D  +       P     + D           N   AF  ++R   GL       T ++R+         T++S PS  P+D+    + S + LVSW+P      NG +  Y VRY     E+   + +N    + T  +L  L K+  Y I   A T+VG G  S+P     +  E+ P   P  ++ E  + T I + W  P    +   H  I G+ + Y  +E +    P  IK  + +     VI  L+P+  Y   +AA    G +G  S+    + +      P L+++  P+          L   W  P+ + +           L Y  + G + S  +     ++ F    +RY  +  +  +  ++++A R+
Sbjct:   52 FVCQATGDPKPRVTWNKKGKKVNSQRFETIE--------------FDESAGAVLRIQPLRTPRDENVYECVAQNSVGEITVHAKLTVLR-EDQLPSGFPNIDMGPQLKVVERTRTATMLCAASGNPDPEITWFKDFLPVDPSASNGRIKQLRSGALQIESSEETDQGKYECVATNSAGVRYSSPANLYVRVRRVAPRFSILPMSHEIMPGGNVNITCVAVGSPMPYVKWMQGAEDLTPEDDM-----PVGRNVLE---------LT----------DVKDSANYT--CVAMSS---LGVIEAVAQITVKSLPKAPG----TPMVTENTATSITITWD--SGNPDPVSYYVIEYKSKSQDGP-----YQIKEDITTTRYSIGGLSPNSEYEIWVSAVNSIGQGPPSESVVTRTGEQAPASAPRNVQARMLSATTMIVQWE--EPVEPNGLIRGYRVYYTMEPE-----------HPVGNWQKHNVDDSLLTTVGSLLEDETYTVRVLAFTSVGDGPLSDPIQVKT-QQGVPGQPMNLRAEARSETSITLSWSPPRQESIIKYELLFREGDHGREVGRTFDPTTSYVVED--------LKPNTEYAFRLAARSPQGLGAF----TPVVRQ--------RTLQSKPSAPPQDVKCVSVRSTAILVSWRPPPPETHNGALVGYSVRYRPLGSEDPEPKEVNGIPPTTTQILLEALEKWTQYRITTVAHTEVGPGPESSP--VVVRTDEDVPSAPPRKVEAEALNATAIRVLWRSPAPGRQ---HGQIRGYQVHYVRMEGAEARGPPRIKDVMLADAQEMVITNLQPETAYSITVAAYTMKG-DGARSKPKVVVTKGAVLGRPTLSVQQTPE--------GSLLARWEPPAGTAE--------DQVLGYRLQFGREDSTPL----ATLEFPPSEDRYTASGVHKGATYVFRLAARS 887          

HSP 4 Score: 150.984 bits (380), Expect = 1.373e-35
Identity = 209/970 (21.55%), Postives = 390/970 (40.21%), Query Frame = 1
Query:  268 VLINSQITFTENDEAPK----ISLIIQSPNVLLFKSMILACSSTGHPVPSISWKINESPIEELKSPLKKLQNPPRIFSIKNYQNSVLVITQLIESDSNSVLICEAENNAGFDSRQQQLKVISTETDIPSGFPVFQNNFFPI---IKPYNSNVTLVCQAYGNPPPLIQWFKNYELINESFTKIKILNDGNLLLVQVTREDKGIYHCQAQNTNGLRLSDPSTLDITSYPISPNSLIIERFASDNVEISWRSGLNDVTEQENFILHYREVPENITEKQIMSKFVYLTISEKKSIYKYNLKDLFPFTTYCIWMESENPLGVSPPTIALTVKTLPTSPQLSPRSITATSISNTAILVAWRPPERKFGKFKYYQIIYTNNDGFLPQHWRQFAVKDDNVMLT--HLIASELYHIRVKIVNEIGHGPLSKTISIKTIAGTLSQCPDFKITEIFQSHIKLQWGTPDPVKLFKLIQYNLLCWDV-RLKIVNATAKSSTLFPILNHNLSMNEMEYVLYLKNEKEIKCRLSAINSDGKGMPTEI--QASTVNKGVNYQNLIHIDKIGSTYITFQWRPPSKFSFDYFLWIYQIFDSEKLDRAVKLPKIKINISDSAS-----AENGWFVYNYTNAFSSSRYILGLRYLCRDSTDILREYVHRSDLVSTMKSVPSDSPKDLVVKEIDSNSALVSWKPLDQVHSNGIITHYEVRYYAPKKEES--TERFINVSETSA---ILSNLK-YFHYVIYVRAFTKVGGGSWSNPKNYYRQN-LEEFPIPTTIKGERKSETEINISWELPVLSEKNLAHAAIEGFIILYAPVESSP-KWIKYTVQSKNLSAVIKGLEPDLRYQFQIAATNYAGFNGNFSEIV---QEMPKNFPNLNLKTVPDLRCSVQSSNRLKVEWSSPSIS---TDLLKF--EIRYSGNLSYITEIGLKKSEFIDMESKSVNFETLVNRYDVTLENLQSNALYKIAVRA 3078
            + +++++T    D+ P     I +  Q   V   ++  + C+++G+P P I+W  +  P++   S  +          IK  ++  L I    E+D      C A N+AG          +      P      + +  P+   I P   NV + C A G+P P ++W +      E  T    +  G  +L     +D   Y C A ++ G+ +   + + + S P +P + ++    + ++ I+W SG  D      +++ Y+            S+     I E  +  +Y++  L P + Y IW+ + N +G  PP+ ++  +T   +P  +PR++ A  +S T ++V W  P    G  + Y++ YT        +W++  V DD+++ T   L+  E Y +RV     +G GPLS  I +KT  G   Q  + +     ++ I L W  P   +   +I+Y LL  +    + V  T   +T + + +             LK   E   RL+A +  G G  T +  Q +  +K       +    + ST I   WRPP   + +  L  Y +     L      PK    I  + +     A   W  Y  T                   T++         +V T + VPS  P+ +  + +++ +  V W+       +G I  Y+V Y   +  E+    R  +V    A   +++NL+    Y I V A+T  G G+ S PK    +  +   P   T+  ++  E  +   WE P       A   + G+ + +   +S+P   +++       +A   G+     Y F++AA +  G     +E++   ++ P+  P + L+   +      S+  + + W  P  +     ++K+   +R +G L    E  L  +     E+             +TL+ L+ +  Y + VRA
Sbjct:  116 ITVHAKLTVLREDQLPSGFPNIDMGPQLKVVERTRTATMLCAASGNPDPEITWFKDFLPVDPSASNGR----------IKQLRSGALQIESSEETDQGK-YECVATNSAGVRYSSPANLYVRVRRVAP------RFSILPMSHEIMP-GGNVNITCVAVGSPMPYVKWMQG----AEDLTPEDDMPVGRNVLELTDVKDSANYTCVAMSSLGV-IEAVAQITVKSLPKAPGTPMVTENTATSITITWDSGNPDPVSY--YVIEYKS----------KSQDGPYQIKEDITTTRYSIGGLSPNSEYEIWVSAVNSIGQGPPSESVVTRTGEQAPASAPRNVQARMLSATTMIVQWEEPVEPNGLIRGYRVYYTMEPEHPVGNWQKHNV-DDSLLTTVGSLLEDETYTVRVLAFTSVGDGPLSDPIQVKTQQGVPGQPMNLRAEARSETSITLSWSPP---RQESIIKYELLFREGDHGREVGRTFDPTTSYVVED-------------LKPNTEYAFRLAARSPQGLGAFTPVVRQRTLQSKPSAPPQDVKCVSVRSTAILVSWRPPPPETHNGALVGYSV-RYRPLGSEDPEPKEVNGIPPTTTQILLEALEKWTQYRITTV---------------AHTEVGPGPESSPVVVRTDEDVPSAPPRKVEAEALNATAIRVLWRSPAPGRQHGQIRGYQVHYVRMEGAEARGPPRIKDVMLADAQEMVITNLQPETAYSITVAAYTMKGDGARSKPKVVVTKGAVLGRP---TLSVQQTPEGSLLARWEPPA----GTAEDQVLGYRLQFGREDSTPLATLEFPPSEDRYTA--SGVHKGATYVFRLAARSRGGLGEEAAEVLSIPEDTPRGHPQI-LEAAGN-----ASAGTVLLRWLPPVPAERNGAIVKYTVAVREAGALGPARETELPAAAEPGAENA------------LTLQGLKPDTAYDLQVRA 990          

HSP 5 Score: 90.8929 bits (224), Expect = 2.520e-17
Identity = 125/573 (21.82%), Postives = 218/573 (38.05%), Query Frame = 1
Query:  889 LSDPSTLDIT-SYPISPNSLIIERFASDNVEISWRSGLNDVTEQENFILHYREVPENITEKQIMSKFVYLTISEKKSIYKYNLKDLFPFTTYCIWMESENPLGVSPPTIALTVKTLPTSPQLSPRSITATSISNTAILVAWRPP--ERKFGKFKYYQIIYT--NNDGFLPQHWRQFAVKDDNVMLTHLIASELYHIRVKIVNEIGHGPLSKTISIKTIAGTLSQCP-DFKITEIFQSHIKLQWGTPDPVKLFKLIQYNLLCWDVRLKIVNATAKSSTLFPILNHNLSMNEMEYVLY-LKNEKEIKCRLSAINSDGKGMPTEIQASTVNKGVNYQNLIHIDKIGSTYITFQWRPPSKFSFDYFLWIYQIFDSEKLDRAVKLPKIKINISDSASAENGWFVYNYTNAFSSSRYILGLRYLCRDSTDILREYVHRSDLVSTMKSVPSDSPKDL-VVKEIDSNSALVSWKPLDQVHSNGIITHY-----EVRYYAPKKE-ESTERFINVSETSAILSNLKY-FHYVIYVRAFTKVGGGSWSNPKNYYRQNLEEFPIPTTIKGERKSETEINISWELP 2562
            LSDP  +      P  P +L  E  +  ++ +SW         QE+ I +     E    +++   F   T         Y ++DL P T Y   + + +P G+   T  +  +TL + P   P+ +   S+ +TAILV+WRPP  E   G    Y + Y    ++   P+           ++L  L     Y I      E+G GP S  + ++T     S  P   +   +  + I++ W +P P +    I+   + + VR++   A        P +   +  +  E V+  L+ E      ++A    G G  ++ +       V  +  + + +     +  +W PP+  + D  L     F  E    +  L  ++   S+          Y  +     + Y+   R   R    +  E    ++++S  +  P   P+ L       + + L+ W P      NG I  Y     E     P +E E        +E +  L  LK    Y + VRA T+ G G +S P  Y R  L +   P   K +   +T + +SWE P
Sbjct:  499 LSDPIQVKTQQGVPGQPMNLRAEARSETSITLSWSP-----PRQESIIKYELLFREGDHGREVGRTFDPTT--------SYVVEDLKPNTEYAFRLAARSPQGLGAFTPVVRQRTLQSKPSAPPQDVKCVSVRSTAILVSWRPPPPETHNGALVGYSVRYRPLGSEDPEPKEVNGIPPTTTQILLEALEKWTQYRITTVAHTEVGPGPESSPVVVRTDEDVPSAPPRKVEAEALNATAIRVLWRSPAPGRQHGQIRGYQVHY-VRMEGAEARGP-----PRIKDVMLADAQEMVITNLQPETAYSITVAAYTMKGDGARSKPKVVVTKGAVLGRPTLSVQQTPEGSLLARWEPPAGTAEDQVLGYRLQFGRED---STPLATLEFPPSEDR--------YTASGVHKGATYVF--RLAARSRGGLGEEA---AEVLSIPEDTPRGHPQILEAAGNASAGTVLLRWLPPVPAERNGAIVKYTVAVREAGALGPARETELPAAAEPGAENALTLQGLKPDTAYDLQVRAHTRRGPGPFSPPVRY-RTFLRDQVSPKNFKVKMIMKTSVLLSWEFP 1035          
BLAST of Protein tyrosine phosphatase receptor type D vs. Ensembl Human
Match: PTPRS (protein tyrosine phosphatase receptor type S [Source:HGNC Symbol;Acc:HGNC:9681])

HSP 1 Score: 717.613 bits (1851), Expect = 0.000e+0
Identity = 341/635 (53.70%), Postives = 449/635 (70.71%), Query Frame = 1
Query: 3928 KSIPDLVNADS---VQMCQDGTKLSPVLVSDSIKLRIGSQKSENISDRPSISICNLYQYVTDLKANDCTLLQAEFETLNTNLDDRFTWQRSNIDSNKSKNRYANVVAYDHTSVLLTPVDDVIGSDYINANYIDGYQRQNAYIATQGPLPDTTDDFWRMVWEQRSNCIVMMTRLEERSGIKCHQYWPNRGFICYGQMIVSHIDTFVLAYYTIRLFEIRHSKYSEKREIQHFQFTAWPDHGVPKLSTPLLMFIRRVRSIGKIESCPKIVHCSAGVGRTGAFIVVDAQLERIKQEKNIDVFNYVSKIRCQRNYMVQTQAQYQFILETLLEAVEDGNTEVMACNFHAHVTKLSQIGISGSNQLSGFEMEFSKLNSLASNRGRHGVMLADFVKAAGNQAVNMTKNRVRNIIPYEWNRVVLNAIRGIEGSDYINASYIDGYRDRRAYIAAQSPIPSTVEDFWRMLWDQHCGVVIVLNQPHE---DKSHIYWPINKSIRYQFFVVDPVVEYNMPNYILREFKVTDARDGEFRALRQFQFTQWPNHGCPKESESILDFIRQVHKTKEQFGHMEPMVIHCNTGSGRTGVFIALSIVLDRLQQESVVDMYQTVKLLHKQRIGLVQTEEQYEFCYMAVLDYLSNYE 5814
            K+ PD    DS    +   +   L+P    D +++R  + ++  +   P I I ++ ++   LKAND   L  E+E+++     +FTW+ SN++ NK KNRYANV+AYDH+ V+L P++ ++GSDYINANY+DGY+ QNAYIATQGPLP+T  DFWRMVWEQRS  IVMMTRLEE+S IKC QYWPNRG   YG + V+ +DT  LA + +R F +  +  SEKRE++ FQFTAWPDHGVP+  TP L F+RRV++    ++ P +VHCSAGVGRTG FIV+DA LERIK EK +DV+ +V+ +R QRNYMVQT+ QY FI E LLEAV  GNTEV A + +A++ KL+Q  +     ++G E+EF +L +  ++  R       F+ A  N   N  KNR+ NI+PYE  RV L  IRG+EGSDYINAS+IDGYR ++AYIA Q P+  T EDFWRMLW+ +  +V++L +  E   +K H YWP  +S RYQ+FVVDP+ EYNMP YILREFKVTDARDG+ R +RQFQFT WP  G PK  E  +DFI QVHKTKEQFG   P+ +HC+ G GRTGVFI LSIVL+R++ E VVD++QTVK+L  QR  +VQTE++Y+FCY A L+YL +++
Sbjct:  880 KNKPDSKRKDSEPRTKCLLNNADLAPHHPKDPVEMRRINFQTPGMLSHPPIPIADMAEHTERLKANDSLKLSQEYESIDPG--QQFTWEHSNLEVNKPKNRYANVIAYDHSRVILQPIEGIMGSDYINANYVDGYRCQNAYIATQGPLPETFGDFWRMVWEQRSATIVMMTRLEEKSRIKCDQYWPNRGTETYGFIQVTLLDTIELATFCVRTFSLHKNGSSEKREVRQFQFTAWPDHGVPEYPTPFLAFLRRVKTCNPPDAGPIVVHCSAGVGRTGCFIVIDAMLERIKPEKTVDVYGHVTLMRSQRNYMVQTEDQYSFIHEALLEAVGCGNTEVPARSLYAYIQKLAQ--VEPGEHVTGMELEFKRLANSKAHTSR-------FISA--NLPCNKFKNRLVNIMPYESTRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWENNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDEYQFCYQAALEYLGSFD 1501          

HSP 2 Score: 204.527 bits (519), Expect = 4.292e-52
Identity = 105/262 (40.08%), Postives = 151/262 (57.63%), Query Frame = 1
Query: 5092 NQAVNMTKNRVRNIIPYEWNRVVLNAIRGIEGSDYINASYIDGYRDRRAYIAAQSPIPSTVEDFWRMLWDQHCGVVIVLNQPHEDKSHI----YWPINKSIRYQFFVVDPVVEYNMPNYILREFKVTDARDGEFRALRQFQFTQWPNHGCPKESESILDFIRQVHKTKEQFGHMEPMVIHCNTGSGRTGVFIALSIVLDRLQQESVVDMYQTVKLLHKQRIGLVQTEEQYEFCYMAVLDYLSNYEKILEKSHLY*TYQDLSE 5865
            N  VN  KNR  N+I Y+ +RV+L  I GI GSDYINA+Y+DGYR + AYIA Q P+P T  DFWRM+W+Q    ++++ +  E+KS I    YWP   +  Y F  V  +    +  + +R F +      E R +RQFQFT WP+HG P+     L F+R+V           P+V+HC+ G GRTG FI +  +L+R++ E  VD+Y  V L+  QR  +VQTE+QY F + A+L+ +      +    LY   Q L++
Sbjct:  969 NLEVNKPKNRYANVIAYDHSRVILQPIEGIMGSDYINANYVDGYRCQNAYIATQGPLPETFGDFWRMVWEQRSATIVMMTR-LEEKSRIKCDQYWPNRGTETYGFIQVTLLDTIELATFCVRTFSLHKNGSSEKREVRQFQFTAWPDHGVPEYPTPFLAFLRRVKTCNPP--DAGPIVVHCSAGVGRTGCFIVIDAMLERIKPEKTVDVYGHVTLMRSQRNYMVQTEDQYSFIHEALLEAVGCGNTEVPARSLYAYIQKLAQ 1227          

HSP 3 Score: 127.872 bits (320), Expect = 1.459e-28
Identity = 128/568 (22.54%), Postives = 241/568 (42.43%), Query Frame = 1
Query:  268 VLINSQITFTENDEAPK----ISLIIQSPNVLLFKSMILACSSTGHPVPSISWKINESPIEELKSPLKKLQNPPRIFSIKNYQNSVLVITQLIESDSNSVLICEAENNAGFDSRQQQLKVISTETDIPSGFPVFQNNFFPI---IKPYNSNVTLVCQAYGNPPPLIQWFKNYELINESFTKIKILNDGNLLLVQVTREDKGIYHCQAQNTNGLRLSDPSTLDITSYPISPNSLIIERFASDNVEISWRSGLNDVTEQENFILHYREVPENITEKQIMSKFVYLTISEKKSIYKYNLKDLFPFTTYCIWMESENPLGVSPPTIALTVKTLPTSPQLSPRSITATSISNTAILVAWRPPERKFGKFKYYQIIYTNNDGFLPQHWRQFAVKDDNVMLT--HLIASELYHIRVKIVNEIGHGPLSKTISIKTIAGTLSQCPDFKITEIFQSHIKLQWGTPDPVKLFKLIQYNLLCWDV-RLKIVNATAKSSTLFPILNHNLSMNEMEYVLYLKNEKEIKCRLSAINSDGKGMPTEIQASTVNKGVNYQNLIHIDKIGSTYITFQWRPPSKFS 1941
            + +++++T    D+ P     I +  Q   V   ++  + C+++G+P P I+W  +  P++   S  +          IK  ++  L I    E+D      C A N+AG          +    ++    P F  +  P+   I P   NV + C A G+P P ++W +      E  T    +  G  +L     +D   Y C A ++ G+ +   + + + S P +P + ++    + ++ I+W SG  D      +++ Y+            S+     I E  +  +Y++  L P + Y IW+ + N +G  PP+ ++  +T   +P  +PR++ A  +S T ++V W  P    G  + Y++ YT        +W++  V DD+++ T   L+  E Y +RV     +G GPLS  I +KT  G   Q  + +     ++ I L W  P   +   +I+Y LL  +    + V  T   +T + + +             LK   E   RL+A +  G G  T +      + ++ +N   +  I  T +   W  P  ++
Sbjct:  116 ITVHAKLTVLREDQLPSGFPNIDMGPQLKVVERTRTATMLCAASGNPDPEITWFKDFLPVDPSASNGR----------IKQLRSGALQIESSEETDQGKYE-CVATNSAGVRYSSPANLYVRELREVRRVAPRF--SILPMSHEIMP-GGNVNITCVAVGSPMPYVKWMQG----AEDLTPEDDMPVGRNVLELTDVKDSANYTCVAMSSLGV-IEAVAQITVKSLPKAPGTPMVTENTATSITITWDSGNPDPVSY--YVIEYKS----------KSQDGPYQIKEDITTTRYSIGGLSPNSEYEIWVSAVNSIGQGPPSESVVTRTGEQAPASAPRNVQARMLSATTMIVQWEEPVEPNGLIRGYRVYYTMEPEHPVGNWQKHNV-DDSLLTTVGSLLEDETYTVRVLAFTSVGDGPLSDPIQVKTQQGVPGQPMNLRAEARSETSITLSWSPP---RQESIIKYELLFREGDHGREVGRTFDPTTSYVVED-------------LKPNTEYAFRLAARSPQGLGAFTPVVRQRTLQSISPKNF-KVKMIMKTSVLLSWEFPDNYN 634          

HSP 4 Score: 109.383 bits (272), Expect = 5.614e-23
Identity = 166/687 (24.16%), Postives = 272/687 (39.59%), Query Frame = 1
Query:  370 LACSSTGHPVPSISW-----KINESPIEELKSPLKKLQNPPRIFSIKNYQNSVLVITQLIESDSNSVLICEAENNAGFDSRQQQLKVISTETDIPSGFPVFQNNFFPIIKPYNSNVTLVCQAYGNPPPLIQWFKNYELINESFT--KIKILNDGNLLLVQVTREDKGIYHCQAQNTNGLRLSDPSTLDITSY----PISPNSLII----ERFASDNVEIS------------WRSGLNDVTEQENFILHYREVPENITEKQIMSKFVYLTISEKKSIYKYNLKDLFPFTTYCIWMESENPLGVSPPTIALTVKTLPTSPQLSPRSITATSISNTAILVAWRPPERKFGKFKYYQIIYTNNDGFLPQHWRQFAVKDDNVMLTHLIAS----ELYHIRVKIVNEIGHGPLSKTISIKTIAGTLSQCP-DFKITEIFQSHIKLQWGTPDPVKLFKLIQYNLLCWDVRLKIVNATAKSSTLFPILN---HNLSMNEMEYVLYLKNEKEIKCRLSAINSDGKG-MPTEIQASTVNKGVNYQNL-IHIDKIGSTYITFQWRPPSKFSFDYFLWIYQIFDSEKLDRAVKLPKIKINISDSASAENGWFVYNYTNAFS-SSRYILGLRYLCRDSTDILREYVHRSDLVSTMKSVPSDSPKDLVVKEIDSNSALVSWKPLDQVHSNGIITHYEVRY 2316
              C +TG P P ++W     K+N    E ++                    +VL I  L      +V  C A+N+ G  +   +L V+  E  +PSGFP         +       T++C A GNP P I WFK++  ++ S +  +IK L  G L +      D+G Y C A N+ G+R S P+ L +        ++P   I+    E     NV I+            W  G  D+T +++       V  N+ E         LT          ++KD   +T  C+ M S   LGV      +TVK+LP +P     +   T  + T+I + W           YY I Y +     P     + +K+D     + I        Y I V  VN IG GP S+++  +T     +  P + +   +  + + +QW   +PV+   LI+   + + +  +            P+ N   HN+  + +  V  L  ++    R+ A  S G G +   IQ  T  +GV  Q + +  +    T IT  W PP + S   +  +++  D  +       P     + D           N   AF  ++R   GL       T ++R+         T++S+   SPK+  VK I   S L+SW+  D  +S    T Y+++Y
Sbjct:   52 FVCQATGDPKPRVTWNKKGKKVNSQRFETIE--------------FDESAGAVLRIQPLRTPRDENVYECVAQNSVGEITVHAKLTVLR-EDQLPSGFPNIDMGPQLKVVERTRTATMLCAASGNPDPEITWFKDFLPVDPSASNGRIKQLRSGALQIESSEETDQGKYECVATNSAGVRYSSPANLYVRELREVRRVAPRFSILPMSHEIMPGGNVNITCVAVGSPMPYVKWMQGAEDLTPEDDM-----PVGRNVLE---------LT----------DVKDSANYT--CVAMSS---LGVIEAVAQITVKSLPKAPG----TPMVTENTATSITITWD--SGNPDPVSYYVIEYKSKSQDGP-----YQIKEDITTTRYSIGGLSPNSEYEIWVSAVNSIGQGPPSESVVTRTGEQAPASAPRNVQARMLSATTMIVQWE--EPVEPNGLIRGYRVYYTMEPE-----------HPVGNWQKHNVDDSLLTTVGSLLEDETYTVRVLAFTSVGDGPLSDPIQVKT-QQGVPGQPMNLRAEARSETSITLSWSPPRQESIIKYELLFREGDHGREVGRTFDPTTSYVVED--------LKPNTEYAFRLAARSPQGLGAF----TPVVRQ--------RTLQSI---SPKNFKVKMIMKTSVLLSWEFPDNYNSP---TPYKIQY 643          

HSP 5 Score: 63.1586 bits (152), Expect = 6.538e-9
Identity = 67/265 (25.28%), Postives = 125/265 (47.17%), Query Frame = 1
Query: 2164 SDLVSTMKSVPSDSPKDLVVKEIDSNSALVSWKPLDQVHSNGIITHYEVRYYAPKKEESTERF----INVSETSAILSNLKYFHYVIYVRAFTKVGGGSWSNPKNYYRQNLEEFP-IPTTIKGERKSETEINISWELPVLSEKNLAHAAIEGFIILYAPVESSPKWIKYTVQSKNLSAVIKGLEPDLRYQFQIAATNYAGFNGNFSEIVQEM------PKNFPNLNLKTVPDLRCSVQSSNRLKVEWSSPSISTDLLKFEIRYSG 2925
            S +  T +  P+ +P+++  + + + + +V W+  + V  NG+I  Y V YY  + E     +    ++ S  + + S L+   Y + V AFT VG G  S+P     Q  +  P  P  ++ E +SET I +SW  P          +I  + +L+   +   + +  T      S V++ L+P+  Y F++AA +  G  G F+ +V++       PKNF    +K +  ++ SV  S      ++SP+       ++I+Y+G
Sbjct:  407 SVVTRTGEQAPASAPRNVQARMLSATTMIVQWE--EPVEPNGLIRGYRV-YYTMEPEHPVGNWQKHNVDDSLLTTVGSLLEDETYTVRVLAFTSVGDGPLSDPIQVKTQ--QGVPGQPMNLRAEARSETSITLSWSPP-------RQESIIKYELLFREGDHG-REVGRTFDPTT-SYVVEDLKPNTEYAFRLAARSPQGL-GAFTPVVRQRTLQSISPKNF---KVKMI--MKTSVLLSWEFPDNYNSPT------PYKIQYNG 645          
BLAST of Protein tyrosine phosphatase receptor type D vs. Ensembl Human
Match: PTPRS (protein tyrosine phosphatase receptor type S [Source:HGNC Symbol;Acc:HGNC:9681])

HSP 1 Score: 717.613 bits (1851), Expect = 0.000e+0
Identity = 341/635 (53.70%), Postives = 449/635 (70.71%), Query Frame = 1
Query: 3928 KSIPDLVNADS---VQMCQDGTKLSPVLVSDSIKLRIGSQKSENISDRPSISICNLYQYVTDLKANDCTLLQAEFETLNTNLDDRFTWQRSNIDSNKSKNRYANVVAYDHTSVLLTPVDDVIGSDYINANYIDGYQRQNAYIATQGPLPDTTDDFWRMVWEQRSNCIVMMTRLEERSGIKCHQYWPNRGFICYGQMIVSHIDTFVLAYYTIRLFEIRHSKYSEKREIQHFQFTAWPDHGVPKLSTPLLMFIRRVRSIGKIESCPKIVHCSAGVGRTGAFIVVDAQLERIKQEKNIDVFNYVSKIRCQRNYMVQTQAQYQFILETLLEAVEDGNTEVMACNFHAHVTKLSQIGISGSNQLSGFEMEFSKLNSLASNRGRHGVMLADFVKAAGNQAVNMTKNRVRNIIPYEWNRVVLNAIRGIEGSDYINASYIDGYRDRRAYIAAQSPIPSTVEDFWRMLWDQHCGVVIVLNQPHE---DKSHIYWPINKSIRYQFFVVDPVVEYNMPNYILREFKVTDARDGEFRALRQFQFTQWPNHGCPKESESILDFIRQVHKTKEQFGHMEPMVIHCNTGSGRTGVFIALSIVLDRLQQESVVDMYQTVKLLHKQRIGLVQTEEQYEFCYMAVLDYLSNYE 5814
            K+ PD    DS    +   +   L+P    D +++R  + ++  +   P I I ++ ++   LKAND   L  E+E+++     +FTW+ SN++ NK KNRYANV+AYDH+ V+L P++ ++GSDYINANY+DGY+ QNAYIATQGPLP+T  DFWRMVWEQRS  IVMMTRLEE+S IKC QYWPNRG   YG + V+ +DT  LA + +R F +  +  SEKRE++ FQFTAWPDHGVP+  TP L F+RRV++    ++ P +VHCSAGVGRTG FIV+DA LERIK EK +DV+ +V+ +R QRNYMVQT+ QY FI E LLEAV  GNTEV A + +A++ KL+Q  +     ++G E+EF +L +  ++  R       F+ A  N   N  KNR+ NI+PYE  RV L  IRG+EGSDYINAS+IDGYR ++AYIA Q P+  T EDFWRMLW+ +  +V++L +  E   +K H YWP  +S RYQ+FVVDP+ EYNMP YILREFKVTDARDG+ R +RQFQFT WP  G PK  E  +DFI QVHKTKEQFG   P+ +HC+ G GRTGVFI LSIVL+R++ E VVD++QTVK+L  QR  +VQTE++Y+FCY A L+YL +++
Sbjct:  876 KNKPDSKRKDSEPRTKCLLNNADLAPHHPKDPVEMRRINFQTPGMLSHPPIPIADMAEHTERLKANDSLKLSQEYESIDPG--QQFTWEHSNLEVNKPKNRYANVIAYDHSRVILQPIEGIMGSDYINANYVDGYRCQNAYIATQGPLPETFGDFWRMVWEQRSATIVMMTRLEEKSRIKCDQYWPNRGTETYGFIQVTLLDTIELATFCVRTFSLHKNGSSEKREVRQFQFTAWPDHGVPEYPTPFLAFLRRVKTCNPPDAGPIVVHCSAGVGRTGCFIVIDAMLERIKPEKTVDVYGHVTLMRSQRNYMVQTEDQYSFIHEALLEAVGCGNTEVPARSLYAYIQKLAQ--VEPGEHVTGMELEFKRLANSKAHTSR-------FISA--NLPCNKFKNRLVNIMPYESTRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWENNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDEYQFCYQAALEYLGSFD 1497          

HSP 2 Score: 204.912 bits (520), Expect = 4.060e-52
Identity = 105/262 (40.08%), Postives = 151/262 (57.63%), Query Frame = 1
Query: 5092 NQAVNMTKNRVRNIIPYEWNRVVLNAIRGIEGSDYINASYIDGYRDRRAYIAAQSPIPSTVEDFWRMLWDQHCGVVIVLNQPHEDKSHI----YWPINKSIRYQFFVVDPVVEYNMPNYILREFKVTDARDGEFRALRQFQFTQWPNHGCPKESESILDFIRQVHKTKEQFGHMEPMVIHCNTGSGRTGVFIALSIVLDRLQQESVVDMYQTVKLLHKQRIGLVQTEEQYEFCYMAVLDYLSNYEKILEKSHLY*TYQDLSE 5865
            N  VN  KNR  N+I Y+ +RV+L  I GI GSDYINA+Y+DGYR + AYIA Q P+P T  DFWRM+W+Q    ++++ +  E+KS I    YWP   +  Y F  V  +    +  + +R F +      E R +RQFQFT WP+HG P+     L F+R+V           P+V+HC+ G GRTG FI +  +L+R++ E  VD+Y  V L+  QR  +VQTE+QY F + A+L+ +      +    LY   Q L++
Sbjct:  965 NLEVNKPKNRYANVIAYDHSRVILQPIEGIMGSDYINANYVDGYRCQNAYIATQGPLPETFGDFWRMVWEQRSATIVMMTR-LEEKSRIKCDQYWPNRGTETYGFIQVTLLDTIELATFCVRTFSLHKNGSSEKREVRQFQFTAWPDHGVPEYPTPFLAFLRRVKTCNPP--DAGPIVVHCSAGVGRTGCFIVIDAMLERIKPEKTVDVYGHVTLMRSQRNYMVQTEDQYSFIHEALLEAVGCGNTEVPARSLYAYIQKLAQ 1223          

HSP 3 Score: 125.561 bits (314), Expect = 6.834e-28
Identity = 128/567 (22.57%), Postives = 238/567 (41.98%), Query Frame = 1
Query:  268 VLINSQITFTENDEAPK----ISLIIQSPNVLLFKSMILACSSTGHPVPSISWKINESPIEELKSPLKKLQNPPRIFSIKNYQNSVLVITQLIESDSNSVLICEAENNAGFDSRQQQLKVISTETDIP--SGFPVFQNNFFPIIKPYNSNVTLVCQAYGNPPPLIQWFKNYELINESFTKIKILNDGNLLLVQVTREDKGIYHCQAQNTNGLRLSDPSTLDITSYPISPNSLIIERFASDNVEISWRSGLNDVTEQENFILHYREVPENITEKQIMSKFVYLTISEKKSIYKYNLKDLFPFTTYCIWMESENPLGVSPPTIALTVKTLPTSPQLSPRSITATSISNTAILVAWRPPERKFGKFKYYQIIYTNNDGFLPQHWRQFAVKDDNVMLT--HLIASELYHIRVKIVNEIGHGPLSKTISIKTIAGTLSQCPDFKITEIFQSHIKLQWGTPDPVKLFKLIQYNLLCWDV-RLKIVNATAKSSTLFPILNHNLSMNEMEYVLYLKNEKEIKCRLSAINSDGKGMPTEIQASTVNKGVNYQNLIHIDKIGSTYITFQWRPPSKFS 1941
            + +++++T    D+ P     I +  Q   V   ++  + C+++G+P P I+W  +  P++   S  +          IK  ++  L I    E+D      C A N+AG          +      P  S  P+        I P   NV + C A G+P P ++W +      E  T    +  G  +L     +D   Y C A ++ G+ +   + + + S P +P + ++    + ++ I+W SG  D      +++ Y+            S+     I E  +  +Y++  L P + Y IW+ + N +G  PP+ ++  +T   +P  +PR++ A  +S T ++V W  P    G  + Y++ YT        +W++  V DD+++ T   L+  E Y +RV     +G GPLS  I +KT  G   Q  + +     ++ I L W  P   +   +I+Y LL  +    + V  T   +T + + +             LK   E   RL+A +  G G  T +      + ++ +N   +  I  T +   W  P  ++
Sbjct:  116 ITVHAKLTVLREDQLPSGFPNIDMGPQLKVVERTRTATMLCAASGNPDPEITWFKDFLPVDPSASNGR----------IKQLRSGALQIESSEETDQGKYE-CVATNSAGVRYSSPANLYVRVRRVAPRFSILPMSHE-----IMP-GGNVNITCVAVGSPMPYVKWMQG----AEDLTPEDDMPVGRNVLELTDVKDSANYTCVAMSSLGV-IEAVAQITVKSLPKAPGTPMVTENTATSITITWDSGNPDPVSY--YVIEYKS----------KSQDGPYQIKEDITTTRYSIGGLSPNSEYEIWVSAVNSIGQGPPSESVVTRTGEQAPASAPRNVQARMLSATTMIVQWEEPVEPNGLIRGYRVYYTMEPEHPVGNWQKHNV-DDSLLTTVGSLLEDETYTVRVLAFTSVGDGPLSDPIQVKTQQGVPGQPMNLRAEARSETSITLSWSPP---RQESIIKYELLFREGDHGREVGRTFDPTTSYVVED-------------LKPNTEYAFRLAARSPQGLGAFTPVVRQRTLQSISPKNF-KVKMIMKTSVLLSWEFPDNYN 630          

HSP 4 Score: 114.39 bits (285), Expect = 1.618e-24
Identity = 166/683 (24.30%), Postives = 272/683 (39.82%), Query Frame = 1
Query:  370 LACSSTGHPVPSISW-----KINESPIEELKSPLKKLQNPPRIFSIKNYQNSVLVITQLIESDSNSVLICEAENNAGFDSRQQQLKVISTETDIPSGFPVFQNNFFPIIKPYNSNVTLVCQAYGNPPPLIQWFKNYELINESFT--KIKILNDGNLLLVQVTREDKGIYHCQAQNTNGLRLSDPSTLDITSYPISPNSLII----ERFASDNVEIS------------WRSGLNDVTEQENFILHYREVPENITEKQIMSKFVYLTISEKKSIYKYNLKDLFPFTTYCIWMESENPLGVSPPTIALTVKTLPTSPQLSPRSITATSISNTAILVAWRPPERKFGKFKYYQIIYTNNDGFLPQHWRQFAVKDDNVMLTHLIAS----ELYHIRVKIVNEIGHGPLSKTISIKTIAGTLSQCP-DFKITEIFQSHIKLQWGTPDPVKLFKLIQYNLLCWDVRLKIVNATAKSSTLFPILN---HNLSMNEMEYVLYLKNEKEIKCRLSAINSDGKG-MPTEIQASTVNKGVNYQNL-IHIDKIGSTYITFQWRPPSKFSFDYFLWIYQIFDSEKLDRAVKLPKIKINISDSASAENGWFVYNYTNAFS-SSRYILGLRYLCRDSTDILREYVHRSDLVSTMKSVPSDSPKDLVVKEIDSNSALVSWKPLDQVHSNGIITHYEVRY 2316
              C +TG P P ++W     K+N    E ++                    +VL I  L      +V  C A+N+ G  +   +L V+  E  +PSGFP         +       T++C A GNP P I WFK++  ++ S +  +IK L  G L +      D+G Y C A N+ G+R S P+ L +    ++P   I+    E     NV I+            W  G  D+T +++       V  N+ E         LT          ++KD   +T  C+ M S   LGV      +TVK+LP +P     +   T  + T+I + W           YY I Y +     P     + +K+D     + I        Y I V  VN IG GP S+++  +T     +  P + +   +  + + +QW   +PV+   LI+   + + +  +            P+ N   HN+  + +  V  L  ++    R+ A  S G G +   IQ  T  +GV  Q + +  +    T IT  W PP + S   +  +++  D  +       P     + D           N   AF  ++R   GL       T ++R+         T++S+   SPK+  VK I   S L+SW+  D  +S    T Y+++Y
Sbjct:   52 FVCQATGDPKPRVTWNKKGKKVNSQRFETIE--------------FDESAGAVLRIQPLRTPRDENVYECVAQNSVGEITVHAKLTVLR-EDQLPSGFPNIDMGPQLKVVERTRTATMLCAASGNPDPEITWFKDFLPVDPSASNGRIKQLRSGALQIESSEETDQGKYECVATNSAGVRYSSPANLYVRVRRVAPRFSILPMSHEIMPGGNVNITCVAVGSPMPYVKWMQGAEDLTPEDDM-----PVGRNVLE---------LT----------DVKDSANYT--CVAMSS---LGVIEAVAQITVKSLPKAPG----TPMVTENTATSITITWD--SGNPDPVSYYVIEYKSKSQDGP-----YQIKEDITTTRYSIGGLSPNSEYEIWVSAVNSIGQGPPSESVVTRTGEQAPASAPRNVQARMLSATTMIVQWE--EPVEPNGLIRGYRVYYTMEPE-----------HPVGNWQKHNVDDSLLTTVGSLLEDETYTVRVLAFTSVGDGPLSDPIQVKT-QQGVPGQPMNLRAEARSETSITLSWSPPRQESIIKYELLFREGDHGREVGRTFDPTTSYVVED--------LKPNTEYAFRLAARSPQGLGAF----TPVVRQ--------RTLQSI---SPKNFKVKMIMKTSVLLSWEFPDNYNSP---TPYKIQY 639          

HSP 5 Score: 63.1586 bits (152), Expect = 6.318e-9
Identity = 67/265 (25.28%), Postives = 125/265 (47.17%), Query Frame = 1
Query: 2164 SDLVSTMKSVPSDSPKDLVVKEIDSNSALVSWKPLDQVHSNGIITHYEVRYYAPKKEESTERF----INVSETSAILSNLKYFHYVIYVRAFTKVGGGSWSNPKNYYRQNLEEFP-IPTTIKGERKSETEINISWELPVLSEKNLAHAAIEGFIILYAPVESSPKWIKYTVQSKNLSAVIKGLEPDLRYQFQIAATNYAGFNGNFSEIVQEM------PKNFPNLNLKTVPDLRCSVQSSNRLKVEWSSPSISTDLLKFEIRYSG 2925
            S +  T +  P+ +P+++  + + + + +V W+  + V  NG+I  Y V YY  + E     +    ++ S  + + S L+   Y + V AFT VG G  S+P     Q  +  P  P  ++ E +SET I +SW  P          +I  + +L+   +   + +  T      S V++ L+P+  Y F++AA +  G  G F+ +V++       PKNF    +K +  ++ SV  S      ++SP+       ++I+Y+G
Sbjct:  403 SVVTRTGEQAPASAPRNVQARMLSATTMIVQWE--EPVEPNGLIRGYRV-YYTMEPEHPVGNWQKHNVDDSLLTTVGSLLEDETYTVRVLAFTSVGDGPLSDPIQVKTQ--QGVPGQPMNLRAEARSETSITLSWSPP-------RQESIIKYELLFREGDHG-REVGRTFDPTT-SYVVEDLKPNTEYAFRLAARSPQGL-GAFTPVVRQRTLQSISPKNF---KVKMI--MKTSVLLSWEFPDNYNSPT------PYKIQYNG 641          
BLAST of Protein tyrosine phosphatase receptor type D vs. Ensembl Human
Match: PTPRS (protein tyrosine phosphatase receptor type S [Source:HGNC Symbol;Acc:HGNC:9681])

HSP 1 Score: 717.227 bits (1850), Expect = 0.000e+0
Identity = 336/612 (54.90%), Postives = 441/612 (72.06%), Query Frame = 1
Query: 3988 LSPVLVSDSIKLRIGSQKSENISDRPSISICNLYQYVTDLKANDCTLLQAEFETLNTNLDDRFTWQRSNIDSNKSKNRYANVVAYDHTSVLLTPVDDVIGSDYINANYIDGYQRQNAYIATQGPLPDTTDDFWRMVWEQRSNCIVMMTRLEERSGIKCHQYWPNRGFICYGQMIVSHIDTFVLAYYTIRLFEIRHSKYSEKREIQHFQFTAWPDHGVPKLSTPLLMFIRRVRSIGKIESCPKIVHCSAGVGRTGAFIVVDAQLERIKQEKNIDVFNYVSKIRCQRNYMVQTQAQYQFILETLLEAVEDGNTEVMACNFHAHVTKLSQIGISGSNQLSGFEMEFSKLNSLASNRGRHGVMLADFVKAAGNQAVNMTKNRVRNIIPYEWNRVVLNAIRGIEGSDYINASYIDGYRDRRAYIAAQSPIPSTVEDFWRMLWDQHCGVVIVLNQPHE---DKSHIYWPINKSIRYQFFVVDPVVEYNMPNYILREFKVTDARDGEFRALRQFQFTQWPNHGCPKESESILDFIRQVHKTKEQFGHMEPMVIHCNTGSGRTGVFIALSIVLDRLQQESVVDMYQTVKLLHKQRIGLVQTEEQYEFCYMAVLDYLSNYE 5814
            L+P    D +++R  + ++  +   P I I ++ ++   LKAND   L  E+E+++     +FTW+ SN++ NK KNRYANV+AYDH+ V+L P++ ++GSDYINANY+DGY+ QNAYIATQGPLP+T  DFWRMVWEQRS  IVMMTRLEE+S IKC QYWPNRG   YG + V+ +DT  LA + +R F +  +  SEKRE++ FQFTAWPDHGVP+  TP L F+RRV++    ++ P +VHCSAGVGRTG FIV+DA LERIK EK +DV+ +V+ +R QRNYMVQT+ QY FI E LLEAV  GNTEV A + +A++ KL+Q  +     ++G E+EF +L +  ++  R       F+ A  N   N  KNR+ NI+PYE  RV L  IRG+EGSDYINAS+IDGYR ++AYIA Q P+  T EDFWRMLW+ +  +V++L +  E   +K H YWP  +S RYQ+FVVDP+ EYNMP YILREFKVTDARDG+ R +RQFQFT WP  G PK  E  +DFI QVHKTKEQFG   P+ +HC+ G GRTGVFI LSIVL+R++ E VVD++QTVK+L  QR  +VQTE++Y+FCY A L+YL +++
Sbjct:  899 LAPHHPKDPVEMRRINFQTPGMLSHPPIPIADMAEHTERLKANDSLKLSQEYESIDPG--QQFTWEHSNLEVNKPKNRYANVIAYDHSRVILQPIEGIMGSDYINANYVDGYRCQNAYIATQGPLPETFGDFWRMVWEQRSATIVMMTRLEEKSRIKCDQYWPNRGTETYGFIQVTLLDTIELATFCVRTFSLHKNGSSEKREVRQFQFTAWPDHGVPEYPTPFLAFLRRVKTCNPPDAGPIVVHCSAGVGRTGCFIVIDAMLERIKPEKTVDVYGHVTLMRSQRNYMVQTEDQYSFIHEALLEAVGCGNTEVPARSLYAYIQKLAQ--VEPGEHVTGMELEFKRLANSKAHTSR-------FISA--NLPCNKFKNRLVNIMPYESTRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWENNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDEYQFCYQAALEYLGSFD 1497          

HSP 2 Score: 204.527 bits (519), Expect = 4.273e-52
Identity = 105/262 (40.08%), Postives = 151/262 (57.63%), Query Frame = 1
Query: 5092 NQAVNMTKNRVRNIIPYEWNRVVLNAIRGIEGSDYINASYIDGYRDRRAYIAAQSPIPSTVEDFWRMLWDQHCGVVIVLNQPHEDKSHI----YWPINKSIRYQFFVVDPVVEYNMPNYILREFKVTDARDGEFRALRQFQFTQWPNHGCPKESESILDFIRQVHKTKEQFGHMEPMVIHCNTGSGRTGVFIALSIVLDRLQQESVVDMYQTVKLLHKQRIGLVQTEEQYEFCYMAVLDYLSNYEKILEKSHLY*TYQDLSE 5865
            N  VN  KNR  N+I Y+ +RV+L  I GI GSDYINA+Y+DGYR + AYIA Q P+P T  DFWRM+W+Q    ++++ +  E+KS I    YWP   +  Y F  V  +    +  + +R F +      E R +RQFQFT WP+HG P+     L F+R+V           P+V+HC+ G GRTG FI +  +L+R++ E  VD+Y  V L+  QR  +VQTE+QY F + A+L+ +      +    LY   Q L++
Sbjct:  965 NLEVNKPKNRYANVIAYDHSRVILQPIEGIMGSDYINANYVDGYRCQNAYIATQGPLPETFGDFWRMVWEQRSATIVMMTR-LEEKSRIKCDQYWPNRGTETYGFIQVTLLDTIELATFCVRTFSLHKNGSSEKREVRQFQFTAWPDHGVPEYPTPFLAFLRRVKTCNPP--DAGPIVVHCSAGVGRTGCFIVIDAMLERIKPEKTVDVYGHVTLMRSQRNYMVQTEDQYSFIHEALLEAVGCGNTEVPARSLYAYIQKLAQ 1223          

HSP 3 Score: 125.561 bits (314), Expect = 7.563e-28
Identity = 128/567 (22.57%), Postives = 238/567 (41.98%), Query Frame = 1
Query:  268 VLINSQITFTENDEAPK----ISLIIQSPNVLLFKSMILACSSTGHPVPSISWKINESPIEELKSPLKKLQNPPRIFSIKNYQNSVLVITQLIESDSNSVLICEAENNAGFDSRQQQLKVISTETDIP--SGFPVFQNNFFPIIKPYNSNVTLVCQAYGNPPPLIQWFKNYELINESFTKIKILNDGNLLLVQVTREDKGIYHCQAQNTNGLRLSDPSTLDITSYPISPNSLIIERFASDNVEISWRSGLNDVTEQENFILHYREVPENITEKQIMSKFVYLTISEKKSIYKYNLKDLFPFTTYCIWMESENPLGVSPPTIALTVKTLPTSPQLSPRSITATSISNTAILVAWRPPERKFGKFKYYQIIYTNNDGFLPQHWRQFAVKDDNVMLT--HLIASELYHIRVKIVNEIGHGPLSKTISIKTIAGTLSQCPDFKITEIFQSHIKLQWGTPDPVKLFKLIQYNLLCWDV-RLKIVNATAKSSTLFPILNHNLSMNEMEYVLYLKNEKEIKCRLSAINSDGKGMPTEIQASTVNKGVNYQNLIHIDKIGSTYITFQWRPPSKFS 1941
            + +++++T    D+ P     I +  Q   V   ++  + C+++G+P P I+W  +  P++   S  +          IK  ++  L I    E+D      C A N+AG          +      P  S  P+        I P   NV + C A G+P P ++W +      E  T    +  G  +L     +D   Y C A ++ G+ +   + + + S P +P + ++    + ++ I+W SG  D      +++ Y+            S+     I E  +  +Y++  L P + Y IW+ + N +G  PP+ ++  +T   +P  +PR++ A  +S T ++V W  P    G  + Y++ YT        +W++  V DD+++ T   L+  E Y +RV     +G GPLS  I +KT  G   Q  + +     ++ I L W  P   +   +I+Y LL  +    + V  T   +T + + +             LK   E   RL+A +  G G  T +      + ++ +N   +  I  T +   W  P  ++
Sbjct:  116 ITVHAKLTVLREDQLPSGFPNIDMGPQLKVVERTRTATMLCAASGNPDPEITWFKDFLPVDPSASNGR----------IKQLRSGALQIESSEETDQGKYE-CVATNSAGVRYSSPANLYVRVRRVAPRFSILPMSHE-----IMP-GGNVNITCVAVGSPMPYVKWMQG----AEDLTPEDDMPVGRNVLELTDVKDSANYTCVAMSSLGV-IEAVAQITVKSLPKAPGTPMVTENTATSITITWDSGNPDPVSY--YVIEYKS----------KSQDGPYQIKEDITTTRYSIGGLSPNSEYEIWVSAVNSIGQGPPSESVVTRTGEQAPASAPRNVQARMLSATTMIVQWEEPVEPNGLIRGYRVYYTMEPEHPVGNWQKHNV-DDSLLTTVGSLLEDETYTVRVLAFTSVGDGPLSDPIQVKTQQGVPGQPMNLRAEARSETSITLSWSPP---RQESIIKYELLFREGDHGREVGRTFDPTTSYVVED-------------LKPNTEYAFRLAARSPQGLGAFTPVVRQRTLQSISPKNF-KVKMIMKTSVLLSWEFPDNYN 630          

HSP 4 Score: 114.39 bits (285), Expect = 1.775e-24
Identity = 166/683 (24.30%), Postives = 272/683 (39.82%), Query Frame = 1
Query:  370 LACSSTGHPVPSISW-----KINESPIEELKSPLKKLQNPPRIFSIKNYQNSVLVITQLIESDSNSVLICEAENNAGFDSRQQQLKVISTETDIPSGFPVFQNNFFPIIKPYNSNVTLVCQAYGNPPPLIQWFKNYELINESFT--KIKILNDGNLLLVQVTREDKGIYHCQAQNTNGLRLSDPSTLDITSYPISPNSLII----ERFASDNVEIS------------WRSGLNDVTEQENFILHYREVPENITEKQIMSKFVYLTISEKKSIYKYNLKDLFPFTTYCIWMESENPLGVSPPTIALTVKTLPTSPQLSPRSITATSISNTAILVAWRPPERKFGKFKYYQIIYTNNDGFLPQHWRQFAVKDDNVMLTHLIAS----ELYHIRVKIVNEIGHGPLSKTISIKTIAGTLSQCP-DFKITEIFQSHIKLQWGTPDPVKLFKLIQYNLLCWDVRLKIVNATAKSSTLFPILN---HNLSMNEMEYVLYLKNEKEIKCRLSAINSDGKG-MPTEIQASTVNKGVNYQNL-IHIDKIGSTYITFQWRPPSKFSFDYFLWIYQIFDSEKLDRAVKLPKIKINISDSASAENGWFVYNYTNAFS-SSRYILGLRYLCRDSTDILREYVHRSDLVSTMKSVPSDSPKDLVVKEIDSNSALVSWKPLDQVHSNGIITHYEVRY 2316
              C +TG P P ++W     K+N    E ++                    +VL I  L      +V  C A+N+ G  +   +L V+  E  +PSGFP         +       T++C A GNP P I WFK++  ++ S +  +IK L  G L +      D+G Y C A N+ G+R S P+ L +    ++P   I+    E     NV I+            W  G  D+T +++       V  N+ E         LT          ++KD   +T  C+ M S   LGV      +TVK+LP +P     +   T  + T+I + W           YY I Y +     P     + +K+D     + I        Y I V  VN IG GP S+++  +T     +  P + +   +  + + +QW   +PV+   LI+   + + +  +            P+ N   HN+  + +  V  L  ++    R+ A  S G G +   IQ  T  +GV  Q + +  +    T IT  W PP + S   +  +++  D  +       P     + D           N   AF  ++R   GL       T ++R+         T++S+   SPK+  VK I   S L+SW+  D  +S    T Y+++Y
Sbjct:   52 FVCQATGDPKPRVTWNKKGKKVNSQRFETIE--------------FDESAGAVLRIQPLRTPRDENVYECVAQNSVGEITVHAKLTVLR-EDQLPSGFPNIDMGPQLKVVERTRTATMLCAASGNPDPEITWFKDFLPVDPSASNGRIKQLRSGALQIESSEETDQGKYECVATNSAGVRYSSPANLYVRVRRVAPRFSILPMSHEIMPGGNVNITCVAVGSPMPYVKWMQGAEDLTPEDDM-----PVGRNVLE---------LT----------DVKDSANYT--CVAMSS---LGVIEAVAQITVKSLPKAPG----TPMVTENTATSITITWD--SGNPDPVSYYVIEYKSKSQDGP-----YQIKEDITTTRYSIGGLSPNSEYEIWVSAVNSIGQGPPSESVVTRTGEQAPASAPRNVQARMLSATTMIVQWE--EPVEPNGLIRGYRVYYTMEPE-----------HPVGNWQKHNVDDSLLTTVGSLLEDETYTVRVLAFTSVGDGPLSDPIQVKT-QQGVPGQPMNLRAEARSETSITLSWSPPRQESIIKYELLFREGDHGREVGRTFDPTTSYVVED--------LKPNTEYAFRLAARSPQGLGAF----TPVVRQ--------RTLQSI---SPKNFKVKMIMKTSVLLSWEFPDNYNSP---TPYKIQY 639          

HSP 5 Score: 63.1586 bits (152), Expect = 6.873e-9
Identity = 67/265 (25.28%), Postives = 125/265 (47.17%), Query Frame = 1
Query: 2164 SDLVSTMKSVPSDSPKDLVVKEIDSNSALVSWKPLDQVHSNGIITHYEVRYYAPKKEESTERF----INVSETSAILSNLKYFHYVIYVRAFTKVGGGSWSNPKNYYRQNLEEFP-IPTTIKGERKSETEINISWELPVLSEKNLAHAAIEGFIILYAPVESSPKWIKYTVQSKNLSAVIKGLEPDLRYQFQIAATNYAGFNGNFSEIVQEM------PKNFPNLNLKTVPDLRCSVQSSNRLKVEWSSPSISTDLLKFEIRYSG 2925
            S +  T +  P+ +P+++  + + + + +V W+  + V  NG+I  Y V YY  + E     +    ++ S  + + S L+   Y + V AFT VG G  S+P     Q  +  P  P  ++ E +SET I +SW  P          +I  + +L+   +   + +  T      S V++ L+P+  Y F++AA +  G  G F+ +V++       PKNF    +K +  ++ SV  S      ++SP+       ++I+Y+G
Sbjct:  403 SVVTRTGEQAPASAPRNVQARMLSATTMIVQWE--EPVEPNGLIRGYRV-YYTMEPEHPVGNWQKHNVDDSLLTTVGSLLEDETYTVRVLAFTSVGDGPLSDPIQVKTQ--QGVPGQPMNLRAEARSETSITLSWSPP-------RQESIIKYELLFREGDHG-REVGRTFDPTT-SYVVEDLKPNTEYAFRLAARSPQGL-GAFTPVVRQRTLQSISPKNF---KVKMI--MKTSVLLSWEFPDNYNSPT------PYKIQYNG 641          
BLAST of Protein tyrosine phosphatase receptor type D vs. Ensembl Human
Match: PTPRS (protein tyrosine phosphatase receptor type S [Source:HGNC Symbol;Acc:HGNC:9681])

HSP 1 Score: 717.227 bits (1850), Expect = 0.000e+0
Identity = 333/593 (56.16%), Postives = 432/593 (72.85%), Query Frame = 1
Query: 4045 ENISDRPSISICNLYQYVTDLKANDCTLLQAEFETLNTNLDDRFTWQRSNIDSNKSKNRYANVVAYDHTSVLLTPVDDVIGSDYINANYIDGYQRQNAYIATQGPLPDTTDDFWRMVWEQRSNCIVMMTRLEERSGIKCHQYWPNRGFICYGQMIVSHIDTFVLAYYTIRLFEIRHSKYSEKREIQHFQFTAWPDHGVPKLSTPLLMFIRRVRSIGKIESCPKIVHCSAGVGRTGAFIVVDAQLERIKQEKNIDVFNYVSKIRCQRNYMVQTQAQYQFILETLLEAVEDGNTEVMACNFHAHVTKLSQIGISGSNQLSGFEMEFSKLNSLASNRGRHGVMLADFVKAAGNQAVNMTKNRVRNIIPYEWNRVVLNAIRGIEGSDYINASYIDGYRDRRAYIAAQSPIPSTVEDFWRMLWDQHCGVVIVLNQPHE---DKSHIYWPINKSIRYQFFVVDPVVEYNMPNYILREFKVTDARDGEFRALRQFQFTQWPNHGCPKESESILDFIRQVHKTKEQFGHMEPMVIHCNTGSGRTGVFIALSIVLDRLQQESVVDMYQTVKLLHKQRIGLVQTEEQYEFCYMAVLDYLSNYE 5814
            E++   P I I ++ ++   LKAND   L  E+E+++     +FTW+ SN++ NK KNRYANV+AYDH+ V+L P++ ++GSDYINANY+DGY+ QNAYIATQGPLP+T  DFWRMVWEQRS  IVMMTRLEE+S IKC QYWPNRG   YG + V+ +DT  LA + +R F +  +  SEKRE++ FQFTAWPDHGVP+  TP L F+RRV++    ++ P +VHCSAGVGRTG FIV+DA LERIK EK +DV+ +V+ +R QRNYMVQT+ QY FI E LLEAV  GNTEV A + +A++ KL+Q  +     ++G E+EF +L +  ++  R       F+ A  N   N  KNR+ NI+PYE  RV L  IRG+EGSDYINAS+IDGYR ++AYIA Q P+  T EDFWRMLW+ +  +V++L +  E   +K H YWP  +S RYQ+FVVDP+ EYNMP YILREFKVTDARDG+ R +RQFQFT WP  G PK  E  +DFI QVHKTKEQFG   P+ +HC+ G GRTGVFI LSIVL+R++ E VVD++QTVK+L  QR  +VQTE++Y+FCY A L+YL +++
Sbjct: 1365 ESMLSHPPIPIADMAEHTERLKANDSLKLSQEYESIDPG--QQFTWEHSNLEVNKPKNRYANVIAYDHSRVILQPIEGIMGSDYINANYVDGYRCQNAYIATQGPLPETFGDFWRMVWEQRSATIVMMTRLEEKSRIKCDQYWPNRGTETYGFIQVTLLDTIELATFCVRTFSLHKNGSSEKREVRQFQFTAWPDHGVPEYPTPFLAFLRRVKTCNPPDAGPIVVHCSAGVGRTGCFIVIDAMLERIKPEKTVDVYGHVTLMRSQRNYMVQTEDQYSFIHEALLEAVGCGNTEVPARSLYAYIQKLAQ--VEPGEHVTGMELEFKRLANSKAHTSR-------FISA--NLPCNKFKNRLVNIMPYESTRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWENNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDEYQFCYQAALEYLGSFD 1944          

HSP 2 Score: 204.912 bits (520), Expect = 4.867e-52
Identity = 105/262 (40.08%), Postives = 151/262 (57.63%), Query Frame = 1
Query: 5092 NQAVNMTKNRVRNIIPYEWNRVVLNAIRGIEGSDYINASYIDGYRDRRAYIAAQSPIPSTVEDFWRMLWDQHCGVVIVLNQPHEDKSHI----YWPINKSIRYQFFVVDPVVEYNMPNYILREFKVTDARDGEFRALRQFQFTQWPNHGCPKESESILDFIRQVHKTKEQFGHMEPMVIHCNTGSGRTGVFIALSIVLDRLQQESVVDMYQTVKLLHKQRIGLVQTEEQYEFCYMAVLDYLSNYEKILEKSHLY*TYQDLSE 5865
            N  VN  KNR  N+I Y+ +RV+L  I GI GSDYINA+Y+DGYR + AYIA Q P+P T  DFWRM+W+Q    ++++ +  E+KS I    YWP   +  Y F  V  +    +  + +R F +      E R +RQFQFT WP+HG P+     L F+R+V           P+V+HC+ G GRTG FI +  +L+R++ E  VD+Y  V L+  QR  +VQTE+QY F + A+L+ +      +    LY   Q L++
Sbjct: 1412 NLEVNKPKNRYANVIAYDHSRVILQPIEGIMGSDYINANYVDGYRCQNAYIATQGPLPETFGDFWRMVWEQRSATIVMMTR-LEEKSRIKCDQYWPNRGTETYGFIQVTLLDTIELATFCVRTFSLHKNGSSEKREVRQFQFTAWPDHGVPEYPTPFLAFLRRVKTCNPP--DAGPIVVHCSAGVGRTGCFIVIDAMLERIKPEKTVDVYGHVTLMRSQRNYMVQTEDQYSFIHEALLEAVGCGNTEVPARSLYAYIQKLAQ 1670          

HSP 3 Score: 147.132 bits (370), Expect = 2.361e-34
Identity = 210/979 (21.45%), Postives = 393/979 (40.14%), Query Frame = 1
Query:  268 VLINSQITFTENDEAPK----ISLIIQSPNVLLFKSMILACSSTGHPVPSISWKINESPIEELKSPLKKLQNPPRIFSIKNYQNSVLVITQLIESDSNSVLICEAENNAGFDSRQQQLKVISTETDIPSGFPVFQNNFFPI---IKPYNSNVTLVCQAYGNPPPLIQWFKNYELINESFTKIKILNDGNLLLVQVTREDKGIYHCQAQNTNGLRLSDPSTLDITSYPISPNSLIIERFASDNVEISWRSGLNDVTEQENFILHYREVPENITEKQIMSKFVYLTISEKKSIYKYNLKDLFPFTTYCIWMESENPLGVSPPTIALTVKTLPTSPQLSPRSITATSISNTAILVAWRPPERKFGKFKYYQIIYTNNDGFLPQHWRQFAVKDDNVMLT--HLIASELYHIRVKIVNEIGHGPLSKTISIKTIAGTLSQCPDFKITEIFQSHIKLQWGTPDPVKLFKLIQYNLLCWDV-RLKIVNATAKSSTLFPILNHNLSMNEMEYVLYLKNEKEIKCRLSAINSDGKGMPTEI--QASTVNKGVNYQNLIHIDKIGSTYITFQWRPPSKFSFDYFLWIYQIFDSEKLDRAVKLPKIKINISDSAS-----AENGWFVYNYTNAFSSSRYILGLRYLCRDSTDILREYVHRSDLVSTMKSVPSDSPKDLVVKEIDSNSALVSWKPLDQVHSNGIITHYEVRYYAPKKEES--TERFINV------------SETSAILSNLK-YFHYVIYVRAFTKVGGGSWSNPKNYYRQN-LEEFPIPTTIKGERKSETEINISWELPVLSEKNLAHAAIEGFIILYAPVESSP-KWIKYTVQSKNLSAVIKGLEPDLRYQFQIAATNYAGFNGNFSEIV---QEMPKNFPNLNLKTVPDLRCSVQSSNRLKVEWSSPSIS---TDLLKF--EIRYSGNLSYITEIGLKKSEFIDMESKSVNFETLVNRYDVTLENLQSNALYKIAVRA 3078
            + +++++T    D+ P     I +  Q   V   ++  + C+++G+P P I+W  +  P++   S  +  Q     F     + + L I    E+D      C A N+AG          +    ++    P F  +  P+   I P   NV + C A G+P P ++W +      E  T    +  G  +L     +D   Y C A ++ G+ +   + + + S P +P + ++    + ++ I+W SG  D      +++ Y+            S+     I E  +  +Y++  L P + Y IW+ + N +G  PP+ ++  +T   +P  +PR++ A  +S T ++V W  P    G  + Y++ YT        +W++  V DD+++ T   L+  E Y +RV     +G GPLS  I +KT  G   Q  + +     ++ I L W  P   +   +I+Y LL  +    + V  T   +T + + +             LK   E   RL+A +  G G  T +  Q +  +K       +    + ST I   WRPP   + +  L  Y +     L      PK    I  + +     A   W  Y  T                   T++         +V T + VPS  P+ +  + +++ +  V W+       +G I  Y+V Y   +  E+    R  +V            +E   +++NL+    Y I V A+T  G G+ S PK    +  +   P   T+  ++  E  +   WE P       A   + G+ + +   +S+P   +++       +A   G+     Y F++AA +  G     +E++   ++ P+  P + L+   +      S+  + + W  P  +     ++K+   +R +G L    E  L  +     E+             +TL+ L+ +  Y + VRA
Sbjct:  116 ITVHAKLTVLREDQLPSGFPNIDMGPQLKVVERTRTATMLCAASGNPDPEITWFKDFLPVDPSASNGRIKQLRSETFESTPIRGA-LQIESSEETDQGKYE-CVATNSAGVRYSSPANLYVRELREVRRVAPRF--SILPMSHEIMP-GGNVNITCVAVGSPMPYVKWMQG----AEDLTPEDDMPVGRNVLELTDVKDSANYTCVAMSSLGV-IEAVAQITVKSLPKAPGTPMVTENTATSITITWDSGNPDPVSY--YVIEYKS----------KSQDGPYQIKEDITTTRYSIGGLSPNSEYEIWVSAVNSIGQGPPSESVVTRTGEQAPASAPRNVQARMLSATTMIVQWEEPVEPNGLIRGYRVYYTMEPEHPVGNWQKHNV-DDSLLTTVGSLLEDETYTVRVLAFTSVGDGPLSDPIQVKTQQGVPGQPMNLRAEARSETSITLSWSPP---RQESIIKYELLFREGDHGREVGRTFDPTTSYVVED-------------LKPNTEYAFRLAARSPQGLGAFTPVVRQRTLQSKPSAPPQDVKCVSVRSTAILVSWRPPPPETHNGALVGYSV-RYRPLGSEDPEPKEVNGIPPTTTQILLEALEKWTQYRITTV---------------AHTEVGPGPESSPVVVRTDEDVPSAPPRKVEAEALNATAIRVLWRSPAPGRQHGQIRGYQVHYVRMEGAEARGPPRIKDVMLADAQWETDDTAEYEMVITNLQPETAYSITVAAYTMKGDGARSKPKVVVTKGAVLGRP---TLSVQQTPEGSLLARWEPPA----GTAEDQVLGYRLQFGREDSTPLATLEFPPSEDRYTA--SGVHKGATYVFRLAARSRGGLGEEAAEVLSIPEDTPRGHPQI-LEAAGN-----ASAGTVLLRWLPPVPAERNGAIVKYTVAVREAGALGPARETELPAAAEPGAENA------------LTLQGLKPDTAYDLQVRA 1012          

HSP 4 Score: 142.124 bits (357), Expect = 6.659e-33
Identity = 224/973 (23.02%), Postives = 376/973 (38.64%), Query Frame = 1
Query:  370 LACSSTGHPVPSISW-----KINESPIEELKSPLKKLQNPPRIFSIKNYQNSVLVITQLIESDSNSVLICEAENNAGFDSRQQQLKVISTETDIPSGFPVFQNNFFPIIKPYNSNVTLVCQAYGNPPPLIQWFKNYELINESFT--KIKILND---------GNLLLVQVTREDKGIYHCQAQNTNGLRLSDPSTLDITSY----PISPNSLII----ERFASDNVEIS------------WRSGLNDVTEQENFILHYREVPENITEKQIMSKFVYLTISEKKSIYKYNLKDLFPFTTYCIWMESENPLGVSPPTIALTVKTLPTSPQLSPRSITATSISNTAILVAWRPPERKFGKFKYYQIIYTNNDGFLPQHWRQFAVKDDNVMLTHLIAS----ELYHIRVKIVNEIGHGPLSKTISIKTIAGTLSQCP-DFKITEIFQSHIKLQWGTPDPVKLFKLIQYNLLCWDVRLKIVNATAKSSTLFPILN---HNLSMNEMEYVLYLKNEKEIKCRLSAINSDGKG-MPTEIQASTVNKGVNYQNL-IHIDKIGSTYITFQWRPPSKFSFDYFLWIYQIFDSEKLDRAVKLPKIKINISDSASAENGWFVYNYTNAFS-SSRYILGLRYLCRDSTDILREYVHRSDLVSTMKSVPSDSPKDLVVKEIDSNSALVSWKPLDQVHSNGIITHYEVRYYAPKKEESTERFIN---VSETSAILSNL-KYFHYVIYVRAFTKVGGGSWSNPKNYYRQNLEEFP--IPTTIKGERKSETEINISWELPVLSEKNLAHAAIEGFIILYAPVESS----PKWIK---------YTVQSKNLSAVIKGLEPDLRYQFQIAATNYAGFNGNFSE----IVQEMPKNFPNLNLKTVPDLRCSVQSSNRLKVEWSSPSISTDLLKFEIRYSGNLSYITEIGLKKSEFIDMESKSVNFETLVNRYDVTLENLQSNALYKIAVRA 3078
              C +TG P P ++W     K+N    E ++                    +VL I  L      +V  C A+N+ G  +   +L V+  E  +PSGFP         +       T++C A GNP P I WFK++  ++ S +  +IK L           G L +      D+G Y C A N+ G+R S P+ L +        ++P   I+    E     NV I+            W  G  D+T +++       V  N+ E         LT          ++KD   +T  C+ M S   LGV      +TVK+LP +P     +   T  + T+I + W           YY I Y +     P     + +K+D     + I        Y I V  VN IG GP S+++  +T     +  P + +   +  + + +QW   +PV+   LI+   + + +  +            P+ N   HN+  + +  V  L  ++    R+ A  S G G +   IQ  T  +GV  Q + +  +    T IT  W PP + S   +  +++  D  +       P     + D           N   AF  ++R   GL       T ++R+         T++S PS  P+D+    + S + LVSW+P      NG +  Y VRY     E+   + +N    + T  +L  L K+  Y I   A T+VG G  S+P     +  E+ P   P  ++ E  + T I + W  P    +   H  I G+ + Y  +E +    P  IK          T  +     VI  L+P+  Y   +AA    G +G  S+    + +      P L+++  P+          L   W  P+ + +           L Y  + G + S  +     ++ F    +RY  +  +  +  ++++A R+
Sbjct:   52 FVCQATGDPKPRVTWNKKGKKVNSQRFETIE--------------FDESAGAVLRIQPLRTPRDENVYECVAQNSVGEITVHAKLTVLR-EDQLPSGFPNIDMGPQLKVVERTRTATMLCAASGNPDPEITWFKDFLPVDPSASNGRIKQLRSETFESTPIRGALQIESSEETDQGKYECVATNSAGVRYSSPANLYVRELREVRRVAPRFSILPMSHEIMPGGNVNITCVAVGSPMPYVKWMQGAEDLTPEDDM-----PVGRNVLE---------LT----------DVKDSANYT--CVAMSS---LGVIEAVAQITVKSLPKAPG----TPMVTENTATSITITWD--SGNPDPVSYYVIEYKSKSQDGP-----YQIKEDITTTRYSIGGLSPNSEYEIWVSAVNSIGQGPPSESVVTRTGEQAPASAPRNVQARMLSATTMIVQWE--EPVEPNGLIRGYRVYYTMEPE-----------HPVGNWQKHNVDDSLLTTVGSLLEDETYTVRVLAFTSVGDGPLSDPIQVKT-QQGVPGQPMNLRAEARSETSITLSWSPPRQESIIKYELLFREGDHGREVGRTFDPTTSYVVED--------LKPNTEYAFRLAARSPQGLGAF----TPVVRQ--------RTLQSKPSAPPQDVKCVSVRSTAILVSWRPPPPETHNGALVGYSVRYRPLGSEDPEPKEVNGIPPTTTQILLEALEKWTQYRITTVAHTEVGPGPESSP--VVVRTDEDVPSAPPRKVEAEALNATAIRVLWRSPAPGRQ---HGQIRGYQVHYVRMEGAEARGPPRIKDVMLADAQWETDDTAEYEMVITNLQPETAYSITVAAYTMKG-DGARSKPKVVVTKGAVLGRPTLSVQQTPE--------GSLLARWEPPAGTAE--------DQVLGYRLQFGREDSTPL----ATLEFPPSEDRYTASGVHKGATYVFRLAARS 909          
BLAST of Protein tyrosine phosphatase receptor type D vs. Ensembl Celegans
Match: ptp-3 (Tyrosine-protein phosphatase Lar-like [Source:UniProtKB/Swiss-Prot;Acc:Q9BMN8])

HSP 1 Score: 590.112 bits (1520), Expect = 0.000e+0
Identity = 275/587 (46.85%), Postives = 393/587 (66.95%), Query Frame = 1
Query: 4063 PSISICNLYQYVTDLKANDCTLLQAEFETLNTNLDDRFTWQRSNIDSNKSKNRYANVVAYDHTSVLLTPVDDVIGSDYINANYIDGYQRQNAYIATQGPLPDTTDDFWRMVWEQRSNCIVMMTRLEERSGIKCHQYWPNRGFICYGQMIVSHIDTFVLAYYTIRLFEIRHSKYSEKREIQHFQFTAWPDHGVPKLSTPLLMFIRRVRSIGKIESCPKIVHCSAGVGRTGAFIVVDAQLERIKQEKNIDVFNYVSKIRCQRNYMVQTQAQYQFILETLLEAVEDGNTEVMACNFHAHVTKLSQIGISGSNQLSGFEMEFSKLNSLASNRGRHGVMLADFVKAAGNQAVNMTKNRVRNIIPYEWNRVVLNAIRGIEGSDYINASYIDGYRDRRAYIAAQSPIPSTVEDFWRMLWDQHCGVVIVL---NQPHEDKSHIYWPINKSIRYQFFVVDPVVEYNMPNYILREFKVTDARDGEFRALRQFQFTQWPNHGCPKESESILDFIRQVHKTKEQFGHMEPMVIHCNTGSGRTGVFIALSIVLDRLQQESVVDMYQTVKLLHKQRIGLVQTEEQYEFCYMAVLDYLSNYE 5814
            P++ I  L  ++  L+ N+    Q+EFE++ T     FTW+ S+ D NK KNRYANV AYDH+ V+L+ V+   G DYINANY+DGY +  +YIATQGPLP+T  DFWRMVWE++S  IVM+T LEERS +KC QYWP+RG   YG + V+ +++  LA+YT+R   ++     E REI+H Q+TAWPDHGVP   TP L+F++RV+++   ++ P I HCSAG+GRTGAFIV+D  LER++ +  +D++  V+ +R QR+YMVQT+ QY FI + +L+AV  G+TEV A   H H+  LSQ     ++QLSG +MEF  L +L     R  V          N  VN  KNR+ + +PY+ NRV++  + G +GSDYINAS+IDGY++R AYIA Q+P   T  DFWR +W+ +  ++ +L   N+  +++   YWP+   ++    VV+P+ EY+M +Y LREF+++D    E R +RQF F +WP+ G P  ++  LDF+ QVH T  QFG   P+ +HC +G+GRT VFIALSI+LDR++ E VVD++ TVKLL  +R  ++Q  EQY F Y+A  +YL+ Y+
Sbjct:  892 PAVPIAELANHIERLRMNNNAGFQSEFESIETG--QHFTWEHSSADMNKHKNRYANVAAYDHSRVVLSNVEGYPGMDYINANYVDGYDKPRSYIATQGPLPETFSDFWRMVWEEQSVTIVMLTNLEERSRVKCDQYWPSRGTATYGDIEVTLLESVHLAHYTMRTMRLKMVGEPEVREIKHLQYTAWPDHGVPDHPTPFLIFLKRVKTLNPNDAGPIISHCSAGIGRTGAFIVIDCMLERLRYDNTVDIYGCVTALRAQRSYMVQTEEQYIFIHDAVLDAVNSGSTEVPASRLHQHLHILSQ---PSADQLSGIDMEFRHLTTLKWTSNRCTV---------ANLPVNRPKNRMLSAVPYDSNRVIMRLLPGADGSDYINASWIDGYKERGAYIATQAPTNETAADFWRAIWEHNSPIIAMLVRTNERGQEQCSDYWPLETGVQVGMLVVEPMAEYDMKHYHLREFRISDINTREVRTVRQFHFMEWPDVGKPHTADHFLDFVTQVHNTYAQFGCTGPITVHCCSGAGRTAVFIALSIILDRMRAEHVVDVFTTVKLLRTERQNMIQEPEQYHFLYLAAYEYLAAYD 1464          

HSP 2 Score: 186.422 bits (472), Expect = 6.946e-47
Identity = 102/300 (34.00%), Postives = 161/300 (53.67%), Query Frame = 1
Query: 4987 NQLSGFEMEFSKLNSLASNRGRHGVMLADFVKAAGNQAVNMTKNRVRNIIPYEWNRVVLNAIRGIEGSDYINASYIDGYRDRRAYIAAQSPIPSTVEDFWRMLWDQHCGVVIVLNQPHEDKSHI----YWPINKSIRYQFFVVDPVVEYNMPNYILREFKVTDARDGEFRALRQFQFTQWPNHGCPKESESILDFIRQVHKTKEQFGHMEPMVIHCNTGSGRTGVFIALSIVLDRLQQESVVDMYQTVKLLHKQRIGLVQTEEQYEFCYMAVLDYLSNYEKILEKSHLY*TYQDLSESSV 5874
            N  +GF+ EF  + +     G+H      F     +  +N  KNR  N+  Y+ +RVVL+ + G  G DYINA+Y+DGY   R+YIA Q P+P T  DFWRM+W++    +++L    E++S +    YWP   +  Y    V  +   ++ +Y +R  ++    + E R ++  Q+T WP+HG P      L F+++V           P++ HC+ G GRTG FI +  +L+RL+ ++ VD+Y  V  L  QR  +VQTEEQY F + AVLD +++    +  S L+     LS+ S 
Sbjct:  909 NNNAGFQSEFESIET-----GQH------FTWEHSSADMNKHKNRYANVAAYDHSRVVLSNVEGYPGMDYINANYVDGYDKPRSYIATQGPLPETFSDFWRMVWEEQSVTIVMLTN-LEERSRVKCDQYWPSRGTATYGDIEVTLLESVHLAHYTMRTMRLKMVGEPEVREIKHLQYTAWPDHGVPDHPTPFLIFLKRVKTLNPN--DAGPIISHCSAGIGRTGAFIVIDCMLERLRYDNTVDIYGCVTALRAQRSYMVQTEEQYIFIHDAVLDAVNSGSTEVPASRLHQHLHILSQPSA 1194          
BLAST of Protein tyrosine phosphatase receptor type D vs. Ensembl Celegans
Match: ptp-3 (Tyrosine-protein phosphatase Lar-like [Source:UniProtKB/Swiss-Prot;Acc:Q9BMN8])

HSP 1 Score: 588.571 bits (1516), Expect = 0.000e+0
Identity = 275/587 (46.85%), Postives = 393/587 (66.95%), Query Frame = 1
Query: 4063 PSISICNLYQYVTDLKANDCTLLQAEFETLNTNLDDRFTWQRSNIDSNKSKNRYANVVAYDHTSVLLTPVDDVIGSDYINANYIDGYQRQNAYIATQGPLPDTTDDFWRMVWEQRSNCIVMMTRLEERSGIKCHQYWPNRGFICYGQMIVSHIDTFVLAYYTIRLFEIRHSKYSEKREIQHFQFTAWPDHGVPKLSTPLLMFIRRVRSIGKIESCPKIVHCSAGVGRTGAFIVVDAQLERIKQEKNIDVFNYVSKIRCQRNYMVQTQAQYQFILETLLEAVEDGNTEVMACNFHAHVTKLSQIGISGSNQLSGFEMEFSKLNSLASNRGRHGVMLADFVKAAGNQAVNMTKNRVRNIIPYEWNRVVLNAIRGIEGSDYINASYIDGYRDRRAYIAAQSPIPSTVEDFWRMLWDQHCGVVIVL---NQPHEDKSHIYWPINKSIRYQFFVVDPVVEYNMPNYILREFKVTDARDGEFRALRQFQFTQWPNHGCPKESESILDFIRQVHKTKEQFGHMEPMVIHCNTGSGRTGVFIALSIVLDRLQQESVVDMYQTVKLLHKQRIGLVQTEEQYEFCYMAVLDYLSNYE 5814
            P++ I  L  ++  L+ N+    Q+EFE++ T     FTW+ S+ D NK KNRYANV AYDH+ V+L+ V+   G DYINANY+DGY +  +YIATQGPLP+T  DFWRMVWE++S  IVM+T LEERS +KC QYWP+RG   YG + V+ +++  LA+YT+R   ++     E REI+H Q+TAWPDHGVP   TP L+F++RV+++   ++ P I HCSAG+GRTGAFIV+D  LER++ +  +D++  V+ +R QR+YMVQT+ QY FI + +L+AV  G+TEV A   H H+  LSQ     ++QLSG +MEF  L +L     R  V          N  VN  KNR+ + +PY+ NRV++  + G +GSDYINAS+IDGY++R AYIA Q+P   T  DFWR +W+ +  ++ +L   N+  +++   YWP+   ++    VV+P+ EY+M +Y LREF+++D    E R +RQF F +WP+ G P  ++  LDF+ QVH T  QFG   P+ +HC +G+GRT VFIALSI+LDR++ E VVD++ TVKLL  +R  ++Q  EQY F Y+A  +YL+ Y+
Sbjct:  641 PAVPIAELANHIERLRMNNNAGFQSEFESIETG--QHFTWEHSSADMNKHKNRYANVAAYDHSRVVLSNVEGYPGMDYINANYVDGYDKPRSYIATQGPLPETFSDFWRMVWEEQSVTIVMLTNLEERSRVKCDQYWPSRGTATYGDIEVTLLESVHLAHYTMRTMRLKMVGEPEVREIKHLQYTAWPDHGVPDHPTPFLIFLKRVKTLNPNDAGPIISHCSAGIGRTGAFIVIDCMLERLRYDNTVDIYGCVTALRAQRSYMVQTEEQYIFIHDAVLDAVNSGSTEVPASRLHQHLHILSQ---PSADQLSGIDMEFRHLTTLKWTSNRCTV---------ANLPVNRPKNRMLSAVPYDSNRVIMRLLPGADGSDYINASWIDGYKERGAYIATQAPTNETAADFWRAIWEHNSPIIAMLVRTNERGQEQCSDYWPLETGVQVGMLVVEPMAEYDMKHYHLREFRISDINTREVRTVRQFHFMEWPDVGKPHTADHFLDFVTQVHNTYAQFGCTGPITVHCCSGAGRTAVFIALSIILDRMRAEHVVDVFTTVKLLRTERQNMIQEPEQYHFLYLAAYEYLAAYD 1213          

HSP 2 Score: 186.037 bits (471), Expect = 5.939e-47
Identity = 102/300 (34.00%), Postives = 161/300 (53.67%), Query Frame = 1
Query: 4987 NQLSGFEMEFSKLNSLASNRGRHGVMLADFVKAAGNQAVNMTKNRVRNIIPYEWNRVVLNAIRGIEGSDYINASYIDGYRDRRAYIAAQSPIPSTVEDFWRMLWDQHCGVVIVLNQPHEDKSHI----YWPINKSIRYQFFVVDPVVEYNMPNYILREFKVTDARDGEFRALRQFQFTQWPNHGCPKESESILDFIRQVHKTKEQFGHMEPMVIHCNTGSGRTGVFIALSIVLDRLQQESVVDMYQTVKLLHKQRIGLVQTEEQYEFCYMAVLDYLSNYEKILEKSHLY*TYQDLSESSV 5874
            N  +GF+ EF  + +     G+H      F     +  +N  KNR  N+  Y+ +RVVL+ + G  G DYINA+Y+DGY   R+YIA Q P+P T  DFWRM+W++    +++L    E++S +    YWP   +  Y    V  +   ++ +Y +R  ++    + E R ++  Q+T WP+HG P      L F+++V           P++ HC+ G GRTG FI +  +L+RL+ ++ VD+Y  V  L  QR  +VQTEEQY F + AVLD +++    +  S L+     LS+ S 
Sbjct:  658 NNNAGFQSEFESIET-----GQH------FTWEHSSADMNKHKNRYANVAAYDHSRVVLSNVEGYPGMDYINANYVDGYDKPRSYIATQGPLPETFSDFWRMVWEEQSVTIVMLTN-LEERSRVKCDQYWPSRGTATYGDIEVTLLESVHLAHYTMRTMRLKMVGEPEVREIKHLQYTAWPDHGVPDHPTPFLIFLKRVKTLNPN--DAGPIISHCSAGIGRTGAFIVIDCMLERLRYDNTVDIYGCVTALRAQRSYMVQTEEQYIFIHDAVLDAVNSGSTEVPASRLHQHLHILSQPSA 943          
BLAST of Protein tyrosine phosphatase receptor type D vs. Ensembl Celegans
Match: ptp-3 (Tyrosine-protein phosphatase Lar-like [Source:UniProtKB/Swiss-Prot;Acc:Q9BMN8])

HSP 1 Score: 588.186 bits (1515), Expect = 0.000e+0
Identity = 275/587 (46.85%), Postives = 393/587 (66.95%), Query Frame = 1
Query: 4063 PSISICNLYQYVTDLKANDCTLLQAEFETLNTNLDDRFTWQRSNIDSNKSKNRYANVVAYDHTSVLLTPVDDVIGSDYINANYIDGYQRQNAYIATQGPLPDTTDDFWRMVWEQRSNCIVMMTRLEERSGIKCHQYWPNRGFICYGQMIVSHIDTFVLAYYTIRLFEIRHSKYSEKREIQHFQFTAWPDHGVPKLSTPLLMFIRRVRSIGKIESCPKIVHCSAGVGRTGAFIVVDAQLERIKQEKNIDVFNYVSKIRCQRNYMVQTQAQYQFILETLLEAVEDGNTEVMACNFHAHVTKLSQIGISGSNQLSGFEMEFSKLNSLASNRGRHGVMLADFVKAAGNQAVNMTKNRVRNIIPYEWNRVVLNAIRGIEGSDYINASYIDGYRDRRAYIAAQSPIPSTVEDFWRMLWDQHCGVVIVL---NQPHEDKSHIYWPINKSIRYQFFVVDPVVEYNMPNYILREFKVTDARDGEFRALRQFQFTQWPNHGCPKESESILDFIRQVHKTKEQFGHMEPMVIHCNTGSGRTGVFIALSIVLDRLQQESVVDMYQTVKLLHKQRIGLVQTEEQYEFCYMAVLDYLSNYE 5814
            P++ I  L  ++  L+ N+    Q+EFE++ T     FTW+ S+ D NK KNRYANV AYDH+ V+L+ V+   G DYINANY+DGY +  +YIATQGPLP+T  DFWRMVWE++S  IVM+T LEERS +KC QYWP+RG   YG + V+ +++  LA+YT+R   ++     E REI+H Q+TAWPDHGVP   TP L+F++RV+++   ++ P I HCSAG+GRTGAFIV+D  LER++ +  +D++  V+ +R QR+YMVQT+ QY FI + +L+AV  G+TEV A   H H+  LSQ     ++QLSG +MEF  L +L     R  V          N  VN  KNR+ + +PY+ NRV++  + G +GSDYINAS+IDGY++R AYIA Q+P   T  DFWR +W+ +  ++ +L   N+  +++   YWP+   ++    VV+P+ EY+M +Y LREF+++D    E R +RQF F +WP+ G P  ++  LDF+ QVH T  QFG   P+ +HC +G+GRT VFIALSI+LDR++ E VVD++ TVKLL  +R  ++Q  EQY F Y+A  +YL+ Y+
Sbjct:  672 PAVPIAELANHIERLRMNNNAGFQSEFESIETG--QHFTWEHSSADMNKHKNRYANVAAYDHSRVVLSNVEGYPGMDYINANYVDGYDKPRSYIATQGPLPETFSDFWRMVWEEQSVTIVMLTNLEERSRVKCDQYWPSRGTATYGDIEVTLLESVHLAHYTMRTMRLKMVGEPEVREIKHLQYTAWPDHGVPDHPTPFLIFLKRVKTLNPNDAGPIISHCSAGIGRTGAFIVIDCMLERLRYDNTVDIYGCVTALRAQRSYMVQTEEQYIFIHDAVLDAVNSGSTEVPASRLHQHLHILSQ---PSADQLSGIDMEFRHLTTLKWTSNRCTV---------ANLPVNRPKNRMLSAVPYDSNRVIMRLLPGADGSDYINASWIDGYKERGAYIATQAPTNETAADFWRAIWEHNSPIIAMLVRTNERGQEQCSDYWPLETGVQVGMLVVEPMAEYDMKHYHLREFRISDINTREVRTVRQFHFMEWPDVGKPHTADHFLDFVTQVHNTYAQFGCTGPITVHCCSGAGRTAVFIALSIILDRMRAEHVVDVFTTVKLLRTERQNMIQEPEQYHFLYLAAYEYLAAYD 1244          

HSP 2 Score: 185.652 bits (470), Expect = 8.326e-47
Identity = 102/300 (34.00%), Postives = 161/300 (53.67%), Query Frame = 1
Query: 4987 NQLSGFEMEFSKLNSLASNRGRHGVMLADFVKAAGNQAVNMTKNRVRNIIPYEWNRVVLNAIRGIEGSDYINASYIDGYRDRRAYIAAQSPIPSTVEDFWRMLWDQHCGVVIVLNQPHEDKSHI----YWPINKSIRYQFFVVDPVVEYNMPNYILREFKVTDARDGEFRALRQFQFTQWPNHGCPKESESILDFIRQVHKTKEQFGHMEPMVIHCNTGSGRTGVFIALSIVLDRLQQESVVDMYQTVKLLHKQRIGLVQTEEQYEFCYMAVLDYLSNYEKILEKSHLY*TYQDLSESSV 5874
            N  +GF+ EF  + +     G+H      F     +  +N  KNR  N+  Y+ +RVVL+ + G  G DYINA+Y+DGY   R+YIA Q P+P T  DFWRM+W++    +++L    E++S +    YWP   +  Y    V  +   ++ +Y +R  ++    + E R ++  Q+T WP+HG P      L F+++V           P++ HC+ G GRTG FI +  +L+RL+ ++ VD+Y  V  L  QR  +VQTEEQY F + AVLD +++    +  S L+     LS+ S 
Sbjct:  689 NNNAGFQSEFESIET-----GQH------FTWEHSSADMNKHKNRYANVAAYDHSRVVLSNVEGYPGMDYINANYVDGYDKPRSYIATQGPLPETFSDFWRMVWEEQSVTIVMLTN-LEERSRVKCDQYWPSRGTATYGDIEVTLLESVHLAHYTMRTMRLKMVGEPEVREIKHLQYTAWPDHGVPDHPTPFLIFLKRVKTLNPN--DAGPIISHCSAGIGRTGAFIVIDCMLERLRYDNTVDIYGCVTALRAQRSYMVQTEEQYIFIHDAVLDAVNSGSTEVPASRLHQHLHILSQPSA 974          
BLAST of Protein tyrosine phosphatase receptor type D vs. Ensembl Celegans
Match: ptp-3 (Tyrosine-protein phosphatase Lar-like [Source:UniProtKB/Swiss-Prot;Acc:Q9BMN8])

HSP 1 Score: 587.8 bits (1514), Expect = 0.000e+0
Identity = 275/587 (46.85%), Postives = 393/587 (66.95%), Query Frame = 1
Query: 4063 PSISICNLYQYVTDLKANDCTLLQAEFETLNTNLDDRFTWQRSNIDSNKSKNRYANVVAYDHTSVLLTPVDDVIGSDYINANYIDGYQRQNAYIATQGPLPDTTDDFWRMVWEQRSNCIVMMTRLEERSGIKCHQYWPNRGFICYGQMIVSHIDTFVLAYYTIRLFEIRHSKYSEKREIQHFQFTAWPDHGVPKLSTPLLMFIRRVRSIGKIESCPKIVHCSAGVGRTGAFIVVDAQLERIKQEKNIDVFNYVSKIRCQRNYMVQTQAQYQFILETLLEAVEDGNTEVMACNFHAHVTKLSQIGISGSNQLSGFEMEFSKLNSLASNRGRHGVMLADFVKAAGNQAVNMTKNRVRNIIPYEWNRVVLNAIRGIEGSDYINASYIDGYRDRRAYIAAQSPIPSTVEDFWRMLWDQHCGVVIVL---NQPHEDKSHIYWPINKSIRYQFFVVDPVVEYNMPNYILREFKVTDARDGEFRALRQFQFTQWPNHGCPKESESILDFIRQVHKTKEQFGHMEPMVIHCNTGSGRTGVFIALSIVLDRLQQESVVDMYQTVKLLHKQRIGLVQTEEQYEFCYMAVLDYLSNYE 5814
            P++ I  L  ++  L+ N+    Q+EFE++ T     FTW+ S+ D NK KNRYANV AYDH+ V+L+ V+   G DYINANY+DGY +  +YIATQGPLP+T  DFWRMVWE++S  IVM+T LEERS +KC QYWP+RG   YG + V+ +++  LA+YT+R   ++     E REI+H Q+TAWPDHGVP   TP L+F++RV+++   ++ P I HCSAG+GRTGAFIV+D  LER++ +  +D++  V+ +R QR+YMVQT+ QY FI + +L+AV  G+TEV A   H H+  LSQ     ++QLSG +MEF  L +L     R  V          N  VN  KNR+ + +PY+ NRV++  + G +GSDYINAS+IDGY++R AYIA Q+P   T  DFWR +W+ +  ++ +L   N+  +++   YWP+   ++    VV+P+ EY+M +Y LREF+++D    E R +RQF F +WP+ G P  ++  LDF+ QVH T  QFG   P+ +HC +G+GRT VFIALSI+LDR++ E VVD++ TVKLL  +R  ++Q  EQY F Y+A  +YL+ Y+
Sbjct:  508 PAVPIAELANHIERLRMNNNAGFQSEFESIETG--QHFTWEHSSADMNKHKNRYANVAAYDHSRVVLSNVEGYPGMDYINANYVDGYDKPRSYIATQGPLPETFSDFWRMVWEEQSVTIVMLTNLEERSRVKCDQYWPSRGTATYGDIEVTLLESVHLAHYTMRTMRLKMVGEPEVREIKHLQYTAWPDHGVPDHPTPFLIFLKRVKTLNPNDAGPIISHCSAGIGRTGAFIVIDCMLERLRYDNTVDIYGCVTALRAQRSYMVQTEEQYIFIHDAVLDAVNSGSTEVPASRLHQHLHILSQ---PSADQLSGIDMEFRHLTTLKWTSNRCTV---------ANLPVNRPKNRMLSAVPYDSNRVIMRLLPGADGSDYINASWIDGYKERGAYIATQAPTNETAADFWRAIWEHNSPIIAMLVRTNERGQEQCSDYWPLETGVQVGMLVVEPMAEYDMKHYHLREFRISDINTREVRTVRQFHFMEWPDVGKPHTADHFLDFVTQVHNTYAQFGCTGPITVHCCSGAGRTAVFIALSIILDRMRAEHVVDVFTTVKLLRTERQNMIQEPEQYHFLYLAAYEYLAAYD 1080          

HSP 2 Score: 185.652 bits (470), Expect = 5.948e-47
Identity = 102/300 (34.00%), Postives = 161/300 (53.67%), Query Frame = 1
Query: 4987 NQLSGFEMEFSKLNSLASNRGRHGVMLADFVKAAGNQAVNMTKNRVRNIIPYEWNRVVLNAIRGIEGSDYINASYIDGYRDRRAYIAAQSPIPSTVEDFWRMLWDQHCGVVIVLNQPHEDKSHI----YWPINKSIRYQFFVVDPVVEYNMPNYILREFKVTDARDGEFRALRQFQFTQWPNHGCPKESESILDFIRQVHKTKEQFGHMEPMVIHCNTGSGRTGVFIALSIVLDRLQQESVVDMYQTVKLLHKQRIGLVQTEEQYEFCYMAVLDYLSNYEKILEKSHLY*TYQDLSESSV 5874
            N  +GF+ EF  + +     G+H      F     +  +N  KNR  N+  Y+ +RVVL+ + G  G DYINA+Y+DGY   R+YIA Q P+P T  DFWRM+W++    +++L    E++S +    YWP   +  Y    V  +   ++ +Y +R  ++    + E R ++  Q+T WP+HG P      L F+++V           P++ HC+ G GRTG FI +  +L+RL+ ++ VD+Y  V  L  QR  +VQTEEQY F + AVLD +++    +  S L+     LS+ S 
Sbjct:  525 NNNAGFQSEFESIET-----GQH------FTWEHSSADMNKHKNRYANVAAYDHSRVVLSNVEGYPGMDYINANYVDGYDKPRSYIATQGPLPETFSDFWRMVWEEQSVTIVMLTN-LEERSRVKCDQYWPSRGTATYGDIEVTLLESVHLAHYTMRTMRLKMVGEPEVREIKHLQYTAWPDHGVPDHPTPFLIFLKRVKTLNPN--DAGPIISHCSAGIGRTGAFIVIDCMLERLRYDNTVDIYGCVTALRAQRSYMVQTEEQYIFIHDAVLDAVNSGSTEVPASRLHQHLHILSQPSA 810          
BLAST of Protein tyrosine phosphatase receptor type D vs. Ensembl Celegans
Match: ptp-3 (Tyrosine-protein phosphatase Lar-like [Source:UniProtKB/Swiss-Prot;Acc:Q9BMN8])

HSP 1 Score: 590.112 bits (1520), Expect = 1.100e-180
Identity = 275/587 (46.85%), Postives = 393/587 (66.95%), Query Frame = 1
Query: 4063 PSISICNLYQYVTDLKANDCTLLQAEFETLNTNLDDRFTWQRSNIDSNKSKNRYANVVAYDHTSVLLTPVDDVIGSDYINANYIDGYQRQNAYIATQGPLPDTTDDFWRMVWEQRSNCIVMMTRLEERSGIKCHQYWPNRGFICYGQMIVSHIDTFVLAYYTIRLFEIRHSKYSEKREIQHFQFTAWPDHGVPKLSTPLLMFIRRVRSIGKIESCPKIVHCSAGVGRTGAFIVVDAQLERIKQEKNIDVFNYVSKIRCQRNYMVQTQAQYQFILETLLEAVEDGNTEVMACNFHAHVTKLSQIGISGSNQLSGFEMEFSKLNSLASNRGRHGVMLADFVKAAGNQAVNMTKNRVRNIIPYEWNRVVLNAIRGIEGSDYINASYIDGYRDRRAYIAAQSPIPSTVEDFWRMLWDQHCGVVIVL---NQPHEDKSHIYWPINKSIRYQFFVVDPVVEYNMPNYILREFKVTDARDGEFRALRQFQFTQWPNHGCPKESESILDFIRQVHKTKEQFGHMEPMVIHCNTGSGRTGVFIALSIVLDRLQQESVVDMYQTVKLLHKQRIGLVQTEEQYEFCYMAVLDYLSNYE 5814
            P++ I  L  ++  L+ N+    Q+EFE++ T     FTW+ S+ D NK KNRYANV AYDH+ V+L+ V+   G DYINANY+DGY +  +YIATQGPLP+T  DFWRMVWE++S  IVM+T LEERS +KC QYWP+RG   YG + V+ +++  LA+YT+R   ++     E REI+H Q+TAWPDHGVP   TP L+F++RV+++   ++ P I HCSAG+GRTGAFIV+D  LER++ +  +D++  V+ +R QR+YMVQT+ QY FI + +L+AV  G+TEV A   H H+  LSQ     ++QLSG +MEF  L +L     R  V          N  VN  KNR+ + +PY+ NRV++  + G +GSDYINAS+IDGY++R AYIA Q+P   T  DFWR +W+ +  ++ +L   N+  +++   YWP+   ++    VV+P+ EY+M +Y LREF+++D    E R +RQF F +WP+ G P  ++  LDF+ QVH T  QFG   P+ +HC +G+GRT VFIALSI+LDR++ E VVD++ TVKLL  +R  ++Q  EQY F Y+A  +YL+ Y+
Sbjct:  912 PAVPIAELANHIERLRMNNNAGFQSEFESIETG--QHFTWEHSSADMNKHKNRYANVAAYDHSRVVLSNVEGYPGMDYINANYVDGYDKPRSYIATQGPLPETFSDFWRMVWEEQSVTIVMLTNLEERSRVKCDQYWPSRGTATYGDIEVTLLESVHLAHYTMRTMRLKMVGEPEVREIKHLQYTAWPDHGVPDHPTPFLIFLKRVKTLNPNDAGPIISHCSAGIGRTGAFIVIDCMLERLRYDNTVDIYGCVTALRAQRSYMVQTEEQYIFIHDAVLDAVNSGSTEVPASRLHQHLHILSQ---PSADQLSGIDMEFRHLTTLKWTSNRCTV---------ANLPVNRPKNRMLSAVPYDSNRVIMRLLPGADGSDYINASWIDGYKERGAYIATQAPTNETAADFWRAIWEHNSPIIAMLVRTNERGQEQCSDYWPLETGVQVGMLVVEPMAEYDMKHYHLREFRISDINTREVRTVRQFHFMEWPDVGKPHTADHFLDFVTQVHNTYAQFGCTGPITVHCCSGAGRTAVFIALSIILDRMRAEHVVDVFTTVKLLRTERQNMIQEPEQYHFLYLAAYEYLAAYD 1484          

HSP 2 Score: 186.422 bits (472), Expect = 6.724e-47
Identity = 102/300 (34.00%), Postives = 161/300 (53.67%), Query Frame = 1
Query: 4987 NQLSGFEMEFSKLNSLASNRGRHGVMLADFVKAAGNQAVNMTKNRVRNIIPYEWNRVVLNAIRGIEGSDYINASYIDGYRDRRAYIAAQSPIPSTVEDFWRMLWDQHCGVVIVLNQPHEDKSHI----YWPINKSIRYQFFVVDPVVEYNMPNYILREFKVTDARDGEFRALRQFQFTQWPNHGCPKESESILDFIRQVHKTKEQFGHMEPMVIHCNTGSGRTGVFIALSIVLDRLQQESVVDMYQTVKLLHKQRIGLVQTEEQYEFCYMAVLDYLSNYEKILEKSHLY*TYQDLSESSV 5874
            N  +GF+ EF  + +     G+H      F     +  +N  KNR  N+  Y+ +RVVL+ + G  G DYINA+Y+DGY   R+YIA Q P+P T  DFWRM+W++    +++L    E++S +    YWP   +  Y    V  +   ++ +Y +R  ++    + E R ++  Q+T WP+HG P      L F+++V           P++ HC+ G GRTG FI +  +L+RL+ ++ VD+Y  V  L  QR  +VQTEEQY F + AVLD +++    +  S L+     LS+ S 
Sbjct:  929 NNNAGFQSEFESIET-----GQH------FTWEHSSADMNKHKNRYANVAAYDHSRVVLSNVEGYPGMDYINANYVDGYDKPRSYIATQGPLPETFSDFWRMVWEEQSVTIVMLTN-LEERSRVKCDQYWPSRGTATYGDIEVTLLESVHLAHYTMRTMRLKMVGEPEVREIKHLQYTAWPDHGVPDHPTPFLIFLKRVKTLNPN--DAGPIISHCSAGIGRTGAFIVIDCMLERLRYDNTVDIYGCVTALRAQRSYMVQTEEQYIFIHDAVLDAVNSGSTEVPASRLHQHLHILSQPSA 1214          
BLAST of Protein tyrosine phosphatase receptor type D vs. Ensembl Fly
Match: Lar (gene:FBgn0000464 transcript:FBtr0112800)

HSP 1 Score: 666.381 bits (1718), Expect = 0.000e+0
Identity = 324/630 (51.43%), Postives = 424/630 (67.30%), Query Frame = 1
Query: 3937 PDLVNADSVQMCQD-GTKLSPVLVSDSIKLRIGSQKSENISDRPSISICNLYQYVTDLKANDCTLLQAEFETLNTNLDDRFTWQRSNIDSNKSKNRYANVVAYDHTSVLLTPVDDVIGSDYINANYIDGYQRQNAYIATQGPLPDTTDDFWRMVWEQRSNCIVMMTRLEERSGIKCHQYWPNRGFICYGQMIVSHIDTFVLAYYTIRLFEIRHSKYSEKREIQHFQFTAWPDHGVPKLSTPLLMFIRRVRSIGKIESCPKIVHCSAGVGRTGAFIVVDAQLERIKQEKNIDVFNYVSKIRCQRNYMVQTQAQYQFILETLLEAVEDGNTEVMACNFHAHVTKLSQIGISGSNQLSGFEMEFSKLNSLASNRGRHGVMLADFVKAAGNQAVNMTKNRVRNIIPYEWNRVVLNAIRGIEGSDYINASYIDGYRDRRAYIAAQSPIPSTVEDFWRMLWDQHCGVVIVLNQPHE---DKSHIYWPINKSIRYQFFVVDPVVEYNMPNYILREFKVTDARDGEFRALRQFQFTQWPNHGCPKESESILDFIRQVHKTKEQFGHMEPMVIHCNTGSGRTGVFIALSIVLDRLQQESVVDMYQTVKLLHKQRIGLVQTEEQYEFCYMAVLDYLSNYE 5814
            PD        M  D G   +P   SD + +R  + ++  +   P I I     ++  LK+ND      E+E++      +FTW  SN++ NKSKNRYANV AYDH+ V L  V+ V+GSDYINANY DGY++ NAY+ATQGPL +T  DFWRM WE ++  IVMMTRLEER+ IKC QYWP RG   YGQ+ V+  +T  LA Y+IR F++    ++++REI+  QFTAWPDHGVP    P L F+RR R++   ES P IVHCSAGVGRTG +IV+D+ LER+K EK ID++ +V+ +R QRNYMVQT+ QY FI + +LEA+  G TEV A N H H+ KL  +       +SG E+EF KL+++  +  +       FV A  N   N  KNR+ +I+PYE +RV L  I GIEGSDY+NAS+IDGYR R AYIAAQ P+    EDFWRMLW+ +  +V++L +  E   +K   YWP  +S+RYQ++VVDP+ EYNMP Y LREFKVTDARDG  R +RQFQF  WP  G PK  E  +DFI QVHKTKEQFG   P+ +HC+ G GR+GVFI LSIVL+R+Q E V+D++QTV++L  QR  +VQTE+QY FCY A L+YL +++
Sbjct: 1394 PDQAAVTRPLMAADLGAGPTP---SDPVDMRRLNFQTPGMISHPPIPISEFANHIERLKSNDNQKFSQEYESIEPG--QQFTWDNSNLEHNKSKNRYANVTAYDHSRVQLPAVEGVVGSDYINANYCDGYRKHNAYVATQGPLQETFVDFWRMCWELKTATIVMMTRLEERTRIKCDQYWPTRGTETYGQIFVTITETQELATYSIRTFQLCRQGFNDRREIKQLQFTAWPDHGVPDHPAPFLQFLRRCRALTPPESGPVIVHCSAGVGRTGCYIVIDSMLERMKHEKIIDIYGHVTCLRAQRNYMVQTEDQYIFIHDAILEAIICGVTEVPARNLHTHLQKL--LITEPGETISGMEVEFKKLSNVKMDSSK-------FVTA--NLPCNKHKNRLVHILPYESSRVYLTPIHGIEGSDYVNASFIDGYRYRSAYIAAQGPVQDAAEDFWRMLWEHNSTIVVMLTKLKEMGREKCFQYWPHERSVRYQYYVVDPIAEYNMPQYKLREFKVTDARDGSSRTVRQFQFIDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQDGPITVHCSAGVGRSGVFITLSIVLERMQYEGVLDVFQTVRILRSQRPAMVQTEDQYHFCYRAALEYLGSFD 2007          

HSP 2 Score: 166.392 bits (420), Expect = 1.238e-40
Identity = 212/944 (22.46%), Postives = 391/944 (41.42%), Query Frame = 1
Query:  256 ITQLVLINSQITFTENDEAPK-ISLIIQSPNVLLFK---SMILACSSTGHPVPSISWKINESPIEELKSPLKKLQNPPRIFSIKNYQNSVLVITQLIESDSNSVLICEAENNAGFD-SRQQQLKVISTETDIPSGFPVFQNNFFPIIKPYNSNVTLVCQAYGNPPPLIQWFKNYELINESFTKIKILNDGNLLLVQVTREDKGIYHCQAQNTNGLRLSDPSTLDITSYPISPNSLIIERFASDNVEISWR-SGLNDVTEQENFILHYREVPENITEKQIMSKFVYLTISEKKSIYKYNLKDLFPFTTYCIWMESENPLGVSPPTIALTVKTLPTSPQLSPRSITATSISNTAILVAWRPPERKFGKFKYYQIIYTNNDGFLPQHWRQFAVKDDNV-MLTHLIASELYHIRVKIVNEIGHGPLSKTISIKTIAGTLSQCPDFKITEIFQSHIKLQWGTPDPVKLFKLIQYNLLCWDVRLKIVNATAKSSTLFPILNHNLSMNEMEYVLYLKNEKEIKCRLSAINSDGKGM---PTEIQASTVNKGVNYQNLIHIDKIGSTYITFQWRPPSKFSFDYFLWIYQIFDSEKLDRAVKLPKIKINISDSASAE-NGWFVYNYTNAFSSSRYILGLRYLCRDSTDILREYVHRSDLVSTMKSVPSDSPKDLVVKEIDSNSALVSWKPLDQVHSNGIITHYEVRYYAPKKEESTERFINVSETSAILSNLKY--------FHYVIYVRAFTKVGGGSWSNPKNYYRQNLEEFPIPTTIK---GERKSETEINISWELPVLSEKNLAHAAIEGFI---ILYAPVESSPKWIKYTVQSKNLSAVIKGLEPDLRYQFQIAATNYAGFNGNFSEIVQEMPKNFPNLNLKTVPDLRCSVQSSNRLKVEWSSPS-------ISTDLLKFEIRYSGNLSYITEIGLKKSEFIDMESKS 2991
            +   V  ++ +T  E D+ P    +I Q P   + +   ++++ C + G+P P+I W  N++ ++        + NP   +S+K+     L I    E D      C AEN+ G + S+   L V      +P  F         ++    SN+ L C A G+P P ++W K     +E  T    +  G  +L  +  ++   Y C A +T G ++   S + + S P +P  + I    + +V + W   G  D+   + +++ Y+  P+N  +        +  IS   ++Y Y ++ L P+T Y  ++ + N +G  PP+   T  T  T  + +PR++   ++S++ +++ W PPE   G+   Y++ YT N       W    V +  +  ++ L    +Y +RV+    +G GP+S  + +K   G  SQ  +F+ T+I ++ + LQW  P       ++ Y L   D      +    S++    L+  L  + + Y+            L+A +  G+G    P  ++      G   +N+  I    ST I+  W PP     +  +  Y++F  E      +   + +N++     E   W  Y       +S     +    R    ILR          T + VP D P+D+    ++S S  VSWKP  +   NGII  Y +  +A +  +  + F+N      ++  L++          Y I V A T+ G G  S       +     P+  T+     ER+    I + WE P  +   L    +   +    L   + S P+  K     K    + +G+E    Y+F++A +N+ G      +I Q  P+  P        ++    Q+ + L V W  P+       I+   ++F  +    L     + L+K+ F ++E  +
Sbjct:   99 VGDAVSADATLTIYEGDKTPAGFPVITQGPGTRVIEVGHTVLMTCKAIGNPTPNIYWIKNQTKVD--------MSNP--RYSLKD---GFLQIENSREEDQGKYE-CVAENSMGTEHSKATNLYVKVRR--VPPTFSRPPETISEVM--LGSNLNLSCIAVGSPMPHVKWMKG----SEDLTPENEMPIGRNVLQLINIQESANYTCIAASTLG-QIDSVSVVKVQSLPTAPTDVQISEVTATSVRLEWSYKGPEDL---QYYVIQYK--PKNANQ-------AFSEISGIITMY-YVVRALSPYTEYEFYVIAVNNIGRGPPSAPATCTTGETKMESAPRNVQVRTLSSSTMVITWEPPETPNGQVTGYKVYYTTNSNQPEASWNSQMVDNSELTTVSELTPHAIYTVRVQAYTSMGAGPMSTPVQVKAQQGVPSQPSNFRATDIGETAVTLQWTKPTHSSE-NIVHYELYWNDTYANQAHHKRISNSEAYTLD-GLYPDTLYYIW-----------LAARSQRGEGATTPPIPVRTKQYVPGAPPRNITAI-ATSSTTISLSWLPPPVERSNGRIIYYKVFFVEVGREDDEATTMTLNMTSIVLDELKRWTEYKIWVLAGTS-----VGDGPRSHPIILR----------TQEDVPGD-PQDVKATPLNSTSIHVSWKPPLEKDRNGIIRGYHI--HAQELRDEGKGFLNEPFKFDVVDTLEFNVTGLQPDTKYSIQVAALTRKGDGDRS--AAIVVKTPGGVPVRPTVSLKIMEREPIVSIELEWERPAQTYGELRGYRLRWGVKDQALKEEMLSGPQMTK-----KRFDNLERGVE----YEFRVAGSNHIGIGQETVKIFQ-TPEGTPG---GPPSNITIRFQTPDVLCVTWDPPTREHRNGIITRYDVQFHKKIDHGLGSERNMTLRKAVFTNLEENT 959          

HSP 3 Score: 142.124 bits (357), Expect = 3.645e-33
Identity = 206/874 (23.57%), Postives = 347/874 (39.70%), Query Frame = 1
Query: 1051 ENITEKQIMSKFVYLTISEKKSIY---KYNLKDLFPFTTYCIWMESENPLGVSPPTIALTVKTLPTSPQLSPRSITATSISNTAILVAWRPP--ERKFGKFKYYQIIYTNNDGFLPQHWRQFAVKDDNVM-----LTHLIASEL-----YHIRVKIVNEIGHGPLSKTISIKTIAGTLSQCPDFKITEIFQSHIKLQWGTPDPVKLFKLIQ-YNLLCWDVRLK---IVNATAKSSTLFPILNHNLSMNEMEYVLYLKNEKEIKCRLSAINSDGKGMPTEIQASTVNKGVNYQNLIHI---DKIGSTYITFQWRPPSKFSFDYFLWIYQIFDSEKLDRAVKLPKIKINISDSASAENGWFVYNYTNAFSSSRYILGLRYLCRDSTDILREYVHRSDLVSTMKSVPSDSPKDLVVKEIDSNSALVSWKPLDQVHSNGIITHYEVRYYAPKKEESTERFINVSETSAILSNLKY-FHYVIYVRAFTKVGGGSWSNPKNYYRQNLEEFPIPTTIKGERKSETEINISWELPVLSEKNLAHAAIEGFIILY--APVESSPKWIKYTVQSKNLSAVIKGLEPDLRYQFQIAATNYAGFNGNFSE--IVQEMPKNFPNLNLKTVPDLRCSVQSSNRLKVEWSSPSISTDLLKFEIRYSGNLSYITEIGLKKSEFIDMESKSVNFETLVNRYDVTLENLQSNALYKIAVRAIYQNKELYESHRETTCDTMPAVPNLVKPPIIVGLDEEKSKVIIKLHRCSQRNGKISYYFVIVAAFQGNKNQQISFQEDTESYTFMELSVNTRSNNAKGEYIAI---MKDINDIFKVSGKDHSSVLLGDGTHDENHLSVNKKLEKNFNYRCFARVCLKYSNNSLCKSSPWSE 3582
            ENI   ++     Y   +  K I     Y L  L+P T Y IW+ + +  G    T  + V+T    P   PR+ITA + S+T I ++W PP  ER  G+  YY++ +            +   +DD        +T ++  EL     Y I V     +G GP S  I ++T         D K T +  + I + W  P       +I+ Y++   ++R +    +N   K    F +++  L  N    V  L+ + +   +++A+   G G  +         GV  +  + +   ++     I  +W  P++         Y      +L   VK   +K  +          F     N      Y    R    +   I +E V    +  T +  P   P ++ ++    +   V+W P  + H NGIIT Y+V+++  K +       N++   A+ +NL+    Y+  VRA+TK G G +S+ K       +    P +++ E  SE    I WE PV S   L      G+ I Y    VE    W   TV     SA +  LE   +Y   IAA    G  G  SE   V+  P++ P LN      LR    S++ + + W SP I    + ++I +     ++   G  +++ +    + +  +  V  +  T+  L     Y + V AI  +       + T    M A   +VKP     ++ E  ++++ L + S+  G IS+Y+++V     +   +I  Q  T+      L    +       YIA     + I   F +            G+ D+ H   N+KLE+   YR F R  +      L  SSP+SE
Sbjct:  525 ENIVHYELYWNDTYANQAHHKRISNSEAYTLDGLYPDTLYYIWLAARSQRGEGATTPPIPVRTKQYVPGAPPRNITAIATSSTTISLSWLPPPVERSNGRIIYYKVFFV-----------EVGREDDEATTMTLNMTSIVLDELKRWTEYKIWVLAGTSVGDGPRSHPIILRTQEDVPGDPQDVKATPLNSTSIHVSWKPPLEKDRNGIIRGYHIHAQELRDEGKGFLNEPFK----FDVVD-TLEFN----VTGLQPDTKYSIQVAALTRKGDGDRSAAIVVKTPGGVPVRPTVSLKIMEREPIVSIELEWERPAQ--------TYGELRGYRLRWGVKDQALKEEMLSGPQMTKKRF----DNLERGVEY--EFRVAGSNHIGIGQETV---KIFQTPEGTPGGPPSNITIRFQTPDVLCVTWDPPTREHRNGIITRYDVQFHK-KIDHGLGSERNMTLRKAVFTNLEENTEYIFRVRAYTKQGAGPFSD-KLIVETERDMGRAPMSLQAEATSEQTAEIWWE-PVTSRGKLL-----GYKIFYTMTAVEDLDDWQTKTV-GLTESADLVNLEKFAQYAVAIAARFKNGL-GRLSEKVTVRIKPEDVP-LN------LRAHDVSTHSMTLSW-SPPIRLTPVNYKISFDAMKVFVDSQGFSQTQIV--PKREIILKHYVKTH--TINELSPFTTYNVNVSAIPSDYSYRPPTKITVTTQMAAPQPMVKPDFYGVVNGE--EILVILPQASEEYGPISHYYLVVVPEDKSNLHKIPDQFLTDDL----LPGRNKPERPNAPYIAAKFPQRSIPFTFHL------------GSGDDYHNFTNRKLEREKRYRIFVRAVVDTPQKHLYTSSPFSE 1321          

HSP 4 Score: 138.658 bits (348), Expect = 3.862e-32
Identity = 212/892 (23.77%), Postives = 346/892 (38.79%), Query Frame = 1
Query:  376 CSSTGHPVPSISWKINESPIEELKSPLKKLQNPPRIFSIKNYQNSVLVITQLIESDSNSVLICEAENNAGFDSRQQQLKVISTETDIPSGFPVFQNNFFPIIKPYNSNVTLVCQAYGNPPPLIQWFKNYELINESFTKIKILNDGNLLLVQVTREDKGIYHCQAQNTNGLRLSDPSTLDITSYPISPN-----SLIIERFASDNVEIS------------WRSGLNDVTEQENFILHYREVPENITEKQIMSKFVYLTISEKKSIYKYNLKDLFPFTTYCIWMESENPLGVSPPTIALTVKTLPTSPQLSPRSITATSISNTAILVAW--RPPERKFGKFKYYQIIYTNNDGFLPQHWRQFAVKDDNVMLTHLIASEL-----YHIRVKIVNEIGHGPLSKTISIKTIAGTLSQCP-DFKITEIFQSHIKLQWGTPDPVKLFKLIQYNLLCWDVRLKIVNATAKSSTLFPILNHNLSMN-EMEYVLYLKNEKEIKCRLSAINSDGKG-MPTEIQASTVNKGVNYQ--NLIHIDKIGSTYITFQWRPPSKFS---FDYFLWIYQIFDSEKLDRAVKLPKIKINISDSASAENGWFVYNYTNAFSSSRYILGLRYLCRDSTDILREYVHRSDLVSTMKSVPSDSPKDLVVKEIDSNSALVSWKPLDQVHSNGIITHYEVRYYAPKKEESTERFINVSETSAILSNLK-YFHYVIYVRAFTKVGGGSWSNPKNYYRQNLEEFPI-PTTIKGERKSETEINISWELPVLSEKNLAHAAIEGFIILYAPVESSPKW-----IKYTVQSKNLSAVIKGLEPDLRYQFQIAATNYAGFNGNFSEIVQEMPKNF---PNLNLKTVPDLRCSVQSSNRLKVEWSSPSIS-TDLLKFEIRYS 2922
            C++ G P PSI W+ N   +   +S    L+ P  I        S+L I  +     ++   C AEN  G          I      P+GFPV        +      V + C+A GNP P I W KN   ++ S  +   L DG L +     ED+G Y C A+N+ G   S  + L +    + P        I E     N+ +S            W  G  D+T            PEN  E  I    + L           N+++   +T  CI   + + LG       + V++LPT+P      +  + ++ T++ + W  + PE      +YY I Y       P++  Q   +   ++  + +   L     Y   V  VN IG GP S   +  T    +   P + ++  +  S + + W  P+     ++  Y           V  T  S+      N  +  N E+  V  L        R+ A  S G G M T +Q     +GV  Q  N    D IG T +T QW  P+  S     Y L+    + ++   +          IS+S +       Y     +  + Y + L    +         +     V T + VP   P+++      S +  +SW P     SNG I +Y+V +    +E+     + ++ TS +L  LK +  Y I+V A T VG G  S+P     Q  E+ P  P  +K    + T I++SW+ P+  ++N     I G+ I    +    K       K+ V    L   + GL+PD +Y  Q+AA    G     + IV + P      P ++LK +   R  + S   +++EW  P+ +  +L  + +R+ 
Sbjct:   39 CAARGDPPPSIVWRKNGKKVSGTQSRYTVLEQPGGI--------SILRIEPVRAGRDDAPYECVAENGVGDAVSADATLTIYEGDKTPAGFPVITQGPGTRVIEVGHTVLMTCKAIGNPTPNIYWIKNQTKVDMSNPRYS-LKDGFLQIENSREEDQGKYECVAENSMGTEHSKATNLYVKVRRVPPTFSRPPETISEVMLGSNLNLSCIAVGSPMPHVKWMKGSEDLT------------PEN--EMPIGRNVLQLI----------NIQESANYT--CI---AASTLGQIDSVSVVKVQSLPTAPT----DVQISEVTATSVRLEWSYKGPE----DLQYYVIQYK------PKNANQAFSEISGIITMYYVVRALSPYTEYEFYVIAVNNIGRGPPSAPATCTTGETKMESAPRNVQVRTLSSSTMVITWEPPE-TPNGQVTGYK----------VYYTTNSNQPEASWNSQMVDNSELTTVSELTPHAIYTVRVQAYTSMGAGPMSTPVQVK-AQQGVPSQPSNFRATD-IGETAVTLQWTKPTHSSENIVHYELYWNDTYANQAHHK---------RISNSEA-------YTLDGLYPDTLYYIWLAARSQRGEGATTPPIP----VRTKQYVPGAPPRNITAIATSSTTISLSWLPPPVERSNGRIIYYKVFFVEVGREDDEATTMTLNMTSIVLDELKRWTEYKIWVLAGTSVGDGPRSHPIILRTQ--EDVPGDPQDVKATPLNSTSIHVSWKPPLEKDRN---GIIRGYHIHAQELRDEGKGFLNEPFKFDV-VDTLEFNVTGLQPDTKYSIQVAALTRKGDGDRSAAIVVKTPGGVPVRPTVSLKIME--REPIVS---IELEWERPAQTYGELRGYRLRWG 834          

HSP 5 Score: 53.9138 bits (128), Expect = 2.177e-6
Identity = 63/300 (21.00%), Postives = 119/300 (39.67%), Query Frame = 1
Query: 2203 SPKDLVVKEIDSNSALVSWKPLDQVHSNGIITHYEVRYYAPKKEESTE---RFINVSETSAILSNLKYFHYVIYVRAFTKVGGGSWSNPKNYYRQNLEEFPI-PTTIKGERKSETEINISWELPVLSEKNLAHAAIEGFIILYAPVESSPKWIKYTVQSKNLSAVIKGLEPDLRYQFQIAATNYAGFNGNFSEIVQEMPKNFPNLNLKTVPDLRCSVQSSNRLKVEWSSPSISTDLLKFEIRYSGNLSY----ITEIGLKKSEFIDMESKSVNFETLVNRYDVTLENLQSNALYKIAVRA 3078
            +P+++ V+ + S++ +++W+P +    NG +T Y+V Y     +       + ++ SE + +     +  Y + V+A+T +G G  S P     Q  +  P  P+  +     ET + + W  P  S +N+ H  +  +   YA          +   S + +  + GL PD  Y   +AA +  G       I     +  P    + +  +     SS  + + W  P +         R +G + Y      E+G +  E   M          +N   + L+ L+    YKI V A
Sbjct:  401 APRNVQVRTLSSSTMVITWEPPET--PNGQVTGYKVYYTTNSNQPEASWNSQMVDNSELTTVSELTPHAIYTVRVQAYTSMGAGPMSTPVQVKAQ--QGVPSQPSNFRATDIGETAVTLQWTKPTHSSENIVHYELY-WNDTYA------NQAHHKRISNSEAYTLDGLYPDTLYYIWLAARSQRGEGATTPPIPVRTKQYVPGAPPRNITAI---ATSSTTISLSWLPPPVE--------RSNGRIIYYKVFFVEVGREDDEATTM---------TLNMTSIVLDELKRWTEYKIWVLA 669          
BLAST of Protein tyrosine phosphatase receptor type D vs. Ensembl Fly
Match: Lar (gene:FBgn0000464 transcript:FBtr0331242)

HSP 1 Score: 665.996 bits (1717), Expect = 0.000e+0
Identity = 324/630 (51.43%), Postives = 424/630 (67.30%), Query Frame = 1
Query: 3937 PDLVNADSVQMCQD-GTKLSPVLVSDSIKLRIGSQKSENISDRPSISICNLYQYVTDLKANDCTLLQAEFETLNTNLDDRFTWQRSNIDSNKSKNRYANVVAYDHTSVLLTPVDDVIGSDYINANYIDGYQRQNAYIATQGPLPDTTDDFWRMVWEQRSNCIVMMTRLEERSGIKCHQYWPNRGFICYGQMIVSHIDTFVLAYYTIRLFEIRHSKYSEKREIQHFQFTAWPDHGVPKLSTPLLMFIRRVRSIGKIESCPKIVHCSAGVGRTGAFIVVDAQLERIKQEKNIDVFNYVSKIRCQRNYMVQTQAQYQFILETLLEAVEDGNTEVMACNFHAHVTKLSQIGISGSNQLSGFEMEFSKLNSLASNRGRHGVMLADFVKAAGNQAVNMTKNRVRNIIPYEWNRVVLNAIRGIEGSDYINASYIDGYRDRRAYIAAQSPIPSTVEDFWRMLWDQHCGVVIVLNQPHE---DKSHIYWPINKSIRYQFFVVDPVVEYNMPNYILREFKVTDARDGEFRALRQFQFTQWPNHGCPKESESILDFIRQVHKTKEQFGHMEPMVIHCNTGSGRTGVFIALSIVLDRLQQESVVDMYQTVKLLHKQRIGLVQTEEQYEFCYMAVLDYLSNYE 5814
            PD        M  D G   +P   SD + +R  + ++  +   P I I     ++  LK+ND      E+E++      +FTW  SN++ NKSKNRYANV AYDH+ V L  V+ V+GSDYINANY DGY++ NAY+ATQGPL +T  DFWRM WE ++  IVMMTRLEER+ IKC QYWP RG   YGQ+ V+  +T  LA Y+IR F++    ++++REI+  QFTAWPDHGVP    P L F+RR R++   ES P IVHCSAGVGRTG +IV+D+ LER+K EK ID++ +V+ +R QRNYMVQT+ QY FI + +LEA+  G TEV A N H H+ KL  +       +SG E+EF KL+++  +  +       FV A  N   N  KNR+ +I+PYE +RV L  I GIEGSDY+NAS+IDGYR R AYIAAQ P+    EDFWRMLW+ +  +V++L +  E   +K   YWP  +S+RYQ++VVDP+ EYNMP Y LREFKVTDARDG  R +RQFQF  WP  G PK  E  +DFI QVHKTKEQFG   P+ +HC+ G GR+GVFI LSIVL+R+Q E V+D++QTV++L  QR  +VQTE+QY FCY A L+YL +++
Sbjct: 1324 PDQAAVTRPLMAADLGAGPTP---SDPVDMRRLNFQTPGMISHPPIPISEFANHIERLKSNDNQKFSQEYESIEPG--QQFTWDNSNLEHNKSKNRYANVTAYDHSRVQLPAVEGVVGSDYINANYCDGYRKHNAYVATQGPLQETFVDFWRMCWELKTATIVMMTRLEERTRIKCDQYWPTRGTETYGQIFVTITETQELATYSIRTFQLCRQGFNDRREIKQLQFTAWPDHGVPDHPAPFLQFLRRCRALTPPESGPVIVHCSAGVGRTGCYIVIDSMLERMKHEKIIDIYGHVTCLRAQRNYMVQTEDQYIFIHDAILEAIICGVTEVPARNLHTHLQKL--LITEPGETISGMEVEFKKLSNVKMDSSK-------FVTA--NLPCNKHKNRLVHILPYESSRVYLTPIHGIEGSDYVNASFIDGYRYRSAYIAAQGPVQDAAEDFWRMLWEHNSTIVVMLTKLKEMGREKCFQYWPHERSVRYQYYVVDPIAEYNMPQYKLREFKVTDARDGSSRTVRQFQFIDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQDGPITVHCSAGVGRSGVFITLSIVLERMQYEGVLDVFQTVRILRSQRPAMVQTEDQYHFCYRAALEYLGSFD 1937          

HSP 2 Score: 139.043 bits (349), Expect = 2.689e-32
Identity = 207/973 (21.27%), Postives = 390/973 (40.08%), Query Frame = 1
Query:  256 ITQLVLINSQITFTENDEAPK-ISLIIQSPNVLLFK---SMILACSSTGHPVPSISWKINESPIEELKSPLKKLQNPPRIFSIKNYQNSVLVITQLIESDSNSVLICEAENNAGFD-SRQQQLKVISTETDIPSGFPVFQNNFFPIIKPYNSNVTLVCQAYGNPPPLIQWFKNYELINESFTKIKILNDGNLLLVQVTREDKGIYHCQAQNTNGLRLSDPSTLDITSYPISPNSLIIERFASDNVEISWR-SGLNDVTEQENFILHYREVPENITEKQIMSKFVYLTISEKKSIYKYNLKDLFPFTTYCIWMESENPLGVSPPTIALTVKTLPTSPQLSPRSITATSISNTAILVAWRPPERKFGKFKYYQIIYTNNDGFLPQHWRQFAVKDDNVM-LTHLIASELYHIRVKIVNEIGHGPLSKTISIKTIAGTLSQCPDFKITEIFQSHIKLQWGTPDPVKLFKLIQYNLLCWDVRLKIVNATAKSSTLFPILNHNLSMNEMEYV-LYLKNEKEIKCRLSAINSDGK----GMPTEIQASTVNKGVNYQNLIHIDKIGSTYITFQWRPPSKFSFDYFLWIYQIFDSEKLDRAVKL--PKIKINISDSASAENGWFVYNYTNAFSSSRYILGLRYLCRDSTDILREYVHRSDLVSTMKSVPSDSPKDLVVKEIDSNSAL-VSWKPLDQVHSNGIITHYEVRYYAPKKEESTERFINVSETSAILSNL-KYFHYVIYVRAFTKVGGGSWSNPKNYYRQNLEEFPIPTTIKGERKSETEIN--------ISWELPVLSEKNLAHAAIEGFIILYAPVESSPKWIKYTVQSKNLS---AVIKGLEPDLRYQFQIAATNYAGFNGNFSE-IVQEMPKNFPNLNLKTVPDLRCSVQSSNRLKVEWSSPSISTDLLKFEIRYSGNLSYITEIGLKKSEFIDMESKSVNFETLVNRYDVTLENLQSNALYKIAVRAIYQN 3090
            +   V  ++ +T  E D+ P    +I Q P   + +   ++++ C + G+P P+I W  N++ ++        + NP   +S+K+     L I    E D      C AEN+ G + S+   L V      +P  F         ++    SN+ L C A G+P P ++W K     +E  T    +  G  +L  +  ++   Y C A +T G ++   S + + S P +P  + I    + +V + W   G  D+   + +++ Y+  P+N  +        +  IS   ++Y Y ++ L P+T Y  ++ + N +G  PP+   T  T   S   +PR++   ++S++ +++ W PPE   G+   Y++ YT N       W    V +  +  ++ L    +Y +RV+    +G GP+S  + +K   G  SQ  +F+ T+I ++ + LQW  P       ++ Y L   D      +    S++    L+  L  + + Y+ L  ++++        I    K    G P +++A+ +N               ST I   W+PP +   +  +  Y I   E  D          K ++ D+         +N T     ++Y + +  L R         +    +V T   VP      L + E +   ++ + W+   Q +  G +  Y +R+    +    E       T     NL +   Y   V     +G G         ++ ++ F  P    G   S   I         ++W+ P    +N       G I  Y  V+   K        +N++   AV   LE +  Y F++ A    G  G FS+ ++ E  ++     +     L+    S    ++ W   +    LL ++I Y+     +T +     +  D ++K+V      +     L NL+  A Y +A+ A ++N
Sbjct:  131 VGDAVSADATLTIYEGDKTPAGFPVITQGPGTRVIEVGHTVLMTCKAIGNPTPNIYWIKNQTKVD--------MSNP--RYSLKD---GFLQIENSREEDQGKYE-CVAENSMGTEHSKATNLYVKVRR--VPPTFSRPPETISEVM--LGSNLNLSCIAVGSPMPHVKWMKG----SEDLTPENEMPIGRNVLQLINIQESANYTCIAASTLG-QIDSVSVVKVQSLPTAPTDVQISEVTATSVRLEWSYKGPEDL---QYYVIQYK--PKNANQ-------AFSEISGIITMY-YVVRALSPYTEYEFYVIAVNNIGRGPPSAPATCTTEMES---APRNVQVRTLSSSTMVITWEPPETPNGQVTGYKVYYTTNSNQPEASWNSQMVDNSELTTVSELTPHAIYTVRVQAYTSMGAGPMSTPVQVKAQQGVPSQPSNFRATDIGETAVTLQWTKPTHSSE-NIVHYELYWNDTYANQAHHKRISNSEAYTLD-GLYPDTLYYIWLAARSQRGEGATTPPIPVRTKQYVPGDPQDVKATPLN---------------STSIHVSWKPPLEKDRNGIIRGYHIHAQELRDEGKGFLNEPFKFDVVDT-------LEFNVTGLQPDTKYSIQVAALTRKGDGDRSAAI----VVKTPGGVPVRPTVSLKIMEREPIVSIELEWERPAQTY--GELRGYRLRWGVKDQALKEEMLSGPQMTKKRFDNLERGVEYEFRVAGSNHIGIG---------QETVKIFQTPEGTPGGPPSNITIRFQTPDVLCVTWDPPTREHRN-------GIITRYD-VQFHKKIDHGLGSERNMTLRKAVFTNLEENTEYIFRVRAYTKQG-AGPFSDKLIVETERDMGRAPM----SLQAEATSEQTAEIWWEPVTSRGKLLGYKIFYT-----MTAV----EDLDDWQTKTVGLTESAD-----LVNLEKFAQYAVAIAARFKN 998          

HSP 3 Score: 126.716 bits (317), Expect = 1.458e-28
Identity = 236/1104 (21.38%), Postives = 425/1104 (38.50%), Query Frame = 1
Query:  346 VLLFKSMILACSSTGHPVPSISW-KINESPIEELKSPLKKLQNPPRIFSIKNYQN-SVLVITQLIESDSNSVLICEAENNAGFDSRQQQLKVISTETDIPSGFPVFQNNFFPIIKPYNSNVTLVCQAYGNPPPLIQWFKNYELINESFTKIKILNDGNLLLVQVTRE-----DKGIYHCQAQNTNGLRLSDPSTLDITSYPISPNSLIIERFASDNVEISWRSGLNDVTEQENFILHY---REVPENITEKQIMSKFVYLTISEKKSIYKYNLKDLFPFTTYCIWMESENPLGVSPPTIALTVKTLPTSPQLSPRSITATSISNTAILVAWRPPERKFGKFKYYQIIYTNNDGFLPQHWRQFAVKDDNVMLTHLIASELYHIRVKIVNEIGHGPLSKTISIKTIAGTLSQCPDFKITEIFQSHIKLQWGTPDPVKLFKLIQ-YNLLCWDVRLK---IVNATAKSSTLFPILNHNLSMNEMEYVLYLKNEKEIKCRLSAINSDGKGMPTEIQASTVNKGVNYQNLIHI---DKIGSTYITFQWRPPSKFSFDYFLWIYQIFDSEKLDRAVKLPKIKINISDSASAENGWFVYNYTNAFSSSRYILGLRYLCRDSTDILREYVHRSDLVSTMKSVPSDSPKDLVVKEIDSNSALVSWKPLDQVHSNGIITHYEVRYYAPKKEESTERFINVSETSAILSNLKY-FHYVIYVRAFTKVGGGSWSNPKNYYRQNLEEFPIPTTIKGERKSETEINISWELPVLSEKNLAHAAIEGFIILY--APVESSPKWIKYTVQSKNLSAVIKGLEPDLRYQFQIAATNYAGFNGNFSE--IVQEMPKNFPNLNLKTVPDLRCSVQSSNRLKVEWSSPSISTDLLKFEIRYSGNLSYITEIGLKKSEFIDMESKSVNFETLVNRYDVTLENLQSNALYKIAVRAIYQNKELYESHRETTCDTMPAVPNLVKPPIIVGLDEEKSKVIIKLHRCSQRNGKISYYFVIVAAFQGNKNQQISFQEDTESYTFMELSVNTRSNNAKGEYIAI---MKDINDIFKVSGKDHSSVLLGDGTHDENHLSVNKKLEKNFNYRCFARVCLKYSNNSLCKSSPWSE 3582
            V+L  ++ L+C + G P+P + W K +E    E + P+ +  N  ++ +I+   N + +  + L + DS SV+  ++   A  D +  ++   S   +     P     +    KP N+N                         ++F++I     G + +  V R      +   Y     N      S P+T   T    +P ++ +   +S  + I+W        +   + ++Y      PE     Q++      T+SE           L P   Y + +++   +G  P +  + VK     P   P +  AT I  TA+ + W  P        +Y++ +  ND +  Q   +     +   L  L    LY+I +   ++ G G  +  I ++T         D K T +  + I + W  P       +I+ Y++   ++R +    +N   K    F +++  L  N    V  L+ + +   +++A+   G G  +         GV  +  + +   ++     I  +W  P++         Y      +L   VK   +K  +          F     N      Y    R    +   I +E V    +  T +  P   P ++ ++    +   V+W P  + H NGIIT Y+V+++  K +       N++   A+ +NL+    Y+  VRA+TK G G +S+ K       +    P +++ E  SE    I WE PV S   L      G+ I Y    VE    W   TV     SA +  LE   +Y   IAA    G  G  SE   V+  P++ P LN      LR    S++ + + W SP I    + ++I +     ++   G  +++ +    + +  +  V  +  T+  L     Y + V AI  +       + T    M A   +VKP     ++ E  ++++ L + S+  G IS+Y+++V     +   +I  Q  T+      L    +       YIA     + I   F +            G+ D+ H   N+KLE+   YR F R  +      L  SSP+SE
Sbjct:  260 VMLGSNLNLSCIAVGSPMPHVKWMKGSEDLTPENEMPIGR--NVLQLINIQESANYTCIAASTLGQIDSVSVVKVQSLPTAPTDVQISEVTATSVRLEWSYKGPEDLQYYVIQYKPKNAN-------------------------QAFSEI----SGIITMYYVVRALSPYTEYEFYVIAVNNIGRGPPSAPATC-TTEMESAPRNVQVRTLSSSTMVITWEPPETPNGQVTGYKVYYTTNSNQPEASWNSQMVDNSELTTVSE-----------LTPHAIYTVRVQAYTSMGAGPMSTPVQVKAQQGVPS-QPSNFRATDIGETAVTLQWTKPTHSSENIVHYELYW--NDTYANQAHHKRISNSEAYTLDGLYPDTLYYIWLAARSQRGEGATTPPIPVRTKQYVPGDPQDVKATPLNSTSIHVSWKPPLEKDRNGIIRGYHIHAQELRDEGKGFLNEPFK----FDVVD-TLEFN----VTGLQPDTKYSIQVAALTRKGDGDRSAAIVVKTPGGVPVRPTVSLKIMEREPIVSIELEWERPAQ--------TYGELRGYRLRWGVKDQALKEEMLSGPQMTKKRF----DNLERGVEY--EFRVAGSNHIGIGQETV---KIFQTPEGTPGGPPSNITIRFQTPDVLCVTWDPPTREHRNGIITRYDVQFHK-KIDHGLGSERNMTLRKAVFTNLEENTEYIFRVRAYTKQGAGPFSD-KLIVETERDMGRAPMSLQAEATSEQTAEIWWE-PVTSRGKLL-----GYKIFYTMTAVEDLDDWQTKTV-GLTESADLVNLEKFAQYAVAIAARFKNGL-GRLSEKVTVRIKPEDVP-LN------LRAHDVSTHSMTLSW-SPPIRLTPVNYKISFDAMKVFVDSQGFSQTQIV--PKREIILKHYVKTH--TINELSPFTTYNVNVSAIPSDYSYRPPTKITVTTQMAAPQPMVKPDFYGVVNGE--EILVILPQASEEYGPISHYYLVVVPEDKSNLHKIPDQFLTDDL----LPGRNKPERPNAPYIAAKFPQRSIPFTFHL------------GSGDDYHNFTNRKLEREKRYRIFVRAVVDTPQKHLYTSSPFSE 1251          

HSP 4 Score: 113.235 bits (282), Expect = 1.800e-24
Identity = 209/925 (22.59%), Postives = 346/925 (37.41%), Query Frame = 1
Query:  376 CSSTGHPVPSISWKINESPIEELKSPLKKLQNPPRIFSIKNYQNSVLVITQLIESDSNSVLICEAENNAGFDSRQQQLKVISTETDIPSGFPVFQNNFFPIIKPYNSNVTLVCQAYGNPPPLIQWFKNYELINESFTKIKILNDGNLLLVQVTREDKGIYHCQAQNTNGLRLSDPSTLDITSYPISPN-----SLIIERFASDNVEIS------------WRSGLNDVTEQENFILHYREVPENITEKQIMSKFVYLTISEKKSIYKYNLKDLFPFTTYCIWMESENPLGVSPPTIALTVKTLPTSPQLSPRSITATSISNTAILVAW--RPPERKFGKFKYYQIIYTNNDGFLPQHWRQFAVKDDNVMLTHLIASEL-----YHIRVKIVNEIGHGPLSKTISIKTIAGTLSQCP-DFKITEIFQSHIKLQWGTPDPVKLFKLIQYNLLCWDVRLKIVNATAKSSTLFPILNHNLSMN-EMEYVLYLKNEKEIKCRLSAINSDGKG-MPTEIQASTVNKGVNYQ--NLIHIDKIGSTYITFQWRPPSKFS---FDYFLWIYQIFDSEKLDRAVKLPKIKINISDSASAENGWFVYNYTNAFSSSRYILGLRYLCRDSTDILREYVHRSDLVSTMKSVPSDSPKDLVVKEIDSNSALVSWKPLDQVHSNGIITHYEVRYYAPKKEESTERFINVSETSAILSNLKY--------FHYVIYVRAFTKVGGGSWSNPKNYYRQNLEEFPIPTTIK---GERKSETEINISWELPVLSEKNLAHAAIEGFI---ILYAPVESSPKWIKYTVQSKNLSAVIKGLEPDLRYQFQIAATNYAGFNGNFSEIVQEMPKNFPNLNLKTVPDLRCSVQSSNRLKVEWSSPS-------ISTDLLKFEIRYSGNLSYITEIGLKKSEFIDMESKS 2991
            C++ G P PSI W+ N   +   +S    L+ P  I        S+L I  +     ++   C AEN  G          I      P+GFPV        +      V + C+A GNP P I W KN   ++ S  +   L DG L +     ED+G Y C A+N+ G   S  + L +    + P        I E     N+ +S            W  G  D+T            PEN  E  I    + L           N+++   +T  CI   + + LG       + V++LPT+P      +  + ++ T++ + W  + PE      +YY I Y       P++  Q   +   ++  + +   L     Y   V  VN IG GP S   +  T    +   P + ++  +  S + + W  P+     ++  Y           V  T  S+      N  +  N E+  V  L        R+ A  S G G M T +Q     +GV  Q  N    D IG T +T QW  P+  S     Y L+    + ++   +          IS+S +       Y     +  + Y + L    +         +     V T + VP D P+D+    ++S S  VSWKP  +   NGII  Y +  +A +  +  + F+N      ++  L++          Y I V A T+ G G  S       +     P+  T+     ER+    I + WE P  +   L    +   +    L   + S P+  K     K    + +G+E    Y+F++A +N+ G      +I Q  P+  P        ++    Q+ + L V W  P+       I+   ++F  +    L     + L+K+ F ++E  +
Sbjct:   71 CAARGDPPPSIVWRKNGKKVSGTQSRYTVLEQPGGI--------SILRIEPVRAGRDDAPYECVAENGVGDAVSADATLTIYEGDKTPAGFPVITQGPGTRVIEVGHTVLMTCKAIGNPTPNIYWIKNQTKVDMSNPRYS-LKDGFLQIENSREEDQGKYECVAENSMGTEHSKATNLYVKVRRVPPTFSRPPETISEVMLGSNLNLSCIAVGSPMPHVKWMKGSEDLT------------PEN--EMPIGRNVLQLI----------NIQESANYT--CI---AASTLGQIDSVSVVKVQSLPTAPT----DVQISEVTATSVRLEWSYKGPE----DLQYYVIQYK------PKNANQAFSEISGIITMYYVVRALSPYTEYEFYVIAVNNIGRGPPSAPATCTT---EMESAPRNVQVRTLSSSTMVITWEPPE-TPNGQVTGYK----------VYYTTNSNQPEASWNSQMVDNSELTTVSELTPHAIYTVRVQAYTSMGAGPMSTPVQVK-AQQGVPSQPSNFRATD-IGETAVTLQWTKPTHSSENIVHYELYWNDTYANQAHHK---------RISNSEA-------YTLDGLYPDTLYYIWLAARSQRGEGATTPPIP----VRTKQYVPGD-PQDVKATPLNSTSIHVSWKPPLEKDRNGIIRGYHI--HAQELRDEGKGFLNEPFKFDVVDTLEFNVTGLQPDTKYSIQVAALTRKGDGDRS--AAIVVKTPGGVPVRPTVSLKIMEREPIVSIELEWERPAQTYGELRGYRLRWGVKDQALKEEMLSGPQMTK-----KRFDNLERGVE----YEFRVAGSNHIGIGQETVKIFQ-TPEGTPG---GPPSNITIRFQTPDVLCVTWDPPTREHRNGIITRYDVQFHKKIDHGLGSERNMTLRKAVFTNLEENT 889          
BLAST of Protein tyrosine phosphatase receptor type D vs. Ensembl Fly
Match: Lar (gene:FBgn0000464 transcript:FBtr0331241)

HSP 1 Score: 665.996 bits (1717), Expect = 0.000e+0
Identity = 324/630 (51.43%), Postives = 424/630 (67.30%), Query Frame = 1
Query: 3937 PDLVNADSVQMCQD-GTKLSPVLVSDSIKLRIGSQKSENISDRPSISICNLYQYVTDLKANDCTLLQAEFETLNTNLDDRFTWQRSNIDSNKSKNRYANVVAYDHTSVLLTPVDDVIGSDYINANYIDGYQRQNAYIATQGPLPDTTDDFWRMVWEQRSNCIVMMTRLEERSGIKCHQYWPNRGFICYGQMIVSHIDTFVLAYYTIRLFEIRHSKYSEKREIQHFQFTAWPDHGVPKLSTPLLMFIRRVRSIGKIESCPKIVHCSAGVGRTGAFIVVDAQLERIKQEKNIDVFNYVSKIRCQRNYMVQTQAQYQFILETLLEAVEDGNTEVMACNFHAHVTKLSQIGISGSNQLSGFEMEFSKLNSLASNRGRHGVMLADFVKAAGNQAVNMTKNRVRNIIPYEWNRVVLNAIRGIEGSDYINASYIDGYRDRRAYIAAQSPIPSTVEDFWRMLWDQHCGVVIVLNQPHE---DKSHIYWPINKSIRYQFFVVDPVVEYNMPNYILREFKVTDARDGEFRALRQFQFTQWPNHGCPKESESILDFIRQVHKTKEQFGHMEPMVIHCNTGSGRTGVFIALSIVLDRLQQESVVDMYQTVKLLHKQRIGLVQTEEQYEFCYMAVLDYLSNYE 5814
            PD        M  D G   +P   SD + +R  + ++  +   P I I     ++  LK+ND      E+E++      +FTW  SN++ NKSKNRYANV AYDH+ V L  V+ V+GSDYINANY DGY++ NAY+ATQGPL +T  DFWRM WE ++  IVMMTRLEER+ IKC QYWP RG   YGQ+ V+  +T  LA Y+IR F++    ++++REI+  QFTAWPDHGVP    P L F+RR R++   ES P IVHCSAGVGRTG +IV+D+ LER+K EK ID++ +V+ +R QRNYMVQT+ QY FI + +LEA+  G TEV A N H H+ KL  +       +SG E+EF KL+++  +  +       FV A  N   N  KNR+ +I+PYE +RV L  I GIEGSDY+NAS+IDGYR R AYIAAQ P+    EDFWRMLW+ +  +V++L +  E   +K   YWP  +S+RYQ++VVDP+ EYNMP Y LREFKVTDARDG  R +RQFQF  WP  G PK  E  +DFI QVHKTKEQFG   P+ +HC+ G GR+GVFI LSIVL+R+Q E V+D++QTV++L  QR  +VQTE+QY FCY A L+YL +++
Sbjct: 1310 PDQAAVTRPLMAADLGAGPTP---SDPVDMRRLNFQTPGMISHPPIPISEFANHIERLKSNDNQKFSQEYESIEPG--QQFTWDNSNLEHNKSKNRYANVTAYDHSRVQLPAVEGVVGSDYINANYCDGYRKHNAYVATQGPLQETFVDFWRMCWELKTATIVMMTRLEERTRIKCDQYWPTRGTETYGQIFVTITETQELATYSIRTFQLCRQGFNDRREIKQLQFTAWPDHGVPDHPAPFLQFLRRCRALTPPESGPVIVHCSAGVGRTGCYIVIDSMLERMKHEKIIDIYGHVTCLRAQRNYMVQTEDQYIFIHDAILEAIICGVTEVPARNLHTHLQKL--LITEPGETISGMEVEFKKLSNVKMDSSK-------FVTA--NLPCNKHKNRLVHILPYESSRVYLTPIHGIEGSDYVNASFIDGYRYRSAYIAAQGPVQDAAEDFWRMLWEHNSTIVVMLTKLKEMGREKCFQYWPHERSVRYQYYVVDPIAEYNMPQYKLREFKVTDARDGSSRTVRQFQFIDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQDGPITVHCSAGVGRSGVFITLSIVLERMQYEGVLDVFQTVRILRSQRPAMVQTEDQYHFCYRAALEYLGSFD 1923          

HSP 2 Score: 139.428 bits (350), Expect = 2.401e-32
Identity = 211/975 (21.64%), Postives = 390/975 (40.00%), Query Frame = 1
Query:  256 ITQLVLINSQITFTENDEAPK-ISLIIQSPNVLLFK---SMILACSSTGHPVPSISWKINESPIEELKSPLKKLQNPPRIFSIKNYQNSVLVITQLIESDSNSVLICEAENNAGFD-SRQQQLKVISTETDIPSGFPVFQNNFFPIIKPYNSNVTLVCQAYGNPPPLIQWFKNYELINESFTKIKILNDGNLLLVQVTREDKGIYHCQAQNTNGLRLSDPSTLDITSYPISPNSLIIERFASDNVEISWR-SGLNDVTEQENFILHYREVPENITEKQIMSKFVYLTISEKKSIYKYNLKDLFPFTTYCIWMESENPLGVSPPTIALTVKTLPTSPQLSPRSITATSISNTAILVAWRPPERKFGKFKYYQIIYTNNDGFLPQHWRQFAVKDDNVMLT---HLIASELYHIRVKIVNEIGHGPLSKTISIKTIAGTLSQCPDFKITEIFQSHIKLQWGTPDPVKLFKLIQYNLLCWDVRLKIVNATAKSSTLFPILNHNLSMNEMEYV-LYLKNEKEIKCRLSAINSDGK----GMPTEIQASTVNKGVNYQNLIHIDKIGSTYITFQWRPPSKFSFDYFLWIYQIFDSEKLDRAVKL--PKIKINISDSASAENGWFVYNYTNAFSSSRYILGLRYLCRDSTDILREYVHRSDLVSTMKSVPSDSPKDLVVKEIDSNSAL-VSWKPLDQVHSNGIITHYEVRYYAPKKEESTERFINVSETSAILSNL-KYFHYVIYVRAFTKVGGGSWSNPKNYYRQNLEEFPIPTTIKGERKSETEIN--------ISWELPVLSEKNLAHAAIEGFIILYAPVESSPKWIKYTVQSKNLS---AVIKGLEPDLRYQFQIAATNYAGFNGNFSE-IVQEMPKNFPNLNLKTVPDLRCSVQSSNRLKVEWSSPSISTDLLKFEIRYSGNLSYITEIGLKKSEFIDMESKSVNFETLVNRYDVTLENLQSNALYKIAVRAIYQN 3090
            +   V  ++ +T  E D+ P    +I Q P   + +   ++++ C + G+P P+I W  N++ ++        + NP   +S+K+     L I    E D      C AEN+ G + S+   L V      +P  F         ++    SN+ L C A G+P P ++W K     +E  T    +  G  +L  +  ++   Y C A +T G ++   S + + S P +P  + I    + +V + W   G  D+   + +++ Y+  P+N  +        +  IS   ++Y Y ++ L P+T Y  ++ + N +G  PP+   T  T   S   +PR++   ++S++ +++ W PPE   G+   Y++ YT N       W    V  DN  LT    L    +Y +RV+    +G GP+S  + +K   G  SQ  +F+ T+I ++ + LQW  P       ++ Y L   D      +    S++    L+  L  + + Y+ L  ++++        I    K    G P +++A+ +N               ST I   W+PP +   +  +  Y I   E  D          K ++ D+         +N T     ++Y + +  L R         +    +V T   VP      L + E +   ++ + W+   Q +  G +  Y +R+    +    E       T     NL +   Y   V     +G G         ++ ++ F  P    G   S   I         ++W+ P    +N       G I  Y  V+   K        +N++   AV   LE +  Y F++ A    G  G FS+ ++ E  ++     +     L+    S    ++ W   +    LL ++I Y+     +T +     +  D ++K+V      +     L NL+  A Y +A+ A ++N
Sbjct:  117 VGDAVSADATLTIYEGDKTPAGFPVITQGPGTRVIEVGHTVLMTCKAIGNPTPNIYWIKNQTKVD--------MSNP--RYSLKD---GFLQIENSREEDQGKYE-CVAENSMGTEHSKATNLYVKVRR--VPPTFSRPPETISEVM--LGSNLNLSCIAVGSPMPHVKWMKG----SEDLTPENEMPIGRNVLQLINIQESANYTCIAASTLG-QIDSVSVVKVQSLPTAPTDVQISEVTATSVRLEWSYKGPEDL---QYYVIQYK--PKNANQ-------AFSEISGIITMY-YVVRALSPYTEYEFYVIAVNNIGRGPPSAPATCTTEMES---APRNVQVRTLSSSTMVITWEPPETPNGQVTGYKVYYTTNSNQPEASWNSQMV--DNSELTTVSELTPHAIYTVRVQAYTSMGAGPMSTPVQVKAQQGVPSQPSNFRATDIGETAVTLQWTKPTHSSE-NIVHYELYWNDTYANQAHHKRISNSEAYTLD-GLYPDTLYYIWLAARSQRGEGATTPPIPVRTKQYVPGDPQDVKATPLN---------------STSIHVSWKPPLEKDRNGIIRGYHIHAQELRDEGKGFLNEPFKFDVVDT-------LEFNVTGLQPDTKYSIQVAALTRKGDGDRSAAI----VVKTPGGVPVRPTVSLKIMEREPIVSIELEWERPAQTY--GELRGYRLRWGVKDQALKEEMLSGPQMTKKRFDNLERGVEYEFRVAGSNHIGIG---------QETVKIFQTPEGTPGGPPSNITIRFQTPDVLCVTWDPPTREHRN-------GIITRYD-VQFHKKIDHGLGSERNMTLRKAVFTNLEENTEYIFRVRAYTKQG-AGPFSDKLIVETERDMGRAPM----SLQAEATSEQTAEIWWEPVTSRGKLLGYKIFYT-----MTAV----EDLDDWQTKTVGLTESAD-----LVNLEKFAQYAVAIAARFKN 984          

HSP 3 Score: 126.716 bits (317), Expect = 1.430e-28
Identity = 236/1104 (21.38%), Postives = 425/1104 (38.50%), Query Frame = 1
Query:  346 VLLFKSMILACSSTGHPVPSISW-KINESPIEELKSPLKKLQNPPRIFSIKNYQN-SVLVITQLIESDSNSVLICEAENNAGFDSRQQQLKVISTETDIPSGFPVFQNNFFPIIKPYNSNVTLVCQAYGNPPPLIQWFKNYELINESFTKIKILNDGNLLLVQVTRE-----DKGIYHCQAQNTNGLRLSDPSTLDITSYPISPNSLIIERFASDNVEISWRSGLNDVTEQENFILHY---REVPENITEKQIMSKFVYLTISEKKSIYKYNLKDLFPFTTYCIWMESENPLGVSPPTIALTVKTLPTSPQLSPRSITATSISNTAILVAWRPPERKFGKFKYYQIIYTNNDGFLPQHWRQFAVKDDNVMLTHLIASELYHIRVKIVNEIGHGPLSKTISIKTIAGTLSQCPDFKITEIFQSHIKLQWGTPDPVKLFKLIQ-YNLLCWDVRLK---IVNATAKSSTLFPILNHNLSMNEMEYVLYLKNEKEIKCRLSAINSDGKGMPTEIQASTVNKGVNYQNLIHI---DKIGSTYITFQWRPPSKFSFDYFLWIYQIFDSEKLDRAVKLPKIKINISDSASAENGWFVYNYTNAFSSSRYILGLRYLCRDSTDILREYVHRSDLVSTMKSVPSDSPKDLVVKEIDSNSALVSWKPLDQVHSNGIITHYEVRYYAPKKEESTERFINVSETSAILSNLKY-FHYVIYVRAFTKVGGGSWSNPKNYYRQNLEEFPIPTTIKGERKSETEINISWELPVLSEKNLAHAAIEGFIILY--APVESSPKWIKYTVQSKNLSAVIKGLEPDLRYQFQIAATNYAGFNGNFSE--IVQEMPKNFPNLNLKTVPDLRCSVQSSNRLKVEWSSPSISTDLLKFEIRYSGNLSYITEIGLKKSEFIDMESKSVNFETLVNRYDVTLENLQSNALYKIAVRAIYQNKELYESHRETTCDTMPAVPNLVKPPIIVGLDEEKSKVIIKLHRCSQRNGKISYYFVIVAAFQGNKNQQISFQEDTESYTFMELSVNTRSNNAKGEYIAI---MKDINDIFKVSGKDHSSVLLGDGTHDENHLSVNKKLEKNFNYRCFARVCLKYSNNSLCKSSPWSE 3582
            V+L  ++ L+C + G P+P + W K +E    E + P+ +  N  ++ +I+   N + +  + L + DS SV+  ++   A  D +  ++   S   +     P     +    KP N+N                         ++F++I     G + +  V R      +   Y     N      S P+T   T    +P ++ +   +S  + I+W        +   + ++Y      PE     Q++      T+SE           L P   Y + +++   +G  P +  + VK     P   P +  AT I  TA+ + W  P        +Y++ +  ND +  Q   +     +   L  L    LY+I +   ++ G G  +  I ++T         D K T +  + I + W  P       +I+ Y++   ++R +    +N   K    F +++  L  N    V  L+ + +   +++A+   G G  +         GV  +  + +   ++     I  +W  P++         Y      +L   VK   +K  +          F     N      Y    R    +   I +E V    +  T +  P   P ++ ++    +   V+W P  + H NGIIT Y+V+++  K +       N++   A+ +NL+    Y+  VRA+TK G G +S+ K       +    P +++ E  SE    I WE PV S   L      G+ I Y    VE    W   TV     SA +  LE   +Y   IAA    G  G  SE   V+  P++ P LN      LR    S++ + + W SP I    + ++I +     ++   G  +++ +    + +  +  V  +  T+  L     Y + V AI  +       + T    M A   +VKP     ++ E  ++++ L + S+  G IS+Y+++V     +   +I  Q  T+      L    +       YIA     + I   F +            G+ D+ H   N+KLE+   YR F R  +      L  SSP+SE
Sbjct:  246 VMLGSNLNLSCIAVGSPMPHVKWMKGSEDLTPENEMPIGR--NVLQLINIQESANYTCIAASTLGQIDSVSVVKVQSLPTAPTDVQISEVTATSVRLEWSYKGPEDLQYYVIQYKPKNAN-------------------------QAFSEI----SGIITMYYVVRALSPYTEYEFYVIAVNNIGRGPPSAPATC-TTEMESAPRNVQVRTLSSSTMVITWEPPETPNGQVTGYKVYYTTNSNQPEASWNSQMVDNSELTTVSE-----------LTPHAIYTVRVQAYTSMGAGPMSTPVQVKAQQGVPS-QPSNFRATDIGETAVTLQWTKPTHSSENIVHYELYW--NDTYANQAHHKRISNSEAYTLDGLYPDTLYYIWLAARSQRGEGATTPPIPVRTKQYVPGDPQDVKATPLNSTSIHVSWKPPLEKDRNGIIRGYHIHAQELRDEGKGFLNEPFK----FDVVD-TLEFN----VTGLQPDTKYSIQVAALTRKGDGDRSAAIVVKTPGGVPVRPTVSLKIMEREPIVSIELEWERPAQ--------TYGELRGYRLRWGVKDQALKEEMLSGPQMTKKRF----DNLERGVEY--EFRVAGSNHIGIGQETV---KIFQTPEGTPGGPPSNITIRFQTPDVLCVTWDPPTREHRNGIITRYDVQFHK-KIDHGLGSERNMTLRKAVFTNLEENTEYIFRVRAYTKQGAGPFSD-KLIVETERDMGRAPMSLQAEATSEQTAEIWWE-PVTSRGKLL-----GYKIFYTMTAVEDLDDWQTKTV-GLTESADLVNLEKFAQYAVAIAARFKNGL-GRLSEKVTVRIKPEDVP-LN------LRAHDVSTHSMTLSW-SPPIRLTPVNYKISFDAMKVFVDSQGFSQTQIV--PKREIILKHYVKTH--TINELSPFTTYNVNVSAIPSDYSYRPPTKITVTTQMAAPQPMVKPDFYGVVNGE--EILVILPQASEEYGPISHYYLVVVPEDKSNLHKIPDQFLTDDL----LPGRNKPERPNAPYIAAKFPQRSIPFTFHL------------GSGDDYHNFTNRKLEREKRYRIFVRAVVDTPQKHLYTSSPFSE 1237          

HSP 4 Score: 114.39 bits (285), Expect = 9.149e-25
Identity = 214/954 (22.43%), Postives = 355/954 (37.21%), Query Frame = 1
Query:  289 TFTENDEAPKISLIIQSPNVLLFKSMILACSSTGHPVPSISWKINESPIEELKSPLKKLQNPPRIFSIKNYQNSVLVITQLIESDSNSVLICEAENNAGFDSRQQQLKVISTETDIPSGFPVFQNNFFPIIKPYNSNVTLVCQAYGNPPPLIQWFKNYELINESFTKIKILNDGNLLLVQVTREDKGIYHCQAQNTNGLRLSDPSTLDITSYPISPN-----SLIIERFASDNVEIS------------WRSGLNDVTEQENFILHYREVPENITEKQIMSKFVYLTISEKKSIYKYNLKDLFPFTTYCIWMESENPLGVSPPTIALTVKTLPTSPQLSPRSITATSISNTAILVAW--RPPERKFGKFKYYQIIYTNNDGFLPQHWRQFAVKDDNVMLTHLIASEL-----YHIRVKIVNEIGHGPLSKTISIKTIAGTLSQCP-DFKITEIFQSHIKLQWGTPDPVKLFKLIQYNLLCWDVRLKIVNATAKSSTLFPILNHNLSMN-EMEYVLYLKNEKEIKCRLSAINSDGKG-MPTEIQASTVNKGVNYQ--NLIHIDKIGSTYITFQWRPPSKFS---FDYFLWIYQIFDSEKLDRAVKLPKIKINISDSASAENGWFVYNYTNAFSSSRYILGLRYLCRDSTDILREYVHRSDLVSTMKSVPSDSPKDLVVKEIDSNSALVSWKPLDQVHSNGIITHYEVRYYAPKKEESTERFINVSETSAILSNLKY--------FHYVIYVRAFTKVGGGSWSNPKNYYRQNLEEFPIPTTIK---GERKSETEINISWELPVLSEKNLAHAAIEGFI---ILYAPVESSPKWIKYTVQSKNLSAVIKGLEPDLRYQFQIAATNYAGFNGNFSEIVQEMPKNFPNLNLKTVPDLRCSVQSSNRLKVEWSSPS-------ISTDLLKFEIRYSGNLSYITEIGLKKSEFIDMESKS 2991
            T  +    P+I    Q+  V +       C++ G P PSI W+ N   +   +S    L+ P  I        S+L I  +     ++   C AEN  G          I      P+GFPV        +      V + C+A GNP P I W KN   ++ S  +   L DG L +     ED+G Y C A+N+ G   S  + L +    + P        I E     N+ +S            W  G  D+T            PEN  E  I    + L           N+++   +T  CI   + + LG       + V++LPT+P      +  + ++ T++ + W  + PE      +YY I Y       P++  Q   +   ++  + +   L     Y   V  VN IG GP S   +  T    +   P + ++  +  S + + W  P+     ++  Y           V  T  S+      N  +  N E+  V  L        R+ A  S G G M T +Q     +GV  Q  N    D IG T +T QW  P+  S     Y L+    + ++   +          IS+S +       Y     +  + Y + L    +         +     V T + VP D P+D+    ++S S  VSWKP  +   NGII  Y +  +A +  +  + F+N      ++  L++          Y I V A T+ G G  S       +     P+  T+     ER+    I + WE P  +   L    +   +    L   + S P+  K     K    + +G+E    Y+F++A +N+ G      +I Q  P+  P        ++    Q+ + L V W  P+       I+   ++F  +    L     + L+K+ F ++E  +
Sbjct:   28 TIVDAAHPPEIIRKPQNQGVRVGGVASFYCAARGDPPPSIVWRKNGKKVSGTQSRYTVLEQPGGI--------SILRIEPVRAGRDDAPYECVAENGVGDAVSADATLTIYEGDKTPAGFPVITQGPGTRVIEVGHTVLMTCKAIGNPTPNIYWIKNQTKVDMSNPRYS-LKDGFLQIENSREEDQGKYECVAENSMGTEHSKATNLYVKVRRVPPTFSRPPETISEVMLGSNLNLSCIAVGSPMPHVKWMKGSEDLT------------PEN--EMPIGRNVLQLI----------NIQESANYT--CI---AASTLGQIDSVSVVKVQSLPTAPT----DVQISEVTATSVRLEWSYKGPE----DLQYYVIQYK------PKNANQAFSEISGIITMYYVVRALSPYTEYEFYVIAVNNIGRGPPSAPATCTT---EMESAPRNVQVRTLSSSTMVITWEPPE-TPNGQVTGYK----------VYYTTNSNQPEASWNSQMVDNSELTTVSELTPHAIYTVRVQAYTSMGAGPMSTPVQVK-AQQGVPSQPSNFRATD-IGETAVTLQWTKPTHSSENIVHYELYWNDTYANQAHHK---------RISNSEA-------YTLDGLYPDTLYYIWLAARSQRGEGATTPPIP----VRTKQYVPGD-PQDVKATPLNSTSIHVSWKPPLEKDRNGIIRGYHI--HAQELRDEGKGFLNEPFKFDVVDTLEFNVTGLQPDTKYSIQVAALTRKGDGDRS--AAIVVKTPGGVPVRPTVSLKIMEREPIVSIELEWERPAQTYGELRGYRLRWGVKDQALKEEMLSGPQMTK-----KRFDNLERGVE----YEFRVAGSNHIGIGQETVKIFQ-TPEGTPG---GPPSNITIRFQTPDVLCVTWDPPTREHRNGIITRYDVQFHKKIDHGLGSERNMTLRKAVFTNLEENT 875          
BLAST of Protein tyrosine phosphatase receptor type D vs. Ensembl Fly
Match: Lar (gene:FBgn0000464 transcript:FBtr0081260)

HSP 1 Score: 665.996 bits (1717), Expect = 0.000e+0
Identity = 324/630 (51.43%), Postives = 424/630 (67.30%), Query Frame = 1
Query: 3937 PDLVNADSVQMCQD-GTKLSPVLVSDSIKLRIGSQKSENISDRPSISICNLYQYVTDLKANDCTLLQAEFETLNTNLDDRFTWQRSNIDSNKSKNRYANVVAYDHTSVLLTPVDDVIGSDYINANYIDGYQRQNAYIATQGPLPDTTDDFWRMVWEQRSNCIVMMTRLEERSGIKCHQYWPNRGFICYGQMIVSHIDTFVLAYYTIRLFEIRHSKYSEKREIQHFQFTAWPDHGVPKLSTPLLMFIRRVRSIGKIESCPKIVHCSAGVGRTGAFIVVDAQLERIKQEKNIDVFNYVSKIRCQRNYMVQTQAQYQFILETLLEAVEDGNTEVMACNFHAHVTKLSQIGISGSNQLSGFEMEFSKLNSLASNRGRHGVMLADFVKAAGNQAVNMTKNRVRNIIPYEWNRVVLNAIRGIEGSDYINASYIDGYRDRRAYIAAQSPIPSTVEDFWRMLWDQHCGVVIVLNQPHE---DKSHIYWPINKSIRYQFFVVDPVVEYNMPNYILREFKVTDARDGEFRALRQFQFTQWPNHGCPKESESILDFIRQVHKTKEQFGHMEPMVIHCNTGSGRTGVFIALSIVLDRLQQESVVDMYQTVKLLHKQRIGLVQTEEQYEFCYMAVLDYLSNYE 5814
            PD        M  D G   +P   SD + +R  + ++  +   P I I     ++  LK+ND      E+E++      +FTW  SN++ NKSKNRYANV AYDH+ V L  V+ V+GSDYINANY DGY++ NAY+ATQGPL +T  DFWRM WE ++  IVMMTRLEER+ IKC QYWP RG   YGQ+ V+  +T  LA Y+IR F++    ++++REI+  QFTAWPDHGVP    P L F+RR R++   ES P IVHCSAGVGRTG +IV+D+ LER+K EK ID++ +V+ +R QRNYMVQT+ QY FI + +LEA+  G TEV A N H H+ KL  +       +SG E+EF KL+++  +  +       FV A  N   N  KNR+ +I+PYE +RV L  I GIEGSDY+NAS+IDGYR R AYIAAQ P+    EDFWRMLW+ +  +V++L +  E   +K   YWP  +S+RYQ++VVDP+ EYNMP Y LREFKVTDARDG  R +RQFQF  WP  G PK  E  +DFI QVHKTKEQFG   P+ +HC+ G GR+GVFI LSIVL+R+Q E V+D++QTV++L  QR  +VQTE+QY FCY A L+YL +++
Sbjct: 1412 PDQAAVTRPLMAADLGAGPTP---SDPVDMRRLNFQTPGMISHPPIPISEFANHIERLKSNDNQKFSQEYESIEPG--QQFTWDNSNLEHNKSKNRYANVTAYDHSRVQLPAVEGVVGSDYINANYCDGYRKHNAYVATQGPLQETFVDFWRMCWELKTATIVMMTRLEERTRIKCDQYWPTRGTETYGQIFVTITETQELATYSIRTFQLCRQGFNDRREIKQLQFTAWPDHGVPDHPAPFLQFLRRCRALTPPESGPVIVHCSAGVGRTGCYIVIDSMLERMKHEKIIDIYGHVTCLRAQRNYMVQTEDQYIFIHDAILEAIICGVTEVPARNLHTHLQKL--LITEPGETISGMEVEFKKLSNVKMDSSK-------FVTA--NLPCNKHKNRLVHILPYESSRVYLTPIHGIEGSDYVNASFIDGYRYRSAYIAAQGPVQDAAEDFWRMLWEHNSTIVVMLTKLKEMGREKCFQYWPHERSVRYQYYVVDPIAEYNMPQYKLREFKVTDARDGSSRTVRQFQFIDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQDGPITVHCSAGVGRSGVFITLSIVLERMQYEGVLDVFQTVRILRSQRPAMVQTEDQYHFCYRAALEYLGSFD 2025          

HSP 2 Score: 165.622 bits (418), Expect = 2.209e-40
Identity = 214/945 (22.65%), Postives = 389/945 (41.16%), Query Frame = 1
Query:  256 ITQLVLINSQITFTENDEAPK-ISLIIQSPNVLLFK---SMILACSSTGHPVPSISWKINESPIEELKSPLKKLQNPPRIFSIKNYQNSVLVITQLIESDSNSVLICEAENNAGFD-SRQQQLKVISTETDIPSGFPVFQNNFFPIIKPYNSNVTLVCQAYGNPPPLIQWFKNYELINESFTKIKILNDGNLLLVQVTREDKGIYHCQAQNTNGLRLSDPSTLDITSYPISPNSLIIERFASDNVEISWR-SGLNDVTEQENFILHYREVPENITEKQIMSKFVYLTISEKKSIYKYNLKDLFPFTTYCIWMESENPLGVSPPTIALTVKTLPTSPQLSPRSITATSISNTAILVAWRPPERKFGKFKYYQIIYTNNDGFLPQHWRQFAVKDDNV-MLTHLIASELYHIRVKIVNEIGHGPLSKTISIKTIAGTLSQCPDFKITEIFQSHIKLQWGTPDPVKLFKLIQYNLLCWDVRLKIVNATAKSSTLFPILNHNLSMNEMEYVL-YLKNEKEIKCRLSAINSDGKGM---PTEIQASTVNKGVNYQNLIHIDKIGSTYITFQWRPPSKFSFDYFLWIYQIFDSEKLDRAVKLPKIKINISDSASAE-NGWFVYNYTNAFSSSRYILGLRYLCRDSTDILREYVHRSDLVSTMKSVPSDSPKDLVVKEIDSNSALVSWKPLDQVHSNGIITHYEVRYYAPKKEESTERFINVSETSAILSNLKY--------FHYVIYVRAFTKVGGGSWSNPKNYYRQNLEEFPIPTTIK---GERKSETEINISWELPVLSEKNLAHAAIEGFI---ILYAPVESSPKWIKYTVQSKNLSAVIKGLEPDLRYQFQIAATNYAGFNGNFSEIVQEMPKNFPNLNLKTVPDLRCSVQSSNRLKVEWSSPS-------ISTDLLKFEIRYSGNLSYITEIGLKKSEFIDMESKS 2991
            +   V  ++ +T  E D+ P    +I Q P   + +   ++++ C + G+P P+I W  N++ ++        + NP   +S+K+     L I    E D      C AEN+ G + S+   L V      +P  F         ++    SN+ L C A G+P P ++W K     +E  T    +  G  +L  +  ++   Y C A +T G ++   S + + S P +P  + I    + +V + W   G  D+   + +++ Y+  P+N  +        +  IS   ++Y Y ++ L P+T Y  ++ + N +G  PP+   T  T  T  + +PR++   ++S++ +++ W PPE   G+   Y++ YT N       W    V +  +  ++ L    +Y +RV+    +G GP+S  + +K   G  SQ  +F+ T+I ++ + LQW  P       ++ Y L  W+             T     +H    N   Y L  L  +      L+A +  G+G    P  ++      G   +N+  I    ST I+  W PP     +  +  Y++F  E      +   + +N++     E   W  Y       +S     +    R    ILR          T + VP D P+D+    ++S S  VSWKP  +   NGII  Y +  +A +  +  + F+N      ++  L++          Y I V A T+ G G  S       +     P+  T+     ER+    I + WE P  +   L    +   +    L   + S P+  K     K    + +G+E    Y+F++A +N+ G      +I Q  P+  P        ++    Q+ + L V W  P+       I+   ++F  +    L     + L+K+ F ++E  +
Sbjct:  117 VGDAVSADATLTIYEGDKTPAGFPVITQGPGTRVIEVGHTVLMTCKAIGNPTPNIYWIKNQTKVD--------MSNP--RYSLKD---GFLQIENSREEDQGKYE-CVAENSMGTEHSKATNLYVKVRR--VPPTFSRPPETISEVM--LGSNLNLSCIAVGSPMPHVKWMKG----SEDLTPENEMPIGRNVLQLINIQESANYTCIAASTLG-QIDSVSVVKVQSLPTAPTDVQISEVTATSVRLEWSYKGPEDL---QYYVIQYK--PKNANQ-------AFSEISGIITMY-YVVRALSPYTEYEFYVIAVNNIGRGPPSAPATCTTGETKMESAPRNVQVRTLSSSTMVITWEPPETPNGQVTGYKVYYTTNSNQPEASWNSQMVDNSELTTVSELTPHAIYTVRVQAYTSMGAGPMSTPVQVKAQQGVPSQPSNFRATDIGETAVTLQWTKPTHSSE-NIVHYELY-WN------------DTYANQAHHKRISNSEAYTLDGLYPDTLYYIWLAARSQRGEGATTPPIPVRTKQYVPGAPPRNITAI-ATSSTTISLSWLPPPVERSNGRIIYYKVFFVEVGREDDEATTMTLNMTSIVLDELKRWTEYKIWVLAGTS-----VGDGPRSHPIILR----------TQEDVPGD-PQDVKATPLNSTSIHVSWKPPLEKDRNGIIRGYHI--HAQELRDEGKGFLNEPFKFDVVDTLEFNVTGLQPDTKYSIQVAALTRKGDGDRS--AAIVVKTPGGVPVRPTVSLKIMEREPIVSIELEWERPAQTYGELRGYRLRWGVKDQALKEEMLSGPQMTK-----KRFDNLERGVE----YEFRVAGSNHIGIGQETVKIFQ-TPEGTPG---GPPSNITIRFQTPDVLCVTWDPPTREHRNGIITRYDVQFHKKIDHGLGSERNMTLRKAVFTNLEENT 977          

HSP 3 Score: 138.658 bits (348), Expect = 3.781e-32
Identity = 217/921 (23.56%), Postives = 355/921 (38.55%), Query Frame = 1
Query:  289 TFTENDEAPKISLIIQSPNVLLFKSMILACSSTGHPVPSISWKINESPIEELKSPLKKLQNPPRIFSIKNYQNSVLVITQLIESDSNSVLICEAENNAGFDSRQQQLKVISTETDIPSGFPVFQNNFFPIIKPYNSNVTLVCQAYGNPPPLIQWFKNYELINESFTKIKILNDGNLLLVQVTREDKGIYHCQAQNTNGLRLSDPSTLDITSYPISPN-----SLIIERFASDNVEIS------------WRSGLNDVTEQENFILHYREVPENITEKQIMSKFVYLTISEKKSIYKYNLKDLFPFTTYCIWMESENPLGVSPPTIALTVKTLPTSPQLSPRSITATSISNTAILVAW--RPPERKFGKFKYYQIIYTNNDGFLPQHWRQFAVKDDNVMLTHLIASEL-----YHIRVKIVNEIGHGPLSKTISIKTIAGTLSQCP-DFKITEIFQSHIKLQWGTPDPVKLFKLIQYNLLCWDVRLKIVNATAKSSTLFPILNHNLSMN-EMEYVLYLKNEKEIKCRLSAINSDGKG-MPTEIQASTVNKGVNYQ--NLIHIDKIGSTYITFQWRPPSKFS---FDYFLWIYQIFDSEKLDRAVKLPKIKINISDSASAENGWFVYNYTNAFSSSRYILGLRYLCRDSTDILREYVHRSDLVSTMKSVPSDSPKDLVVKEIDSNSALVSWKPLDQVHSNGIITHYEVRYYAPKKEESTERFINVSETSAILSNLK-YFHYVIYVRAFTKVGGGSWSNPKNYYRQNLEEFPI-PTTIKGERKSETEINISWELPVLSEKNLAHAAIEGFIILYAPVESSPKW-----IKYTVQSKNLSAVIKGLEPDLRYQFQIAATNYAGFNGNFSEIVQEMPKNF---PNLNLKTVPDLRCSVQSSNRLKVEWSSPSIS-TDLLKFEIRYS 2922
            T  +    P+I    Q+  V +       C++ G P PSI W+ N   +   +S    L+ P  I        S+L I  +     ++   C AEN  G          I      P+GFPV        +      V + C+A GNP P I W KN   ++ S  +   L DG L +     ED+G Y C A+N+ G   S  + L +    + P        I E     N+ +S            W  G  D+T            PEN  E  I    + L           N+++   +T  CI   + + LG       + V++LPT+P      +  + ++ T++ + W  + PE      +YY I Y       P++  Q   +   ++  + +   L     Y   V  VN IG GP S   +  T    +   P + ++  +  S + + W  P+     ++  Y           V  T  S+      N  +  N E+  V  L        R+ A  S G G M T +Q     +GV  Q  N    D IG T +T QW  P+  S     Y L+    + ++   +          IS+S +       Y     +  + Y + L    +         +     V T + VP   P+++      S +  +SW P     SNG I +Y+V +    +E+     + ++ TS +L  LK +  Y I+V A T VG G  S+P     Q  E+ P  P  +K    + T I++SW+ P+  ++N     I G+ I    +    K       K+ V    L   + GL+PD +Y  Q+AA    G     + IV + P      P ++LK +   R  + S   +++EW  P+ +  +L  + +R+ 
Sbjct:   28 TIVDAAHPPEIIRKPQNQGVRVGGVASFYCAARGDPPPSIVWRKNGKKVSGTQSRYTVLEQPGGI--------SILRIEPVRAGRDDAPYECVAENGVGDAVSADATLTIYEGDKTPAGFPVITQGPGTRVIEVGHTVLMTCKAIGNPTPNIYWIKNQTKVDMSNPRYS-LKDGFLQIENSREEDQGKYECVAENSMGTEHSKATNLYVKVRRVPPTFSRPPETISEVMLGSNLNLSCIAVGSPMPHVKWMKGSEDLT------------PEN--EMPIGRNVLQLI----------NIQESANYT--CI---AASTLGQIDSVSVVKVQSLPTAPT----DVQISEVTATSVRLEWSYKGPE----DLQYYVIQYK------PKNANQAFSEISGIITMYYVVRALSPYTEYEFYVIAVNNIGRGPPSAPATCTTGETKMESAPRNVQVRTLSSSTMVITWEPPE-TPNGQVTGYK----------VYYTTNSNQPEASWNSQMVDNSELTTVSELTPHAIYTVRVQAYTSMGAGPMSTPVQVK-AQQGVPSQPSNFRATD-IGETAVTLQWTKPTHSSENIVHYELYWNDTYANQAHHK---------RISNSEA-------YTLDGLYPDTLYYIWLAARSQRGEGATTPPIP----VRTKQYVPGAPPRNITAIATSSTTISLSWLPPPVERSNGRIIYYKVFFVEVGREDDEATTMTLNMTSIVLDELKRWTEYKIWVLAGTSVGDGPRSHPIILRTQ--EDVPGDPQDVKATPLNSTSIHVSWKPPLEKDRN---GIIRGYHIHAQELRDEGKGFLNEPFKFDV-VDTLEFNVTGLQPDTKYSIQVAALTRKGDGDRSAAIVVKTPGGVPVRPTVSLKIME--REPIVS---IELEWERPAQTYGELRGYRLRWG 852          

HSP 4 Score: 102.064 bits (253), Expect = 4.798e-21
Identity = 121/479 (25.26%), Postives = 201/479 (41.96%), Query Frame = 1
Query: 2170 LVSTMKSVPSDSPKDLVVKEIDSNSALVSWKPLDQVHSNGIITHYEVRYYAPKKEESTERFINVSETSAILSNLKY-FHYVIYVRAFTKVGGGSWSNPKNYYRQNLEEFPIPTTIKGERKSETEINISWELPVLSEKNLAHAAIEGFIILY--APVESSPKWIKYTVQSKNLSAVIKGLEPDLRYQFQIAATNYAGFNGNFSE--IVQEMPKNFPNLNLKTVPDLRCSVQSSNRLKVEWSSPSISTDLLKFEIRYSGNLSYITEIGLKKSEFIDMESKSVNFETLVNRYDVTLENLQSNALYKIAVRAIYQNKELYESHRETTCDTMPAVPNLVKPPIIVGLDEEKSKVIIKLHRCSQRNGKISYYFVIVAAFQGNKNQQISFQEDTESYTFMELSVNTRSNNAKGEYIAI---MKDINDIFKVSGKDHSSVLLGDGTHDENHLSVNKKLEKNFNYRCFARVCLKYSNNSLCKSSPWSE 3582
            +  T +  P   P ++ ++    +   V+W P  + H NGIIT Y+V+++  K +       N++   A+ +NL+    Y+  VRA+TK G G +S+ K       +    P +++ E  SE    I WE PV S   L      G+ I Y    VE    W   TV     SA +  LE   +Y   IAA    G  G  SE   V+  P++ P LN      LR    S++ + + W SP I    + ++I +     ++   G  +++ +    + +  +  V  +  T+  L     Y + V AI  +       + T    M A   +VKP     ++ E  ++++ L + S+  G IS+Y+++V     +   +I  Q  T+      L    +       YIA     + I   F +            G+ D+ H   N+KLE+   YR F R  +      L  SSP+SE
Sbjct:  901 IFQTPEGTPGGPPSNITIRFQTPDVLCVTWDPPTREHRNGIITRYDVQFHK-KIDHGLGSERNMTLRKAVFTNLEENTEYIFRVRAYTKQGAGPFSD-KLIVETERDMGRAPMSLQAEATSEQTAEIWWE-PVTSRGKLL-----GYKIFYTMTAVEDLDDWQTKTV-GLTESADLVNLEKFAQYAVAIAARFKNGL-GRLSEKVTVRIKPEDVP-LN------LRAHDVSTHSMTLSW-SPPIRLTPVNYKISFDAMKVFVDSQGFSQTQIV--PKREIILKHYVKTH--TINELSPFTTYNVNVSAIPSDYSYRPPTKITVTTQMAAPQPMVKPDFYGVVNGE--EILVILPQASEEYGPISHYYLVVVPEDKSNLHKIPDQFLTDDL----LPGRNKPERPNAPYIAAKFPQRSIPFTFHL------------GSGDDYHNFTNRKLEREKRYRIFVRAVVDTPQKHLYTSSPFSE 1339          

HSP 5 Score: 53.5286 bits (127), Expect = 2.452e-6
Identity = 63/300 (21.00%), Postives = 119/300 (39.67%), Query Frame = 1
Query: 2203 SPKDLVVKEIDSNSALVSWKPLDQVHSNGIITHYEVRYYAPKKEESTE---RFINVSETSAILSNLKYFHYVIYVRAFTKVGGGSWSNPKNYYRQNLEEFPI-PTTIKGERKSETEINISWELPVLSEKNLAHAAIEGFIILYAPVESSPKWIKYTVQSKNLSAVIKGLEPDLRYQFQIAATNYAGFNGNFSEIVQEMPKNFPNLNLKTVPDLRCSVQSSNRLKVEWSSPSISTDLLKFEIRYSGNLSY----ITEIGLKKSEFIDMESKSVNFETLVNRYDVTLENLQSNALYKIAVRA 3078
            +P+++ V+ + S++ +++W+P +    NG +T Y+V Y     +       + ++ SE + +     +  Y + V+A+T +G G  S P     Q  +  P  P+  +     ET + + W  P  S +N+ H  +  +   YA          +   S + +  + GL PD  Y   +AA +  G       I     +  P    + +  +     SS  + + W  P +         R +G + Y      E+G +  E   M          +N   + L+ L+    YKI V A
Sbjct:  419 APRNVQVRTLSSSTMVITWEPPET--PNGQVTGYKVYYTTNSNQPEASWNSQMVDNSELTTVSELTPHAIYTVRVQAYTSMGAGPMSTPVQVKAQ--QGVPSQPSNFRATDIGETAVTLQWTKPTHSSENIVHYELY-WNDTYA------NQAHHKRISNSEAYTLDGLYPDTLYYIWLAARSQRGEGATTPPIPVRTKQYVPGAPPRNITAI---ATSSTTISLSWLPPPVE--------RSNGRIIYYKVFFVEVGREDDEATTM---------TLNMTSIVLDELKRWTEYKIWVLA 687          
BLAST of Protein tyrosine phosphatase receptor type D vs. Ensembl Fly
Match: Lar (gene:FBgn0000464 transcript:FBtr0331239)

HSP 1 Score: 665.611 bits (1716), Expect = 0.000e+0
Identity = 324/630 (51.43%), Postives = 424/630 (67.30%), Query Frame = 1
Query: 3937 PDLVNADSVQMCQD-GTKLSPVLVSDSIKLRIGSQKSENISDRPSISICNLYQYVTDLKANDCTLLQAEFETLNTNLDDRFTWQRSNIDSNKSKNRYANVVAYDHTSVLLTPVDDVIGSDYINANYIDGYQRQNAYIATQGPLPDTTDDFWRMVWEQRSNCIVMMTRLEERSGIKCHQYWPNRGFICYGQMIVSHIDTFVLAYYTIRLFEIRHSKYSEKREIQHFQFTAWPDHGVPKLSTPLLMFIRRVRSIGKIESCPKIVHCSAGVGRTGAFIVVDAQLERIKQEKNIDVFNYVSKIRCQRNYMVQTQAQYQFILETLLEAVEDGNTEVMACNFHAHVTKLSQIGISGSNQLSGFEMEFSKLNSLASNRGRHGVMLADFVKAAGNQAVNMTKNRVRNIIPYEWNRVVLNAIRGIEGSDYINASYIDGYRDRRAYIAAQSPIPSTVEDFWRMLWDQHCGVVIVLNQPHE---DKSHIYWPINKSIRYQFFVVDPVVEYNMPNYILREFKVTDARDGEFRALRQFQFTQWPNHGCPKESESILDFIRQVHKTKEQFGHMEPMVIHCNTGSGRTGVFIALSIVLDRLQQESVVDMYQTVKLLHKQRIGLVQTEEQYEFCYMAVLDYLSNYE 5814
            PD        M  D G   +P   SD + +R  + ++  +   P I I     ++  LK+ND      E+E++      +FTW  SN++ NKSKNRYANV AYDH+ V L  V+ V+GSDYINANY DGY++ NAY+ATQGPL +T  DFWRM WE ++  IVMMTRLEER+ IKC QYWP RG   YGQ+ V+  +T  LA Y+IR F++    ++++REI+  QFTAWPDHGVP    P L F+RR R++   ES P IVHCSAGVGRTG +IV+D+ LER+K EK ID++ +V+ +R QRNYMVQT+ QY FI + +LEA+  G TEV A N H H+ KL  +       +SG E+EF KL+++  +  +       FV A  N   N  KNR+ +I+PYE +RV L  I GIEGSDY+NAS+IDGYR R AYIAAQ P+    EDFWRMLW+ +  +V++L +  E   +K   YWP  +S+RYQ++VVDP+ EYNMP Y LREFKVTDARDG  R +RQFQF  WP  G PK  E  +DFI QVHKTKEQFG   P+ +HC+ G GR+GVFI LSIVL+R+Q E V+D++QTV++L  QR  +VQTE+QY FCY A L+YL +++
Sbjct: 1415 PDQAAVTRPLMAADLGAGPTP---SDPVDMRRLNFQTPGMISHPPIPISEFANHIERLKSNDNQKFSQEYESIEPG--QQFTWDNSNLEHNKSKNRYANVTAYDHSRVQLPAVEGVVGSDYINANYCDGYRKHNAYVATQGPLQETFVDFWRMCWELKTATIVMMTRLEERTRIKCDQYWPTRGTETYGQIFVTITETQELATYSIRTFQLCRQGFNDRREIKQLQFTAWPDHGVPDHPAPFLQFLRRCRALTPPESGPVIVHCSAGVGRTGCYIVIDSMLERMKHEKIIDIYGHVTCLRAQRNYMVQTEDQYIFIHDAILEAIICGVTEVPARNLHTHLQKL--LITEPGETISGMEVEFKKLSNVKMDSSK-------FVTA--NLPCNKHKNRLVHILPYESSRVYLTPIHGIEGSDYVNASFIDGYRYRSAYIAAQGPVQDAAEDFWRMLWEHNSTIVVMLTKLKEMGREKCFQYWPHERSVRYQYYVVDPIAEYNMPQYKLREFKVTDARDGSSRTVRQFQFIDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQDGPITVHCSAGVGRSGVFITLSIVLERMQYEGVLDVFQTVRILRSQRPAMVQTEDQYHFCYRAALEYLGSFD 2028          

HSP 2 Score: 160.999 bits (406), Expect = 6.194e-39
Identity = 216/948 (22.78%), Postives = 389/948 (41.03%), Query Frame = 1
Query:  256 ITQLVLINSQITFTENDEAPK-ISLIIQSPNVLLFK---SMILACSSTGHPVPSISWKINESPIEELKSPLKKLQNPPRIFSIKNYQNSVLVITQLIESDSNSVLICEAENNAGFD-SRQQQLKVISTETDIPSGFPVFQNNFFPIIKPYNSNVTLVCQAYGNPPPLIQWFKNYELINESFTKIKILNDGNLLLVQVTREDKGIYHCQAQNTNGLRLSDPSTLDITSYPISPNSLIIERFASDNVEISWR-SGLNDVTEQENFILHYREVPENITEKQIMSKFVYLTISEKKSIYKYNLKDLFPFTTYCIWMESENPLGVSPPTIALTVKTL-----PTSPQLSPRSITATSISNTAILVAWRPPERKFGKFKYYQIIYTNNDGFLPQHWRQFAVKDDNVM-LTHLIASELYHIRVKIVNEIGHGPLSKTISIKTIAGTLSQCPDFKITEIFQSHIKLQWGTPDPVKLFKLIQYNLLCWDVRLKIVNATAKSSTLFPILNHNLSMNEMEYVL-YLKNEKEIKCRLSAINSDGKGMPT-EIQASTVNKGVNYQNLIHIDKIGSTYITFQWRPPSKFSFDYFLWIYQIFDSEKLDRAVKLPKIKINISDSASAE-NGWFVYNYTNAFSSSRYILGLRYLCRDSTDILREYVHRSDLVSTMKSVPSDSPKDLVVKEIDSNSALVSWKPLDQVHSNGIITHYEVRYYAPKKEESTERFINVSETSAILSNLKY--------FHYVIYVRAFTKVGGGSWSNPKNYYRQNLEEFPIPTTIK---GERKSETEINISWELPVLSEKNLAHAAIEGFI---ILYAPVESSPKWIKYTVQSKNLSAVIKGLEPDLRYQFQIAATNYAGFNGNFSEIVQEMPKNFPNLNLKTVPDLRCSVQSSNRLKVEWSSPS-------ISTDLLKFEIRYSGNLSYITEIGLKKSEFIDMESKS 2991
            +   V  ++ +T  E D+ P    +I Q P   + +   ++++ C + G+P P+I W  N++ ++        + NP   +S+K+     L I    E D      C AEN+ G + S+   L V      +P  F         ++    SN+ L C A G+P P ++W K     +E  T    +  G  +L  +  ++   Y C A +T G ++   S + + S P +P  + I    + +V + W   G  D+   + +++ Y+  P+N  +        +  IS   ++Y Y ++ L P+T Y  ++ + N +G  PP+   T  T       T  + +PR++   ++S++ +++ W PPE   G+   Y++ YT N       W    V +  +  ++ L    +Y +RV+    +G GP+S  + +K   G  SQ  +F+ T+I ++ + LQW  P       ++ Y L  W+             T     +H    N   Y L  L  +      L+A +  G+G  T  I   T   G   +N+  I    ST I+  W PP     +  +  Y++F  E      +   + +N++     E   W  Y       +S     +    R    ILR          T + VP D P+D+    ++S S  VSWKP  +   NGII  Y +  +A +  +  + F+N      ++  L++          Y I V A T+ G G  S       +     P+  T+     ER+    I + WE P  +   L    +   +    L   + S P+  K     K    + +G+E    Y+F++A +N+ G      +I Q  P+  P        ++    Q+ + L V W  P+       I+   ++F  +    L     + L+K+ F ++E  +
Sbjct:  117 VGDAVSADATLTIYEGDKTPAGFPVITQGPGTRVIEVGHTVLMTCKAIGNPTPNIYWIKNQTKVD--------MSNP--RYSLKD---GFLQIENSREEDQGKYE-CVAENSMGTEHSKATNLYVKVRR--VPPTFSRPPETISEVM--LGSNLNLSCIAVGSPMPHVKWMKG----SEDLTPENEMPIGRNVLQLINIQESANYTCIAASTLG-QIDSVSVVKVQSLPTAPTDVQISEVTATSVRLEWSYKGPEDL---QYYVIQYK--PKNANQ-------AFSEISGIITMY-YVVRALSPYTEYEFYVIAVNNIGRGPPSAPATCTTGDFSFGGTKMESAPRNVQVRTLSSSTMVITWEPPETPNGQVTGYKVYYTTNSNQPEASWNSQMVDNSELTTVSELTPHAIYTVRVQAYTSMGAGPMSTPVQVKAQQGVPSQPSNFRATDIGETAVTLQWTKPTHSSE-NIVHYELY-WN------------DTYANQAHHKRISNSEAYTLDGLYPDTLYYIWLAARSQRGEGATTPPIPVRTKQYGAPPRNITAI-ATSSTTISLSWLPPPVERSNGRIIYYKVFFVEVGREDDEATTMTLNMTSIVLDELKRWTEYKIWVLAGTS-----VGDGPRSHPIILR----------TQEDVPGD-PQDVKATPLNSTSIHVSWKPPLEKDRNGIIRGYHI--HAQELRDEGKGFLNEPFKFDVVDTLEFNVTGLQPDTKYSIQVAALTRKGDGDRS--AAIVVKTPGGVPVRPTVSLKIMEREPIVSIELEWERPAQTYGELRGYRLRWGVKDQALKEEMLSGPQMTK-----KRFDNLERGVE----YEFRVAGSNHIGIGQETVKIFQ-TPEGTPG---GPPSNITIRFQTPDVLCVTWDPPTREHRNGIITRYDVQFHKKIDHGLGSERNMTLRKAVFTNLEENT 980          

HSP 3 Score: 135.191 bits (339), Expect = 3.939e-31
Identity = 205/874 (23.46%), Postives = 346/874 (39.59%), Query Frame = 1
Query: 1051 ENITEKQIMSKFVYLTISEKKSIY---KYNLKDLFPFTTYCIWMESENPLGVSPPTIALTVKTLPTSPQLSPRSITATSISNTAILVAWRPP--ERKFGKFKYYQIIYTNNDGFLPQHWRQFAVKDDNVM-----LTHLIASEL-----YHIRVKIVNEIGHGPLSKTISIKTIAGTLSQCPDFKITEIFQSHIKLQWGTPDPVKLFKLIQ-YNLLCWDVRLK---IVNATAKSSTLFPILNHNLSMNEMEYVLYLKNEKEIKCRLSAINSDGKGMPTEIQASTVNKGVNYQNLIHI---DKIGSTYITFQWRPPSKFSFDYFLWIYQIFDSEKLDRAVKLPKIKINISDSASAENGWFVYNYTNAFSSSRYILGLRYLCRDSTDILREYVHRSDLVSTMKSVPSDSPKDLVVKEIDSNSALVSWKPLDQVHSNGIITHYEVRYYAPKKEESTERFINVSETSAILSNLKY-FHYVIYVRAFTKVGGGSWSNPKNYYRQNLEEFPIPTTIKGERKSETEINISWELPVLSEKNLAHAAIEGFIILY--APVESSPKWIKYTVQSKNLSAVIKGLEPDLRYQFQIAATNYAGFNGNFSE--IVQEMPKNFPNLNLKTVPDLRCSVQSSNRLKVEWSSPSISTDLLKFEIRYSGNLSYITEIGLKKSEFIDMESKSVNFETLVNRYDVTLENLQSNALYKIAVRAIYQNKELYESHRETTCDTMPAVPNLVKPPIIVGLDEEKSKVIIKLHRCSQRNGKISYYFVIVAAFQGNKNQQISFQEDTESYTFMELSVNTRSNNAKGEYIAI---MKDINDIFKVSGKDHSSVLLGDGTHDENHLSVNKKLEKNFNYRCFARVCLKYSNNSLCKSSPWSE 3582
            ENI   ++     Y   +  K I     Y L  L+P T Y IW+ + +  G    T  + V+T        PR+ITA + S+T I ++W PP  ER  G+  YY++ +            +   +DD        +T ++  EL     Y I V     +G GP S  I ++T         D K T +  + I + W  P       +I+ Y++   ++R +    +N   K    F +++  L  N    V  L+ + +   +++A+   G G  +         GV  +  + +   ++     I  +W  P++         Y      +L   VK   +K  +          F     N      Y    R    +   I +E V    +  T +  P   P ++ ++    +   V+W P  + H NGIIT Y+V+++  K +       N++   A+ +NL+    Y+  VRA+TK G G +S+ K       +    P +++ E  SE    I WE PV S   L      G+ I Y    VE    W   TV     SA +  LE   +Y   IAA    G  G  SE   V+  P++ P LN      LR    S++ + + W SP I    + ++I +     ++   G  +++ +    + +  +  V  +  T+  L     Y + V AI  +       + T    M A   +VKP     ++ E  ++++ L + S+  G IS+Y+++V     +   +I  Q  T+      L    +       YIA     + I   F +            G+ D+ H   N+KLE+   YR F R  +      L  SSP+SE
Sbjct:  548 ENIVHYELYWNDTYANQAHHKRISNSEAYTLDGLYPDTLYYIWLAARSQRGEGATTPPIPVRTKQYG--APPRNITAIATSSTTISLSWLPPPVERSNGRIIYYKVFFV-----------EVGREDDEATTMTLNMTSIVLDELKRWTEYKIWVLAGTSVGDGPRSHPIILRTQEDVPGDPQDVKATPLNSTSIHVSWKPPLEKDRNGIIRGYHIHAQELRDEGKGFLNEPFK----FDVVD-TLEFN----VTGLQPDTKYSIQVAALTRKGDGDRSAAIVVKTPGGVPVRPTVSLKIMEREPIVSIELEWERPAQ--------TYGELRGYRLRWGVKDQALKEEMLSGPQMTKKRF----DNLERGVEY--EFRVAGSNHIGIGQETV---KIFQTPEGTPGGPPSNITIRFQTPDVLCVTWDPPTREHRNGIITRYDVQFHK-KIDHGLGSERNMTLRKAVFTNLEENTEYIFRVRAYTKQGAGPFSD-KLIVETERDMGRAPMSLQAEATSEQTAEIWWE-PVTSRGKLL-----GYKIFYTMTAVEDLDDWQTKTV-GLTESADLVNLEKFAQYAVAIAARFKNGL-GRLSEKVTVRIKPEDVP-LN------LRAHDVSTHSMTLSW-SPPIRLTPVNYKISFDAMKVFVDSQGFSQTQIV--PKREIILKHYVKTH--TINELSPFTTYNVNVSAIPSDYSYRPPTKITVTTQMAAPQPMVKPDFYGVVNGE--EILVILPQASEEYGPISHYYLVVVPEDKSNLHKIPDQFLTDDL----LPGRNKPERPNAPYIAAKFPQRSIPFTFHL------------GSGDDYHNFTNRKLEREKRYRIFVRAVVDTPQKHLYTSSPFSE 1342          

HSP 4 Score: 127.487 bits (319), Expect = 9.666e-29
Identity = 217/932 (23.28%), Postives = 355/932 (38.09%), Query Frame = 1
Query:  289 TFTENDEAPKISLIIQSPNVLLFKSMILACSSTGHPVPSISWKINESPIEELKSPLKKLQNPPRIFSIKNYQNSVLVITQLIESDSNSVLICEAENNAGFDSRQQQLKVISTETDIPSGFPVFQNNFFPIIKPYNSNVTLVCQAYGNPPPLIQWFKNYELINESFTKIKILNDGNLLLVQVTREDKGIYHCQAQNTNGLRLSDPSTLDITSYPISPN-----SLIIERFASDNVEIS------------WRSGLNDVTEQENFILHYREVPENITEKQIMSKFVYLTISEKKSIYKYNLKDLFPFTTYCIWMESENPLGVSPPTIALTVKTLPTSPQLSPRSITATSISNTAILVAW--RPPERKFGKFKYYQIIYTNNDGFLPQHWRQFAVKDDNVMLTHLIASEL-----YHIRVKIVNEIGHGPLSKTISIKT----IAGT-LSQCP-DFKITEIFQSHIKLQWGTPDPVKLFKLIQYNLLCWDVRLKIVNATAKSSTLFPILNHNLSMN-EMEYVLYLKNEKEIKCRLSAINSDGKG-MPTEIQASTVNKGVNYQ--NLIHIDKIGSTYITFQWRPPSKFS---FDYFLWIYQIFDSEKLDRAVKLPKIKINISDSASAENGWFVYNYTNAFSSSRYILGLRYLCRDSTDILREYVHRSDLVSTMKSVP------SDSPKDLVVKEIDSNSALVSWKPLDQVHSNGIITHYEVRYYAPKKEESTERFINVSETSAILSNLK-YFHYVIYVRAFTKVGGGSWSNPKNYYRQNLEEFPI-PTTIKGERKSETEINISWELPVLSEKNLAHAAIEGFIILYAPVESSPKW-----IKYTVQSKNLSAVIKGLEPDLRYQFQIAATNYAGFNGNFSEIVQEMPKNF---PNLNLKTVPDLRCSVQSSNRLKVEWSSPSIS-TDLLKFEIRYS 2922
            T  +    P+I    Q+  V +       C++ G P PSI W+ N   +   +S    L+ P  I        S+L I  +     ++   C AEN  G          I      P+GFPV        +      V + C+A GNP P I W KN   ++ S  +   L DG L +     ED+G Y C A+N+ G   S  + L +    + P        I E     N+ +S            W  G  D+T            PEN  E  I    + L           N+++   +T  CI   + + LG       + V++LPT+P      +  + ++ T++ + W  + PE      +YY I Y       P++  Q   +   ++  + +   L     Y   V  VN IG GP S   +  T      GT +   P + ++  +  S + + W  P+     ++  Y           V  T  S+      N  +  N E+  V  L        R+ A  S G G M T +Q     +GV  Q  N    D IG T +T QW  P+  S     Y L+    + ++   +          IS+S +       Y     +  + Y + L    +                +T   +P         P+++      S +  +SW P     SNG I +Y+V +    +E+     + ++ TS +L  LK +  Y I+V A T VG G  S+P     Q  E+ P  P  +K    + T I++SW+ P+  ++N     I G+ I    +    K       K+ V    L   + GL+PD +Y  Q+AA    G     + IV + P      P ++LK +   R  + S   +++EW  P+ +  +L  + +R+ 
Sbjct:   28 TIVDAAHPPEIIRKPQNQGVRVGGVASFYCAARGDPPPSIVWRKNGKKVSGTQSRYTVLEQPGGI--------SILRIEPVRAGRDDAPYECVAENGVGDAVSADATLTIYEGDKTPAGFPVITQGPGTRVIEVGHTVLMTCKAIGNPTPNIYWIKNQTKVDMSNPRYS-LKDGFLQIENSREEDQGKYECVAENSMGTEHSKATNLYVKVRRVPPTFSRPPETISEVMLGSNLNLSCIAVGSPMPHVKWMKGSEDLT------------PEN--EMPIGRNVLQLI----------NIQESANYT--CI---AASTLGQIDSVSVVKVQSLPTAPT----DVQISEVTATSVRLEWSYKGPE----DLQYYVIQYK------PKNANQAFSEISGIITMYYVVRALSPYTEYEFYVIAVNNIGRGPPSAPATCTTGDFSFGGTKMESAPRNVQVRTLSSSTMVITWEPPE-TPNGQVTGYK----------VYYTTNSNQPEASWNSQMVDNSELTTVSELTPHAIYTVRVQAYTSMGAGPMSTPVQVK-AQQGVPSQPSNFRATD-IGETAVTLQWTKPTHSSENIVHYELYWNDTYANQAHHK---------RISNSEA-------YTLDGLYPDTLYYIWLAARSQRGEG------------ATTPPIPVRTKQYGAPPRNITAIATSSTTISLSWLPPPVERSNGRIIYYKVFFVEVGREDDEATTMTLNMTSIVLDELKRWTEYKIWVLAGTSVGDGPRSHPIILRTQ--EDVPGDPQDVKATPLNSTSIHVSWKPPLEKDRN---GIIRGYHIHAQELRDEGKGFLNEPFKFDV-VDTLEFNVTGLQPDTKYSIQVAALTRKGDGDRSAAIVVKTPGGVPVRPTVSLKIME--REPIVS---IELEWERPAQTYGELRGYRLRWG 855          

HSP 5 Score: 53.1434 bits (126), Expect = 3.183e-6
Identity = 65/301 (21.59%), Postives = 120/301 (39.87%), Query Frame = 1
Query: 2203 SPKDLVVKEIDSNSALVSWKPLDQVHSNGIITHYEVRYYAPKKEESTE---RFINVSETSAILSNLKYFHYVIYVRAFTKVGGGSWSNPKNYYRQNLEEFPI-PTTIKGERKSETEINISWELPVLSEKNLAHAAIEGFIILYAPVESSPKWIKYTVQSKNLSAVIKGLEPDLRYQFQIAATNYAGFNGNFSEI-VQEMPKNFPNLNLKTVPDLRCSVQSSNRLKVEWSSPSISTDLLKFEIRYSGNLSY----ITEIGLKKSEFIDMESKSVNFETLVNRYDVTLENLQSNALYKIAVRA 3078
            +P+++ V+ + S++ +++W+P +    NG +T Y+V Y     +       + ++ SE + +     +  Y + V+A+T +G G  S P     Q  +  P  P+  +     ET + + W  P  S +N+ H  +  +   YA          +   S + +  + GL PD  Y   +AA +  G       I V+      P  N+  +        SS  + + W  P +         R +G + Y      E+G +  E   M          +N   + L+ L+    YKI V A
Sbjct:  424 APRNVQVRTLSSSTMVITWEPPET--PNGQVTGYKVYYTTNSNQPEASWNSQMVDNSELTTVSELTPHAIYTVRVQAYTSMGAGPMSTPVQVKAQ--QGVPSQPSNFRATDIGETAVTLQWTKPTHSSENIVHYELY-WNDTYA------NQAHHKRISNSEAYTLDGLYPDTLYYIWLAARSQRGEGATTPPIPVRTKQYGAPPRNITAI------ATSSTTISLSWLPPPVE--------RSNGRIIYYKVFFVEVGREDDEATTM---------TLNMTSIVLDELKRWTEYKIWVLA 690          
BLAST of Protein tyrosine phosphatase receptor type D vs. Ensembl Zebrafish
Match: ptprfa (protein tyrosine phosphatase receptor type Fa [Source:ZFIN;Acc:ZDB-GENE-020107-2])

HSP 1 Score: 720.694 bits (1859), Expect = 0.000e+0
Identity = 331/606 (54.62%), Postives = 440/606 (72.61%), Query Frame = 1
Query: 4006 SDSIKLRIGSQKSENISDRPSISICNLYQYVTDLKANDCTLLQAEFETLNTNLDDRFTWQRSNIDSNKSKNRYANVVAYDHTSVLLTPVDDVIGSDYINANYIDGYQRQNAYIATQGPLPDTTDDFWRMVWEQRSNCIVMMTRLEERSGIKCHQYWPNRGFICYGQMIVSHIDTFVLAYYTIRLFEIRHSKYSEKREIQHFQFTAWPDHGVPKLSTPLLMFIRRVRSIGKIESCPKIVHCSAGVGRTGAFIVVDAQLERIKQEKNIDVFNYVSKIRCQRNYMVQTQAQYQFILETLLEAVEDGNTEVMACNFHAHVTKLSQIGISGSNQLSGFEMEFSKLNSLASNRGRHGVMLADFVKAAGNQAVNMTKNRVRNIIPYEWNRVVLNAIRGIEGSDYINASYIDGYRDRRAYIAAQSPIPSTVEDFWRMLWDQHCGVVIVLNQPHE---DKSHIYWPINKSIRYQFFVVDPVVEYNMPNYILREFKVTDARDGEFRALRQFQFTQWPNHGCPKESESILDFIRQVHKTKEQFGHMEPMVIHCNTGSGRTGVFIALSIVLDRLQQESVVDMYQTVKLLHKQRIGLVQTEEQYEFCYMAVLDYLSNYE 5814
            SD +++R  + +++ + + P +S+C L  ++  L+AND      E+E+++     +FTW+ SN++ NK KNRYANV+AYDH+ V+LTPVD V GSDYIN NYIDGY++QNAYIATQGPLP+T  DFWRMVWEQR++ IVMMTRLEE+S +KC QYWP+RG   YG + VS +DT  LA Y++R F +  +  SEKRE++ FQF AWPDHGVP+  TP+L F+RRV++    ++ P +VHCSAGVGRTG FIV+DA LER+K EK++D++ +V+ +R QRNYMVQT+ QY FI E LLEA   GNTEV A + + H+ KL+Q      + ++  E+EF KL +  ++  R       F+ A+     N  KNR+ NI+P+E +RV L  IRG+EGSDYINAS+IDGYR ++AYIA Q P+  T EDFWRMLW+ +  +V++L +  E   +K H YWP  +S RYQ+FVVDP+ EYNMP YILREFKVTDARDG+ R +RQFQFT WP  G PK  E  +DFI QVHKTKEQFG   P+ +HC+ G GRTGVFI LSIVL+R++ E VVDM+QT+K L  QR  +VQTE+QY+ CY A L+YL +++
Sbjct: 1301 SDPVEMRRLNYQTQGMREHPPVSVCALADHIERLRANDSLRFSQEYESVDPG--QQFTWENSNLEVNKPKNRYANVIAYDHSRVVLTPVDGVPGSDYINGNYIDGYRKQNAYIATQGPLPETLSDFWRMVWEQRTSTIVMMTRLEEKSRVKCDQYWPSRGTETYGMIQVSMLDTVELATYSVRTFALYKNGSSEKREVRQFQFMAWPDHGVPEYPTPILAFLRRVKACNPPDAGPMVVHCSAGVGRTGCFIVIDAMLERMKHEKSVDIYGHVTCMRSQRNYMVQTEDQYIFIHEALLEAATCGNTEVPARSLYTHIQKLTQ--APPGDTVTAMELEFKKLANSKAHTSR-------FISAS--LPCNKFKNRLVNIMPFESSRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLSETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTIRQFQFTDWPEQGVPKTGEGFIDFIGQVHKTKEQFGQDGPITVHCSAGVGRTGVFITLSIVLERMRYEGVVDMFQTIKTLRTQRPAMVQTEDQYQLCYRAALEYLGSFD 1893          

HSP 2 Score: 202.601 bits (514), Expect = 1.585e-51
Identity = 103/263 (39.16%), Postives = 150/263 (57.03%), Query Frame = 1
Query: 5092 NQAVNMTKNRVRNIIPYEWNRVVLNAIRGIEGSDYINASYIDGYRDRRAYIAAQSPIPSTVEDFWRMLWDQHCGVVIVLNQPHEDKSHI----YWPINKSIRYQFFVVDPVVEYNMPNYILREFKVTDARDGEFRALRQFQFTQWPNHGCPKESESILDFIRQVHKTKEQFGHMEPMVIHCNTGSGRTGVFIALSIVLDRLQQESVVDMYQTVKLLHKQRIGLVQTEEQYEFCYMAVLDYLSNYEKILEKSHLY*TYQDLSES 5868
            N  VN  KNR  N+I Y+ +RVVL  + G+ GSDYIN +YIDGYR + AYIA Q P+P T+ DFWRM+W+Q    ++++ +  E+KS +    YWP   +  Y    V  +    +  Y +R F +      E R +RQFQF  WP+HG P+    IL F+R+V           PMV+HC+ G GRTG FI +  +L+R++ E  VD+Y  V  +  QR  +VQTE+QY F + A+L+  +     +    LY   Q L+++
Sbjct: 1361 NLEVNKPKNRYANVIAYDHSRVVLTPVDGVPGSDYINGNYIDGYRKQNAYIATQGPLPETLSDFWRMVWEQRTSTIVMMTR-LEEKSRVKCDQYWPSRGTETYGMIQVSMLDTVELATYSVRTFALYKNGSSEKREVRQFQFMAWPDHGVPEYPTPILAFLRRVKACNPP--DAGPMVVHCSAGVGRTGCFIVIDAMLERMKHEKSVDIYGHVTCMRSQRNYMVQTEDQYIFIHEALLEAATCGNTEVPARSLYTHIQKLTQA 1620          

HSP 3 Score: 151.369 bits (381), Expect = 7.472e-36
Identity = 231/1011 (22.85%), Postives = 377/1011 (37.29%), Query Frame = 1
Query:  370 LACSSTGHPVPSISWKINESPIEELKSPLKKLQNPPRIFSIKNYQNSVLVITQLIESDSNSVLICEAENNAGFDSRQQQLKVISTETDIPSGFPVFQNNFFPIIKPYNSNVTLVCQAYGNPPPLIQWFKNYEL--INESFTKIKILNDGNLLLVQVTREDKGIYHCQAQNTNGLRLSDPSTLDI------TSYPISPNSLIIERFASDNVE----------ISWRSGLNDVTEQENFILHYREVPENITEKQIMSKFVYLTISEKKSIYKYNLKDLFPFTTYCIWMESENPLGVSPPTIALTVKTLPTSPQLSPRSITATSISNTAILVAWRP--PERKFGKFKYYQIIY---TNNDGFLPQHWRQFAVKDDNVMLTHLIASELYHIRVKIVNEIGHGPLSKTISIKTIAGTLSQCP-DFKITEIFQSHIKLQWGTPDPVKLFKLIQYNLLCWDVRLKIVNATAKSSTLFPI---LNHNLSMNEMEYVLYLKNEKEIKCRLSAINSDGKGMPTEIQASTVNKGVNYQNL-IHIDKIGSTYITFQWRPPSKFSFDYFLWIYQIFDSEKLDRAVKLPKIKINISDSASAENGWFVYNYTNAFSSSRYILGLRYLCRDSTDILREYVHRSDLVSTMKSVPSDSPKDLVVKEIDSNSALVSWKPLDQVHSNGIITHYEVRYYAPKKEESTE---RFINVSETSAILSNL-KYFHYVIYVRAFTKVGGGSWSNPKNYYRQNLEEFPIPTTIKGERKSETEINISWELPVLSEKNLAHAAIEGFIILYAPVESS-PKW---IKYTVQSKNLSAVIKGLEPDLRYQFQIAATNYAGFNGNFSEIVQEMPKNFPNLNLKTVPDLRCSVQSSNRLKVEWSSP-SISTDLLKFEIRYSGNLSYITEIGLKKSEFIDMESKSVNFETLVNRYDVTLENLQSNALYKIAVRAIYQNKELYESHRETTCDTMPAVPNLVKPPIIVGLDEEKSKVIIKLHRCSQRNGKISYYFVIVAAFQGNKNQ 3291
              C + G P P I+W         +K   K       +    +   SVL I  L      ++  C A N+ G  +   +L V+  E  IP GFP         +       T++C A GNP P I WFK++    IN S  +IK L  G L +      D+G Y C A N+ G R S P+ L +        + I P +  +    S N+           + W  G  ++T++E              E  I    + LT          N++    +T  C+ + S   LG+   T  +TVK LP  P     S+  T  + T++ + W    PE       YY I Y    +++GF         V      +  L     Y  RV  VN IG GP S  +  +T     S  P   +   +  + + +QW  P+               + +++       S   FP+     HN   + +  +  L  +     R+ A  S G G P++I      +GV  Q      +    T I   W  P +     +   Y   DS+     +  P     I DS   +    +Y ++ A   +R  +GL    +                 T +S PS  P+++ +  + S+S  VSW        +G I  Y + Y A   E+      + I    +S +L  L K+  Y ++V+A T VG G  S       Q       P  ++ +  + T + +SW+ P+  ++   H  I G+ ++Y+ +E+  P+    I      +   AVI GL P+  Y   +AA    G        V       P       P +  S    N   ++W  P  +  +L+ + +RY             K E  D+ +   +F    + + VT  +  +  ++K+  +    N E Y     T  D   + P  +K   +VGL    +K+        +RNGKI  Y V+      ++NQ
Sbjct:   52 FVCQAVGEPKPRITW---------MKKGKKVSSQRFEVIEFDDGSGSVLRIQPLRTHRDEAIYECTATNSVGEINTSAKLTVLE-EDQIPHGFPTIDMGPQLKVVERTRTATMLCAASGNPDPEISWFKDFLPVDINSSNGRIKQLRSGALQIENSEESDQGKYECVAVNSAGTRYSAPANLYVRVRRVPPRFSIPPTNHEVMPGGSVNLTCVAVGAPMPYVKWMKGEQELTKEE--------------EMPIGRNVLELT----------NIRQSGNYT--CVAISS---LGMIDTTAQITVKALPRPPA----SLIVTETTATSVTLTWDSGNPE----PVSYYVIQYRSKISDNGFQ----EVDGVASTRYSIGGLSPYSEYEFRVMAVNNIGRGPPSGMVETRTSEQAPSSPPLRVQARMLSATTMLVQWEPPEEP-------------NGQIRGYRVYYTSDLHFPLSTWQKHNTEDSSLTTISGLVPDITYGLRVLAFTSVGDGPPSDILQVKTQQGVPAQPTGFEAEAELDTRIMLSWLWPVQDQITKYELTYWEADSDNKHHVIFDPAGSYAI-DSLKPDT---LYKFSLA---ARSEMGLGVYTQPIE------------ARTAQSAPSAPPQEVHLISLSSSSIKVSWVAPPAASRHGSIVRYSLAYQAVSGEDQERHEVKDIPADVSSYVLEGLEKWTEYTVWVKAHTDVGPGPESGSTRIRTQEDVPGAPPRRVEVDNINSTALRVSWKPPLQQKQ---HGHIRGYQVVYSRLENGEPRGQPIILDVALPEAQEAVISGLLPETTYSVTVAAYTTKGDGARSKAKVVTTTGAVPGK-----PTMIISTTIGNTALIQWQPPKEMVGELMGYRLRY-------------KREEEDIYTVR-DFRRTDDHFTVTGLHKGATYIFKLCAKNRAGNGEEYSKEISTPEDVPSSYPQNLK---VVGLTTTTTKLAWDPPPLPERNGKIVRYVVVYRDINSHQNQ 954          

HSP 4 Score: 140.969 bits (354), Expect = 9.882e-33
Identity = 207/898 (23.05%), Postives = 358/898 (39.87%), Query Frame = 1
Query:  277 NSQITFTENDEAP----KISLIIQSPNVLLFKSMILACSSTGHPVPSISWKINESPIEELKSPLKKLQNPPRIFSIKNYQNSVLVITQLIESDSNSVLICEAENNAGFD-SRQQQLKVISTETDIPSGFPVFQNNFFPIIKPYNSNVTLVCQAYGNPPPLIQWFKNYELINESFTKIKILNDGNLLLVQVTREDKGIYHCQAQNTNGLRLSDPSTLDITSYPISPNSLIIERFASDNVEISWRSGLNDVTEQENFILHYREVPENITEKQIMSKFVYLTISEKKSIY--KYNLKDLFPFTTYCIWMESENPLGVSPPTIALTVKTLPTSPQLSPRSITATSISNTAILVAWRPPERKFGKFKYYQIIYTNNDGFLPQHWRQFAVKDDNV-MLTHLIASELYHIRVKIVNEIGHGPLSKTISIKTIAGTLSQCPDFKITEIFQSHIKLQWGTPDPVKLFKLIQYNLLCWDVRLKIVNATAKSSTLF-PILNHNLSMNEMEYVLYLKNEKEIKCRLSAINSDGKGMPTE-IQASTVNKGVNY-QNLIHIDKIGSTYITFQW-RPPSK---FSFDYFLWIYQIFDSEKLDRAVKLPKIKINISDSA-SAENGWFVYNYTNAFSSSRYILGLRYLCRDSTDILREYVHRSDLVSTMKSVPSDSPKDLVVKEIDSNSALVSWKPLDQVHSNGIITHYEVRYYAPKKEESTERFINV------SETSAILSNLKYFHYVIYVRAFTKVGGGSWSNPKNYYRQNLEEFPIPTTIKGERKSETEINISWELPVLSEKNLAHAAIEGFIILYAPVESSPKWIKYTVQSKNLSA---VIKGLEPDLRYQFQIAATNYAGFNGNFSEIV---QEMPKNFPNLNLKTVPDLRCSVQSSNRLKVEWSSPSI 2886
            ++++T  E D+ P     I +  Q   V   ++  + C+++G+P P ISW  +  P++   S  +          IK  ++  L I    ESD      C A N+AG   S    L V           P   +   P       +V L C A G P P ++W K      +  TK + +  G  +L        G Y C A ++ G+ +   + + + + P  P SLI+    + +V ++W SG  +      +++ YR            SK       E   +   +Y++  L P++ Y   + + N +G  PP+  +  +T   +P   P  + A  +S T +LV W PPE   G+ + Y++ YT++  F    W++   +D ++  ++ L+    Y +RV     +G GP S  + +KT  G  +Q   F+      + I L W  P   ++ K   Y L  W+      ++  K   +F P  ++ +          LK +   K  L+A +  G G+ T+ I+A T     +     +H+  + S+ I   W  PP+     S   +   YQ    E  +R  ++  I  ++S         W  Y                   +  TD+       S  + T + VP   P+ + V  I+S +  VSWKP  Q   +G I  Y+V Y   +  E   + I +      ++ + I   L    Y + V A+T  G G+ S  K            PT I       T + I W+ P    K +    + G+ + Y   E       YTV+    +     + GL     Y F++ A N AG    +S+ +   +++P ++P  NLK V        ++   K+ W  P +
Sbjct:  119 SAKLTVLEEDQIPHGFPTIDMGPQLKVVERTRTATMLCAASGNPDPEISWFKDFLPVDINSSNGR----------IKQLRSGALQIENSEESDQGK-YECVAVNSAGTRYSAPANLYVRVRRVPPRFSIPPTNHEVMP-----GGSVNLTCVAVGAPMPYVKWMKG----EQELTKEEEMPIGRNVLELTNIRQSGNYTCVAISSLGM-IDTTAQITVKALPRPPASLIVTETTATSVTLTWDSGNPEPVSY--YVIQYR------------SKISDNGFQEVDGVASTRYSIGGLSPYSEYEFRVMAVNNIGRGPPSGMVETRTSEQAPSSPPLRVQARMLSATTMLVQWEPPEEPNGQIRGYRVYYTSDLHFPLSTWQKHNTEDSSLTTISGLVPDITYGLRVLAFTSVGDGPPSDILQVKTQQGVPAQPTGFEAEAELDTRIMLSWLWPVQDQITK---YELTYWE-----ADSDNKHHVIFDPAGSYAIDS--------LKPDTLYKFSLAARSEMGLGVYTQPIEARTAQSAPSAPPQEVHLISLSSSSIKVSWVAPPAASRHGSIVRYSLAYQAVSGEDQERH-EVKDIPADVSSYVLEGLEKWTEYT---------------VWVKAHTDVGPGPESGSTRIRTQEDVPGAPPRRVEVDNINSTALRVSWKPPLQQKQHGHIRGYQVVYSRLENGEPRGQPIILDVALPEAQEAVISGLLPETTYSVTVAAYTTKGDGARSKAKVVTTTGAVPGK-PTMIISTTIGNTAL-IQWQPP----KEMV-GELMGYRLRYKREEED----IYTVRDFRRTDDHFTVTGLHKGATYIFKLCAKNRAGNGEEYSKEISTPEDVPSSYPQ-NLKVV------GLTTTTTKLAWDPPPL 931          

HSP 5 Score: 70.8626 bits (172), Expect = 2.039e-11
Identity = 131/594 (22.05%), Postives = 236/594 (39.73%), Query Frame = 1
Query: 1126 YNLKDLFPFTTYCIWMESENPLGVSPPTIALTVKTLPTSPQLSPRSITATSISNTAILVAW--RPPERKFGKFKYYQIIYTNNDGFLPQHWRQFAVKDDNVMLTHLIASEL-----YHIRVKIVNEIGHGPLSKTISIKTIAGTLSQCPD-FKITEIFQSHIKLQWGTPDPVKLFKLIQYNLLCWDVRLKIVNATAKSSTLFPILNHNLSMNEMEYVLYLKNEKEIKCRLSAINSDGKGMPTEIQASTVNKGV-NYQNLIHIDKIGSTYITFQWRPPSKFSFDYFLWIYQI-FDSEKLDRAVKLPKIKINISDSASAENGWFVYNYTNAFSSSRYILGLRYLCRDSTDILREYVHRSDLVSTMKSVPSDSPKDLVVKEIDSNSALVSWKPLDQVHSNGIITHYEVRYYAPKKEESTERFINVSETSAILSNLKY-FHYVIYVRAFTKVGGG--SWSNPKNYYRQNLEEFPIPTTIKGERKSETEINISWELPVLSEKNLAHAAIEGFIILYAPVESSPKWIKYTVQSKNLSAVIKGLEPDLRYQFQIAATNYAGFNGNFSEIVQEMPKNFPNLNLKTVPDLRCSVQSSNRLKVE 2868
            Y +  L P T Y   + + + +G+   T  +  +T  ++P   P+ +   S+S+++I V+W   P   + G    Y + Y    G   +   +  VKD    ++  +   L     Y + VK   ++G GP S +  I+T        P   ++  I  + +++ W  P   K    I+   + +    ++ N   +   +  IL+  L   +   +  L  E      ++A  + G G  ++ +  T    V     +I    IG+T +  QW+PP +   +  L  Y++ +  E+ D           + D    ++ + V   T     + YI  L    ++      EY   S  +ST + VPS  P++L V  + + +  ++W P      NG I  Y V Y      ++       ++T   +  LK    Y I VRAFT  GGG  S S        ++ EF     +K   K  T + ++WE+P   +  +       F ILY             VQ      +I  L+PD  Y F + +       GN +  +Q+       ++++T PDL  +  +  +L  E
Sbjct:  566 YAIDSLKPDTLYKFSLAARSEMGLGVYTQPIEARTAQSAPSAPPQEVHLISLSSSSIKVSWVAPPAASRHGSIVRYSLAYQAVSG---EDQERHEVKDIPADVSSYVLEGLEKWTEYTVWVKAHTDVGPGPESGSTRIRTQEDVPGAPPRRVEVDNINSTALRVSWKPPLQQKQHGHIRGYQVVYS---RLENGEPRGQPI--ILDVALPEAQEAVISGLLPETTYSVTVAAYTTKGDGARSKAKVVTTTGAVPGKPTMIISTTIGNTAL-IQWQPPKEMVGE--LMGYRLRYKREEED--------IYTVRDFRRTDDHFTV---TGLHKGATYIFKL--CAKNRAGNGEEY---SKEISTPEDVPSSYPQNLKVVGLTTTTTKLAWDPPPLPERNGKIVRYVVVYRDINSHQNQTN--GTADTEMTIQGLKPDTTYDIRVRAFTGKGGGPISPSIQSRTMSTSMPEFTKNFGVKAVMK--TSVLLTWEVPETYKSQVP------FKILY-------NQQSVEVQGDLKRKLITRLQPDTDYSFVLMS------RGNSAGGLQQ------QVSIRTAPDLFTTKPAHQKLDPE 1103          
BLAST of Protein tyrosine phosphatase receptor type D vs. Ensembl Zebrafish
Match: ptprfa (protein tyrosine phosphatase receptor type Fa [Source:ZFIN;Acc:ZDB-GENE-020107-2])

HSP 1 Score: 720.309 bits (1858), Expect = 0.000e+0
Identity = 331/606 (54.62%), Postives = 440/606 (72.61%), Query Frame = 1
Query: 4006 SDSIKLRIGSQKSENISDRPSISICNLYQYVTDLKANDCTLLQAEFETLNTNLDDRFTWQRSNIDSNKSKNRYANVVAYDHTSVLLTPVDDVIGSDYINANYIDGYQRQNAYIATQGPLPDTTDDFWRMVWEQRSNCIVMMTRLEERSGIKCHQYWPNRGFICYGQMIVSHIDTFVLAYYTIRLFEIRHSKYSEKREIQHFQFTAWPDHGVPKLSTPLLMFIRRVRSIGKIESCPKIVHCSAGVGRTGAFIVVDAQLERIKQEKNIDVFNYVSKIRCQRNYMVQTQAQYQFILETLLEAVEDGNTEVMACNFHAHVTKLSQIGISGSNQLSGFEMEFSKLNSLASNRGRHGVMLADFVKAAGNQAVNMTKNRVRNIIPYEWNRVVLNAIRGIEGSDYINASYIDGYRDRRAYIAAQSPIPSTVEDFWRMLWDQHCGVVIVLNQPHE---DKSHIYWPINKSIRYQFFVVDPVVEYNMPNYILREFKVTDARDGEFRALRQFQFTQWPNHGCPKESESILDFIRQVHKTKEQFGHMEPMVIHCNTGSGRTGVFIALSIVLDRLQQESVVDMYQTVKLLHKQRIGLVQTEEQYEFCYMAVLDYLSNYE 5814
            SD +++R  + +++ + + P +S+C L  ++  L+AND      E+E+++     +FTW+ SN++ NK KNRYANV+AYDH+ V+LTPVD V GSDYIN NYIDGY++QNAYIATQGPLP+T  DFWRMVWEQR++ IVMMTRLEE+S +KC QYWP+RG   YG + VS +DT  LA Y++R F +  +  SEKRE++ FQF AWPDHGVP+  TP+L F+RRV++    ++ P +VHCSAGVGRTG FIV+DA LER+K EK++D++ +V+ +R QRNYMVQT+ QY FI E LLEA   GNTEV A + + H+ KL+Q      + ++  E+EF KL +  ++  R       F+ A+     N  KNR+ NI+P+E +RV L  IRG+EGSDYINAS+IDGYR ++AYIA Q P+  T EDFWRMLW+ +  +V++L +  E   +K H YWP  +S RYQ+FVVDP+ EYNMP YILREFKVTDARDG+ R +RQFQFT WP  G PK  E  +DFI QVHKTKEQFG   P+ +HC+ G GRTGVFI LSIVL+R++ E VVDM+QT+K L  QR  +VQTE+QY+ CY A L+YL +++
Sbjct: 1297 SDPVEMRRLNYQTQGMREHPPVSVCALADHIERLRANDSLRFSQEYESVDPG--QQFTWENSNLEVNKPKNRYANVIAYDHSRVVLTPVDGVPGSDYINGNYIDGYRKQNAYIATQGPLPETLSDFWRMVWEQRTSTIVMMTRLEEKSRVKCDQYWPSRGTETYGMIQVSMLDTVELATYSVRTFALYKNGSSEKREVRQFQFMAWPDHGVPEYPTPILAFLRRVKACNPPDAGPMVVHCSAGVGRTGCFIVIDAMLERMKHEKSVDIYGHVTCMRSQRNYMVQTEDQYIFIHEALLEAATCGNTEVPARSLYTHIQKLTQ--APPGDTVTAMELEFKKLANSKAHTSR-------FISAS--LPCNKFKNRLVNIMPFESSRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLSETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTIRQFQFTDWPEQGVPKTGEGFIDFIGQVHKTKEQFGQDGPITVHCSAGVGRTGVFITLSIVLERMRYEGVVDMFQTIKTLRTQRPAMVQTEDQYQLCYRAALEYLGSFD 1889          

HSP 2 Score: 202.601 bits (514), Expect = 1.664e-51
Identity = 103/263 (39.16%), Postives = 150/263 (57.03%), Query Frame = 1
Query: 5092 NQAVNMTKNRVRNIIPYEWNRVVLNAIRGIEGSDYINASYIDGYRDRRAYIAAQSPIPSTVEDFWRMLWDQHCGVVIVLNQPHEDKSHI----YWPINKSIRYQFFVVDPVVEYNMPNYILREFKVTDARDGEFRALRQFQFTQWPNHGCPKESESILDFIRQVHKTKEQFGHMEPMVIHCNTGSGRTGVFIALSIVLDRLQQESVVDMYQTVKLLHKQRIGLVQTEEQYEFCYMAVLDYLSNYEKILEKSHLY*TYQDLSES 5868
            N  VN  KNR  N+I Y+ +RVVL  + G+ GSDYIN +YIDGYR + AYIA Q P+P T+ DFWRM+W+Q    ++++ +  E+KS +    YWP   +  Y    V  +    +  Y +R F +      E R +RQFQF  WP+HG P+    IL F+R+V           PMV+HC+ G GRTG FI +  +L+R++ E  VD+Y  V  +  QR  +VQTE+QY F + A+L+  +     +    LY   Q L+++
Sbjct: 1357 NLEVNKPKNRYANVIAYDHSRVVLTPVDGVPGSDYINGNYIDGYRKQNAYIATQGPLPETLSDFWRMVWEQRTSTIVMMTR-LEEKSRVKCDQYWPSRGTETYGMIQVSMLDTVELATYSVRTFALYKNGSSEKREVRQFQFMAWPDHGVPEYPTPILAFLRRVKACNPP--DAGPMVVHCSAGVGRTGCFIVIDAMLERMKHEKSVDIYGHVTCMRSQRNYMVQTEDQYIFIHEALLEAATCGNTEVPARSLYTHIQKLTQA 1616          

HSP 3 Score: 150.984 bits (380), Expect = 7.655e-36
Identity = 231/1011 (22.85%), Postives = 377/1011 (37.29%), Query Frame = 1
Query:  370 LACSSTGHPVPSISWKINESPIEELKSPLKKLQNPPRIFSIKNYQNSVLVITQLIESDSNSVLICEAENNAGFDSRQQQLKVISTETDIPSGFPVFQNNFFPIIKPYNSNVTLVCQAYGNPPPLIQWFKNYEL--INESFTKIKILNDGNLLLVQVTREDKGIYHCQAQNTNGLRLSDPSTLDI------TSYPISPNSLIIERFASDNVE----------ISWRSGLNDVTEQENFILHYREVPENITEKQIMSKFVYLTISEKKSIYKYNLKDLFPFTTYCIWMESENPLGVSPPTIALTVKTLPTSPQLSPRSITATSISNTAILVAWRP--PERKFGKFKYYQIIY---TNNDGFLPQHWRQFAVKDDNVMLTHLIASELYHIRVKIVNEIGHGPLSKTISIKTIAGTLSQCP-DFKITEIFQSHIKLQWGTPDPVKLFKLIQYNLLCWDVRLKIVNATAKSSTLFPI---LNHNLSMNEMEYVLYLKNEKEIKCRLSAINSDGKGMPTEIQASTVNKGVNYQNL-IHIDKIGSTYITFQWRPPSKFSFDYFLWIYQIFDSEKLDRAVKLPKIKINISDSASAENGWFVYNYTNAFSSSRYILGLRYLCRDSTDILREYVHRSDLVSTMKSVPSDSPKDLVVKEIDSNSALVSWKPLDQVHSNGIITHYEVRYYAPKKEESTE---RFINVSETSAILSNL-KYFHYVIYVRAFTKVGGGSWSNPKNYYRQNLEEFPIPTTIKGERKSETEINISWELPVLSEKNLAHAAIEGFIILYAPVESS-PKW---IKYTVQSKNLSAVIKGLEPDLRYQFQIAATNYAGFNGNFSEIVQEMPKNFPNLNLKTVPDLRCSVQSSNRLKVEWSSP-SISTDLLKFEIRYSGNLSYITEIGLKKSEFIDMESKSVNFETLVNRYDVTLENLQSNALYKIAVRAIYQNKELYESHRETTCDTMPAVPNLVKPPIIVGLDEEKSKVIIKLHRCSQRNGKISYYFVIVAAFQGNKNQ 3291
              C + G P P I+W         +K   K       +    +   SVL I  L      ++  C A N+ G  +   +L V+  E  IP GFP         +       T++C A GNP P I WFK++    IN S  +IK L  G L +      D+G Y C A N+ G R S P+ L +        + I P +  +    S N+           + W  G  ++T++E              E  I    + LT          N++    +T  C+ + S   LG+   T  +TVK LP  P     S+  T  + T++ + W    PE       YY I Y    +++GF         V      +  L     Y  RV  VN IG GP S  +  +T     S  P   +   +  + + +QW  P+               + +++       S   FP+     HN   + +  +  L  +     R+ A  S G G P++I      +GV  Q      +    T I   W  P +     +   Y   DS+     +  P     I DS   +    +Y ++ A   +R  +GL    +                 T +S PS  P+++ +  + S+S  VSW        +G I  Y + Y A   E+      + I    +S +L  L K+  Y ++V+A T VG G  S       Q       P  ++ +  + T + +SW+ P+  ++   H  I G+ ++Y+ +E+  P+    I      +   AVI GL P+  Y   +AA    G        V       P       P +  S    N   ++W  P  +  +L+ + +RY             K E  D+ +   +F    + + VT  +  +  ++K+  +    N E Y     T  D   + P  +K   +VGL    +K+        +RNGKI  Y V+      ++NQ
Sbjct:   52 FVCQAVGEPKPRITW---------MKKGKKVSSQRFEVIEFDDGSGSVLRIQPLRTHRDEAIYECTATNSVGEINTSAKLTVLE-EDQIPHGFPTIDMGPQLKVVERTRTATMLCAASGNPDPEISWFKDFLPVDINSSNGRIKQLRSGALQIENSEESDQGKYECVAVNSAGTRYSAPANLYVRVRRVPPRFSIPPTNHEVMPGGSVNLTCVAVGAPMPYVKWMKGEQELTKEE--------------EMPIGRNVLELT----------NIRQSGNYT--CVAISS---LGMIDTTAQITVKALPRPPA----SLIVTETTATSVTLTWDSGNPE----PVSYYVIQYRSKISDNGFQ----EVDGVASTRYSIGGLSPYSEYEFRVMAVNNIGRGPPSGMVETRTSEQAPSSPPLRVQARMLSATTMLVQWEPPEEP-------------NGQIRGYRVYYTSDLHFPLSTWQKHNTEDSSLTTISGLVPDITYGLRVLAFTSVGDGPPSDILQVKTQQGVPAQPTGFEAEAELDTRIMLSWLWPVQDQITKYELTYWEADSDNKHHVIFDPAGSYAI-DSLKPDT---LYKFSLA---ARSEMGLGVYTQPIE------------ARTAQSAPSAPPQEVHLISLSSSSIKVSWVAPPAASRHGSIVRYSLAYQAVSGEDQERHEVKDIPADVSSYVLEGLEKWTEYTVWVKAHTDVGPGPESGSTRIRTQEDVPGAPPRRVEVDNINSTALRVSWKPPLQQKQ---HGHIRGYQVVYSRLENGEPRGQPIILDVALPEAQEAVISGLLPETTYSVTVAAYTTKGDGARSKAKVVTTTGAVPGK-----PTMIISTTIGNTALIQWQPPKEMVGELMGYRLRY-------------KREEEDIYTVR-DFRRTDDHFTVTGLHKGATYIFKLCAKNRAGNGEEYSKEISTPEDVPSSYPQNLK---VVGLTTTTTKLAWDPPPLPERNGKIVRYVVVYRDINSHQNQ 954          

HSP 4 Score: 140.969 bits (354), Expect = 1.056e-32
Identity = 207/898 (23.05%), Postives = 358/898 (39.87%), Query Frame = 1
Query:  277 NSQITFTENDEAP----KISLIIQSPNVLLFKSMILACSSTGHPVPSISWKINESPIEELKSPLKKLQNPPRIFSIKNYQNSVLVITQLIESDSNSVLICEAENNAGFD-SRQQQLKVISTETDIPSGFPVFQNNFFPIIKPYNSNVTLVCQAYGNPPPLIQWFKNYELINESFTKIKILNDGNLLLVQVTREDKGIYHCQAQNTNGLRLSDPSTLDITSYPISPNSLIIERFASDNVEISWRSGLNDVTEQENFILHYREVPENITEKQIMSKFVYLTISEKKSIY--KYNLKDLFPFTTYCIWMESENPLGVSPPTIALTVKTLPTSPQLSPRSITATSISNTAILVAWRPPERKFGKFKYYQIIYTNNDGFLPQHWRQFAVKDDNV-MLTHLIASELYHIRVKIVNEIGHGPLSKTISIKTIAGTLSQCPDFKITEIFQSHIKLQWGTPDPVKLFKLIQYNLLCWDVRLKIVNATAKSSTLF-PILNHNLSMNEMEYVLYLKNEKEIKCRLSAINSDGKGMPTE-IQASTVNKGVNY-QNLIHIDKIGSTYITFQW-RPPSK---FSFDYFLWIYQIFDSEKLDRAVKLPKIKINISDSA-SAENGWFVYNYTNAFSSSRYILGLRYLCRDSTDILREYVHRSDLVSTMKSVPSDSPKDLVVKEIDSNSALVSWKPLDQVHSNGIITHYEVRYYAPKKEESTERFINV------SETSAILSNLKYFHYVIYVRAFTKVGGGSWSNPKNYYRQNLEEFPIPTTIKGERKSETEINISWELPVLSEKNLAHAAIEGFIILYAPVESSPKWIKYTVQSKNLSA---VIKGLEPDLRYQFQIAATNYAGFNGNFSEIV---QEMPKNFPNLNLKTVPDLRCSVQSSNRLKVEWSSPSI 2886
            ++++T  E D+ P     I +  Q   V   ++  + C+++G+P P ISW  +  P++   S  +          IK  ++  L I    ESD      C A N+AG   S    L V           P   +   P       +V L C A G P P ++W K      +  TK + +  G  +L        G Y C A ++ G+ +   + + + + P  P SLI+    + +V ++W SG  +      +++ YR            SK       E   +   +Y++  L P++ Y   + + N +G  PP+  +  +T   +P   P  + A  +S T +LV W PPE   G+ + Y++ YT++  F    W++   +D ++  ++ L+    Y +RV     +G GP S  + +KT  G  +Q   F+      + I L W  P   ++ K   Y L  W+      ++  K   +F P  ++ +          LK +   K  L+A +  G G+ T+ I+A T     +     +H+  + S+ I   W  PP+     S   +   YQ    E  +R  ++  I  ++S         W  Y                   +  TD+       S  + T + VP   P+ + V  I+S +  VSWKP  Q   +G I  Y+V Y   +  E   + I +      ++ + I   L    Y + V A+T  G G+ S  K            PT I       T + I W+ P    K +    + G+ + Y   E       YTV+    +     + GL     Y F++ A N AG    +S+ +   +++P ++P  NLK V        ++   K+ W  P +
Sbjct:  119 SAKLTVLEEDQIPHGFPTIDMGPQLKVVERTRTATMLCAASGNPDPEISWFKDFLPVDINSSNGR----------IKQLRSGALQIENSEESDQGK-YECVAVNSAGTRYSAPANLYVRVRRVPPRFSIPPTNHEVMP-----GGSVNLTCVAVGAPMPYVKWMKG----EQELTKEEEMPIGRNVLELTNIRQSGNYTCVAISSLGM-IDTTAQITVKALPRPPASLIVTETTATSVTLTWDSGNPEPVSY--YVIQYR------------SKISDNGFQEVDGVASTRYSIGGLSPYSEYEFRVMAVNNIGRGPPSGMVETRTSEQAPSSPPLRVQARMLSATTMLVQWEPPEEPNGQIRGYRVYYTSDLHFPLSTWQKHNTEDSSLTTISGLVPDITYGLRVLAFTSVGDGPPSDILQVKTQQGVPAQPTGFEAEAELDTRIMLSWLWPVQDQITK---YELTYWE-----ADSDNKHHVIFDPAGSYAIDS--------LKPDTLYKFSLAARSEMGLGVYTQPIEARTAQSAPSAPPQEVHLISLSSSSIKVSWVAPPAASRHGSIVRYSLAYQAVSGEDQERH-EVKDIPADVSSYVLEGLEKWTEYT---------------VWVKAHTDVGPGPESGSTRIRTQEDVPGAPPRRVEVDNINSTALRVSWKPPLQQKQHGHIRGYQVVYSRLENGEPRGQPIILDVALPEAQEAVISGLLPETTYSVTVAAYTTKGDGARSKAKVVTTTGAVPGK-PTMIISTTIGNTAL-IQWQPP----KEMV-GELMGYRLRYKREEED----IYTVRDFRRTDDHFTVTGLHKGATYIFKLCAKNRAGNGEEYSKEISTPEDVPSSYPQ-NLKVV------GLTTTTTKLAWDPPPL 931          

HSP 5 Score: 70.8626 bits (172), Expect = 1.921e-11
Identity = 131/594 (22.05%), Postives = 236/594 (39.73%), Query Frame = 1
Query: 1126 YNLKDLFPFTTYCIWMESENPLGVSPPTIALTVKTLPTSPQLSPRSITATSISNTAILVAW--RPPERKFGKFKYYQIIYTNNDGFLPQHWRQFAVKDDNVMLTHLIASEL-----YHIRVKIVNEIGHGPLSKTISIKTIAGTLSQCPD-FKITEIFQSHIKLQWGTPDPVKLFKLIQYNLLCWDVRLKIVNATAKSSTLFPILNHNLSMNEMEYVLYLKNEKEIKCRLSAINSDGKGMPTEIQASTVNKGV-NYQNLIHIDKIGSTYITFQWRPPSKFSFDYFLWIYQI-FDSEKLDRAVKLPKIKINISDSASAENGWFVYNYTNAFSSSRYILGLRYLCRDSTDILREYVHRSDLVSTMKSVPSDSPKDLVVKEIDSNSALVSWKPLDQVHSNGIITHYEVRYYAPKKEESTERFINVSETSAILSNLKY-FHYVIYVRAFTKVGGG--SWSNPKNYYRQNLEEFPIPTTIKGERKSETEINISWELPVLSEKNLAHAAIEGFIILYAPVESSPKWIKYTVQSKNLSAVIKGLEPDLRYQFQIAATNYAGFNGNFSEIVQEMPKNFPNLNLKTVPDLRCSVQSSNRLKVE 2868
            Y +  L P T Y   + + + +G+   T  +  +T  ++P   P+ +   S+S+++I V+W   P   + G    Y + Y    G   +   +  VKD    ++  +   L     Y + VK   ++G GP S +  I+T        P   ++  I  + +++ W  P   K    I+   + +    ++ N   +   +  IL+  L   +   +  L  E      ++A  + G G  ++ +  T    V     +I    IG+T +  QW+PP +   +  L  Y++ +  E+ D           + D    ++ + V   T     + YI  L    ++      EY   S  +ST + VPS  P++L V  + + +  ++W P      NG I  Y V Y      ++       ++T   +  LK    Y I VRAFT  GGG  S S        ++ EF     +K   K  T + ++WE+P   +  +       F ILY             VQ      +I  L+PD  Y F + +       GN +  +Q+       ++++T PDL  +  +  +L  E
Sbjct:  566 YAIDSLKPDTLYKFSLAARSEMGLGVYTQPIEARTAQSAPSAPPQEVHLISLSSSSIKVSWVAPPAASRHGSIVRYSLAYQAVSG---EDQERHEVKDIPADVSSYVLEGLEKWTEYTVWVKAHTDVGPGPESGSTRIRTQEDVPGAPPRRVEVDNINSTALRVSWKPPLQQKQHGHIRGYQVVYS---RLENGEPRGQPI--ILDVALPEAQEAVISGLLPETTYSVTVAAYTTKGDGARSKAKVVTTTGAVPGKPTMIISTTIGNTAL-IQWQPPKEMVGE--LMGYRLRYKREEED--------IYTVRDFRRTDDHFTV---TGLHKGATYIFKL--CAKNRAGNGEEY---SKEISTPEDVPSSYPQNLKVVGLTTTTTKLAWDPPPLPERNGKIVRYVVVYRDINSHQNQTN--GTADTEMTIQGLKPDTTYDIRVRAFTGKGGGPISPSIQSRTMSTSMPEFTKNFGVKAVMK--TSVLLTWEVPETYKSQVP------FKILY-------NQQSVEVQGDLKRKLITRLQPDTDYSFVLMS------RGNSAGGLQQ------QVSIRTAPDLFTTKPAHQKLDPE 1103          
BLAST of Protein tyrosine phosphatase receptor type D vs. Ensembl Zebrafish
Match: ptprfa (protein tyrosine phosphatase receptor type Fa [Source:ZFIN;Acc:ZDB-GENE-020107-2])

HSP 1 Score: 720.309 bits (1858), Expect = 0.000e+0
Identity = 331/606 (54.62%), Postives = 440/606 (72.61%), Query Frame = 1
Query: 4006 SDSIKLRIGSQKSENISDRPSISICNLYQYVTDLKANDCTLLQAEFETLNTNLDDRFTWQRSNIDSNKSKNRYANVVAYDHTSVLLTPVDDVIGSDYINANYIDGYQRQNAYIATQGPLPDTTDDFWRMVWEQRSNCIVMMTRLEERSGIKCHQYWPNRGFICYGQMIVSHIDTFVLAYYTIRLFEIRHSKYSEKREIQHFQFTAWPDHGVPKLSTPLLMFIRRVRSIGKIESCPKIVHCSAGVGRTGAFIVVDAQLERIKQEKNIDVFNYVSKIRCQRNYMVQTQAQYQFILETLLEAVEDGNTEVMACNFHAHVTKLSQIGISGSNQLSGFEMEFSKLNSLASNRGRHGVMLADFVKAAGNQAVNMTKNRVRNIIPYEWNRVVLNAIRGIEGSDYINASYIDGYRDRRAYIAAQSPIPSTVEDFWRMLWDQHCGVVIVLNQPHE---DKSHIYWPINKSIRYQFFVVDPVVEYNMPNYILREFKVTDARDGEFRALRQFQFTQWPNHGCPKESESILDFIRQVHKTKEQFGHMEPMVIHCNTGSGRTGVFIALSIVLDRLQQESVVDMYQTVKLLHKQRIGLVQTEEQYEFCYMAVLDYLSNYE 5814
            SD +++R  + +++ + + P +S+C L  ++  L+AND      E+E+++     +FTW+ SN++ NK KNRYANV+AYDH+ V+LTPVD V GSDYIN NYIDGY++QNAYIATQGPLP+T  DFWRMVWEQR++ IVMMTRLEE+S +KC QYWP+RG   YG + VS +DT  LA Y++R F +  +  SEKRE++ FQF AWPDHGVP+  TP+L F+RRV++    ++ P +VHCSAGVGRTG FIV+DA LER+K EK++D++ +V+ +R QRNYMVQT+ QY FI E LLEA   GNTEV A + + H+ KL+Q      + ++  E+EF KL +  ++  R       F+ A+     N  KNR+ NI+P+E +RV L  IRG+EGSDYINAS+IDGYR ++AYIA Q P+  T EDFWRMLW+ +  +V++L +  E   +K H YWP  +S RYQ+FVVDP+ EYNMP YILREFKVTDARDG+ R +RQFQFT WP  G PK  E  +DFI QVHKTKEQFG   P+ +HC+ G GRTGVFI LSIVL+R++ E VVDM+QT+K L  QR  +VQTE+QY+ CY A L+YL +++
Sbjct: 1297 SDPVEMRRLNYQTQGMREHPPVSVCALADHIERLRANDSLRFSQEYESVDPG--QQFTWENSNLEVNKPKNRYANVIAYDHSRVVLTPVDGVPGSDYINGNYIDGYRKQNAYIATQGPLPETLSDFWRMVWEQRTSTIVMMTRLEEKSRVKCDQYWPSRGTETYGMIQVSMLDTVELATYSVRTFALYKNGSSEKREVRQFQFMAWPDHGVPEYPTPILAFLRRVKACNPPDAGPMVVHCSAGVGRTGCFIVIDAMLERMKHEKSVDIYGHVTCMRSQRNYMVQTEDQYIFIHEALLEAATCGNTEVPARSLYTHIQKLTQ--APPGDTVTAMELEFKKLANSKAHTSR-------FISAS--LPCNKFKNRLVNIMPFESSRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLSETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTIRQFQFTDWPEQGVPKTGEGFIDFIGQVHKTKEQFGQDGPITVHCSAGVGRTGVFITLSIVLERMRYEGVVDMFQTIKTLRTQRPAMVQTEDQYQLCYRAALEYLGSFD 1889          

HSP 2 Score: 202.601 bits (514), Expect = 1.664e-51
Identity = 103/263 (39.16%), Postives = 150/263 (57.03%), Query Frame = 1
Query: 5092 NQAVNMTKNRVRNIIPYEWNRVVLNAIRGIEGSDYINASYIDGYRDRRAYIAAQSPIPSTVEDFWRMLWDQHCGVVIVLNQPHEDKSHI----YWPINKSIRYQFFVVDPVVEYNMPNYILREFKVTDARDGEFRALRQFQFTQWPNHGCPKESESILDFIRQVHKTKEQFGHMEPMVIHCNTGSGRTGVFIALSIVLDRLQQESVVDMYQTVKLLHKQRIGLVQTEEQYEFCYMAVLDYLSNYEKILEKSHLY*TYQDLSES 5868
            N  VN  KNR  N+I Y+ +RVVL  + G+ GSDYIN +YIDGYR + AYIA Q P+P T+ DFWRM+W+Q    ++++ +  E+KS +    YWP   +  Y    V  +    +  Y +R F +      E R +RQFQF  WP+HG P+    IL F+R+V           PMV+HC+ G GRTG FI +  +L+R++ E  VD+Y  V  +  QR  +VQTE+QY F + A+L+  +     +    LY   Q L+++
Sbjct: 1357 NLEVNKPKNRYANVIAYDHSRVVLTPVDGVPGSDYINGNYIDGYRKQNAYIATQGPLPETLSDFWRMVWEQRTSTIVMMTR-LEEKSRVKCDQYWPSRGTETYGMIQVSMLDTVELATYSVRTFALYKNGSSEKREVRQFQFMAWPDHGVPEYPTPILAFLRRVKACNPP--DAGPMVVHCSAGVGRTGCFIVIDAMLERMKHEKSVDIYGHVTCMRSQRNYMVQTEDQYIFIHEALLEAATCGNTEVPARSLYTHIQKLTQA 1616          

HSP 3 Score: 150.984 bits (380), Expect = 7.655e-36
Identity = 231/1011 (22.85%), Postives = 377/1011 (37.29%), Query Frame = 1
Query:  370 LACSSTGHPVPSISWKINESPIEELKSPLKKLQNPPRIFSIKNYQNSVLVITQLIESDSNSVLICEAENNAGFDSRQQQLKVISTETDIPSGFPVFQNNFFPIIKPYNSNVTLVCQAYGNPPPLIQWFKNYEL--INESFTKIKILNDGNLLLVQVTREDKGIYHCQAQNTNGLRLSDPSTLDI------TSYPISPNSLIIERFASDNVE----------ISWRSGLNDVTEQENFILHYREVPENITEKQIMSKFVYLTISEKKSIYKYNLKDLFPFTTYCIWMESENPLGVSPPTIALTVKTLPTSPQLSPRSITATSISNTAILVAWRP--PERKFGKFKYYQIIY---TNNDGFLPQHWRQFAVKDDNVMLTHLIASELYHIRVKIVNEIGHGPLSKTISIKTIAGTLSQCP-DFKITEIFQSHIKLQWGTPDPVKLFKLIQYNLLCWDVRLKIVNATAKSSTLFPI---LNHNLSMNEMEYVLYLKNEKEIKCRLSAINSDGKGMPTEIQASTVNKGVNYQNL-IHIDKIGSTYITFQWRPPSKFSFDYFLWIYQIFDSEKLDRAVKLPKIKINISDSASAENGWFVYNYTNAFSSSRYILGLRYLCRDSTDILREYVHRSDLVSTMKSVPSDSPKDLVVKEIDSNSALVSWKPLDQVHSNGIITHYEVRYYAPKKEESTE---RFINVSETSAILSNL-KYFHYVIYVRAFTKVGGGSWSNPKNYYRQNLEEFPIPTTIKGERKSETEINISWELPVLSEKNLAHAAIEGFIILYAPVESS-PKW---IKYTVQSKNLSAVIKGLEPDLRYQFQIAATNYAGFNGNFSEIVQEMPKNFPNLNLKTVPDLRCSVQSSNRLKVEWSSP-SISTDLLKFEIRYSGNLSYITEIGLKKSEFIDMESKSVNFETLVNRYDVTLENLQSNALYKIAVRAIYQNKELYESHRETTCDTMPAVPNLVKPPIIVGLDEEKSKVIIKLHRCSQRNGKISYYFVIVAAFQGNKNQ 3291
              C + G P P I+W         +K   K       +    +   SVL I  L      ++  C A N+ G  +   +L V+  E  IP GFP         +       T++C A GNP P I WFK++    IN S  +IK L  G L +      D+G Y C A N+ G R S P+ L +        + I P +  +    S N+           + W  G  ++T++E              E  I    + LT          N++    +T  C+ + S   LG+   T  +TVK LP  P     S+  T  + T++ + W    PE       YY I Y    +++GF         V      +  L     Y  RV  VN IG GP S  +  +T     S  P   +   +  + + +QW  P+               + +++       S   FP+     HN   + +  +  L  +     R+ A  S G G P++I      +GV  Q      +    T I   W  P +     +   Y   DS+     +  P     I DS   +    +Y ++ A   +R  +GL    +                 T +S PS  P+++ +  + S+S  VSW        +G I  Y + Y A   E+      + I    +S +L  L K+  Y ++V+A T VG G  S       Q       P  ++ +  + T + +SW+ P+  ++   H  I G+ ++Y+ +E+  P+    I      +   AVI GL P+  Y   +AA    G        V       P       P +  S    N   ++W  P  +  +L+ + +RY             K E  D+ +   +F    + + VT  +  +  ++K+  +    N E Y     T  D   + P  +K   +VGL    +K+        +RNGKI  Y V+      ++NQ
Sbjct:   52 FVCQAVGEPKPRITW---------MKKGKKVSSQRFEVIEFDDGSGSVLRIQPLRTHRDEAIYECTATNSVGEINTSAKLTVLE-EDQIPHGFPTIDMGPQLKVVERTRTATMLCAASGNPDPEISWFKDFLPVDINSSNGRIKQLRSGALQIENSEESDQGKYECVAVNSAGTRYSAPANLYVRVRRVPPRFSIPPTNHEVMPGGSVNLTCVAVGAPMPYVKWMKGEQELTKEE--------------EMPIGRNVLELT----------NIRQSGNYT--CVAISS---LGMIDTTAQITVKALPRPPA----SLIVTETTATSVTLTWDSGNPE----PVSYYVIQYRSKISDNGFQ----EVDGVASTRYSIGGLSPYSEYEFRVMAVNNIGRGPPSGMVETRTSEQAPSSPPLRVQARMLSATTMLVQWEPPEEP-------------NGQIRGYRVYYTSDLHFPLSTWQKHNTEDSSLTTISGLVPDITYGLRVLAFTSVGDGPPSDILQVKTQQGVPAQPTGFEAEAELDTRIMLSWLWPVQDQITKYELTYWEADSDNKHHVIFDPAGSYAI-DSLKPDT---LYKFSLA---ARSEMGLGVYTQPIE------------ARTAQSAPSAPPQEVHLISLSSSSIKVSWVAPPAASRHGSIVRYSLAYQAVSGEDQERHEVKDIPADVSSYVLEGLEKWTEYTVWVKAHTDVGPGPESGSTRIRTQEDVPGAPPRRVEVDNINSTALRVSWKPPLQQKQ---HGHIRGYQVVYSRLENGEPRGQPIILDVALPEAQEAVISGLLPETTYSVTVAAYTTKGDGARSKAKVVTTTGAVPGK-----PTMIISTTIGNTALIQWQPPKEMVGELMGYRLRY-------------KREEEDIYTVR-DFRRTDDHFTVTGLHKGATYIFKLCAKNRAGNGEEYSKEISTPEDVPSSYPQNLK---VVGLTTTTTKLAWDPPPLPERNGKIVRYVVVYRDINSHQNQ 954          

HSP 4 Score: 140.969 bits (354), Expect = 1.056e-32
Identity = 207/898 (23.05%), Postives = 358/898 (39.87%), Query Frame = 1
Query:  277 NSQITFTENDEAP----KISLIIQSPNVLLFKSMILACSSTGHPVPSISWKINESPIEELKSPLKKLQNPPRIFSIKNYQNSVLVITQLIESDSNSVLICEAENNAGFD-SRQQQLKVISTETDIPSGFPVFQNNFFPIIKPYNSNVTLVCQAYGNPPPLIQWFKNYELINESFTKIKILNDGNLLLVQVTREDKGIYHCQAQNTNGLRLSDPSTLDITSYPISPNSLIIERFASDNVEISWRSGLNDVTEQENFILHYREVPENITEKQIMSKFVYLTISEKKSIY--KYNLKDLFPFTTYCIWMESENPLGVSPPTIALTVKTLPTSPQLSPRSITATSISNTAILVAWRPPERKFGKFKYYQIIYTNNDGFLPQHWRQFAVKDDNV-MLTHLIASELYHIRVKIVNEIGHGPLSKTISIKTIAGTLSQCPDFKITEIFQSHIKLQWGTPDPVKLFKLIQYNLLCWDVRLKIVNATAKSSTLF-PILNHNLSMNEMEYVLYLKNEKEIKCRLSAINSDGKGMPTE-IQASTVNKGVNY-QNLIHIDKIGSTYITFQW-RPPSK---FSFDYFLWIYQIFDSEKLDRAVKLPKIKINISDSA-SAENGWFVYNYTNAFSSSRYILGLRYLCRDSTDILREYVHRSDLVSTMKSVPSDSPKDLVVKEIDSNSALVSWKPLDQVHSNGIITHYEVRYYAPKKEESTERFINV------SETSAILSNLKYFHYVIYVRAFTKVGGGSWSNPKNYYRQNLEEFPIPTTIKGERKSETEINISWELPVLSEKNLAHAAIEGFIILYAPVESSPKWIKYTVQSKNLSA---VIKGLEPDLRYQFQIAATNYAGFNGNFSEIV---QEMPKNFPNLNLKTVPDLRCSVQSSNRLKVEWSSPSI 2886
            ++++T  E D+ P     I +  Q   V   ++  + C+++G+P P ISW  +  P++   S  +          IK  ++  L I    ESD      C A N+AG   S    L V           P   +   P       +V L C A G P P ++W K      +  TK + +  G  +L        G Y C A ++ G+ +   + + + + P  P SLI+    + +V ++W SG  +      +++ YR            SK       E   +   +Y++  L P++ Y   + + N +G  PP+  +  +T   +P   P  + A  +S T +LV W PPE   G+ + Y++ YT++  F    W++   +D ++  ++ L+    Y +RV     +G GP S  + +KT  G  +Q   F+      + I L W  P   ++ K   Y L  W+      ++  K   +F P  ++ +          LK +   K  L+A +  G G+ T+ I+A T     +     +H+  + S+ I   W  PP+     S   +   YQ    E  +R  ++  I  ++S         W  Y                   +  TD+       S  + T + VP   P+ + V  I+S +  VSWKP  Q   +G I  Y+V Y   +  E   + I +      ++ + I   L    Y + V A+T  G G+ S  K            PT I       T + I W+ P    K +    + G+ + Y   E       YTV+    +     + GL     Y F++ A N AG    +S+ +   +++P ++P  NLK V        ++   K+ W  P +
Sbjct:  119 SAKLTVLEEDQIPHGFPTIDMGPQLKVVERTRTATMLCAASGNPDPEISWFKDFLPVDINSSNGR----------IKQLRSGALQIENSEESDQGK-YECVAVNSAGTRYSAPANLYVRVRRVPPRFSIPPTNHEVMP-----GGSVNLTCVAVGAPMPYVKWMKG----EQELTKEEEMPIGRNVLELTNIRQSGNYTCVAISSLGM-IDTTAQITVKALPRPPASLIVTETTATSVTLTWDSGNPEPVSY--YVIQYR------------SKISDNGFQEVDGVASTRYSIGGLSPYSEYEFRVMAVNNIGRGPPSGMVETRTSEQAPSSPPLRVQARMLSATTMLVQWEPPEEPNGQIRGYRVYYTSDLHFPLSTWQKHNTEDSSLTTISGLVPDITYGLRVLAFTSVGDGPPSDILQVKTQQGVPAQPTGFEAEAELDTRIMLSWLWPVQDQITK---YELTYWE-----ADSDNKHHVIFDPAGSYAIDS--------LKPDTLYKFSLAARSEMGLGVYTQPIEARTAQSAPSAPPQEVHLISLSSSSIKVSWVAPPAASRHGSIVRYSLAYQAVSGEDQERH-EVKDIPADVSSYVLEGLEKWTEYT---------------VWVKAHTDVGPGPESGSTRIRTQEDVPGAPPRRVEVDNINSTALRVSWKPPLQQKQHGHIRGYQVVYSRLENGEPRGQPIILDVALPEAQEAVISGLLPETTYSVTVAAYTTKGDGARSKAKVVTTTGAVPGK-PTMIISTTIGNTAL-IQWQPP----KEMV-GELMGYRLRYKREEED----IYTVRDFRRTDDHFTVTGLHKGATYIFKLCAKNRAGNGEEYSKEISTPEDVPSSYPQ-NLKVV------GLTTTTTKLAWDPPPL 931          

HSP 5 Score: 70.8626 bits (172), Expect = 1.921e-11
Identity = 131/594 (22.05%), Postives = 236/594 (39.73%), Query Frame = 1
Query: 1126 YNLKDLFPFTTYCIWMESENPLGVSPPTIALTVKTLPTSPQLSPRSITATSISNTAILVAW--RPPERKFGKFKYYQIIYTNNDGFLPQHWRQFAVKDDNVMLTHLIASEL-----YHIRVKIVNEIGHGPLSKTISIKTIAGTLSQCPD-FKITEIFQSHIKLQWGTPDPVKLFKLIQYNLLCWDVRLKIVNATAKSSTLFPILNHNLSMNEMEYVLYLKNEKEIKCRLSAINSDGKGMPTEIQASTVNKGV-NYQNLIHIDKIGSTYITFQWRPPSKFSFDYFLWIYQI-FDSEKLDRAVKLPKIKINISDSASAENGWFVYNYTNAFSSSRYILGLRYLCRDSTDILREYVHRSDLVSTMKSVPSDSPKDLVVKEIDSNSALVSWKPLDQVHSNGIITHYEVRYYAPKKEESTERFINVSETSAILSNLKY-FHYVIYVRAFTKVGGG--SWSNPKNYYRQNLEEFPIPTTIKGERKSETEINISWELPVLSEKNLAHAAIEGFIILYAPVESSPKWIKYTVQSKNLSAVIKGLEPDLRYQFQIAATNYAGFNGNFSEIVQEMPKNFPNLNLKTVPDLRCSVQSSNRLKVE 2868
            Y +  L P T Y   + + + +G+   T  +  +T  ++P   P+ +   S+S+++I V+W   P   + G    Y + Y    G   +   +  VKD    ++  +   L     Y + VK   ++G GP S +  I+T        P   ++  I  + +++ W  P   K    I+   + +    ++ N   +   +  IL+  L   +   +  L  E      ++A  + G G  ++ +  T    V     +I    IG+T +  QW+PP +   +  L  Y++ +  E+ D           + D    ++ + V   T     + YI  L    ++      EY   S  +ST + VPS  P++L V  + + +  ++W P      NG I  Y V Y      ++       ++T   +  LK    Y I VRAFT  GGG  S S        ++ EF     +K   K  T + ++WE+P   +  +       F ILY             VQ      +I  L+PD  Y F + +       GN +  +Q+       ++++T PDL  +  +  +L  E
Sbjct:  566 YAIDSLKPDTLYKFSLAARSEMGLGVYTQPIEARTAQSAPSAPPQEVHLISLSSSSIKVSWVAPPAASRHGSIVRYSLAYQAVSG---EDQERHEVKDIPADVSSYVLEGLEKWTEYTVWVKAHTDVGPGPESGSTRIRTQEDVPGAPPRRVEVDNINSTALRVSWKPPLQQKQHGHIRGYQVVYS---RLENGEPRGQPI--ILDVALPEAQEAVISGLLPETTYSVTVAAYTTKGDGARSKAKVVTTTGAVPGKPTMIISTTIGNTAL-IQWQPPKEMVGE--LMGYRLRYKREEED--------IYTVRDFRRTDDHFTV---TGLHKGATYIFKL--CAKNRAGNGEEY---SKEISTPEDVPSSYPQNLKVVGLTTTTTKLAWDPPPLPERNGKIVRYVVVYRDINSHQNQTN--GTADTEMTIQGLKPDTTYDIRVRAFTGKGGGPISPSIQSRTMSTSMPEFTKNFGVKAVMK--TSVLLTWEVPETYKSQVP------FKILY-------NQQSVEVQGDLKRKLITRLQPDTDYSFVLMS------RGNSAGGLQQ------QVSIRTAPDLFTTKPAHQKLDPE 1103          
BLAST of Protein tyrosine phosphatase receptor type D vs. Ensembl Zebrafish
Match: ptprfa (protein tyrosine phosphatase receptor type Fa [Source:ZFIN;Acc:ZDB-GENE-020107-2])

HSP 1 Score: 720.309 bits (1858), Expect = 0.000e+0
Identity = 331/606 (54.62%), Postives = 440/606 (72.61%), Query Frame = 1
Query: 4006 SDSIKLRIGSQKSENISDRPSISICNLYQYVTDLKANDCTLLQAEFETLNTNLDDRFTWQRSNIDSNKSKNRYANVVAYDHTSVLLTPVDDVIGSDYINANYIDGYQRQNAYIATQGPLPDTTDDFWRMVWEQRSNCIVMMTRLEERSGIKCHQYWPNRGFICYGQMIVSHIDTFVLAYYTIRLFEIRHSKYSEKREIQHFQFTAWPDHGVPKLSTPLLMFIRRVRSIGKIESCPKIVHCSAGVGRTGAFIVVDAQLERIKQEKNIDVFNYVSKIRCQRNYMVQTQAQYQFILETLLEAVEDGNTEVMACNFHAHVTKLSQIGISGSNQLSGFEMEFSKLNSLASNRGRHGVMLADFVKAAGNQAVNMTKNRVRNIIPYEWNRVVLNAIRGIEGSDYINASYIDGYRDRRAYIAAQSPIPSTVEDFWRMLWDQHCGVVIVLNQPHE---DKSHIYWPINKSIRYQFFVVDPVVEYNMPNYILREFKVTDARDGEFRALRQFQFTQWPNHGCPKESESILDFIRQVHKTKEQFGHMEPMVIHCNTGSGRTGVFIALSIVLDRLQQESVVDMYQTVKLLHKQRIGLVQTEEQYEFCYMAVLDYLSNYE 5814
            SD +++R  + +++ + + P +S+C L  ++  L+AND      E+E+++     +FTW+ SN++ NK KNRYANV+AYDH+ V+LTPVD V GSDYIN NYIDGY++QNAYIATQGPLP+T  DFWRMVWEQR++ IVMMTRLEE+S +KC QYWP+RG   YG + VS +DT  LA Y++R F +  +  SEKRE++ FQF AWPDHGVP+  TP+L F+RRV++    ++ P +VHCSAGVGRTG FIV+DA LER+K EK++D++ +V+ +R QRNYMVQT+ QY FI E LLEA   GNTEV A + + H+ KL+Q      + ++  E+EF KL +  ++  R       F+ A+     N  KNR+ NI+P+E +RV L  IRG+EGSDYINAS+IDGYR ++AYIA Q P+  T EDFWRMLW+ +  +V++L +  E   +K H YWP  +S RYQ+FVVDP+ EYNMP YILREFKVTDARDG+ R +RQFQFT WP  G PK  E  +DFI QVHKTKEQFG   P+ +HC+ G GRTGVFI LSIVL+R++ E VVDM+QT+K L  QR  +VQTE+QY+ CY A L+YL +++
Sbjct: 1195 SDPVEMRRLNYQTQGMREHPPVSVCALADHIERLRANDSLRFSQEYESVDPG--QQFTWENSNLEVNKPKNRYANVIAYDHSRVVLTPVDGVPGSDYINGNYIDGYRKQNAYIATQGPLPETLSDFWRMVWEQRTSTIVMMTRLEEKSRVKCDQYWPSRGTETYGMIQVSMLDTVELATYSVRTFALYKNGSSEKREVRQFQFMAWPDHGVPEYPTPILAFLRRVKACNPPDAGPMVVHCSAGVGRTGCFIVIDAMLERMKHEKSVDIYGHVTCMRSQRNYMVQTEDQYIFIHEALLEAATCGNTEVPARSLYTHIQKLTQ--APPGDTVTAMELEFKKLANSKAHTSR-------FISAS--LPCNKFKNRLVNIMPFESSRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLSETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTIRQFQFTDWPEQGVPKTGEGFIDFIGQVHKTKEQFGQDGPITVHCSAGVGRTGVFITLSIVLERMRYEGVVDMFQTIKTLRTQRPAMVQTEDQYQLCYRAALEYLGSFD 1787          

HSP 2 Score: 202.601 bits (514), Expect = 1.373e-51
Identity = 103/263 (39.16%), Postives = 150/263 (57.03%), Query Frame = 1
Query: 5092 NQAVNMTKNRVRNIIPYEWNRVVLNAIRGIEGSDYINASYIDGYRDRRAYIAAQSPIPSTVEDFWRMLWDQHCGVVIVLNQPHEDKSHI----YWPINKSIRYQFFVVDPVVEYNMPNYILREFKVTDARDGEFRALRQFQFTQWPNHGCPKESESILDFIRQVHKTKEQFGHMEPMVIHCNTGSGRTGVFIALSIVLDRLQQESVVDMYQTVKLLHKQRIGLVQTEEQYEFCYMAVLDYLSNYEKILEKSHLY*TYQDLSES 5868
            N  VN  KNR  N+I Y+ +RVVL  + G+ GSDYIN +YIDGYR + AYIA Q P+P T+ DFWRM+W+Q    ++++ +  E+KS +    YWP   +  Y    V  +    +  Y +R F +      E R +RQFQF  WP+HG P+    IL F+R+V           PMV+HC+ G GRTG FI +  +L+R++ E  VD+Y  V  +  QR  +VQTE+QY F + A+L+  +     +    LY   Q L+++
Sbjct: 1255 NLEVNKPKNRYANVIAYDHSRVVLTPVDGVPGSDYINGNYIDGYRKQNAYIATQGPLPETLSDFWRMVWEQRTSTIVMMTR-LEEKSRVKCDQYWPSRGTETYGMIQVSMLDTVELATYSVRTFALYKNGSSEKREVRQFQFMAWPDHGVPEYPTPILAFLRRVKACNPP--DAGPMVVHCSAGVGRTGCFIVIDAMLERMKHEKSVDIYGHVTCMRSQRNYMVQTEDQYIFIHEALLEAATCGNTEVPARSLYTHIQKLTQA 1514          

HSP 3 Score: 157.918 bits (398), Expect = 7.008e-38
Identity = 250/1151 (21.72%), Postives = 447/1151 (38.84%), Query Frame = 1
Query:  277 NSQITFTENDEAP----KISLIIQSPNVLLFKSMILACSSTGHPVPSISWKINESPIEELKSPLKKLQNPPRIFSIKNYQNSVLVITQLIESDSNSVLICEAENNAGFD-SRQQQLKVISTETDIPSGFPVFQNNFFPIIKPYNSNVTLVCQAYGNPPPLIQWFKNYELINESFTKIKILNDGNLLLVQVTREDKGIYHCQAQNTNGLRLSDPSTLDITSYPISPNSLIIERFASDNVEISWRSGLNDVTEQENFILHYREVPENITEKQIMSKFVYLTISEKKSIY--KYNLKDLFPFTTYCIWMESENPLGVSPPTIALTVKTLPTSPQLSPRSITATSISNTAILVAWRPPERKFGKFKYYQIIYTNNDGFLPQHWRQFAVKDDNV-MLTHLIASELYHIRVKIVNEIGHGPLSKTISIKTIAGTLSQCPDFKITEIFQSHIKLQWGTPDPVKLFKLIQYNLLCWDVRLKIVNATAKSSTLF-PILNHNLSMNEMEYVLYLKNEKEIKCRLSAINSDGKGM---PTEIQASTVNKGVNYQNLIHIDKIGSTYITFQWRPPSKFSFDYFLWIYQIFDSEKLDRA----------VKLPKIKINISDSASAENGW--FVYNYTNAFSSSRYILGLRYLCRDSTDILREYVHRSDLVSTMKSVPSDSPKDLVVKEIDSNSALVSWKPLDQVHSNGIITHYEVRYYAPKKEESTERFINVSETSAILSNL-KYFHYVIYVRAFTKVGGG-----SWSNPKNY---YRQNLEEFPIPTTIKGERKSETEINISWELPVLSEKNLAHAAIEGFIILYAPVESSPKWIKYTVQSKNLSAVIKGLEPDLRYQFQIAATNYAGFNGNFSEIVQ------EMPKNFPNLNLKTVPDLRCSVQSSNRLKVEWSSPSISTDLLKFEIRYSGNLSYITEIGLKKSEFIDMESKSVNFETLVNRYDVTLENLQSNALYKIAVRAIYQNKELYESHRETTCDTMPAVPNLVKPPIIVGLD-EEKSKVIIKLHRCSQRNGKISYYFVIVAAFQGNKNQQISFQEDTESYTFMELSVNTRSNNAKGEYIAIMKDINDIFK--VSGKDHS---SVLLGDGTHDENHLSVNKKLEKNFNYRCFARVCLKYSNNSLCKSSPWSEPFRI 3594
            ++++T  E D+ P     I +  Q   V   ++  + C+++G+P P ISW  +  P++   S  +          IK  ++  L I    ESD      C A N+AG   S    L V           P   +   P       +V L C A G P P ++W K      +  TK + +  G  +L        G Y C A ++ G+ +   + + + + P  P SLI+    + +V ++W SG  +      +++ YR            SK       E   +   +Y++  L P++ Y   + + N +G  PP+  +  +T   +P   P  + A  +S T +LV W PPE   G+ + Y++ YT++  F    W++   +D ++  ++ L+    Y +RV     +G GP S  + +KT  G  +Q   F+      + I L W  P   ++ K   Y L  W+      ++  K   +F P  ++ +          LK +   K  L+A +  G G+   P E + +    G   +  + +D I ST +   W+PP +      +  YQ+  S +L+            V LP+ +  +      E  +   V  YT     +R                     ++ +V+T  +VP      +++     N+AL+ W+P  ++   G +  Y +RY   +++  T R    ++    ++ L K   Y+  + A  + G G       S P++    Y QNL+   + TT            ++W+ P L E+N     I  ++++Y  + S       T  ++     I+GL+PD  Y  ++ A    G  G  S  +Q       MP+   N  +K V  ++ SV       + W  P      + F+I Y+                     +SV  +  + R  +T   LQ +  Y   +  + +        ++ +  T P +      P    LD EE  K+ I L      +  + +++++V     +  +     ED +    M        NN         +   D  +  ++ K  S     +LGD     N+   NK L     YR F    LK   +S    SP+SEP  +
Sbjct:  119 SAKLTVLEEDQIPHGFPTIDMGPQLKVVERTRTATMLCAASGNPDPEISWFKDFLPVDINSSNGR----------IKQLRSGALQIENSEESDQGK-YECVAVNSAGTRYSAPANLYVRVRRVPPRFSIPPTNHEVMP-----GGSVNLTCVAVGAPMPYVKWMKG----EQELTKEEEMPIGRNVLELTNIRQSGNYTCVAISSLGM-IDTTAQITVKALPRPPASLIVTETTATSVTLTWDSGNPEPVSY--YVIQYR------------SKISDNGFQEVDGVASTRYSIGGLSPYSEYEFRVMAVNNIGRGPPSGMVETRTSEQAPSSPPLRVQARMLSATTMLVQWEPPEEPNGQIRGYRVYYTSDLHFPLSTWQKHNTEDSSLTTISGLVPDITYGLRVLAFTSVGDGPPSDILQVKTQQGVPAQPTGFEAEAELDTRIMLSWLWPVQDQITK---YELTYWE-----ADSDNKHHVIFDPAGSYAIDS--------LKPDTLYKFSLAARSEMGLGVYTQPIEARTAQSVPGAPPRR-VEVDNINSTALRVSWKPPLQQKQHGHIRGYQVVYS-RLENGEPRGQPIILDVALPEAQEAVISGLLPETTYSVTVAAYTTKGDGAR--------------------SKAKVVTTTGAVPGKP--TMIISTTIGNTALIQWQPPKEM--VGELMGYRLRYKREEEDIYTVRDFRRTDDHFTVTGLHKGATYIFKLCAKNRAGNGEEYSKEISTPEDVPSSYPQNLKVVGLTTTT---------TKLAWDPPPLPERN---GKIVRYVVVYRDINSHQNQTNGTADTE---MTIQGLKPDTTYDIRVRAFTGKG-GGPISPSIQSRTMSTSMPEFTKNFGVKAV--MKTSVL------LTWEVPETYKSQVPFKILYN--------------------QQSVEVQGDLKRKLIT--RLQPDTDYSFVL--MSRGNSAGGLQQQVSIRTAPDL--FTTKPAHQKLDPEEGGKLAITLPEV-HNSALVRWFYIVVVPVTPSTLRHWENPEDIDLDELM-------GNNRDAAVRRRRRQTQDFLRPYIAAKLESLPERFVLGDEKTYSNYY--NKPLPGQQQYRTFILAALK-DRDSTFTVSPFSEPMMV 1131          

HSP 4 Score: 121.324 bits (303), Expect = 9.433e-27
Identity = 205/879 (23.32%), Postives = 325/879 (36.97%), Query Frame = 1
Query:  370 LACSSTGHPVPSISWKINESPIEELKSPLKKLQNPPRIFSIKNYQNSVLVITQLIESDSNSVLICEAENNAGFDSRQQQLKVISTETDIPSGFPVFQNNFFPIIKPYNSNVTLVCQAYGNPPPLIQWFKNYEL--INESFTKIKILNDGNLLLVQVTREDKGIYHCQAQNTNGLRLSDPSTLDI------TSYPISPNSLIIERFASDNVE----------ISWRSGLNDVTEQENFILHYREVPENITEKQIMSKFVYLTISEKKSIYKYNLKDLFPFTTYCIWMESENPLGVSPPTIALTVKTLPTSPQLSPRSITATSISNTAILVAWRP--PERKFGKFKYYQIIY---TNNDGFLPQHWRQFAVKDDNVMLTHLIASELYHIRVKIVNEIGHGPLSKTISIKTIAGTLSQCP-DFKITEIFQSHIKLQWGTPDPVKLFKLIQYNLLCWDVRLKIVNATAKSSTLFPI---LNHNLSMNEMEYVLYLKNEKEIKCRLSAINSDGKGMPTEIQASTVNKGVNYQNL-IHIDKIGSTYITFQWRPPSKFSFDYFLWIYQIFDSEKLDRAVKLPKIKINISDSASAENGWFVYNYTNAFSSSRYILGLRYLCRDSTDILREYVHRSDLVSTMKSVPSDSPKDLVVKEIDSNSALVSWKPLDQVHSNGIITHYEVRYYAPKKEESTERFINV------SETSAILSNLKYFHYVIYVRAFTKVGGGSWSNPKNYYRQNLEEFPIPTTIKGERKSETEINISWELPVLSEKNLAHAAIEGFIILYAPVESSPKWIKYTVQSKNLSA---VIKGLEPDLRYQFQIAATNYAGFNGNFSEIV---QEMPKNFPNLNLKTVPDLRCSVQSSNRLKVEWSSPSI 2886
              C + G P P I+W         +K   K       +    +   SVL I  L      ++  C A N+ G  +   +L V+  E  IP GFP         +       T++C A GNP P I WFK++    IN S  +IK L  G L +      D+G Y C A N+ G R S P+ L +        + I P +  +    S N+           + W  G  ++T++E              E  I    + LT          N++    +T  C+ + S   LG+   T  +TVK LP  P     S+  T  + T++ + W    PE       YY I Y    +++GF         V      +  L     Y  RV  VN IG GP S  +  +T     S  P   +   +  + + +QW  P+               + +++       S   FP+     HN   + +  +  L  +     R+ A  S G G P++I      +GV  Q      +    T I   W  P +     +   Y   DS+     +  P     I DS   +    +Y ++ A   +R  +GL    +                 T +SVP   P+ + V  I+S +  VSWKP  Q   +G I  Y+V Y   +  E   + I +      ++ + I   L    Y + V A+T  G G+ S  K            PT I       T + I W+ P    K +    + G+ + Y   E       YTV+    +     + GL     Y F++ A N AG    +S+ +   +++P ++P  NLK V        ++   K+ W  P +
Sbjct:   52 FVCQAVGEPKPRITW---------MKKGKKVSSQRFEVIEFDDGSGSVLRIQPLRTHRDEAIYECTATNSVGEINTSAKLTVLE-EDQIPHGFPTIDMGPQLKVVERTRTATMLCAASGNPDPEISWFKDFLPVDINSSNGRIKQLRSGALQIENSEESDQGKYECVAVNSAGTRYSAPANLYVRVRRVPPRFSIPPTNHEVMPGGSVNLTCVAVGAPMPYVKWMKGEQELTKEE--------------EMPIGRNVLELT----------NIRQSGNYT--CVAISS---LGMIDTTAQITVKALPRPPA----SLIVTETTATSVTLTWDSGNPE----PVSYYVIQYRSKISDNGFQEVD----GVASTRYSIGGLSPYSEYEFRVMAVNNIGRGPPSGMVETRTSEQAPSSPPLRVQARMLSATTMLVQWEPPEEP-------------NGQIRGYRVYYTSDLHFPLSTWQKHNTEDSSLTTISGLVPDITYGLRVLAFTSVGDGPPSDILQVKTQQGVPAQPTGFEAEAELDTRIMLSWLWPVQDQITKYELTYWEADSDNKHHVIFDPAGSYAI-DSLKPDT---LYKFSLA---ARSEMGLGVYTQPIE------------ARTAQSVPGAPPRRVEVDNINSTALRVSWKPPLQQKQHGHIRGYQVVYSRLENGEPRGQPIILDVALPEAQEAVISGLLPETTYSVTVAAYTTKGDGARSKAKVVTTTGAVPGK-PTMIISTTIGNTAL-IQWQPP----KEMV-GELMGYRLRYKREEED----IYTVRDFRRTDDHFTVTGLHKGATYIFKLCAKNRAGNGEEYSKEISTPEDVPSSYPQ-NLKVV------GLTTTTTKLAWDPPPL 829          
BLAST of Protein tyrosine phosphatase receptor type D vs. Ensembl Zebrafish
Match: ptprfa (protein tyrosine phosphatase receptor type Fa [Source:ZFIN;Acc:ZDB-GENE-020107-2])

HSP 1 Score: 720.309 bits (1858), Expect = 0.000e+0
Identity = 331/606 (54.62%), Postives = 440/606 (72.61%), Query Frame = 1
Query: 4006 SDSIKLRIGSQKSENISDRPSISICNLYQYVTDLKANDCTLLQAEFETLNTNLDDRFTWQRSNIDSNKSKNRYANVVAYDHTSVLLTPVDDVIGSDYINANYIDGYQRQNAYIATQGPLPDTTDDFWRMVWEQRSNCIVMMTRLEERSGIKCHQYWPNRGFICYGQMIVSHIDTFVLAYYTIRLFEIRHSKYSEKREIQHFQFTAWPDHGVPKLSTPLLMFIRRVRSIGKIESCPKIVHCSAGVGRTGAFIVVDAQLERIKQEKNIDVFNYVSKIRCQRNYMVQTQAQYQFILETLLEAVEDGNTEVMACNFHAHVTKLSQIGISGSNQLSGFEMEFSKLNSLASNRGRHGVMLADFVKAAGNQAVNMTKNRVRNIIPYEWNRVVLNAIRGIEGSDYINASYIDGYRDRRAYIAAQSPIPSTVEDFWRMLWDQHCGVVIVLNQPHE---DKSHIYWPINKSIRYQFFVVDPVVEYNMPNYILREFKVTDARDGEFRALRQFQFTQWPNHGCPKESESILDFIRQVHKTKEQFGHMEPMVIHCNTGSGRTGVFIALSIVLDRLQQESVVDMYQTVKLLHKQRIGLVQTEEQYEFCYMAVLDYLSNYE 5814
            SD +++R  + +++ + + P +S+C L  ++  L+AND      E+E+++     +FTW+ SN++ NK KNRYANV+AYDH+ V+LTPVD V GSDYIN NYIDGY++QNAYIATQGPLP+T  DFWRMVWEQR++ IVMMTRLEE+S +KC QYWP+RG   YG + VS +DT  LA Y++R F +  +  SEKRE++ FQF AWPDHGVP+  TP+L F+RRV++    ++ P +VHCSAGVGRTG FIV+DA LER+K EK++D++ +V+ +R QRNYMVQT+ QY FI E LLEA   GNTEV A + + H+ KL+Q      + ++  E+EF KL +  ++  R       F+ A+     N  KNR+ NI+P+E +RV L  IRG+EGSDYINAS+IDGYR ++AYIA Q P+  T EDFWRMLW+ +  +V++L +  E   +K H YWP  +S RYQ+FVVDP+ EYNMP YILREFKVTDARDG+ R +RQFQFT WP  G PK  E  +DFI QVHKTKEQFG   P+ +HC+ G GRTGVFI LSIVL+R++ E VVDM+QT+K L  QR  +VQTE+QY+ CY A L+YL +++
Sbjct: 1195 SDPVEMRRLNYQTQGMREHPPVSVCALADHIERLRANDSLRFSQEYESVDPG--QQFTWENSNLEVNKPKNRYANVIAYDHSRVVLTPVDGVPGSDYINGNYIDGYRKQNAYIATQGPLPETLSDFWRMVWEQRTSTIVMMTRLEEKSRVKCDQYWPSRGTETYGMIQVSMLDTVELATYSVRTFALYKNGSSEKREVRQFQFMAWPDHGVPEYPTPILAFLRRVKACNPPDAGPMVVHCSAGVGRTGCFIVIDAMLERMKHEKSVDIYGHVTCMRSQRNYMVQTEDQYIFIHEALLEAATCGNTEVPARSLYTHIQKLTQ--APPGDTVTAMELEFKKLANSKAHTSR-------FISAS--LPCNKFKNRLVNIMPFESSRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLSETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTIRQFQFTDWPEQGVPKTGEGFIDFIGQVHKTKEQFGQDGPITVHCSAGVGRTGVFITLSIVLERMRYEGVVDMFQTIKTLRTQRPAMVQTEDQYQLCYRAALEYLGSFD 1787          

HSP 2 Score: 202.601 bits (514), Expect = 1.373e-51
Identity = 103/263 (39.16%), Postives = 150/263 (57.03%), Query Frame = 1
Query: 5092 NQAVNMTKNRVRNIIPYEWNRVVLNAIRGIEGSDYINASYIDGYRDRRAYIAAQSPIPSTVEDFWRMLWDQHCGVVIVLNQPHEDKSHI----YWPINKSIRYQFFVVDPVVEYNMPNYILREFKVTDARDGEFRALRQFQFTQWPNHGCPKESESILDFIRQVHKTKEQFGHMEPMVIHCNTGSGRTGVFIALSIVLDRLQQESVVDMYQTVKLLHKQRIGLVQTEEQYEFCYMAVLDYLSNYEKILEKSHLY*TYQDLSES 5868
            N  VN  KNR  N+I Y+ +RVVL  + G+ GSDYIN +YIDGYR + AYIA Q P+P T+ DFWRM+W+Q    ++++ +  E+KS +    YWP   +  Y    V  +    +  Y +R F +      E R +RQFQF  WP+HG P+    IL F+R+V           PMV+HC+ G GRTG FI +  +L+R++ E  VD+Y  V  +  QR  +VQTE+QY F + A+L+  +     +    LY   Q L+++
Sbjct: 1255 NLEVNKPKNRYANVIAYDHSRVVLTPVDGVPGSDYINGNYIDGYRKQNAYIATQGPLPETLSDFWRMVWEQRTSTIVMMTR-LEEKSRVKCDQYWPSRGTETYGMIQVSMLDTVELATYSVRTFALYKNGSSEKREVRQFQFMAWPDHGVPEYPTPILAFLRRVKACNPP--DAGPMVVHCSAGVGRTGCFIVIDAMLERMKHEKSVDIYGHVTCMRSQRNYMVQTEDQYIFIHEALLEAATCGNTEVPARSLYTHIQKLTQA 1514          

HSP 3 Score: 157.918 bits (398), Expect = 7.008e-38
Identity = 250/1151 (21.72%), Postives = 447/1151 (38.84%), Query Frame = 1
Query:  277 NSQITFTENDEAP----KISLIIQSPNVLLFKSMILACSSTGHPVPSISWKINESPIEELKSPLKKLQNPPRIFSIKNYQNSVLVITQLIESDSNSVLICEAENNAGFD-SRQQQLKVISTETDIPSGFPVFQNNFFPIIKPYNSNVTLVCQAYGNPPPLIQWFKNYELINESFTKIKILNDGNLLLVQVTREDKGIYHCQAQNTNGLRLSDPSTLDITSYPISPNSLIIERFASDNVEISWRSGLNDVTEQENFILHYREVPENITEKQIMSKFVYLTISEKKSIY--KYNLKDLFPFTTYCIWMESENPLGVSPPTIALTVKTLPTSPQLSPRSITATSISNTAILVAWRPPERKFGKFKYYQIIYTNNDGFLPQHWRQFAVKDDNV-MLTHLIASELYHIRVKIVNEIGHGPLSKTISIKTIAGTLSQCPDFKITEIFQSHIKLQWGTPDPVKLFKLIQYNLLCWDVRLKIVNATAKSSTLF-PILNHNLSMNEMEYVLYLKNEKEIKCRLSAINSDGKGM---PTEIQASTVNKGVNYQNLIHIDKIGSTYITFQWRPPSKFSFDYFLWIYQIFDSEKLDRA----------VKLPKIKINISDSASAENGW--FVYNYTNAFSSSRYILGLRYLCRDSTDILREYVHRSDLVSTMKSVPSDSPKDLVVKEIDSNSALVSWKPLDQVHSNGIITHYEVRYYAPKKEESTERFINVSETSAILSNL-KYFHYVIYVRAFTKVGGG-----SWSNPKNY---YRQNLEEFPIPTTIKGERKSETEINISWELPVLSEKNLAHAAIEGFIILYAPVESSPKWIKYTVQSKNLSAVIKGLEPDLRYQFQIAATNYAGFNGNFSEIVQ------EMPKNFPNLNLKTVPDLRCSVQSSNRLKVEWSSPSISTDLLKFEIRYSGNLSYITEIGLKKSEFIDMESKSVNFETLVNRYDVTLENLQSNALYKIAVRAIYQNKELYESHRETTCDTMPAVPNLVKPPIIVGLD-EEKSKVIIKLHRCSQRNGKISYYFVIVAAFQGNKNQQISFQEDTESYTFMELSVNTRSNNAKGEYIAIMKDINDIFK--VSGKDHS---SVLLGDGTHDENHLSVNKKLEKNFNYRCFARVCLKYSNNSLCKSSPWSEPFRI 3594
            ++++T  E D+ P     I +  Q   V   ++  + C+++G+P P ISW  +  P++   S  +          IK  ++  L I    ESD      C A N+AG   S    L V           P   +   P       +V L C A G P P ++W K      +  TK + +  G  +L        G Y C A ++ G+ +   + + + + P  P SLI+    + +V ++W SG  +      +++ YR            SK       E   +   +Y++  L P++ Y   + + N +G  PP+  +  +T   +P   P  + A  +S T +LV W PPE   G+ + Y++ YT++  F    W++   +D ++  ++ L+    Y +RV     +G GP S  + +KT  G  +Q   F+      + I L W  P   ++ K   Y L  W+      ++  K   +F P  ++ +          LK +   K  L+A +  G G+   P E + +    G   +  + +D I ST +   W+PP +      +  YQ+  S +L+            V LP+ +  +      E  +   V  YT     +R                     ++ +V+T  +VP      +++     N+AL+ W+P  ++   G +  Y +RY   +++  T R    ++    ++ L K   Y+  + A  + G G       S P++    Y QNL+   + TT            ++W+ P L E+N     I  ++++Y  + S       T  ++     I+GL+PD  Y  ++ A    G  G  S  +Q       MP+   N  +K V  ++ SV       + W  P      + F+I Y+                     +SV  +  + R  +T   LQ +  Y   +  + +        ++ +  T P +      P    LD EE  K+ I L      +  + +++++V     +  +     ED +    M        NN         +   D  +  ++ K  S     +LGD     N+   NK L     YR F    LK   +S    SP+SEP  +
Sbjct:  119 SAKLTVLEEDQIPHGFPTIDMGPQLKVVERTRTATMLCAASGNPDPEISWFKDFLPVDINSSNGR----------IKQLRSGALQIENSEESDQGK-YECVAVNSAGTRYSAPANLYVRVRRVPPRFSIPPTNHEVMP-----GGSVNLTCVAVGAPMPYVKWMKG----EQELTKEEEMPIGRNVLELTNIRQSGNYTCVAISSLGM-IDTTAQITVKALPRPPASLIVTETTATSVTLTWDSGNPEPVSY--YVIQYR------------SKISDNGFQEVDGVASTRYSIGGLSPYSEYEFRVMAVNNIGRGPPSGMVETRTSEQAPSSPPLRVQARMLSATTMLVQWEPPEEPNGQIRGYRVYYTSDLHFPLSTWQKHNTEDSSLTTISGLVPDITYGLRVLAFTSVGDGPPSDILQVKTQQGVPAQPTGFEAEAELDTRIMLSWLWPVQDQITK---YELTYWE-----ADSDNKHHVIFDPAGSYAIDS--------LKPDTLYKFSLAARSEMGLGVYTQPIEARTAQSVPGAPPRR-VEVDNINSTALRVSWKPPLQQKQHGHIRGYQVVYS-RLENGEPRGQPIILDVALPEAQEAVISGLLPETTYSVTVAAYTTKGDGAR--------------------SKAKVVTTTGAVPGKP--TMIISTTIGNTALIQWQPPKEM--VGELMGYRLRYKREEEDIYTVRDFRRTDDHFTVTGLHKGATYIFKLCAKNRAGNGEEYSKEISTPEDVPSSYPQNLKVVGLTTTT---------TKLAWDPPPLPERN---GKIVRYVVVYRDINSHQNQTNGTADTE---MTIQGLKPDTTYDIRVRAFTGKG-GGPISPSIQSRTMSTSMPEFTKNFGVKAV--MKTSVL------LTWEVPETYKSQVPFKILYN--------------------QQSVEVQGDLKRKLIT--RLQPDTDYSFVL--MSRGNSAGGLQQQVSIRTAPDL--FTTKPAHQKLDPEEGGKLAITLPEV-HNSALVRWFYIVVVPVTPSTLRHWENPEDIDLDELM-------GNNRDAAVRRRRRQTQDFLRPYIAAKLESLPERFVLGDEKTYSNYY--NKPLPGQQQYRTFILAALK-DRDSTFTVSPFSEPMMV 1131          

HSP 4 Score: 121.324 bits (303), Expect = 9.433e-27
Identity = 205/879 (23.32%), Postives = 325/879 (36.97%), Query Frame = 1
Query:  370 LACSSTGHPVPSISWKINESPIEELKSPLKKLQNPPRIFSIKNYQNSVLVITQLIESDSNSVLICEAENNAGFDSRQQQLKVISTETDIPSGFPVFQNNFFPIIKPYNSNVTLVCQAYGNPPPLIQWFKNYEL--INESFTKIKILNDGNLLLVQVTREDKGIYHCQAQNTNGLRLSDPSTLDI------TSYPISPNSLIIERFASDNVE----------ISWRSGLNDVTEQENFILHYREVPENITEKQIMSKFVYLTISEKKSIYKYNLKDLFPFTTYCIWMESENPLGVSPPTIALTVKTLPTSPQLSPRSITATSISNTAILVAWRP--PERKFGKFKYYQIIY---TNNDGFLPQHWRQFAVKDDNVMLTHLIASELYHIRVKIVNEIGHGPLSKTISIKTIAGTLSQCP-DFKITEIFQSHIKLQWGTPDPVKLFKLIQYNLLCWDVRLKIVNATAKSSTLFPI---LNHNLSMNEMEYVLYLKNEKEIKCRLSAINSDGKGMPTEIQASTVNKGVNYQNL-IHIDKIGSTYITFQWRPPSKFSFDYFLWIYQIFDSEKLDRAVKLPKIKINISDSASAENGWFVYNYTNAFSSSRYILGLRYLCRDSTDILREYVHRSDLVSTMKSVPSDSPKDLVVKEIDSNSALVSWKPLDQVHSNGIITHYEVRYYAPKKEESTERFINV------SETSAILSNLKYFHYVIYVRAFTKVGGGSWSNPKNYYRQNLEEFPIPTTIKGERKSETEINISWELPVLSEKNLAHAAIEGFIILYAPVESSPKWIKYTVQSKNLSA---VIKGLEPDLRYQFQIAATNYAGFNGNFSEIV---QEMPKNFPNLNLKTVPDLRCSVQSSNRLKVEWSSPSI 2886
              C + G P P I+W         +K   K       +    +   SVL I  L      ++  C A N+ G  +   +L V+  E  IP GFP         +       T++C A GNP P I WFK++    IN S  +IK L  G L +      D+G Y C A N+ G R S P+ L +        + I P +  +    S N+           + W  G  ++T++E              E  I    + LT          N++    +T  C+ + S   LG+   T  +TVK LP  P     S+  T  + T++ + W    PE       YY I Y    +++GF         V      +  L     Y  RV  VN IG GP S  +  +T     S  P   +   +  + + +QW  P+               + +++       S   FP+     HN   + +  +  L  +     R+ A  S G G P++I      +GV  Q      +    T I   W  P +     +   Y   DS+     +  P     I DS   +    +Y ++ A   +R  +GL    +                 T +SVP   P+ + V  I+S +  VSWKP  Q   +G I  Y+V Y   +  E   + I +      ++ + I   L    Y + V A+T  G G+ S  K            PT I       T + I W+ P    K +    + G+ + Y   E       YTV+    +     + GL     Y F++ A N AG    +S+ +   +++P ++P  NLK V        ++   K+ W  P +
Sbjct:   52 FVCQAVGEPKPRITW---------MKKGKKVSSQRFEVIEFDDGSGSVLRIQPLRTHRDEAIYECTATNSVGEINTSAKLTVLE-EDQIPHGFPTIDMGPQLKVVERTRTATMLCAASGNPDPEISWFKDFLPVDINSSNGRIKQLRSGALQIENSEESDQGKYECVAVNSAGTRYSAPANLYVRVRRVPPRFSIPPTNHEVMPGGSVNLTCVAVGAPMPYVKWMKGEQELTKEE--------------EMPIGRNVLELT----------NIRQSGNYT--CVAISS---LGMIDTTAQITVKALPRPPA----SLIVTETTATSVTLTWDSGNPE----PVSYYVIQYRSKISDNGFQEVD----GVASTRYSIGGLSPYSEYEFRVMAVNNIGRGPPSGMVETRTSEQAPSSPPLRVQARMLSATTMLVQWEPPEEP-------------NGQIRGYRVYYTSDLHFPLSTWQKHNTEDSSLTTISGLVPDITYGLRVLAFTSVGDGPPSDILQVKTQQGVPAQPTGFEAEAELDTRIMLSWLWPVQDQITKYELTYWEADSDNKHHVIFDPAGSYAI-DSLKPDT---LYKFSLA---ARSEMGLGVYTQPIE------------ARTAQSVPGAPPRRVEVDNINSTALRVSWKPPLQQKQHGHIRGYQVVYSRLENGEPRGQPIILDVALPEAQEAVISGLLPETTYSVTVAAYTTKGDGARSKAKVVTTTGAVPGK-PTMIISTTIGNTAL-IQWQPP----KEMV-GELMGYRLRYKREEED----IYTVRDFRRTDDHFTVTGLHKGATYIFKLCAKNRAGNGEEYSKEISTPEDVPSSYPQ-NLKVV------GLTTTTTKLAWDPPPL 829          
BLAST of Protein tyrosine phosphatase receptor type D vs. Ensembl Xenopus
Match: brdt (bromodomain, testis-specific [Source:Xenbase;Acc:XB-GENE-983868])

HSP 1 Score: 721.85 bits (1862), Expect = 0.000e+0
Identity = 338/626 (53.99%), Postives = 450/626 (71.88%), Query Frame = 1
Query: 3949 NADSVQMCQ-DGTKLSPVLVSDSIKLRIGSQKSENISDRPSISICNLYQYVTDLKANDCTLLQAEFETLNTNLDDRFTWQRSNIDSNKSKNRYANVVAYDHTSVLLTPVDDVIGSDYINANYIDGYQRQNAYIATQGPLPDTTDDFWRMVWEQRSNCIVMMTRLEERSGIKCHQYWPNRGFICYGQMIVSHIDTFVLAYYTIRLFEIRHSKYSEKREIQHFQFTAWPDHGVPKLSTPLLMFIRRVRSIGKIESCPKIVHCSAGVGRTGAFIVVDAQLERIKQEKNIDVFNYVSKIRCQRNYMVQTQAQYQFILETLLEAVEDGNTEVMACNFHAHVTKLSQIGISGSNQLSGFEMEFSKLNSLASNRGRHGVMLADFVKAAGNQAVNMTKNRVRNIIPYEWNRVVLNAIRGIEGSDYINASYIDGYRDRRAYIAAQSPIPSTVEDFWRMLWDQHCGVVIVLNQPHE---DKSHIYWPINKSIRYQFFVVDPVVEYNMPNYILREFKVTDARDGEFRALRQFQFTQWPNHGCPKESESILDFIRQVHKTKEQFGHMEPMVIHCNTGSGRTGVFIALSIVLDRLQQESVVDMYQTVKLLHKQRIGLVQTEEQYEFCYMAVLDYLSNYE 5814
            N+D    C  +  +++P   +D +++R  + ++  + + P I I +L ++   LKAND   L  E+E+++     +FTW+ SN++ NK+KNRYANV+AYDH+ V+L PV+ +IGSDYINANYIDGY++QNAYIATQG LP+T  DFWRMVWEQRS  +VMMT+LEE+S IKC QYWP+RG   YG + V+ +DT  LA + +R F +  S  SEKRE++ FQFTAWPDHGVP+  TP L F+RRV++    ++ P +VHCSAGVGRTG FIV+DA LERIK EK +D++ +V+ +R QRNYMVQT+ QY FI + LLEAV  GNTEV A N + ++ KL+QI +     ++G E+EF +L +  ++  R       F+ A  N   N  KNR+ NI+PYE  RV L  IRG+EGSDYINAS+IDGYR ++AYIA Q P+  T EDFWRMLW+ +  +V++L +  E   +K H YWP  +S RYQ+FVVDP+ EYNMP YILREFKVTDARDG+ R +RQFQFT WP  G PK  E  +DFI QVHKTKEQFG   P+ +HC+ G GRTGVFI LSIVL+R++ E VVD++QTVK+L  QR  +VQTE++Y+FCY A L+YL +++
Sbjct: 1282 NSDPRTKCLLNNAEIAPHHPTDPVEMRRINFQTPGMLNHPPIPIADLSEHTEHLKANDNLKLSQEYESVDPG--QQFTWEHSNLEVNKAKNRYANVIAYDHSRVILLPVEGIIGSDYINANYIDGYRKQNAYIATQGALPETFGDFWRMVWEQRSATVVMMTKLEEKSRIKCDQYWPSRGTETYGMIQVTLLDTIELATFCVRTFSLHKSGSSEKREVRQFQFTAWPDHGVPEYPTPFLAFLRRVKTCNPPDAGPVVVHCSAGVGRTGCFIVIDAMLERIKHEKTVDIYGHVTLMRSQRNYMVQTEDQYSFIHDALLEAVACGNTEVPARNLYTYIQKLAQIEL--GEHVTGMELEFKRLANSKAHTSR-------FISA--NLPCNKFKNRLVNIMPYESTRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWENNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDEYQFCYQAALEYLGSFD 1894          

HSP 2 Score: 202.216 bits (513), Expect = 2.768e-51
Identity = 104/262 (39.69%), Postives = 152/262 (58.02%), Query Frame = 1
Query: 5092 NQAVNMTKNRVRNIIPYEWNRVVLNAIRGIEGSDYINASYIDGYRDRRAYIAAQSPIPSTVEDFWRMLWDQHCGVVIVLNQPHEDKSHI----YWPINKSIRYQFFVVDPVVEYNMPNYILREFKVTDARDGEFRALRQFQFTQWPNHGCPKESESILDFIRQVHKTKEQFGHMEPMVIHCNTGSGRTGVFIALSIVLDRLQQESVVDMYQTVKLLHKQRIGLVQTEEQYEFCYMAVLDYLSNYEKILEKSHLY*TYQDLSE 5865
            N  VN  KNR  N+I Y+ +RV+L  + GI GSDYINA+YIDGYR + AYIA Q  +P T  DFWRM+W+Q    V+++ +  E+KS I    YWP   +  Y    V  +    +  + +R F +  +   E R +RQFQFT WP+HG P+     L F+R+V           P+V+HC+ G GRTG FI +  +L+R++ E  VD+Y  V L+  QR  +VQTE+QY F + A+L+ ++     +   +LY   Q L++
Sbjct: 1362 NLEVNKAKNRYANVIAYDHSRVILLPVEGIIGSDYINANYIDGYRKQNAYIATQGALPETFGDFWRMVWEQRSATVVMMTK-LEEKSRIKCDQYWPSRGTETYGMIQVTLLDTIELATFCVRTFSLHKSGSSEKREVRQFQFTAWPDHGVPEYPTPFLAFLRRVKTCNPP--DAGPVVVHCSAGVGRTGCFIVIDAMLERIKHEKTVDIYGHVTLMRSQRNYMVQTEDQYSFIHDALLEAVACGNTEVPARNLYTYIQKLAQ 1620          

HSP 3 Score: 153.68 bits (387), Expect = 1.692e-36
Identity = 253/1086 (23.30%), Postives = 412/1086 (37.94%), Query Frame = 1
Query:  370 LACSSTGHPVPSISW-----KINESPIEELKSPLKKLQNPPRIFSIKNYQNSVLVITQLIESDSNSVLICEAENNAGFDSRQQQLKVISTETDIPSGFPVFQNNFFPIIKPYNSNVTLVCQAYGNPPPLIQWFKNYELINESFT--KIKILNDGN----LLLVQVTRE-DKGIYHCQAQNTNGLRLSDPSTLDITSYPISPNSLII----ERFASDNVEIS------------WRSGLNDVTEQENFILHYREVPENITEKQIMSKFVYLTISEKKSIYKYNLKDLFPFTTYCIWMESENPLGVSPPTIALTVKTLPTSPQLSPRSITATSISNTAILVAWRPPERKFGKFKYYQIIYTNNDGFLPQHWRQFAVKDDNVMLTHLIAS----ELYHIRVKIVNEIGHGPLSKTISIKTIAGTLSQCP-DFKITEIFQSHIKLQWGTPDPVKLFKLIQYNLLCWDVRLKIVNATAKSSTLFPILNHNLSMNEMEYVLYLKNEKEIKCRLSAINSDGKG-MPTEIQASTVNKGVNYQNL-IHIDKIGSTYITFQWRPPSKFSFDYFLWIYQIFDSEKLDRAVKLPKIKINISDSASAENGWFVYNYTNAFSSSRYILGLRYLCRDSTDILREYVHRSDLVSTMKSVPSDSPKDLVVKEIDSNSALVSWKPLDQVHSNGIITHYEVRYYAPKKEESTERFIN--VSETSAILSNL--KYFHYVIYVRAFTKVGGGSWSNPKNYYRQNLEEFPIPTTIKGERKSETEINISWELPVLSEKNLAHAAIEGFIILYAPVE----SSPKWIKYTVQSKNLSAVIKGLEPDLRYQFQIAATNYAGFNGNFSEIVQEMPKNFPNLNLKTVPDLRCSVQSSNRLKVEWSSPSISTDLLKFEIRYSGNLSYITEIGLKKSEFIDMESKSVNFETLVNRYDVTLENLQSNALYKIAVRAIYQNKELYESHRETTCDTMPAVPNLVKPPIIVGLDEEKSKVIIKLHRCSQRNGKIS-YYFVIVAAFQGNKNQQISFQEDTESYTFMELSVNT------RSNNAKG--------EYIAIMKD--INDIFKVSGKDHSSVLL 3447
              C +TG P P ++W     K+N    E ++                    +VL I  L      +V  C A+N  G +    +L V+  E  +PSGFP         +       T++C A GNP P I WFK++  ++ + +  +IK L  G      L ++ + E D+G Y C A N+ G+R S P+ L +    ++P   I+    E     NV I+            W  G  D+T +++       V  N+ E         LT          N+K+   +T  C+ M S   LGV      +TVK+LP +P     +   T  + T+I V W           YY I Y +     P     + +K+D     + I        Y I V  VN IG GP S+ +  +T     +  P + +   +  + + +QW  P        ++ N      R+       +  + +  L +N+  + +  +  L   +    R+ A  S G G +   IQ  T  +GV  Q +    +    T I   W PP + S   +   Y+  +             ++   D A++      Y       ++ Y+   R   R S  +    +   +   TM+S PS  P+++      S + LVSW P      NG++  Y VRY A   +++  + +     +T+ IL     K+  Y I V A T+VG G  S P             P  ++ E  + T I + W  PV   +N  H  I G+ + Y  +E    S    IK  + +     VI GL+P+  Y   +AA    G        +       P       PDL     S   L VEW  P  S   +         L Y  + G +    +     ++ F  L  +Y  T  +  +  ++K+AV+      E          DT    P L++  I+  +  + + +   L   ++RNG I+ Y      A    K Q+I       S+   +L+ NT      R++  KG        +Y   + D  +   FKV     +SVLL
Sbjct:   43 FVCQATGDPKPRVTWNKRGKKVNSQRFETIE--------------FDEGAGAVLRIQPLRTPRDENVYECVAQNVHGEEVVSAKLTVLR-EDQLPSGFPNIDMGPQLKVVERTRTATMLCAASGNPDPEITWFKDFLPVDPASSNGRIKQLRSGKTTNCALQIENSEETDQGKYECVATNSAGVRYSSPANLYVRVRRVAPRFSILPVSHEIMPGGNVNITCVAVGSPMPYVKWMVGAEDLTPEDDM-----PVGRNVLE---------LT----------NVKESANYT--CVAMSS---LGVIESVAQITVKSLPKAPG----TPVVTETTATSITVTWD--SGNPDPVSYYVIEYKSKSQDGP-----YQIKEDITTTRYSIGGLSPNSEYEIWVSAVNSIGQGPPSEPVVTRTGEQAPASAPRNVQARMLSSTTMIIQWEEP--------VEPNGQIRGYRVYYTMEPDQPVSSW--LKYNVDDSLLTTIGSLLEHETYTVRVLAFTSVGDGPLSDPIQVKT-QQGVPGQPMNFRAEAKSETSIGLTWSPPRQDSIVKYELNYREGEGGN----------EVRTFDPATS------YTVEGLKPNTEYL--FRLAARSSHGLGAWTLDIKE--RTMQSKPSAPPRNVKCVSSKSTTILVSWLPPPAESQNGVLAGYSVRYSALDSDDTRPKEVKDIPPQTTQILLEALEKWTVYRITVVAHTEVGPGPESPPVEIRTDEDVPSAPPRKVEVEVLNSTAIKVFWRSPV---QNRQHGQIRGYQVHYVRMENGEASGLTLIKDVMLADAQEMVISGLQPETSYSVTVAAYTMKGDGARSKPKLVTTRGAVPGK-----PDLFVHQNSDGSLLVEWEPPRESEGHI---------LGYRLQFGRQDVMLLS----TLEFGELEKKYLATNIHKGATYVFKMAVKGRVGLSEEAVKEFIVPEDTPKGFPQLIEKGIVTSMSIQLNWLPPVL---AERNGVITKYTLAYRVAGSSEKLQEIDLPSSDNSFILTDLNPNTVYEVKIRAHTRKGPGPYSPTVQYRTFLLDQVLPKNFKVKMVTKTSVLL 1018          

HSP 4 Score: 148.288 bits (373), Expect = 7.801e-35
Identity = 209/965 (21.66%), Postives = 390/965 (40.41%), Query Frame = 1
Query:  271 LINSQITFTENDEAPK----ISLIIQSPNVLLFKSMILACSSTGHPVPSISWKINESPIEELKS--PLKKLQNPPRIFSIKNYQNSVLVITQLIESDSNSVLICEAENNAGFDSRQQQLKVISTETDIP--SGFPVFQNNFFPIIKPYNSNVTLVCQAYGNPPPLIQWFKNYELINESFTKIKILNDGNLLLVQVTREDKGIYHCQAQNTNGLRLSDPSTLDITSYPISPNSLIIERFASDNVEISWRSGLNDVTEQENFILHYREVPENITEKQIMSKFVYLTISEKKSIYKYNLKDLFPFTTYCIWMESENPLGVSPPTIALTVKTLPTSPQLSPRSITATSISNTAILVAWRPPERKFGKFKYYQIIYTNNDGFLPQHWRQFAVKDDNVMLT--HLIASELYHIRVKIVNEIGHGPLSKTISIKTIAGTLSQCPDFKITEIFQSHIKLQWGTPDPVKLFKLIQYNLLCWDVRLKIVNATAKSSTLFPILNHNLSMNEMEYVLYLKNEKEIKCRLSAINSDGKGMPT-EIQASTV-NKGVNYQNLIHIDKIGSTYITFQWRPPSKFSFDYFLWIYQIFDSEKLDRAVKLPKIKINISDSAS-----AENGWFVYNYTNAFSSSRYILGLRYLCRDSTDILREYVHRSDLVSTMKSVPSDSPKDLVVKEIDSNSALVSWKPLDQVHSNGIITHYEVRYYAPKKEEST-----ERFINVSETSAILSNLK-YFHYVIYVRAFTKVGGGSWSNPKNYYRQNLEEFPIPTTIKGERKSETEINISWELPVLSEKNLAHAAIE---GFIILYAPVESSPKWIKYTVQSKNLSAVIKGLEPDLRYQFQIAATNYAGFNGNFSE---IVQEMPKNFPNLNLKTVPDLRCSVQSSNRLKVEWSSPSISTDLLKFEIRYSGNLSYITEIGLKKSEFIDMESKSVNFETLVNRYDVTLENLQSNALYKIAVRA 3078
            ++++++T    D+ P     I +  Q   V   ++  + C+++G+P P I+W  +  P++   S   +K+L++           N  L I    E+D      C A N+AG          +      P  S  PV        I P   NV + C A G+P P ++W     +  E  T    +  G  +L     ++   Y C A ++ G+ +   + + + S P +P + ++    + ++ ++W SG  D      +++ Y+            S+     I E  +  +Y++  L P + Y IW+ + N +G  PP+  +  +T   +P  +PR++ A  +S+T +++ W  P    G+ + Y++ YT         W ++ V DD+++ T   L+  E Y +RV     +G GPLS  I +KT  G   Q  +F+     ++ I L W  P         Q +++ +++  +      +  T  P  ++         V  LK   E   RL+A +S G G  T +I+  T+ +K       +      ST I   W PP   S +  L  Y +  S  LD     PK   +I    +     A   W VY               R      T++          + T + VPS  P+ + V+ ++S +  V W+   Q   +G I  Y+V Y   +  E++     +  +       ++S L+    Y + V A+T  G G+ S PK    +     P    +   + S+  + + WE P  SE ++    ++     ++L + +E      KY   + +  A          Y F++A     G +    +   + ++ PK FP L       +   + +S  +++ W  P ++    +  +     L+Y      +K + ID+ S   +F          L +L  N +Y++ +RA
Sbjct:  108 VVSAKLTVLREDQLPSGFPNIDMGPQLKVVERTRTATMLCAASGNPDPEITWFKDFLPVDPASSNGRIKQLRS-------GKTTNCALQIENSEETDQGKYE-CVATNSAGVRYSSPANLYVRVRRVAPRFSILPVSHE-----IMP-GGNVNITCVAVGSPMPYVKWM----VGAEDLTPEDDMPVGRNVLELTNVKESANYTCVAMSSLGV-IESVAQITVKSLPKAPGTPVVTETTATSITVTWDSGNPDPVSY--YVIEYKS----------KSQDGPYQIKEDITTTRYSIGGLSPNSEYEIWVSAVNSIGQGPPSEPVVTRTGEQAPASAPRNVQARMLSSTTMIIQWEEPVEPNGQIRGYRVYYTMEPDQPVSSWLKYNV-DDSLLTTIGSLLEHETYTVRVLAFTSVGDGPLSDPIQVKTQQGVPGQPMNFRAEAKSETSIGLTWSPPR--------QDSIVKYELNYREGEGGNEVRTFDPATSYT--------VEGLKPNTEYLFRLAARSSHGLGAWTLDIKERTMQSKPSAPPRNVKCVSSKSTTILVSWLPPPAESQNGVLAGYSVRYS-ALDSDDTRPKEVKDIPPQTTQILLEALEKWTVY---------------RITVVAHTEVGPGPESPPVEIRTDEDVPSAPPRKVEVEVLNSTAIKVFWRSPVQNRQHGQIRGYQVHYVRMENGEASGLTLIKDVMLADAQEMVISGLQPETSYSVTVAAYTMKGDGARSKPKLVTTRG--AVPGKPDLFVHQNSDGSLLVEWEPPRESEGHILGYRLQFGRQDVMLLSTLEFGELEKKYLATNIHKGAT---------YVFKMAVKGRVGLSEEAVKEFIVPEDTPKGFPQL-------IEKGIVTSMSIQLNWLPPVLAE---RNGVITKYTLAYRVAGSSEKLQEIDLPSSDNSF---------ILTDLNPNTVYEVKIRA 978          

HSP 5 Score: 96.2857 bits (238), Expect = 5.951e-19
Identity = 118/494 (23.89%), Postives = 210/494 (42.51%), Query Frame = 1
Query: 1126 YNLKDLFPFTTYCIWMESENPLGVSPPTIALTVKTLPTSPQLSPRSITATSISNTAILVAWRPP--ERKFGKFKYYQIIYT--NNDGFLPQHWRQFAVKDDNVMLTHLIASELYHIRVKIVNEIGHGPLSKTISIKTIAGTLSQCPDFKITEIFQS-HIKLQWGTPDPVKLFKLIQYNLLCWDVRLKIVNATAKSSTLFPILNHNLSMNEMEYVLYLKNEKEIKCRLSAINSDGKGMPTEIQASTVNKGVNYQNLIHIDKIGSTYITFQWRPPSKFSFDYFLWIYQIFDSEKLDRAVKLPKIKINISDSASAENGWFVYNY--TNAFSSSRYILGLRYLCRD--STDILREYVHRSDLVSTMKSVPSDSPK---DLVVKEI-DSNSALVSWKPLDQVHSNGIITHYEVRY-YAPKKEESTERFINVSETSAILSNLKYFH-YVIYVRAFTKVGGGSWSNPKNYYRQNLEEFPIPTTIKGERKSETEINISWELP 2562
            Y ++ L P T Y   + + +  G+   T+ +  +T+ + P   PR++   S  +T ILV+W PP  E + G    Y + Y+  ++D   P+  +    +   ++L  L    +Y I V    E+G GP S  + I+T     S  P     E+  S  IK+ W +P   +    I+   + +   +++ N  A   TL  I +  L+  +   +  L+ E      ++A    G G  ++ +  T    V  +  + + +     +  +W PP               +SE      +L   + ++   ++ E G     Y  TN    + Y+  +    R   S + ++E++           VP D+PK    L+ K I  S S  ++W P      NG+IT Y + Y  A   E+  E  +  S+ S IL++L     Y + +RA T+ G G +S P   YR  L +  +P   K +  ++T + +SWE P
Sbjct:  561 YTVEGLKPNTEYLFRLAARSSHGLGAWTLDIKERTMQSKPSAPPRNVKCVSSKSTTILVSWLPPPAESQNGVLAGYSVRYSALDSDDTRPKEVKDIPPQTTQILLEALEKWTVYRITVVAHTEVGPGPESPPVEIRTDEDVPSAPPRKVEVEVLNSTAIKVFWRSPVQNRQHGQIRGYQVHY---VRMENGEASGLTL--IKDVMLADAQEMVISGLQPETSYSVTVAAYTMKGDGARSKPKLVTTRGAVPGKPDLFVHQNSDGSLLVEWEPPR--------------ESEGHILGYRLQFGRQDVMLLSTLEFGELEKKYLATNIHKGATYVFKMAVKGRVGLSEEAVKEFI-----------VPEDTPKGFPQLIEKGIVTSMSIQLNWLPPVLAERNGVITKYTLAYRVAGSSEKLQEIDLPSSDNSFILTDLNPNTVYEVKIRAHTRKGPGPYS-PTVQYRTFLLDQVLPKNFKVKMVTKTSVLLSWEFP 1023          
BLAST of Protein tyrosine phosphatase receptor type D vs. Ensembl Xenopus
Match: brdt (bromodomain, testis-specific [Source:Xenbase;Acc:XB-GENE-983868])

HSP 1 Score: 721.85 bits (1862), Expect = 0.000e+0
Identity = 338/626 (53.99%), Postives = 450/626 (71.88%), Query Frame = 1
Query: 3949 NADSVQMCQ-DGTKLSPVLVSDSIKLRIGSQKSENISDRPSISICNLYQYVTDLKANDCTLLQAEFETLNTNLDDRFTWQRSNIDSNKSKNRYANVVAYDHTSVLLTPVDDVIGSDYINANYIDGYQRQNAYIATQGPLPDTTDDFWRMVWEQRSNCIVMMTRLEERSGIKCHQYWPNRGFICYGQMIVSHIDTFVLAYYTIRLFEIRHSKYSEKREIQHFQFTAWPDHGVPKLSTPLLMFIRRVRSIGKIESCPKIVHCSAGVGRTGAFIVVDAQLERIKQEKNIDVFNYVSKIRCQRNYMVQTQAQYQFILETLLEAVEDGNTEVMACNFHAHVTKLSQIGISGSNQLSGFEMEFSKLNSLASNRGRHGVMLADFVKAAGNQAVNMTKNRVRNIIPYEWNRVVLNAIRGIEGSDYINASYIDGYRDRRAYIAAQSPIPSTVEDFWRMLWDQHCGVVIVLNQPHE---DKSHIYWPINKSIRYQFFVVDPVVEYNMPNYILREFKVTDARDGEFRALRQFQFTQWPNHGCPKESESILDFIRQVHKTKEQFGHMEPMVIHCNTGSGRTGVFIALSIVLDRLQQESVVDMYQTVKLLHKQRIGLVQTEEQYEFCYMAVLDYLSNYE 5814
            N+D    C  +  +++P   +D +++R  + ++  + + P I I +L ++   LKAND   L  E+E+++     +FTW+ SN++ NK+KNRYANV+AYDH+ V+L PV+ +IGSDYINANYIDGY++QNAYIATQG LP+T  DFWRMVWEQRS  +VMMT+LEE+S IKC QYWP+RG   YG + V+ +DT  LA + +R F +  S  SEKRE++ FQFTAWPDHGVP+  TP L F+RRV++    ++ P +VHCSAGVGRTG FIV+DA LERIK EK +D++ +V+ +R QRNYMVQT+ QY FI + LLEAV  GNTEV A N + ++ KL+QI +     ++G E+EF +L +  ++  R       F+ A  N   N  KNR+ NI+PYE  RV L  IRG+EGSDYINAS+IDGYR ++AYIA Q P+  T EDFWRMLW+ +  +V++L +  E   +K H YWP  +S RYQ+FVVDP+ EYNMP YILREFKVTDARDG+ R +RQFQFT WP  G PK  E  +DFI QVHKTKEQFG   P+ +HC+ G GRTGVFI LSIVL+R++ E VVD++QTVK+L  QR  +VQTE++Y+FCY A L+YL +++
Sbjct: 1295 NSDPRTKCLLNNAEIAPHHPTDPVEMRRINFQTPGMLNHPPIPIADLSEHTEHLKANDNLKLSQEYESVDPG--QQFTWEHSNLEVNKAKNRYANVIAYDHSRVILLPVEGIIGSDYINANYIDGYRKQNAYIATQGALPETFGDFWRMVWEQRSATVVMMTKLEEKSRIKCDQYWPSRGTETYGMIQVTLLDTIELATFCVRTFSLHKSGSSEKREVRQFQFTAWPDHGVPEYPTPFLAFLRRVKTCNPPDAGPVVVHCSAGVGRTGCFIVIDAMLERIKHEKTVDIYGHVTLMRSQRNYMVQTEDQYSFIHDALLEAVACGNTEVPARNLYTYIQKLAQIEL--GEHVTGMELEFKRLANSKAHTSR-------FISA--NLPCNKFKNRLVNIMPYESTRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWENNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDEYQFCYQAALEYLGSFD 1907          

HSP 2 Score: 202.216 bits (513), Expect = 3.057e-51
Identity = 104/262 (39.69%), Postives = 152/262 (58.02%), Query Frame = 1
Query: 5092 NQAVNMTKNRVRNIIPYEWNRVVLNAIRGIEGSDYINASYIDGYRDRRAYIAAQSPIPSTVEDFWRMLWDQHCGVVIVLNQPHEDKSHI----YWPINKSIRYQFFVVDPVVEYNMPNYILREFKVTDARDGEFRALRQFQFTQWPNHGCPKESESILDFIRQVHKTKEQFGHMEPMVIHCNTGSGRTGVFIALSIVLDRLQQESVVDMYQTVKLLHKQRIGLVQTEEQYEFCYMAVLDYLSNYEKILEKSHLY*TYQDLSE 5865
            N  VN  KNR  N+I Y+ +RV+L  + GI GSDYINA+YIDGYR + AYIA Q  +P T  DFWRM+W+Q    V+++ +  E+KS I    YWP   +  Y    V  +    +  + +R F +  +   E R +RQFQFT WP+HG P+     L F+R+V           P+V+HC+ G GRTG FI +  +L+R++ E  VD+Y  V L+  QR  +VQTE+QY F + A+L+ ++     +   +LY   Q L++
Sbjct: 1375 NLEVNKAKNRYANVIAYDHSRVILLPVEGIIGSDYINANYIDGYRKQNAYIATQGALPETFGDFWRMVWEQRSATVVMMTK-LEEKSRIKCDQYWPSRGTETYGMIQVTLLDTIELATFCVRTFSLHKSGSSEKREVRQFQFTAWPDHGVPEYPTPFLAFLRRVKTCNPP--DAGPVVVHCSAGVGRTGCFIVIDAMLERIKHEKTVDIYGHVTLMRSQRNYMVQTEDQYSFIHDALLEAVACGNTEVPARNLYTYIQKLAQ 1633          

HSP 3 Score: 145.591 bits (366), Expect = 6.237e-34
Identity = 223/1023 (21.80%), Postives = 387/1023 (37.83%), Query Frame = 1
Query:  370 LACSSTGHPVPSISW-----KINESPIEELKSPLKKLQNPPRIFSIKNYQNSVLVITQLIESDSNSVLICEAENNAGFDSRQQQLKVISTETDIPSGFPVFQNNFFPIIKPYNSNVTLVCQAYGNPPPLIQWFKNYELINESFT--KIKILNDGN----LLLVQVTRE-DKGIYHCQAQNTNGLRLSDPSTLDITSYPISPNSLII----ERFASDNVEIS------------WRSGLNDVTEQENF-----ILHYREVPEN---------------------------------ITEKQIMS-------------KFVYLTISEKKSIYKYNLKDLFPFTTYCI-----------WMESENPLGVSPPTIALTVKTLPTSPQLSPRSITATSISNTAILVAWRPPERKFGKFKYYQIIYTNNDGFLPQHWRQFAVKDDNVMLT--HLIASELYHIRVKIVNEIGHGPLSKTISIKTIAGTLSQCPDFKITEIFQSHIKLQWGTPDPVKLFKLIQYNLLCWDVRLKIVNATAKSSTLFPILNHNLSMNEMEYVLYLKNEKEIKCRLSAINSDGKGMPT-EIQASTV-NKGVNYQNLIHIDKIGSTYITFQWRPPSKFSFDYFLWIYQIFDSEKLDRAVKLPKIKINISDSAS-----AENGWFVYNYTNAFSSSRYILGLRYLCRDSTDILREYVHRSDLVSTMKSVPSDSPKDLVVKEIDSNSALVSWKPLDQVHSNGIITHYEVRYYAPKKEESTERFI--------------NVSETSAILSNLK-YFHYVIYVRAFTKVGGGSWSNPKNYYRQNLEEFPIPTTIKGERKSETEINISWELPVLSEKNLAHAAIE---GFIILYAPVESSPKWIKYTVQSKNLSAVIKGLEPDLRYQFQIAATNYAGFNGNFSE---IVQEMPKNFPNLNLKTVPDLRCSVQSSNRLKVEWSSPSISTDLLKFEIRYSGNLSYITEIGLKKSEFIDMESKSVNFETLVNRYDVTLENLQSNALYKIAVRA 3078
              C +TG P P ++W     K+N    E ++                    +VL I  L      +V  C A+N  G +    +L V+  E  +PSGFP         +       T++C A GNP P I WFK++  ++ + +  +IK L  G      L ++ + E D+G Y C A N+ G+R S P+ L +    ++P   I+    E     NV I+            W  G  D+T +++      +L    V E+                                 +TE    S              +  +    K     Y +K+    T Y I           W+ + N +G  PP+  +  +T   +P  +PR++ A  +S+T +++ W  P    G+ + Y++ YT         W ++ V DD+++ T   L+  E Y +RV     +G GPLS  I +KT  G   Q  +F+     ++ I L W  P   +   +++Y L   +             T  P  ++         V  LK   E   RL+A +S G G  T +I+  T+ +K       +      ST I   W PP   S +  L  Y +  S  LD     PK   +I    +     A   W VY               R      T++          + T + VPS  P+ + V+ ++S +  V W+   Q   +G I  Y+V Y   +  E++   +              + +E   ++S L+    Y + V A+T  G G+ S PK    +     P    +   + S+  + + WE P  SE ++    ++     ++L + +E      KY   + +  A          Y F++A     G +    +   + ++ PK FP L       +   + +S  +++ W  P ++    +  +     L+Y      +K + ID+ S   +F          L +L  N +Y++ +RA
Sbjct:   43 FVCQATGDPKPRVTWNKRGKKVNSQRFETIE--------------FDEGAGAVLRIQPLRTPRDENVYECVAQNVHGEEVVSAKLTVLR-EDQLPSGFPNIDMGPQLKVVERTRTATMLCAASGNPDPEITWFKDFLPVDPASSNGRIKQLRSGKTTNCALQIENSEETDQGKYECVATNSAGVRYSSPANLYVRVRRVAPRFSILPVSHEIMPGGNVNITCVAVGSPMPYVKWMVGAEDLTPEDDMPVGRNVLELTNVKESANYTCVAMSSLGVIESVAQITVKSLPKAPGTPVVTETTATSITVTWDSGNPDPVSYYVIEYKSKSQDGPYQIKEDITTTRYSIGGLSPNSEYEIWVSAVNSIGQGPPSEPVVTRTGEQAPASAPRNVQARMLSSTTMIIQWEEPVEPNGQIRGYRVYYTMEPDQPVSSWLKYNV-DDSLLTTIGSLLEHETYTVRVLAFTSVGDGPLSDPIQVKTQQGVPGQPMNFRAEAKSETSIGLTWSPP---RQDSIVKYELNYREGE----GGNEIRKTFDPATSYT--------VEGLKPNTEYLFRLAARSSHGLGAWTLDIKERTMQSKPSAPPRNVKCVSSKSTTILVSWLPPPAESQNGVLAGYSVRYS-ALDSDDTRPKEVKDIPPQTTQILLEALEKWTVY---------------RITVVAHTEVGPGPESPPVEIRTDEDVPSAPPRKVEVEVLNSTAIKVFWRSPVQNRQHGQIRGYQVHYVRMENGEASGLTLIKDVMLADAQWEMDDTAEYEMVISGLQPETSYSVTVAAYTMKGDGARSKPKLVTTRG--AVPGKPDLFVHQNSDGSLLVEWEPPRESEGHILGYRLQFGRQDVMLLSTLEFGELEKKYLATNIHKGAT---------YVFKMAVKGRVGLSEEAVKEFIVPEDTPKGFPQL-------IEKGIVTSMSIQLNWLPPVLAE---RNGVITKYTLAYRVAGSSEKLQEIDLPSSDNSF---------ILTDLNPNTVYEVKIRA 988          

HSP 4 Score: 88.1965 bits (217), Expect = 1.558e-16
Identity = 121/509 (23.77%), Postives = 213/509 (41.85%), Query Frame = 1
Query: 1126 YNLKDLFPFTTYCIWMESENPLGVSPPTIALTVKTLPTSPQLSPRSITATSISNTAILVAWRPP--ERKFGKFKYYQIIYT--NNDGFLPQHWRQFAVKDDNVMLTHLIASELYHIRVKIVNEIGHGPLSKTISIKTIAGTLSQCPDFKITEIFQS-HIKLQWGTPDPVKLFKLIQYNLLCWDVRLKIVNATAKSSTLFP---ILNHNLSMN---EMEYVLY-LKNEKEIKCRLSAINSDGKGMPTEIQASTVNKGVNYQNLIHIDKIGSTYITFQWRPPSKFSFDYFLWIYQIFDSEKLDRAVKLPKIKINISDSASAENGWFVYNY--TNAFSSSRYILGLRYLCRD--STDILREYVHRSDLVSTMKSVPSDSPK---DLVVKEI-DSNSALVSWKPLDQVHSNGIITHYEVRY-YAPKKEESTERFINVSETSAILSNLK-YFHYVIYVRAFTKVGGGSWSNPKNYYRQNLEE--------FPIPTTIKGERKSETEINISWELP 2562
            Y ++ L P T Y   + + +  G+   T+ +  +T+ + P   PR++   S  +T ILV+W PP  E + G    Y + Y+  ++D   P+  +    +   ++L  L    +Y I V    E+G GP S  + I+T     S  P     E+  S  IK+ W +P   +    I+   + +   +++ N  A   TL     + +    M+   E E V+  L+ E      ++A    G G  ++ +  T    V  +  + + +     +  +W PP               +SE      +L   + ++   ++ E G     Y  TN    + Y+  +    R   S + ++E++           VP D+PK    L+ K I  S S  ++W P      NG+IT Y + Y  A   E+  E  +  S+ S IL++L     Y + +RA T+ G G +S P   YR  L +        F + T  K +  ++T + +SWE P
Sbjct:  562 YTVEGLKPNTEYLFRLAARSSHGLGAWTLDIKERTMQSKPSAPPRNVKCVSSKSTTILVSWLPPPAESQNGVLAGYSVRYSALDSDDTRPKEVKDIPPQTTQILLEALEKWTVYRITVVAHTEVGPGPESPPVEIRTDEDVPSAPPRKVEVEVLNSTAIKVFWRSPVQNRQHGQIRGYQVHY---VRMENGEASGLTLIKDVMLADAQWEMDDTAEYEMVISGLQPETSYSVTVAAYTMKGDGARSKPKLVTTRGAVPGKPDLFVHQNSDGSLLVEWEPPR--------------ESEGHILGYRLQFGRQDVMLLSTLEFGELEKKYLATNIHKGATYVFKMAVKGRVGLSEEAVKEFI-----------VPEDTPKGFPQLIEKGIVTSMSIQLNWLPPVLAERNGVITKYTLAYRVAGSSEKLQEIDLPSSDNSFILTDLNPNTVYEVKIRAHTRKGPGPYS-PTVQYRTFLLDQGRAYQSFFFVFTNFKVKMVTKTSVLLSWEFP 1041          
BLAST of Protein tyrosine phosphatase receptor type D vs. Ensembl Xenopus
Match: brdt (bromodomain, testis-specific [Source:Xenbase;Acc:XB-GENE-983868])

HSP 1 Score: 721.465 bits (1861), Expect = 0.000e+0
Identity = 338/626 (53.99%), Postives = 450/626 (71.88%), Query Frame = 1
Query: 3949 NADSVQMCQ-DGTKLSPVLVSDSIKLRIGSQKSENISDRPSISICNLYQYVTDLKANDCTLLQAEFETLNTNLDDRFTWQRSNIDSNKSKNRYANVVAYDHTSVLLTPVDDVIGSDYINANYIDGYQRQNAYIATQGPLPDTTDDFWRMVWEQRSNCIVMMTRLEERSGIKCHQYWPNRGFICYGQMIVSHIDTFVLAYYTIRLFEIRHSKYSEKREIQHFQFTAWPDHGVPKLSTPLLMFIRRVRSIGKIESCPKIVHCSAGVGRTGAFIVVDAQLERIKQEKNIDVFNYVSKIRCQRNYMVQTQAQYQFILETLLEAVEDGNTEVMACNFHAHVTKLSQIGISGSNQLSGFEMEFSKLNSLASNRGRHGVMLADFVKAAGNQAVNMTKNRVRNIIPYEWNRVVLNAIRGIEGSDYINASYIDGYRDRRAYIAAQSPIPSTVEDFWRMLWDQHCGVVIVLNQPHE---DKSHIYWPINKSIRYQFFVVDPVVEYNMPNYILREFKVTDARDGEFRALRQFQFTQWPNHGCPKESESILDFIRQVHKTKEQFGHMEPMVIHCNTGSGRTGVFIALSIVLDRLQQESVVDMYQTVKLLHKQRIGLVQTEEQYEFCYMAVLDYLSNYE 5814
            N+D    C  +  +++P   +D +++R  + ++  + + P I I +L ++   LKAND   L  E+E+++     +FTW+ SN++ NK+KNRYANV+AYDH+ V+L PV+ +IGSDYINANYIDGY++QNAYIATQG LP+T  DFWRMVWEQRS  +VMMT+LEE+S IKC QYWP+RG   YG + V+ +DT  LA + +R F +  S  SEKRE++ FQFTAWPDHGVP+  TP L F+RRV++    ++ P +VHCSAGVGRTG FIV+DA LERIK EK +D++ +V+ +R QRNYMVQT+ QY FI + LLEAV  GNTEV A N + ++ KL+QI +     ++G E+EF +L +  ++  R       F+ A  N   N  KNR+ NI+PYE  RV L  IRG+EGSDYINAS+IDGYR ++AYIA Q P+  T EDFWRMLW+ +  +V++L +  E   +K H YWP  +S RYQ+FVVDP+ EYNMP YILREFKVTDARDG+ R +RQFQFT WP  G PK  E  +DFI QVHKTKEQFG   P+ +HC+ G GRTGVFI LSIVL+R++ E VVD++QTVK+L  QR  +VQTE++Y+FCY A L+YL +++
Sbjct: 1298 NSDPRTKCLLNNAEIAPHHPTDPVEMRRINFQTPGMLNHPPIPIADLSEHTEHLKANDNLKLSQEYESVDPG--QQFTWEHSNLEVNKAKNRYANVIAYDHSRVILLPVEGIIGSDYINANYIDGYRKQNAYIATQGALPETFGDFWRMVWEQRSATVVMMTKLEEKSRIKCDQYWPSRGTETYGMIQVTLLDTIELATFCVRTFSLHKSGSSEKREVRQFQFTAWPDHGVPEYPTPFLAFLRRVKTCNPPDAGPVVVHCSAGVGRTGCFIVIDAMLERIKHEKTVDIYGHVTLMRSQRNYMVQTEDQYSFIHDALLEAVACGNTEVPARNLYTYIQKLAQIEL--GEHVTGMELEFKRLANSKAHTSR-------FISA--NLPCNKFKNRLVNIMPYESTRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWENNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDEYQFCYQAALEYLGSFD 1910          

HSP 2 Score: 202.216 bits (513), Expect = 3.194e-51
Identity = 104/262 (39.69%), Postives = 152/262 (58.02%), Query Frame = 1
Query: 5092 NQAVNMTKNRVRNIIPYEWNRVVLNAIRGIEGSDYINASYIDGYRDRRAYIAAQSPIPSTVEDFWRMLWDQHCGVVIVLNQPHEDKSHI----YWPINKSIRYQFFVVDPVVEYNMPNYILREFKVTDARDGEFRALRQFQFTQWPNHGCPKESESILDFIRQVHKTKEQFGHMEPMVIHCNTGSGRTGVFIALSIVLDRLQQESVVDMYQTVKLLHKQRIGLVQTEEQYEFCYMAVLDYLSNYEKILEKSHLY*TYQDLSE 5865
            N  VN  KNR  N+I Y+ +RV+L  + GI GSDYINA+YIDGYR + AYIA Q  +P T  DFWRM+W+Q    V+++ +  E+KS I    YWP   +  Y    V  +    +  + +R F +  +   E R +RQFQFT WP+HG P+     L F+R+V           P+V+HC+ G GRTG FI +  +L+R++ E  VD+Y  V L+  QR  +VQTE+QY F + A+L+ ++     +   +LY   Q L++
Sbjct: 1378 NLEVNKAKNRYANVIAYDHSRVILLPVEGIIGSDYINANYIDGYRKQNAYIATQGALPETFGDFWRMVWEQRSATVVMMTK-LEEKSRIKCDQYWPSRGTETYGMIQVTLLDTIELATFCVRTFSLHKSGSSEKREVRQFQFTAWPDHGVPEYPTPFLAFLRRVKTCNPP--DAGPVVVHCSAGVGRTGCFIVIDAMLERIKHEKTVDIYGHVTLMRSQRNYMVQTEDQYSFIHDALLEAVACGNTEVPARNLYTYIQKLAQ 1636          

HSP 3 Score: 145.591 bits (366), Expect = 4.970e-34
Identity = 254/1096 (23.18%), Postives = 407/1096 (37.14%), Query Frame = 1
Query:  370 LACSSTGHPVPSISW-----KINESPIEELKSPLKKLQNPPRIFSIKNYQNSVLVITQLIESDSNSVLICEAENNAGFDSRQQQLKVISTETDIPSGFPVFQNNFFPIIKPYNSNVTLVCQAYGNPPPLIQWFKNYELINESFT--KIKILND------GNLLLVQVTREDKGIYHCQAQNTNGLRLSDPSTLDITSYPISPNSLII----ERFASDNVEIS------------WRSGLNDVTEQENFILHYREVPENITEKQIMSKFVYLTISEKKSIYKYNLKDLFPFTTYCIWMESENPLGVSPPTIALTVKTLPTSPQLSPRSITATSISNTAILVAWRPPERKFGKFKYYQIIYTNNDGFLPQHWRQFAVKDDNVMLTHLIAS----ELYHIRVKIVNEIGHGPLSKTISIKTIAGTLSQCP-DFKITEIFQSHIKLQWGTPDPVKLFKLIQYNLLCWDVRLKIVNATAKSSTLFPILNHNLSMNEMEYVLYLKNEKEIKCRLSAINSDGKG-MPTEIQASTVNKGVNYQNL-IHIDKIGSTYITFQWRPPSKFSFDYFLWIYQIFDSEKLDRAVKLPKIKINISDSASAENGWFVYNYTNAFSSSRYILGLRYLCRDSTDILREYVHRSDLVSTMKSVPSDSPKDLVVKEIDSNSALVSWKPLDQVHSNGIITHYEVRYYAPKKEESTERFIN--VSETSAILSNL--KYFHYVIYVRAFTKVGGGSWSNPKNYYRQNLEEFPIPTTIKGERKSETEINISWELPVLSEKNLAHAAIEGFIILYAPVE----SSPKWIKYTV---------QSKNLSAVIKGLEPDLRYQFQIAATNYAGFNGNFSEIVQEMPKNFPNLNLKTVPDLRCSVQSSNRLKVEWSSPSISTDLLKFEIRYSGNLSYITEIGLKKSEFIDMESKSVNFETLVNRYDVTLENLQSNALYKIAVRAIYQNKELYESHRETTCDTMPAVPNLVKPPIIVGLDEEKSKVIIKLHRCSQRNGKIS-YYFVIVAAFQGNKNQQISFQEDTESYTFMELSVNT------RSNNAKG--------EYIAIMKD--INDIFKVSGKDHSSVLL 3447
              C +TG P P ++W     K+N    E ++                    +VL I  L      +V  C A+N  G +    +L V+  E  +PSGFP         +       T++C A GNP P I WFK++  ++ + +  +IK L        G L +      D+G Y C A N+ G+R S P+ L +    ++P   I+    E     NV I+            W  G  D+T +++       V  N+ E         LT          N+K+   +T  C+ M S   LGV      +TVK+LP +P     +   T  + T+I V W           YY I Y +     P     + +K+D     + I        Y I V  VN IG GP S+ +  +T     +  P + +   +  + + +QW  P        ++ N      R+       +  + +  L +N+  + +  +  L   +    R+ A  S G G +   IQ  T  +GV  Q +    +    T I   W PP + S   +   Y+  +     R    P     +       N  +++      + S + LG   L     DI            TM+S PS  P+++      S + LVSW P      NG++  Y VRY A   +++  + +     +T+ IL     K+  Y I V A T+VG G  S P             P  ++ E  + T I + W  PV   +N  H  I G+ + Y  +E    S    IK  +          +     VI GL+P+  Y   +AA    G        +       P       PDL     S   L VEW  P  S   +         L Y  + G +    +     ++ F  L  +Y  T  +  +  ++K+AV+      E          DT    P L++  I+  +  + + +   L   ++RNG I+ Y      A    K Q+I       S+   +L+ NT      R++  KG        +Y   + D  +   FKV     +SVLL
Sbjct:   52 FVCQATGDPKPRVTWNKRGKKVNSQRFETIE--------------FDEGAGAVLRIQPLRTPRDENVYECVAQNVHGEEVVSAKLTVLR-EDQLPSGFPNIDMGPQLKVVERTRTATMLCAASGNPDPEITWFKDFLPVDPASSNGRIKQLRSENTPIRGALQIENSEETDQGKYECVATNSAGVRYSSPANLYVRVRRVAPRFSILPVSHEIMPGGNVNITCVAVGSPMPYVKWMVGAEDLTPEDDM-----PVGRNVLE---------LT----------NVKESANYT--CVAMSS---LGVIESVAQITVKSLPKAPG----TPVVTETTATSITVTWD--SGNPDPVSYYVIEYKSKSQDGP-----YQIKEDITTTRYSIGGLSPNSEYEIWVSAVNSIGQGPPSEPVVTRTGEQAPASAPRNVQARMLSSTTMIIQWEEP--------VEPNGQIRGYRVYYTMEPDQPVSSW--LKYNVDDSLLTTIGSLLEHETYTVRVLAFTSVGDGPLSDPIQVKT-QQGVPGQPMNFRAEAKSETSIGLTWSPPRQDSIVKYELNYREGEGGNEIRKTFDPATSYTV--EGLKPNTEYLFRLA---ARSSHGLGAWTL-----DIKER---------TMQSKPSAPPRNVKCVSSKSTTILVSWLPPPAESQNGVLAGYSVRYSALDSDDTRPKEVKDIPPQTTQILLEALEKWTVYRITVVAHTEVGPGPESPPVEIRTDEDVPSAPPRKVEVEVLNSTAIKVFWRSPV---QNRQHGQIRGYQVHYVRMENGEASGLTLIKDVMLADAQWEMDDTAEYEMVISGLQPETSYSVTVAAYTMKGDGARSKPKLVTTRGAVPGK-----PDLFVHQNSDGSLLVEWEPPRESEGHI---------LGYRLQFGRQDVMLLS----TLEFGELEKKYLATNIHKGATYVFKMAVKGRVGLSEEAVKEFIVPEDTPKGFPQLIEKGIVTSMSIQLNWLPPVL---AERNGVITKYTLAYRVAGSSEKLQEIDLPSSDNSFILTDLNPNTVYEVKIRAHTRKGPGPYSPTVQYRTFLLDQVLPKNFKVKMVTKTSVLL 1038          

HSP 4 Score: 142.895 bits (359), Expect = 3.288e-33
Identity = 211/976 (21.62%), Postives = 390/976 (39.96%), Query Frame = 1
Query:  271 LINSQITFTENDEAPK----ISLIIQSPNVLLFKSMILACSSTGHPVPSISWKINESPIEELKS--PLKKL--QNPPRIFSIKNYQNSVLVITQLIESDSNSVLICEAENNAGFDSRQQQLKVISTETDIP--SGFPVFQNNFFPIIKPYNSNVTLVCQAYGNPPPLIQWFKNYELINESFTKIKILNDGNLLLVQVTREDKGIYHCQAQNTNGLRLSDPSTLDITSYPISPNSLIIERFASDNVEISWRSGLNDVTEQENFILHYREVPENITEKQIMSKFVYLTISEKKSIYKYNLKDLFPFTTYCIWMESENPLGVSPPTIALTVKTLPTSPQLSPRSITATSISNTAILVAWRPPERKFGKFKYYQIIYTNNDGFLPQHWRQFAVKDDNVMLT--HLIASELYHIRVKIVNEIGHGPLSKTISIKTIAGTLSQCPDFKITEIFQSHIKLQWGTPDPVKLFKLIQYNLLCWDVRLKIVNATAKSSTLFPILNHNLSMNEMEYVLYLKNEKEIKCRLSAINSDGKGMPT-EIQASTV-NKGVNYQNLIHIDKIGSTYITFQWRPPSKFSFDYFLWIYQIFDSEKLDRAVKLPKIKINISDSAS-----AENGWFVYNYTNAFSSSRYILGLRYLCRDSTDILREYVHRSDLVSTMKSVPSDSPKDLVVKEIDSNSALVSWKPLDQVHSNGIITHYEVRYYAPKKEESTERFI--------------NVSETSAILSNLK-YFHYVIYVRAFTKVGGGSWSNPKNYYRQNLEEFPIPTTIKGERKSETEINISWELPVLSEKNLAHAAIE---GFIILYAPVESSPKWIKYTVQSKNLSAVIKGLEPDLRYQFQIAATNYAGFNGNFSE---IVQEMPKNFPNLNLKTVPDLRCSVQSSNRLKVEWSSPSISTDLLKFEIRYSGNLSYITEIGLKKSEFIDMESKSVNFETLVNRYDVTLENLQSNALYKIAVRA 3078
            ++++++T    D+ P     I +  Q   V   ++  + C+++G+P P I+W  +  P++   S   +K+L  +N P I      +NS        E        C A N+AG          +      P  S  PV  +   P       NV + C A G+P P ++W     +  E  T    +  G  +L     ++   Y C A ++ G+ +   + + + S P +P + ++    + ++ ++W SG  D      +++ Y+            S+     I E  +  +Y++  L P + Y IW+ + N +G  PP+  +  +T   +P  +PR++ A  +S+T +++ W  P    G+ + Y++ YT         W ++ V DD+++ T   L+  E Y +RV     +G GPLS  I +KT  G   Q  +F+     ++ I L W  P   +   +++Y L   +             T  P  ++         V  LK   E   RL+A +S G G  T +I+  T+ +K       +      ST I   W PP   S +  L  Y +  S  LD     PK   +I    +     A   W VY               R      T++          + T + VPS  P+ + V+ ++S +  V W+   Q   +G I  Y+V Y   +  E++   +              + +E   ++S L+    Y + V A+T  G G+ S PK    +     P    +   + S+  + + WE P  SE ++    ++     ++L + +E      KY   + +  A          Y F++A     G +    +   + ++ PK FP L       +   + +S  +++ W  P ++    +  +     L+Y      +K + ID+ S   +F          L +L  N +Y++ +RA
Sbjct:  117 VVSAKLTVLREDQLPSGFPNIDMGPQLKVVERTRTATMLCAASGNPDPEITWFKDFLPVDPASSNGRIKQLRSENTP-IRGALQIENS--------EETDQGKYECVATNSAGVRYSSPANLYVRVRRVAPRFSILPV-SHEIMP-----GGNVNITCVAVGSPMPYVKWM----VGAEDLTPEDDMPVGRNVLELTNVKESANYTCVAMSSLGV-IESVAQITVKSLPKAPGTPVVTETTATSITVTWDSGNPDPVSY--YVIEYKS----------KSQDGPYQIKEDITTTRYSIGGLSPNSEYEIWVSAVNSIGQGPPSEPVVTRTGEQAPASAPRNVQARMLSSTTMIIQWEEPVEPNGQIRGYRVYYTMEPDQPVSSWLKYNV-DDSLLTTIGSLLEHETYTVRVLAFTSVGDGPLSDPIQVKTQQGVPGQPMNFRAEAKSETSIGLTWSPP---RQDSIVKYELNYREGE----GGNEIRKTFDPATSYT--------VEGLKPNTEYLFRLAARSSHGLGAWTLDIKERTMQSKPSAPPRNVKCVSSKSTTILVSWLPPPAESQNGVLAGYSVRYS-ALDSDDTRPKEVKDIPPQTTQILLEALEKWTVY---------------RITVVAHTEVGPGPESPPVEIRTDEDVPSAPPRKVEVEVLNSTAIKVFWRSPVQNRQHGQIRGYQVHYVRMENGEASGLTLIKDVMLADAQWEMDDTAEYEMVISGLQPETSYSVTVAAYTMKGDGARSKPKLVTTRG--AVPGKPDLFVHQNSDGSLLVEWEPPRESEGHILGYRLQFGRQDVMLLSTLEFGELEKKYLATNIHKGAT---------YVFKMAVKGRVGLSEEAVKEFIVPEDTPKGFPQL-------IEKGIVTSMSIQLNWLPPVLAE---RNGVITKYTLAYRVAGSSEKLQEIDLPSSDNSF---------ILTDLNPNTVYEVKIRA 998          

HSP 5 Score: 94.7449 bits (234), Expect = 1.798e-18
Identity = 120/501 (23.95%), Postives = 212/501 (42.32%), Query Frame = 1
Query: 1126 YNLKDLFPFTTYCIWMESENPLGVSPPTIALTVKTLPTSPQLSPRSITATSISNTAILVAWRPP--ERKFGKFKYYQIIYT--NNDGFLPQHWRQFAVKDDNVMLTHLIASELYHIRVKIVNEIGHGPLSKTISIKTIAGTLSQCPDFKITEIFQS-HIKLQWGTPDPVKLFKLIQYNLLCWDVRLKIVNATAKSSTLFP---ILNHNLSMN---EMEYVLY-LKNEKEIKCRLSAINSDGKGMPTEIQASTVNKGVNYQNLIHIDKIGSTYITFQWRPPSKFSFDYFLWIYQIFDSEKLDRAVKLPKIKINISDSASAENGWFVYNY--TNAFSSSRYILGLRYLCRD--STDILREYVHRSDLVSTMKSVPSDSPK---DLVVKEI-DSNSALVSWKPLDQVHSNGIITHYEVRY-YAPKKEESTERFINVSETSAILSNLK-YFHYVIYVRAFTKVGGGSWSNPKNYYRQNLEEFPIPTTIKGERKSETEINISWELP 2562
            Y ++ L P T Y   + + +  G+   T+ +  +T+ + P   PR++   S  +T ILV+W PP  E + G    Y + Y+  ++D   P+  +    +   ++L  L    +Y I V    E+G GP S  + I+T     S  P     E+  S  IK+ W +P   +    I+   + +   +++ N  A   TL     + +    M+   E E V+  L+ E      ++A    G G  ++ +  T    V  +  + + +     +  +W PP               +SE      +L   + ++   ++ E G     Y  TN    + Y+  +    R   S + ++E++           VP D+PK    L+ K I  S S  ++W P      NG+IT Y + Y  A   E+  E  +  S+ S IL++L     Y + +RA T+ G G +S P   YR  L +  +P   K +  ++T + +SWE P
Sbjct:  572 YTVEGLKPNTEYLFRLAARSSHGLGAWTLDIKERTMQSKPSAPPRNVKCVSSKSTTILVSWLPPPAESQNGVLAGYSVRYSALDSDDTRPKEVKDIPPQTTQILLEALEKWTVYRITVVAHTEVGPGPESPPVEIRTDEDVPSAPPRKVEVEVLNSTAIKVFWRSPVQNRQHGQIRGYQVHY---VRMENGEASGLTLIKDVMLADAQWEMDDTAEYEMVISGLQPETSYSVTVAAYTMKGDGARSKPKLVTTRGAVPGKPDLFVHQNSDGSLLVEWEPPR--------------ESEGHILGYRLQFGRQDVMLLSTLEFGELEKKYLATNIHKGATYVFKMAVKGRVGLSEEAVKEFI-----------VPEDTPKGFPQLIEKGIVTSMSIQLNWLPPVLAERNGVITKYTLAYRVAGSSEKLQEIDLPSSDNSFILTDLNPNTVYEVKIRAHTRKGPGPYS-PTVQYRTFLLDQVLPKNFKVKMVTKTSVLLSWEFP 1043          
BLAST of Protein tyrosine phosphatase receptor type D vs. Ensembl Xenopus
Match: brdt (bromodomain, testis-specific [Source:Xenbase;Acc:XB-GENE-983868])

HSP 1 Score: 721.465 bits (1861), Expect = 0.000e+0
Identity = 338/626 (53.99%), Postives = 450/626 (71.88%), Query Frame = 1
Query: 3949 NADSVQMCQ-DGTKLSPVLVSDSIKLRIGSQKSENISDRPSISICNLYQYVTDLKANDCTLLQAEFETLNTNLDDRFTWQRSNIDSNKSKNRYANVVAYDHTSVLLTPVDDVIGSDYINANYIDGYQRQNAYIATQGPLPDTTDDFWRMVWEQRSNCIVMMTRLEERSGIKCHQYWPNRGFICYGQMIVSHIDTFVLAYYTIRLFEIRHSKYSEKREIQHFQFTAWPDHGVPKLSTPLLMFIRRVRSIGKIESCPKIVHCSAGVGRTGAFIVVDAQLERIKQEKNIDVFNYVSKIRCQRNYMVQTQAQYQFILETLLEAVEDGNTEVMACNFHAHVTKLSQIGISGSNQLSGFEMEFSKLNSLASNRGRHGVMLADFVKAAGNQAVNMTKNRVRNIIPYEWNRVVLNAIRGIEGSDYINASYIDGYRDRRAYIAAQSPIPSTVEDFWRMLWDQHCGVVIVLNQPHE---DKSHIYWPINKSIRYQFFVVDPVVEYNMPNYILREFKVTDARDGEFRALRQFQFTQWPNHGCPKESESILDFIRQVHKTKEQFGHMEPMVIHCNTGSGRTGVFIALSIVLDRLQQESVVDMYQTVKLLHKQRIGLVQTEEQYEFCYMAVLDYLSNYE 5814
            N+D    C  +  +++P   +D +++R  + ++  + + P I I +L ++   LKAND   L  E+E+++     +FTW+ SN++ NK+KNRYANV+AYDH+ V+L PV+ +IGSDYINANYIDGY++QNAYIATQG LP+T  DFWRMVWEQRS  +VMMT+LEE+S IKC QYWP+RG   YG + V+ +DT  LA + +R F +  S  SEKRE++ FQFTAWPDHGVP+  TP L F+RRV++    ++ P +VHCSAGVGRTG FIV+DA LERIK EK +D++ +V+ +R QRNYMVQT+ QY FI + LLEAV  GNTEV A N + ++ KL+QI +     ++G E+EF +L +  ++  R       F+ A  N   N  KNR+ NI+PYE  RV L  IRG+EGSDYINAS+IDGYR ++AYIA Q P+  T EDFWRMLW+ +  +V++L +  E   +K H YWP  +S RYQ+FVVDP+ EYNMP YILREFKVTDARDG+ R +RQFQFT WP  G PK  E  +DFI QVHKTKEQFG   P+ +HC+ G GRTGVFI LSIVL+R++ E VVD++QTVK+L  QR  +VQTE++Y+FCY A L+YL +++
Sbjct: 1289 NSDPRTKCLLNNAEIAPHHPTDPVEMRRINFQTPGMLNHPPIPIADLSEHTEHLKANDNLKLSQEYESVDPG--QQFTWEHSNLEVNKAKNRYANVIAYDHSRVILLPVEGIIGSDYINANYIDGYRKQNAYIATQGALPETFGDFWRMVWEQRSATVVMMTKLEEKSRIKCDQYWPSRGTETYGMIQVTLLDTIELATFCVRTFSLHKSGSSEKREVRQFQFTAWPDHGVPEYPTPFLAFLRRVKTCNPPDAGPVVVHCSAGVGRTGCFIVIDAMLERIKHEKTVDIYGHVTLMRSQRNYMVQTEDQYSFIHDALLEAVACGNTEVPARNLYTYIQKLAQIEL--GEHVTGMELEFKRLANSKAHTSR-------FISA--NLPCNKFKNRLVNIMPYESTRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWENNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDEYQFCYQAALEYLGSFD 1901          

HSP 2 Score: 202.216 bits (513), Expect = 3.403e-51
Identity = 104/262 (39.69%), Postives = 152/262 (58.02%), Query Frame = 1
Query: 5092 NQAVNMTKNRVRNIIPYEWNRVVLNAIRGIEGSDYINASYIDGYRDRRAYIAAQSPIPSTVEDFWRMLWDQHCGVVIVLNQPHEDKSHI----YWPINKSIRYQFFVVDPVVEYNMPNYILREFKVTDARDGEFRALRQFQFTQWPNHGCPKESESILDFIRQVHKTKEQFGHMEPMVIHCNTGSGRTGVFIALSIVLDRLQQESVVDMYQTVKLLHKQRIGLVQTEEQYEFCYMAVLDYLSNYEKILEKSHLY*TYQDLSE 5865
            N  VN  KNR  N+I Y+ +RV+L  + GI GSDYINA+YIDGYR + AYIA Q  +P T  DFWRM+W+Q    V+++ +  E+KS I    YWP   +  Y    V  +    +  + +R F +  +   E R +RQFQFT WP+HG P+     L F+R+V           P+V+HC+ G GRTG FI +  +L+R++ E  VD+Y  V L+  QR  +VQTE+QY F + A+L+ ++     +   +LY   Q L++
Sbjct: 1369 NLEVNKAKNRYANVIAYDHSRVILLPVEGIIGSDYINANYIDGYRKQNAYIATQGALPETFGDFWRMVWEQRSATVVMMTK-LEEKSRIKCDQYWPSRGTETYGMIQVTLLDTIELATFCVRTFSLHKSGSSEKREVRQFQFTAWPDHGVPEYPTPFLAFLRRVKTCNPP--DAGPVVVHCSAGVGRTGCFIVIDAMLERIKHEKTVDIYGHVTLMRSQRNYMVQTEDQYSFIHDALLEAVACGNTEVPARNLYTYIQKLAQ 1627          

HSP 3 Score: 145.206 bits (365), Expect = 6.605e-34
Identity = 254/1096 (23.18%), Postives = 407/1096 (37.14%), Query Frame = 1
Query:  370 LACSSTGHPVPSISW-----KINESPIEELKSPLKKLQNPPRIFSIKNYQNSVLVITQLIESDSNSVLICEAENNAGFDSRQQQLKVISTETDIPSGFPVFQNNFFPIIKPYNSNVTLVCQAYGNPPPLIQWFKNYELINESFT--KIKILND------GNLLLVQVTREDKGIYHCQAQNTNGLRLSDPSTLDITSYPISPNSLII----ERFASDNVEIS------------WRSGLNDVTEQENFILHYREVPENITEKQIMSKFVYLTISEKKSIYKYNLKDLFPFTTYCIWMESENPLGVSPPTIALTVKTLPTSPQLSPRSITATSISNTAILVAWRPPERKFGKFKYYQIIYTNNDGFLPQHWRQFAVKDDNVMLTHLIAS----ELYHIRVKIVNEIGHGPLSKTISIKTIAGTLSQCP-DFKITEIFQSHIKLQWGTPDPVKLFKLIQYNLLCWDVRLKIVNATAKSSTLFPILNHNLSMNEMEYVLYLKNEKEIKCRLSAINSDGKG-MPTEIQASTVNKGVNYQNL-IHIDKIGSTYITFQWRPPSKFSFDYFLWIYQIFDSEKLDRAVKLPKIKINISDSASAENGWFVYNYTNAFSSSRYILGLRYLCRDSTDILREYVHRSDLVSTMKSVPSDSPKDLVVKEIDSNSALVSWKPLDQVHSNGIITHYEVRYYAPKKEESTERFIN--VSETSAILSNL--KYFHYVIYVRAFTKVGGGSWSNPKNYYRQNLEEFPIPTTIKGERKSETEINISWELPVLSEKNLAHAAIEGFIILYAPVE----SSPKWIKYTV---------QSKNLSAVIKGLEPDLRYQFQIAATNYAGFNGNFSEIVQEMPKNFPNLNLKTVPDLRCSVQSSNRLKVEWSSPSISTDLLKFEIRYSGNLSYITEIGLKKSEFIDMESKSVNFETLVNRYDVTLENLQSNALYKIAVRAIYQNKELYESHRETTCDTMPAVPNLVKPPIIVGLDEEKSKVIIKLHRCSQRNGKIS-YYFVIVAAFQGNKNQQISFQEDTESYTFMELSVNT------RSNNAKG--------EYIAIMKD--INDIFKVSGKDHSSVLL 3447
              C +TG P P ++W     K+N    E ++                    +VL I  L      +V  C A+N  G +    +L V+  E  +PSGFP         +       T++C A GNP P I WFK++  ++ + +  +IK L        G L +      D+G Y C A N+ G+R S P+ L +    ++P   I+    E     NV I+            W  G  D+T +++       V  N+ E         LT          N+K+   +T  C+ M S   LGV      +TVK+LP +P     +   T  + T+I V W           YY I Y +     P     + +K+D     + I        Y I V  VN IG GP S+ +  +T     +  P + +   +  + + +QW  P        ++ N      R+       +  + +  L +N+  + +  +  L   +    R+ A  S G G +   IQ  T  +GV  Q +    +    T I   W PP + S   +   Y+  +     R    P     +       N  +++      + S + LG   L     DI            TM+S PS  P+++      S + LVSW P      NG++  Y VRY A   +++  + +     +T+ IL     K+  Y I V A T+VG G  S P             P  ++ E  + T I + W  PV   +N  H  I G+ + Y  +E    S    IK  +          +     VI GL+P+  Y   +AA    G        +       P       PDL     S   L VEW  P  S   +         L Y  + G +    +     ++ F  L  +Y  T  +  +  ++K+AV+      E          DT    P L++  I+  +  + + +   L   ++RNG I+ Y      A    K Q+I       S+   +L+ NT      R++  KG        +Y   + D  +   FKV     +SVLL
Sbjct:   43 FVCQATGDPKPRVTWNKRGKKVNSQRFETIE--------------FDEGAGAVLRIQPLRTPRDENVYECVAQNVHGEEVVSAKLTVLR-EDQLPSGFPNIDMGPQLKVVERTRTATMLCAASGNPDPEITWFKDFLPVDPASSNGRIKQLRSENTPIRGALQIENSEETDQGKYECVATNSAGVRYSSPANLYVRVRRVAPRFSILPVSHEIMPGGNVNITCVAVGSPMPYVKWMVGAEDLTPEDDM-----PVGRNVLE---------LT----------NVKESANYT--CVAMSS---LGVIESVAQITVKSLPKAPG----TPVVTETTATSITVTWD--SGNPDPVSYYVIEYKSKSQDGP-----YQIKEDITTTRYSIGGLSPNSEYEIWVSAVNSIGQGPPSEPVVTRTGEQAPASAPRNVQARMLSSTTMIIQWEEP--------VEPNGQIRGYRVYYTMEPDQPVSSW--LKYNVDDSLLTTIGSLLEHETYTVRVLAFTSVGDGPLSDPIQVKT-QQGVPGQPMNFRAEAKSETSIGLTWSPPRQDSIVKYELNYREGEGGNEIRKTFDPATSYTV--EGLKPNTEYLFRLA---ARSSHGLGAWTL-----DIKER---------TMQSKPSAPPRNVKCVSSKSTTILVSWLPPPAESQNGVLAGYSVRYSALDSDDTRPKEVKDIPPQTTQILLEALEKWTVYRITVVAHTEVGPGPESPPVEIRTDEDVPSAPPRKVEVEVLNSTAIKVFWRSPV---QNRQHGQIRGYQVHYVRMENGEASGLTLIKDVMLADAQWEMDDTAEYEMVISGLQPETSYSVTVAAYTMKGDGARSKPKLVTTRGAVPGK-----PDLFVHQNSDGSLLVEWEPPRESEGHI---------LGYRLQFGRQDVMLLS----TLEFGELEKKYLATNIHKGATYVFKMAVKGRVGLSEEAVKEFIVPEDTPKGFPQLIEKGIVTSMSIQLNWLPPVL---AERNGVITKYTLAYRVAGSSEKLQEIDLPSSDNSFILTDLNPNTVYEVKIRAHTRKGPGPYSPTVQYRTFLLDQVLPKNFKVKMVTKTSVLL 1029          

HSP 4 Score: 142.51 bits (358), Expect = 4.959e-33
Identity = 211/976 (21.62%), Postives = 390/976 (39.96%), Query Frame = 1
Query:  271 LINSQITFTENDEAPK----ISLIIQSPNVLLFKSMILACSSTGHPVPSISWKINESPIEELKS--PLKKL--QNPPRIFSIKNYQNSVLVITQLIESDSNSVLICEAENNAGFDSRQQQLKVISTETDIP--SGFPVFQNNFFPIIKPYNSNVTLVCQAYGNPPPLIQWFKNYELINESFTKIKILNDGNLLLVQVTREDKGIYHCQAQNTNGLRLSDPSTLDITSYPISPNSLIIERFASDNVEISWRSGLNDVTEQENFILHYREVPENITEKQIMSKFVYLTISEKKSIYKYNLKDLFPFTTYCIWMESENPLGVSPPTIALTVKTLPTSPQLSPRSITATSISNTAILVAWRPPERKFGKFKYYQIIYTNNDGFLPQHWRQFAVKDDNVMLT--HLIASELYHIRVKIVNEIGHGPLSKTISIKTIAGTLSQCPDFKITEIFQSHIKLQWGTPDPVKLFKLIQYNLLCWDVRLKIVNATAKSSTLFPILNHNLSMNEMEYVLYLKNEKEIKCRLSAINSDGKGMPT-EIQASTV-NKGVNYQNLIHIDKIGSTYITFQWRPPSKFSFDYFLWIYQIFDSEKLDRAVKLPKIKINISDSAS-----AENGWFVYNYTNAFSSSRYILGLRYLCRDSTDILREYVHRSDLVSTMKSVPSDSPKDLVVKEIDSNSALVSWKPLDQVHSNGIITHYEVRYYAPKKEESTERFI--------------NVSETSAILSNLK-YFHYVIYVRAFTKVGGGSWSNPKNYYRQNLEEFPIPTTIKGERKSETEINISWELPVLSEKNLAHAAIE---GFIILYAPVESSPKWIKYTVQSKNLSAVIKGLEPDLRYQFQIAATNYAGFNGNFSE---IVQEMPKNFPNLNLKTVPDLRCSVQSSNRLKVEWSSPSISTDLLKFEIRYSGNLSYITEIGLKKSEFIDMESKSVNFETLVNRYDVTLENLQSNALYKIAVRA 3078
            ++++++T    D+ P     I +  Q   V   ++  + C+++G+P P I+W  +  P++   S   +K+L  +N P I      +NS        E        C A N+AG          +      P  S  PV  +   P       NV + C A G+P P ++W     +  E  T    +  G  +L     ++   Y C A ++ G+ +   + + + S P +P + ++    + ++ ++W SG  D      +++ Y+            S+     I E  +  +Y++  L P + Y IW+ + N +G  PP+  +  +T   +P  +PR++ A  +S+T +++ W  P    G+ + Y++ YT         W ++ V DD+++ T   L+  E Y +RV     +G GPLS  I +KT  G   Q  +F+     ++ I L W  P   +   +++Y L   +             T  P  ++         V  LK   E   RL+A +S G G  T +I+  T+ +K       +      ST I   W PP   S +  L  Y +  S  LD     PK   +I    +     A   W VY               R      T++          + T + VPS  P+ + V+ ++S +  V W+   Q   +G I  Y+V Y   +  E++   +              + +E   ++S L+    Y + V A+T  G G+ S PK    +     P    +   + S+  + + WE P  SE ++    ++     ++L + +E      KY   + +  A          Y F++A     G +    +   + ++ PK FP L       +   + +S  +++ W  P ++    +  +     L+Y      +K + ID+ S   +F          L +L  N +Y++ +RA
Sbjct:  108 VVSAKLTVLREDQLPSGFPNIDMGPQLKVVERTRTATMLCAASGNPDPEITWFKDFLPVDPASSNGRIKQLRSENTP-IRGALQIENS--------EETDQGKYECVATNSAGVRYSSPANLYVRVRRVAPRFSILPV-SHEIMP-----GGNVNITCVAVGSPMPYVKWM----VGAEDLTPEDDMPVGRNVLELTNVKESANYTCVAMSSLGV-IESVAQITVKSLPKAPGTPVVTETTATSITVTWDSGNPDPVSY--YVIEYKS----------KSQDGPYQIKEDITTTRYSIGGLSPNSEYEIWVSAVNSIGQGPPSEPVVTRTGEQAPASAPRNVQARMLSSTTMIIQWEEPVEPNGQIRGYRVYYTMEPDQPVSSWLKYNV-DDSLLTTIGSLLEHETYTVRVLAFTSVGDGPLSDPIQVKTQQGVPGQPMNFRAEAKSETSIGLTWSPP---RQDSIVKYELNYREGE----GGNEIRKTFDPATSYT--------VEGLKPNTEYLFRLAARSSHGLGAWTLDIKERTMQSKPSAPPRNVKCVSSKSTTILVSWLPPPAESQNGVLAGYSVRYS-ALDSDDTRPKEVKDIPPQTTQILLEALEKWTVY---------------RITVVAHTEVGPGPESPPVEIRTDEDVPSAPPRKVEVEVLNSTAIKVFWRSPVQNRQHGQIRGYQVHYVRMENGEASGLTLIKDVMLADAQWEMDDTAEYEMVISGLQPETSYSVTVAAYTMKGDGARSKPKLVTTRG--AVPGKPDLFVHQNSDGSLLVEWEPPRESEGHILGYRLQFGRQDVMLLSTLEFGELEKKYLATNIHKGAT---------YVFKMAVKGRVGLSEEAVKEFIVPEDTPKGFPQL-------IEKGIVTSMSIQLNWLPPVLAE---RNGVITKYTLAYRVAGSSEKLQEIDLPSSDNSF---------ILTDLNPNTVYEVKIRA 989          

HSP 5 Score: 93.9745 bits (232), Expect = 2.901e-18
Identity = 120/501 (23.95%), Postives = 212/501 (42.32%), Query Frame = 1
Query: 1126 YNLKDLFPFTTYCIWMESENPLGVSPPTIALTVKTLPTSPQLSPRSITATSISNTAILVAWRPP--ERKFGKFKYYQIIYT--NNDGFLPQHWRQFAVKDDNVMLTHLIASELYHIRVKIVNEIGHGPLSKTISIKTIAGTLSQCPDFKITEIFQS-HIKLQWGTPDPVKLFKLIQYNLLCWDVRLKIVNATAKSSTLFP---ILNHNLSMN---EMEYVLY-LKNEKEIKCRLSAINSDGKGMPTEIQASTVNKGVNYQNLIHIDKIGSTYITFQWRPPSKFSFDYFLWIYQIFDSEKLDRAVKLPKIKINISDSASAENGWFVYNY--TNAFSSSRYILGLRYLCRD--STDILREYVHRSDLVSTMKSVPSDSPK---DLVVKEI-DSNSALVSWKPLDQVHSNGIITHYEVRY-YAPKKEESTERFINVSETSAILSNLKYFH-YVIYVRAFTKVGGGSWSNPKNYYRQNLEEFPIPTTIKGERKSETEINISWELP 2562
            Y ++ L P T Y   + + +  G+   T+ +  +T+ + P   PR++   S  +T ILV+W PP  E + G    Y + Y+  ++D   P+  +    +   ++L  L    +Y I V    E+G GP S  + I+T     S  P     E+  S  IK+ W +P   +    I+   + +   +++ N  A   TL     + +    M+   E E V+  L+ E      ++A    G G  ++ +  T    V  +  + + +     +  +W PP               +SE      +L   + ++   ++ E G     Y  TN    + Y+  +    R   S + ++E++           VP D+PK    L+ K I  S S  ++W P      NG+IT Y + Y  A   E+  E  +  S+ S IL++L     Y + +RA T+ G G +S P   YR  L +  +P   K +  ++T + +SWE P
Sbjct:  563 YTVEGLKPNTEYLFRLAARSSHGLGAWTLDIKERTMQSKPSAPPRNVKCVSSKSTTILVSWLPPPAESQNGVLAGYSVRYSALDSDDTRPKEVKDIPPQTTQILLEALEKWTVYRITVVAHTEVGPGPESPPVEIRTDEDVPSAPPRKVEVEVLNSTAIKVFWRSPVQNRQHGQIRGYQVHY---VRMENGEASGLTLIKDVMLADAQWEMDDTAEYEMVISGLQPETSYSVTVAAYTMKGDGARSKPKLVTTRGAVPGKPDLFVHQNSDGSLLVEWEPPR--------------ESEGHILGYRLQFGRQDVMLLSTLEFGELEKKYLATNIHKGATYVFKMAVKGRVGLSEEAVKEFI-----------VPEDTPKGFPQLIEKGIVTSMSIQLNWLPPVLAERNGVITKYTLAYRVAGSSEKLQEIDLPSSDNSFILTDLNPNTVYEVKIRAHTRKGPGPYS-PTVQYRTFLLDQVLPKNFKVKMVTKTSVLLSWEFP 1034          
BLAST of Protein tyrosine phosphatase receptor type D vs. Ensembl Xenopus
Match: brdt (bromodomain, testis-specific [Source:Xenbase;Acc:XB-GENE-983868])

HSP 1 Score: 720.694 bits (1859), Expect = 0.000e+0
Identity = 338/626 (53.99%), Postives = 450/626 (71.88%), Query Frame = 1
Query: 3949 NADSVQMCQ-DGTKLSPVLVSDSIKLRIGSQKSENISDRPSISICNLYQYVTDLKANDCTLLQAEFETLNTNLDDRFTWQRSNIDSNKSKNRYANVVAYDHTSVLLTPVDDVIGSDYINANYIDGYQRQNAYIATQGPLPDTTDDFWRMVWEQRSNCIVMMTRLEERSGIKCHQYWPNRGFICYGQMIVSHIDTFVLAYYTIRLFEIRHSKYSEKREIQHFQFTAWPDHGVPKLSTPLLMFIRRVRSIGKIESCPKIVHCSAGVGRTGAFIVVDAQLERIKQEKNIDVFNYVSKIRCQRNYMVQTQAQYQFILETLLEAVEDGNTEVMACNFHAHVTKLSQIGISGSNQLSGFEMEFSKLNSLASNRGRHGVMLADFVKAAGNQAVNMTKNRVRNIIPYEWNRVVLNAIRGIEGSDYINASYIDGYRDRRAYIAAQSPIPSTVEDFWRMLWDQHCGVVIVLNQPHE---DKSHIYWPINKSIRYQFFVVDPVVEYNMPNYILREFKVTDARDGEFRALRQFQFTQWPNHGCPKESESILDFIRQVHKTKEQFGHMEPMVIHCNTGSGRTGVFIALSIVLDRLQQESVVDMYQTVKLLHKQRIGLVQTEEQYEFCYMAVLDYLSNYE 5814
            N+D    C  +  +++P   +D +++R  + ++  + + P I I +L ++   LKAND   L  E+E+++     +FTW+ SN++ NK+KNRYANV+AYDH+ V+L PV+ +IGSDYINANYIDGY++QNAYIATQG LP+T  DFWRMVWEQRS  +VMMT+LEE+S IKC QYWP+RG   YG + V+ +DT  LA + +R F +  S  SEKRE++ FQFTAWPDHGVP+  TP L F+RRV++    ++ P +VHCSAGVGRTG FIV+DA LERIK EK +D++ +V+ +R QRNYMVQT+ QY FI + LLEAV  GNTEV A N + ++ KL+QI +     ++G E+EF +L +  ++  R       F+ A  N   N  KNR+ NI+PYE  RV L  IRG+EGSDYINAS+IDGYR ++AYIA Q P+  T EDFWRMLW+ +  +V++L +  E   +K H YWP  +S RYQ+FVVDP+ EYNMP YILREFKVTDARDG+ R +RQFQFT WP  G PK  E  +DFI QVHKTKEQFG   P+ +HC+ G GRTGVFI LSIVL+R++ E VVD++QTVK+L  QR  +VQTE++Y+FCY A L+YL +++
Sbjct: 1281 NSDPRTKCLLNNAEIAPHHPTDPVEMRRINFQTPGMLNHPPIPIADLSEHTEHLKANDNLKLSQEYESVDPG--QQFTWEHSNLEVNKAKNRYANVIAYDHSRVILLPVEGIIGSDYINANYIDGYRKQNAYIATQGALPETFGDFWRMVWEQRSATVVMMTKLEEKSRIKCDQYWPSRGTETYGMIQVTLLDTIELATFCVRTFSLHKSGSSEKREVRQFQFTAWPDHGVPEYPTPFLAFLRRVKTCNPPDAGPVVVHCSAGVGRTGCFIVIDAMLERIKHEKTVDIYGHVTLMRSQRNYMVQTEDQYSFIHDALLEAVACGNTEVPARNLYTYIQKLAQIEL--GEHVTGMELEFKRLANSKAHTSR-------FISA--NLPCNKFKNRLVNIMPYESTRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWENNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDEYQFCYQAALEYLGSFD 1893          

HSP 2 Score: 201.83 bits (512), Expect = 3.506e-51
Identity = 104/262 (39.69%), Postives = 152/262 (58.02%), Query Frame = 1
Query: 5092 NQAVNMTKNRVRNIIPYEWNRVVLNAIRGIEGSDYINASYIDGYRDRRAYIAAQSPIPSTVEDFWRMLWDQHCGVVIVLNQPHEDKSHI----YWPINKSIRYQFFVVDPVVEYNMPNYILREFKVTDARDGEFRALRQFQFTQWPNHGCPKESESILDFIRQVHKTKEQFGHMEPMVIHCNTGSGRTGVFIALSIVLDRLQQESVVDMYQTVKLLHKQRIGLVQTEEQYEFCYMAVLDYLSNYEKILEKSHLY*TYQDLSE 5865
            N  VN  KNR  N+I Y+ +RV+L  + GI GSDYINA+YIDGYR + AYIA Q  +P T  DFWRM+W+Q    V+++ +  E+KS I    YWP   +  Y    V  +    +  + +R F +  +   E R +RQFQFT WP+HG P+     L F+R+V           P+V+HC+ G GRTG FI +  +L+R++ E  VD+Y  V L+  QR  +VQTE+QY F + A+L+ ++     +   +LY   Q L++
Sbjct: 1361 NLEVNKAKNRYANVIAYDHSRVILLPVEGIIGSDYINANYIDGYRKQNAYIATQGALPETFGDFWRMVWEQRSATVVMMTK-LEEKSRIKCDQYWPSRGTETYGMIQVTLLDTIELATFCVRTFSLHKSGSSEKREVRQFQFTAWPDHGVPEYPTPFLAFLRRVKTCNPP--DAGPVVVHCSAGVGRTGCFIVIDAMLERIKHEKTVDIYGHVTLMRSQRNYMVQTEDQYSFIHDALLEAVACGNTEVPARNLYTYIQKLAQ 1619          

HSP 3 Score: 159.073 bits (401), Expect = 4.606e-38
Identity = 252/1081 (23.31%), Postives = 409/1081 (37.84%), Query Frame = 1
Query:  370 LACSSTGHPVPSISW-----KINESPIEELKSPLKKLQNPPRIFSIKNYQNSVLVITQLIESDSNSVLICEAENNAGFDSRQQQLKVISTETDIPSGFPVFQNNFFPIIKPYNSNVTLVCQAYGNPPPLIQWFKNYELINESFT--KIKILNDGNLLLVQVTREDKGIYHCQAQNTNGLRLSDPSTLDITSYPISPNSLII----ERFASDNVEIS------------WRSGLNDVTEQENFILHYREVPENITEKQIMSKFVYLTISEKKSIYKYNLKDLFPFTTYCIWMESENPLGVSPPTIALTVKTLPTSPQLSPRSITATSISNTAILVAWRPPERKFGKFKYYQIIYTNNDGFLPQHWRQFAVKDDNVMLTHLIAS----ELYHIRVKIVNEIGHGPLSKTISIKTIAGTLSQCP-DFKITEIFQSHIKLQWGTPDPVKLFKLIQYNLLCWDVRLKIVNATAKSSTLFPILNHNLSMNEMEYVLYLKNEKEIKCRLSAINSDGKG-MPTEIQASTVNKGVNYQNL-IHIDKIGSTYITFQWRPPSKFSFDYFLWIYQIFDSEKLDRAVKLPKIKINISDSASAENGWFVYNYTNAFSSSRYILGLRYLCRDSTDILREYVHRSDLVSTMKSVPSDSPKDLVVKEIDSNSALVSWKPLDQVHSNGIITHYEVRYYAPKKEESTERFIN--VSETSAILSNL--KYFHYVIYVRAFTKVGGGSWSNPKNYYRQNLEEFPIPTTIKGERKSETEINISWELPVLSEKNLAHAAIEGFIILYAPVE----SSPKWIKYTVQSKNLSAVIKGLEPDLRYQFQIAATNYAGFNGNFSEIVQEMPKNFPNLNLKTVPDLRCSVQSSNRLKVEWSSPSISTDLLKFEIRYSGNLSYITEIGLKKSEFIDMESKSVNFETLVNRYDVTLENLQSNALYKIAVRAIYQNKELYESHRETTCDTMPAVPNLVKPPIIVGLDEEKSKVIIKLHRCSQRNGKIS-YYFVIVAAFQGNKNQQISFQEDTESYTFMELSVNT------RSNNAKG--------EYIAIMKD--INDIFKVSGKDHSSVLL 3447
              C +TG P P ++W     K+N    E ++                    +VL I  L      +V  C A+N  G +    +L V+  E  +PSGFP         +       T++C A GNP P I WFK++  ++ + +  +IK L  G L +      D+G Y C A N+ G+R S P+ L +    ++P   I+    E     NV I+            W  G  D+T +++       V  N+ E         LT          N+K+   +T  C+ M S   LGV      +TVK+LP +P     +   T  + T+I V W           YY I Y +     P     + +K+D     + I        Y I V  VN IG GP S+ +  +T     +  P + +   +  + + +QW  P        ++ N      R+       +  + +  L +N+  + +  +  L   +    R+ A  S G G +   IQ  T  +GV  Q +    +    T I   W PP + S   +   Y+  +             ++   D A++      Y       ++ Y+   R   R S  +    +   +   TM+S PS  P+++      S + LVSW P      NG++  Y VRY A   +++  + +     +T+ IL     K+  Y I V A T+VG G  S P             P  ++ E  + T I + W  PV   +N  H  I G+ + Y  +E    S    IK  + +     VI GL+P+  Y   +AA    G        +       P       PDL     S   L VEW  P  S   +         L Y  + G +    +     ++ F  L  +Y  T  +  +  ++K+AV+      E          DT    P L++  I+  +  + + +   L   ++RNG I+ Y      A    K Q+I       S+   +L+ NT      R++  KG        +Y   + D  +   FKV     +SVLL
Sbjct:   52 FVCQATGDPKPRVTWNKRGKKVNSQRFETIE--------------FDEGAGAVLRIQPLRTPRDENVYECVAQNVHGEEVVSAKLTVLR-EDQLPSGFPNIDMGPQLKVVERTRTATMLCAASGNPDPEITWFKDFLPVDPASSNGRIKQLRSGALQIENSEETDQGKYECVATNSAGVRYSSPANLYVRVRRVAPRFSILPVSHEIMPGGNVNITCVAVGSPMPYVKWMVGAEDLTPEDDM-----PVGRNVLE---------LT----------NVKESANYT--CVAMSS---LGVIESVAQITVKSLPKAPG----TPVVTETTATSITVTWD--SGNPDPVSYYVIEYKSKSQDGP-----YQIKEDITTTRYSIGGLSPNSEYEIWVSAVNSIGQGPPSEPVVTRTGEQAPASAPRNVQARMLSSTTMIIQWEEP--------VEPNGQIRGYRVYYTMEPDQPVSSW--LKYNVDDSLLTTIGSLLEHETYTVRVLAFTSVGDGPLSDPIQVKT-QQGVPGQPMNFRAEAKSETSIGLTWSPPRQDSIVKYELNYREGEGGN----------EVRTFDPATS------YTVEGLKPNTEYL--FRLAARSSHGLGAWTLDIKE--RTMQSKPSAPPRNVKCVSSKSTTILVSWLPPPAESQNGVLAGYSVRYSALDSDDTRPKEVKDIPPQTTQILLEALEKWTVYRITVVAHTEVGPGPESPPVEIRTDEDVPSAPPRKVEVEVLNSTAIKVFWRSPV---QNRQHGQIRGYQVHYVRMENGEASGLTLIKDVMLADAQEMVISGLQPETSYSVTVAAYTMKGDGARSKPKLVTTRGAVPGK-----PDLFVHQNSDGSLLVEWEPPRESEGHI---------LGYRLQFGRQDVMLLS----TLEFGELEKKYLATNIHKGATYVFKMAVKGRVGLSEEAVKEFIVPEDTPKGFPQLIEKGIVTSMSIQLNWLPPVL---AERNGVITKYTLAYRVAGSSEKLQEIDLPSSDNSFILTDLNPNTVYEVKIRAHTRKGPGPYSPTVQYRTFLLDQVLPKNFKVKMVTKTSVLL 1022          

HSP 4 Score: 150.214 bits (378), Expect = 2.434e-35
Identity = 207/963 (21.50%), Postives = 389/963 (40.39%), Query Frame = 1
Query:  271 LINSQITFTENDEAPK----ISLIIQSPNVLLFKSMILACSSTGHPVPSISWKINESPIEELKSPLKKLQNPPRIFSIKNYQNSVLVITQLIESDSNSVLICEAENNAGFDSRQQQLKVISTETDIP--SGFPVFQNNFFPIIKPYNSNVTLVCQAYGNPPPLIQWFKNYELINESFTKIKILNDGNLLLVQVTREDKGIYHCQAQNTNGLRLSDPSTLDITSYPISPNSLIIERFASDNVEISWRSGLNDVTEQENFILHYREVPENITEKQIMSKFVYLTISEKKSIYKYNLKDLFPFTTYCIWMESENPLGVSPPTIALTVKTLPTSPQLSPRSITATSISNTAILVAWRPPERKFGKFKYYQIIYTNNDGFLPQHWRQFAVKDDNVMLT--HLIASELYHIRVKIVNEIGHGPLSKTISIKTIAGTLSQCPDFKITEIFQSHIKLQWGTPDPVKLFKLIQYNLLCWDVRLKIVNATAKSSTLFPILNHNLSMNEMEYVLYLKNEKEIKCRLSAINSDGKGMPT-EIQASTV-NKGVNYQNLIHIDKIGSTYITFQWRPPSKFSFDYFLWIYQIFDSEKLDRAVKLPKIKINISDSAS-----AENGWFVYNYTNAFSSSRYILGLRYLCRDSTDILREYVHRSDLVSTMKSVPSDSPKDLVVKEIDSNSALVSWKPLDQVHSNGIITHYEVRYYAPKKEEST-----ERFINVSETSAILSNLK-YFHYVIYVRAFTKVGGGSWSNPKNYYRQNLEEFPIPTTIKGERKSETEINISWELPVLSEKNLAHAAIE---GFIILYAPVESSPKWIKYTVQSKNLSAVIKGLEPDLRYQFQIAATNYAGFNGNFSE---IVQEMPKNFPNLNLKTVPDLRCSVQSSNRLKVEWSSPSISTDLLKFEIRYSGNLSYITEIGLKKSEFIDMESKSVNFETLVNRYDVTLENLQSNALYKIAVRA 3078
            ++++++T    D+ P     I +  Q   V   ++  + C+++G+P P I+W  +  P++   S  +          IK  ++  L I    E+D      C A N+AG          +      P  S  PV        I P   NV + C A G+P P ++W     +  E  T    +  G  +L     ++   Y C A ++ G+ +   + + + S P +P + ++    + ++ ++W SG  D      +++ Y+   ++   +          I E  +  +Y++  L P + Y IW+ + N +G  PP+  +  +T   +P  +PR++ A  +S+T +++ W  P    G+ + Y++ YT         W ++ V DD+++ T   L+  E Y +RV     +G GPLS  I +KT  G   Q  +F+     ++ I L W  P         Q +++ +++  +      +  T  P  ++         V  LK   E   RL+A +S G G  T +I+  T+ +K       +      ST I   W PP   S +  L  Y +  S  LD     PK   +I    +     A   W VY               R      T++          + T + VPS  P+ + V+ ++S +  V W+   Q   +G I  Y+V Y   +  E++     +  +       ++S L+    Y + V A+T  G G+ S PK    +     P    +   + S+  + + WE P  SE ++    ++     ++L + +E      KY   + +  A          Y F++A     G +    +   + ++ PK FP L       +   + +S  +++ W  P ++    +  +     L+Y      +K + ID+ S   +F          L +L  N +Y++ +RA
Sbjct:  117 VVSAKLTVLREDQLPSGFPNIDMGPQLKVVERTRTATMLCAASGNPDPEITWFKDFLPVDPASSNGR----------IKQLRSGALQIENSEETDQGKYE-CVATNSAGVRYSSPANLYVRVRRVAPRFSILPVSHE-----IMP-GGNVNITCVAVGSPMPYVKWM----VGAEDLTPEDDMPVGRNVLELTNVKESANYTCVAMSSLGV-IESVAQITVKSLPKAPGTPVVTETTATSITVTWDSGNPDPVSY--YVIEYKSKSQDGPYQ----------IKEDITTTRYSIGGLSPNSEYEIWVSAVNSIGQGPPSEPVVTRTGEQAPASAPRNVQARMLSSTTMIIQWEEPVEPNGQIRGYRVYYTMEPDQPVSSWLKYNV-DDSLLTTIGSLLEHETYTVRVLAFTSVGDGPLSDPIQVKTQQGVPGQPMNFRAEAKSETSIGLTWSPPR--------QDSIVKYELNYREGEGGNEVRTFDPATSYT--------VEGLKPNTEYLFRLAARSSHGLGAWTLDIKERTMQSKPSAPPRNVKCVSSKSTTILVSWLPPPAESQNGVLAGYSVRYS-ALDSDDTRPKEVKDIPPQTTQILLEALEKWTVY---------------RITVVAHTEVGPGPESPPVEIRTDEDVPSAPPRKVEVEVLNSTAIKVFWRSPVQNRQHGQIRGYQVHYVRMENGEASGLTLIKDVMLADAQEMVISGLQPETSYSVTVAAYTMKGDGARSKPKLVTTRG--AVPGKPDLFVHQNSDGSLLVEWEPPRESEGHILGYRLQFGRQDVMLLSTLEFGELEKKYLATNIHKGAT---------YVFKMAVKGRVGLSEEAVKEFIVPEDTPKGFPQL-------IEKGIVTSMSIQLNWLPPVLAE---RNGVITKYTLAYRVAGSSEKLQEIDLPSSDNSF---------ILTDLNPNTVYEVKIRA 982          

HSP 5 Score: 95.9005 bits (237), Expect = 6.312e-19
Identity = 118/494 (23.89%), Postives = 210/494 (42.51%), Query Frame = 1
Query: 1126 YNLKDLFPFTTYCIWMESENPLGVSPPTIALTVKTLPTSPQLSPRSITATSISNTAILVAWRPP--ERKFGKFKYYQIIYT--NNDGFLPQHWRQFAVKDDNVMLTHLIASELYHIRVKIVNEIGHGPLSKTISIKTIAGTLSQCPDFKITEIFQS-HIKLQWGTPDPVKLFKLIQYNLLCWDVRLKIVNATAKSSTLFPILNHNLSMNEMEYVLYLKNEKEIKCRLSAINSDGKGMPTEIQASTVNKGVNYQNLIHIDKIGSTYITFQWRPPSKFSFDYFLWIYQIFDSEKLDRAVKLPKIKINISDSASAENGWFVYNY--TNAFSSSRYILGLRYLCRD--STDILREYVHRSDLVSTMKSVPSDSPK---DLVVKEI-DSNSALVSWKPLDQVHSNGIITHYEVRY-YAPKKEESTERFINVSETSAILSNLKYFH-YVIYVRAFTKVGGGSWSNPKNYYRQNLEEFPIPTTIKGERKSETEINISWELP 2562
            Y ++ L P T Y   + + +  G+   T+ +  +T+ + P   PR++   S  +T ILV+W PP  E + G    Y + Y+  ++D   P+  +    +   ++L  L    +Y I V    E+G GP S  + I+T     S  P     E+  S  IK+ W +P   +    I+   + +   +++ N  A   TL  I +  L+  +   +  L+ E      ++A    G G  ++ +  T    V  +  + + +     +  +W PP               +SE      +L   + ++   ++ E G     Y  TN    + Y+  +    R   S + ++E++           VP D+PK    L+ K I  S S  ++W P      NG+IT Y + Y  A   E+  E  +  S+ S IL++L     Y + +RA T+ G G +S P   YR  L +  +P   K +  ++T + +SWE P
Sbjct:  565 YTVEGLKPNTEYLFRLAARSSHGLGAWTLDIKERTMQSKPSAPPRNVKCVSSKSTTILVSWLPPPAESQNGVLAGYSVRYSALDSDDTRPKEVKDIPPQTTQILLEALEKWTVYRITVVAHTEVGPGPESPPVEIRTDEDVPSAPPRKVEVEVLNSTAIKVFWRSPVQNRQHGQIRGYQVHY---VRMENGEASGLTL--IKDVMLADAQEMVISGLQPETSYSVTVAAYTMKGDGARSKPKLVTTRGAVPGKPDLFVHQNSDGSLLVEWEPPR--------------ESEGHILGYRLQFGRQDVMLLSTLEFGELEKKYLATNIHKGATYVFKMAVKGRVGLSEEAVKEFI-----------VPEDTPKGFPQLIEKGIVTSMSIQLNWLPPVLAERNGVITKYTLAYRVAGSSEKLQEIDLPSSDNSFILTDLNPNTVYEVKIRAHTRKGPGPYS-PTVQYRTFLLDQVLPKNFKVKMVTKTSVLLSWEFP 1027          
BLAST of Protein tyrosine phosphatase receptor type D vs. Ensembl Mouse
Match: Ptprs (protein tyrosine phosphatase, receptor type, S [Source:MGI Symbol;Acc:MGI:97815])

HSP 1 Score: 720.694 bits (1859), Expect = 0.000e+0
Identity = 339/635 (53.39%), Postives = 452/635 (71.18%), Query Frame = 1
Query: 3928 KSIPDLVNADS---VQMCQDGTKLSPVLVSDSIKLRIGSQKSENISDRPSISICNLYQYVTDLKANDCTLLQAEFETLNTNLDDRFTWQRSNIDSNKSKNRYANVVAYDHTSVLLTPVDDVIGSDYINANYIDGYQRQNAYIATQGPLPDTTDDFWRMVWEQRSNCIVMMTRLEERSGIKCHQYWPNRGFICYGQMIVSHIDTFVLAYYTIRLFEIRHSKYSEKREIQHFQFTAWPDHGVPKLSTPLLMFIRRVRSIGKIESCPKIVHCSAGVGRTGAFIVVDAQLERIKQEKNIDVFNYVSKIRCQRNYMVQTQAQYQFILETLLEAVEDGNTEVMACNFHAHVTKLSQIGISGSNQLSGFEMEFSKLNSLASNRGRHGVMLADFVKAAGNQAVNMTKNRVRNIIPYEWNRVVLNAIRGIEGSDYINASYIDGYRDRRAYIAAQSPIPSTVEDFWRMLWDQHCGVVIVLNQPHE---DKSHIYWPINKSIRYQFFVVDPVVEYNMPNYILREFKVTDARDGEFRALRQFQFTQWPNHGCPKESESILDFIRQVHKTKEQFGHMEPMVIHCNTGSGRTGVFIALSIVLDRLQQESVVDMYQTVKLLHKQRIGLVQTEEQYEFCYMAVLDYLSNYE 5814
            K+ PD    DS    +   +   L+P    D +++R  + ++  +   P I I ++ +++  LKAND   L  E+E+++     +FTW+ SN+++NK KNRYANV+AYDH+ V+L P++ ++GSDYINANY+DGY+RQNAYIATQGPLP+T  DFWRMVWEQRS  +VMMTRLEE+S IKC QYWPNRG   YG + V+ +DT  LA + +R F +  +  SEKRE++HFQFTAWPDHGVP+  TP L F+RRV++    ++ P +VHCSAGVGRTG FIV+DA LERIK EK +DV+ +V+ +R QRNYMVQT+ QY FI E LLEAV  GNTEV A + + ++ KL+Q  +     ++G E+EF +L S  ++  R       F+ A+     N  KNR+ NI+PYE +RV L  IRG+EGSDYINAS+IDGYR ++AYIA Q P+  T EDFWR LW+ +  +V++L +  E   +K H YWP  +S RYQ+FVVDP+ EYNMP YILREFKVTDARDG+ R +RQFQFT WP  G PK  E  +DFI QVHKTKEQFG   P+ +HC+ G GRTGVFI LSIVL+R++ E VVD++QTVK+L  QR  +VQTE++Y+FC+ A L+YL +++
Sbjct: 1282 KNKPDSKRKDSEPRTKCLLNNADLAPHHPKDPVEMRRINFQTPGMLSHPPIPITDMAEHMERLKANDSLKLSQEYESIDPG--QQFTWEHSNLEANKPKNRYANVIAYDHSRVILQPLEGIMGSDYINANYVDGYRRQNAYIATQGPLPETFGDFWRMVWEQRSATVVMMTRLEEKSRIKCDQYWPNRGTETYGFIQVTLLDTMELATFCVRTFSLHKNGSSEKREVRHFQFTAWPDHGVPEYPTPFLAFLRRVKTCNPPDAGPIVVHCSAGVGRTGCFIVIDAMLERIKTEKTVDVYGHVTLMRSQRNYMVQTEDQYGFIHEALLEAVGCGNTEVPARSLYTYIQKLAQ--VEPGEHVTGMELEFKRLASSKAHTSR-------FITAS--LPCNKFKNRLVNILPYESSRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRALWENNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPEQGAPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKVLRTQRPAMVQTEDEYQFCFQAALEYLGSFD 1903          

HSP 2 Score: 201.83 bits (512), Expect = 2.831e-51
Identity = 103/262 (39.31%), Postives = 149/262 (56.87%), Query Frame = 1
Query: 5092 NQAVNMTKNRVRNIIPYEWNRVVLNAIRGIEGSDYINASYIDGYRDRRAYIAAQSPIPSTVEDFWRMLWDQHCGVVIVLNQPHEDKSHI----YWPINKSIRYQFFVVDPVVEYNMPNYILREFKVTDARDGEFRALRQFQFTQWPNHGCPKESESILDFIRQVHKTKEQFGHMEPMVIHCNTGSGRTGVFIALSIVLDRLQQESVVDMYQTVKLLHKQRIGLVQTEEQYEFCYMAVLDYLSNYEKILEKSHLY*TYQDLSE 5865
            N   N  KNR  N+I Y+ +RV+L  + GI GSDYINA+Y+DGYR + AYIA Q P+P T  DFWRM+W+Q    V+++ +  E+KS I    YWP   +  Y F  V  +    +  + +R F +      E R +R FQFT WP+HG P+     L F+R+V           P+V+HC+ G GRTG FI +  +L+R++ E  VD+Y  V L+  QR  +VQTE+QY F + A+L+ +      +    LY   Q L++
Sbjct: 1371 NLEANKPKNRYANVIAYDHSRVILQPLEGIMGSDYINANYVDGYRRQNAYIATQGPLPETFGDFWRMVWEQRSATVVMMTR-LEEKSRIKCDQYWPNRGTETYGFIQVTLLDTMELATFCVRTFSLHKNGSSEKREVRHFQFTAWPDHGVPEYPTPFLAFLRRVKTCNPP--DAGPIVVHCSAGVGRTGCFIVIDAMLERIKTEKTVDVYGHVTLMRSQRNYMVQTEDQYGFIHEALLEAVGCGNTEVPARSLYTYIQKLAQ 1629          

HSP 3 Score: 153.295 bits (386), Expect = 1.895e-36
Identity = 202/837 (24.13%), Postives = 331/837 (39.55%), Query Frame = 1
Query:  370 LACSSTGHPVPSISW-----KINESPIEELKSPLKKLQNPPRIFSIKNYQNSVLVITQLIESDSNSVLICEAENNAGFDSRQQQLKVISTETDIPSGFPVFQNNFFPIIKPYNSNVTLVCQAYGNPPPLIQWFKNYELINESFT--KIKILNDGNLLLVQVTREDKGIYHCQAQNTNGLRLSDPSTLDITSYPISPNSLII----ERFASDNVEIS------------WRSGLNDVTEQENFILHYREVPENITEKQIMSKFVYLTISEKKSIYKYNLKDLFPFTTYCIWMESENPLGVSPPTIALTVKTLPTSPQLSPRSITATSISNTAILVAWRPPERKFGKFKYYQIIYTNNDGFLPQHWRQFAVKDDNVMLTHLIAS----ELYHIRVKIVNEIGHGPLSKTISIKTIAGTLSQCP-DFKITEIFQSHIKLQWGTPDPVKLFKLIQYNLLCWDVRLKIVNATAKSSTLFPILN---HNLSMNEMEYVLYLKNEKEIKCRLSAINSDGKG-MPTEIQASTVNKGVNYQNL-IHIDKIGSTYITFQWRPPSKFSFDYFLWIYQIFDSEKLDRAVKLPKIKINISDSASAENGWFVYNYTNAFS-SSRYILGLRYLCRDSTDILREYVHRSDLVSTMKSVPSDSPKDLVVKEIDSNSALVSWKPLDQVHSNGIITHYEVRYYAPKKEESTERFIN---VSETSAILSNL-KYFHYVIYVRAFTKVGGGSWSNPKNYYRQNLEEFP--IPTTIKGERKSETEINISWELPVLSEKNLAHAAIEGFIILYAPVESS----PKWIKYTVQSKNLSAVIKGLEPDLRYQFQIAATNYAG 2748
              C +TG P P ++W     K+N    E +                     +VL I  L      +V  C A+N+ G  +   +L V+  E  +P GFP         +       T++C A GNP P I WFK++  ++ S +  +IK L  G L +      D+G Y C A N+ G+R S P+ L +    ++P   I+    E     NV I+            W  G  D+T +++       V  N+ E         LT          ++KD   +T  C+ M S   LGV      +TVK+LP +P     +   T  + T+I V W           YY I Y +     P     + +K+D     + I        Y I V  VN IG GP S+++  +T     +  P + +   +  + + +QW   +PV+   LI+   + + +  +            P+ N   HN+  + +  V  L  ++    R+ A  S G G +   IQ  T  +GV  Q + +  +    T I   W  P + S   +  +++  D  +       P     + D           N   AF  ++R   GL       T ++R+         T+++ PS  P+D+    + S + LVSW+P      NG +  Y VRY     E+   + +N    + T  +L  L K+  Y +   A+T+VG G  S+P     +  E+ P   P  ++ E  + T I + W  P    +   H  I G+ + Y  +E +    P  IK  + +     VI  L+P+  Y   +AA    G
Sbjct:   52 FVCQATGDPKPRVTWNKKGKKVNSQRFETI--------------DFDESSGAVLRIQPLRTPRDENVYECVAQNSVGEITIHAKLTVLR-EDQLPPGFPNIDMGPQLKVVERTRTATMLCAASGNPDPEITWFKDFLPVDPSASNGRIKQLRSGALQIESSEETDQGKYECVATNSAGVRYSSPANLYVRVRRVAPRFSILPMSHEIMPGGNVNITCVAVGSPMPYVKWMQGAEDLTPEDDM-----PVGRNVLE---------LT----------DVKDSANYT--CVAMSS---LGVIEAVAQITVKSLPKAPG----TPVVTENTATSITVTWD--SGNPDPVSYYVIEYKSKSQDGP-----YQIKEDITTTRYSIGGLSPNSEYEIWVSAVNSIGQGPPSESVVTRTGEQAPASAPRNVQARMLSATTMIVQWE--EPVEPNGLIRGYRVYYTMEPE-----------HPVGNWQKHNVDDSLLTTVGSLLEDETYTVRVLAFTSVGDGPLSDPIQVKT-QQGVPGQPMNLRAEAKSETSIGLSWSAPRQESVIKYELLFREGDRGREVGRTFDPTTAFVVED--------LKPNTEYAFRLAARSPQGLGAF----TAVVRQ--------RTLQAKPSAPPQDVKCTSLRSTAILVSWRPPPPETHNGALVGYSVRYRPLGSEDPDPKEVNNIPPTTTQILLEALEKWTEYRVTAVAYTEVGPGPESSP--VVVRTDEDVPSAPPRKVEAEALNATAIRVLWRSPTPGRQ---HGQIRGYQVHYVRMEGAEARGPPRIKDIMLADAQEMVITNLQPETAYSITVAAYTMKG 794          

HSP 4 Score: 153.295 bits (386), Expect = 2.044e-36
Identity = 197/878 (22.44%), Postives = 359/878 (40.89%), Query Frame = 1
Query:  268 VLINSQITFTENDEAPK----ISLIIQSPNVLLFKSMILACSSTGHPVPSISWKINESPIEELKSPLKKLQNPPRIFSIKNYQNSVLVITQLIESDSNSVLICEAENNAGFDSRQQQLKVISTETDIPSGFPVFQNNFFPI---IKPYNSNVTLVCQAYGNPPPLIQWFKNYELINESFTKIKILNDGNLLLVQVTREDKGIYHCQAQNTNGLRLSDPSTLDITSYPISPNSLIIERFASDNVEISWRSGLNDVTEQENFILHYREVPENITEKQIMSKFVYLTISEKKSIYKYNLKDLFPFTTYCIWMESENPLGVSPPTIALTVKTLPTSPQLSPRSITATSISNTAILVAWRPPERKFGKFKYYQIIYTNNDGFLPQHWRQFAVKDDNVMLT--HLIASELYHIRVKIVNEIGHGPLSKTISIKTIAGTLSQCPDFKITEIFQSHIKLQWGTPDPVKLFKLIQYNLLCWDV-RLKIVNATAKSSTLFPILNHNLSMNEMEYVLYLKNEKEIKCRLSAINSDGKGMPTEI--QASTVNKGVNYQNLIHIDKIGSTYITFQWRPPSKFSFDYFLWIYQI----FDSEKLDRAVKLPKIKINISDSAS-----AENGWFVYNYTNAFSSSRYILGLRYLCRDSTDILREYVHRSDLVSTMKSVPSDSPKDLVVKEIDSNSALVSWKPLDQVHSNGIITHYEVRYYAPKKEES--TERFINVSETSA---ILSNLK-YFHYVIYVRAFTKVGGGSWSNPKNYYRQN-LEEFPIPTTIKGERKSETEINISWELPVLSEKNLAHAAIEGFIILYAPVESSPKWIKYTVQSKNLSAVI-KGLEPDLRYQFQIAATN---YAGFNGNFSEIVQEMPKNFPNL 2805
            + I++++T    D+ P     I +  Q   V   ++  + C+++G+P P I+W  +  P++   S  +          IK  ++  L I    E+D      C A N+AG          +      P      + +  P+   I P   NV + C A G+P P ++W +      E  T    +  G  +L     +D   Y C A ++ G+ +   + + + S P +P + ++    + ++ ++W SG  D      +++ Y+            S+     I E  +  +Y++  L P + Y IW+ + N +G  PP+ ++  +T   +P  +PR++ A  +S T ++V W  P    G  + Y++ YT        +W++  V DD+++ T   L+  E Y +RV     +G GPLS  I +KT  G   Q  + +     ++ I L W  P   +   +I+Y LL  +  R + V  T   +T F + +             LK   E   RL+A +  G G  T +  Q +   K       +    + ST I   WRPP   + +  L  Y +      SE  D     PK   NI  + +     A   W  Y  T A + +    G      +S+ +         +V T + VPS  P+ +  + +++ +  V W+       +G I  Y+V Y   +  E+    R  ++    A   +++NL+    Y I V A+T  G G+ S PK    +  +   P   T+  ++  E  +   WE P     + A   + G+ + +   +++P  ++     +  +A   KG      Y F++AA               I ++ P+ FP +
Sbjct:  116 ITIHAKLTVLREDQLPPGFPNIDMGPQLKVVERTRTATMLCAASGNPDPEITWFKDFLPVDPSASNGR----------IKQLRSGALQIESSEETDQGK-YECVATNSAGVRYSSPANLYVRVRRVAP------RFSILPMSHEIMP-GGNVNITCVAVGSPMPYVKWMQG----AEDLTPEDDMPVGRNVLELTDVKDSANYTCVAMSSLGV-IEAVAQITVKSLPKAPGTPVVTENTATSITVTWDSGNPDPVSY--YVIEYKS----------KSQDGPYQIKEDITTTRYSIGGLSPNSEYEIWVSAVNSIGQGPPSESVVTRTGEQAPASAPRNVQARMLSATTMIVQWEEPVEPNGLIRGYRVYYTMEPEHPVGNWQKHNV-DDSLLTTVGSLLEDETYTVRVLAFTSVGDGPLSDPIQVKTQQGVPGQPMNLRAEAKSETSIGLSWSAP---RQESVIKYELLFREGDRGREVGRTFDPTTAFVVED-------------LKPNTEYAFRLAARSPQGLGAFTAVVRQRTLQAKPSAPPQDVKCTSLRSTAILVSWRPPPPETHNGALVGYSVRYRPLGSEDPD-----PKEVNNIPPTTTQILLEALEKWTEYRVT-AVAYTEVGPG-----PESSPV---------VVRTDEDVPSAPPRKVEAEALNATAIRVLWRSPTPGRQHGQIRGYQVHYVRMEGAEARGPPRIKDIMLADAQEMVITNLQPETAYSITVAAYTMKGDGARSKPKVVVTKGAVLGRP---TLSVQQTPEGSLLARWEPPA----DAAEDPVLGYRLQFGREDAAPATLELAAWERRFAAPAHKGAT----YVFRLAARGRAGLGEEAAAALSIPEDAPRGFPQI 910          

HSP 5 Score: 68.9366 bits (167), Expect = 7.461e-11
Identity = 66/265 (24.91%), Postives = 119/265 (44.91%), Query Frame = 1
Query: 2164 SDLVSTMKSVPSDSPKDLVVKEIDSNSALVSWKPLDQVHSNGIITHYEVRYYAPKKEESTERF----INVSETSAILSNLKYFHYVIYVRAFTKVGGGSWSNPKNYYRQNLEEFP-IPTTIKGERKSETEINISWELPVLSEKNLAHAAIEGFIILYAPVESSPKWIKYTVQSKNLSAVIKGLEPDLRYQFQIAATNYAGFNGNFSEIV-----QEMPKNFPNLNLKTVPDLRCSVQSSNRLKVEWSSPSISTD---LLKFEIRY 2919
            S +  T +  P+ +P+++  + + + + +V W+  + V  NG+I  Y V YY  + E     +    ++ S  + + S L+   Y + V AFT VG G  S+P     Q  +  P  P  ++ E KSET I +SW  P          ++  + +L+   +   + +  T      + V++ L+P+  Y F++AA +  G  G F+ +V     Q  P   P        D++C+   S  + V W  P   T    L+ + +RY
Sbjct:  403 SVVTRTGEQAPASAPRNVQARMLSATTMIVQWE--EPVEPNGLIRGYRV-YYTMEPEHPVGNWQKHNVDDSLLTTVGSLLEDETYTVRVLAFTSVGDGPLSDPIQVKTQ--QGVPGQPMNLRAEAKSETSIGLSWSAP-------RQESVIKYELLFREGDRG-REVGRTFDPTT-AFVVEDLKPNTEYAFRLAARSPQGL-GAFTAVVRQRTLQAKPSAPPQ-------DVKCTSLRSTAILVSWRPPPPETHNGALVGYSVRY 645          
BLAST of Protein tyrosine phosphatase receptor type D vs. Ensembl Mouse
Match: Ptprs (protein tyrosine phosphatase, receptor type, S [Source:MGI Symbol;Acc:MGI:97815])

HSP 1 Score: 718.768 bits (1854), Expect = 0.000e+0
Identity = 339/635 (53.39%), Postives = 452/635 (71.18%), Query Frame = 1
Query: 3928 KSIPDLVNADS---VQMCQDGTKLSPVLVSDSIKLRIGSQKSENISDRPSISICNLYQYVTDLKANDCTLLQAEFETLNTNLDDRFTWQRSNIDSNKSKNRYANVVAYDHTSVLLTPVDDVIGSDYINANYIDGYQRQNAYIATQGPLPDTTDDFWRMVWEQRSNCIVMMTRLEERSGIKCHQYWPNRGFICYGQMIVSHIDTFVLAYYTIRLFEIRHSKYSEKREIQHFQFTAWPDHGVPKLSTPLLMFIRRVRSIGKIESCPKIVHCSAGVGRTGAFIVVDAQLERIKQEKNIDVFNYVSKIRCQRNYMVQTQAQYQFILETLLEAVEDGNTEVMACNFHAHVTKLSQIGISGSNQLSGFEMEFSKLNSLASNRGRHGVMLADFVKAAGNQAVNMTKNRVRNIIPYEWNRVVLNAIRGIEGSDYINASYIDGYRDRRAYIAAQSPIPSTVEDFWRMLWDQHCGVVIVLNQPHE---DKSHIYWPINKSIRYQFFVVDPVVEYNMPNYILREFKVTDARDGEFRALRQFQFTQWPNHGCPKESESILDFIRQVHKTKEQFGHMEPMVIHCNTGSGRTGVFIALSIVLDRLQQESVVDMYQTVKLLHKQRIGLVQTEEQYEFCYMAVLDYLSNYE 5814
            K+ PD    DS    +   +   L+P    D +++R  + ++  +   P I I ++ +++  LKAND   L  E+E+++     +FTW+ SN+++NK KNRYANV+AYDH+ V+L P++ ++GSDYINANY+DGY+RQNAYIATQGPLP+T  DFWRMVWEQRS  +VMMTRLEE+S IKC QYWPNRG   YG + V+ +DT  LA + +R F +  +  SEKRE++HFQFTAWPDHGVP+  TP L F+RRV++    ++ P +VHCSAGVGRTG FIV+DA LERIK EK +DV+ +V+ +R QRNYMVQT+ QY FI E LLEAV  GNTEV A + + ++ KL+Q  +     ++G E+EF +L S  ++  R       F+ A+     N  KNR+ NI+PYE +RV L  IRG+EGSDYINAS+IDGYR ++AYIA Q P+  T EDFWR LW+ +  +V++L +  E   +K H YWP  +S RYQ+FVVDP+ EYNMP YILREFKVTDARDG+ R +RQFQFT WP  G PK  E  +DFI QVHKTKEQFG   P+ +HC+ G GRTGVFI LSIVL+R++ E VVD++QTVK+L  QR  +VQTE++Y+FC+ A L+YL +++
Sbjct:  876 KNKPDSKRKDSEPRTKCLLNNADLAPHHPKDPVEMRRINFQTPGMLSHPPIPITDMAEHMERLKANDSLKLSQEYESIDPG--QQFTWEHSNLEANKPKNRYANVIAYDHSRVILQPLEGIMGSDYINANYVDGYRRQNAYIATQGPLPETFGDFWRMVWEQRSATVVMMTRLEEKSRIKCDQYWPNRGTETYGFIQVTLLDTMELATFCVRTFSLHKNGSSEKREVRHFQFTAWPDHGVPEYPTPFLAFLRRVKTCNPPDAGPIVVHCSAGVGRTGCFIVIDAMLERIKTEKTVDVYGHVTLMRSQRNYMVQTEDQYGFIHEALLEAVGCGNTEVPARSLYTYIQKLAQ--VEPGEHVTGMELEFKRLASSKAHTSR-------FITAS--LPCNKFKNRLVNILPYESSRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRALWENNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPEQGAPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKVLRTQRPAMVQTEDEYQFCFQAALEYLGSFD 1497          

HSP 2 Score: 201.83 bits (512), Expect = 2.355e-51
Identity = 103/262 (39.31%), Postives = 149/262 (56.87%), Query Frame = 1
Query: 5092 NQAVNMTKNRVRNIIPYEWNRVVLNAIRGIEGSDYINASYIDGYRDRRAYIAAQSPIPSTVEDFWRMLWDQHCGVVIVLNQPHEDKSHI----YWPINKSIRYQFFVVDPVVEYNMPNYILREFKVTDARDGEFRALRQFQFTQWPNHGCPKESESILDFIRQVHKTKEQFGHMEPMVIHCNTGSGRTGVFIALSIVLDRLQQESVVDMYQTVKLLHKQRIGLVQTEEQYEFCYMAVLDYLSNYEKILEKSHLY*TYQDLSE 5865
            N   N  KNR  N+I Y+ +RV+L  + GI GSDYINA+Y+DGYR + AYIA Q P+P T  DFWRM+W+Q    V+++ +  E+KS I    YWP   +  Y F  V  +    +  + +R F +      E R +R FQFT WP+HG P+     L F+R+V           P+V+HC+ G GRTG FI +  +L+R++ E  VD+Y  V L+  QR  +VQTE+QY F + A+L+ +      +    LY   Q L++
Sbjct:  965 NLEANKPKNRYANVIAYDHSRVILQPLEGIMGSDYINANYVDGYRRQNAYIATQGPLPETFGDFWRMVWEQRSATVVMMTR-LEEKSRIKCDQYWPNRGTETYGFIQVTLLDTMELATFCVRTFSLHKNGSSEKREVRHFQFTAWPDHGVPEYPTPFLAFLRRVKTCNPP--DAGPIVVHCSAGVGRTGCFIVIDAMLERIKTEKTVDVYGHVTLMRSQRNYMVQTEDQYGFIHEALLEAVGCGNTEVPARSLYTYIQKLAQ 1223          

HSP 3 Score: 131.339 bits (329), Expect = 7.102e-30
Identity = 129/567 (22.75%), Postives = 240/567 (42.33%), Query Frame = 1
Query:  268 VLINSQITFTENDEAP----KISLIIQSPNVLLFKSMILACSSTGHPVPSISWKINESPIEELKSPLKKLQNPPRIFSIKNYQNSVLVITQLIESDSNSVLICEAENNAGFDSRQQQLKVISTETDIP--SGFPVFQNNFFPIIKPYNSNVTLVCQAYGNPPPLIQWFKNYELINESFTKIKILNDGNLLLVQVTREDKGIYHCQAQNTNGLRLSDPSTLDITSYPISPNSLIIERFASDNVEISWRSGLNDVTEQENFILHYREVPENITEKQIMSKFVYLTISEKKSIYKYNLKDLFPFTTYCIWMESENPLGVSPPTIALTVKTLPTSPQLSPRSITATSISNTAILVAWRPPERKFGKFKYYQIIYTNNDGFLPQHWRQFAVKDDNVMLT--HLIASELYHIRVKIVNEIGHGPLSKTISIKTIAGTLSQCPDFKITEIFQSHIKLQWGTPDPVKLFKLIQYNLLCWDV-RLKIVNATAKSSTLFPILNHNLSMNEMEYVLYLKNEKEIKCRLSAINSDGKGMPTEIQASTVNKGVNYQNLIHIDKIGSTYITFQWRPPSKFS 1941
            + I++++T    D+ P     I +  Q   V   ++  + C+++G+P P I+W  +  P++   S  +          IK  ++  L I    E+D      C A N+AG          +      P  S  P+        I P   NV + C A G+P P ++W +      E  T    +  G  +L     +D   Y C A ++ G+ +   + + + S P +P + ++    + ++ ++W SG  D      +++ Y+   ++   +          I E  +  +Y++  L P + Y IW+ + N +G  PP+ ++  +T   +P  +PR++ A  +S T ++V W  P    G  + Y++ YT        +W++  V DD+++ T   L+  E Y +RV     +G GPLS  I +KT  G   Q  + +     ++ I L W  P   +   +I+Y LL  +  R + V  T   +T F + +             LK   E   RL+A +  G G  T +      + ++ +N   +  I  T +   W  P  ++
Sbjct:  116 ITIHAKLTVLREDQLPPGFPNIDMGPQLKVVERTRTATMLCAASGNPDPEITWFKDFLPVDPSASNGR----------IKQLRSGALQIESSEETDQGKYE-CVATNSAGVRYSSPANLYVRVRRVAPRFSILPMSHE-----IMP-GGNVNITCVAVGSPMPYVKWMQG----AEDLTPEDDMPVGRNVLELTDVKDSANYTCVAMSSLGV-IEAVAQITVKSLPKAPGTPVVTENTATSITVTWDSGNPDPVSY--YVIEYKSKSQDGPYQ----------IKEDITTTRYSIGGLSPNSEYEIWVSAVNSIGQGPPSESVVTRTGEQAPASAPRNVQARMLSATTMIVQWEEPVEPNGLIRGYRVYYTMEPEHPVGNWQKHNV-DDSLLTTVGSLLEDETYTVRVLAFTSVGDGPLSDPIQVKTQQGVPGQPMNLRAEAKSETSIGLSWSAP---RQESVIKYELLFREGDRGREVGRTFDPTTAFVVED-------------LKPNTEYAFRLAARSPQGLGAFTAVVRQRTLQAISPKNF-KVKMIMKTSVLLSWEFPDNYN 630          

HSP 4 Score: 106.686 bits (265), Expect = 2.304e-22
Identity = 163/683 (23.87%), Postives = 268/683 (39.24%), Query Frame = 1
Query:  370 LACSSTGHPVPSISW-----KINESPIEELKSPLKKLQNPPRIFSIKNYQNSVLVITQLIESDSNSVLICEAENNAGFDSRQQQLKVISTETDIPSGFPVFQNNFFPIIKPYNSNVTLVCQAYGNPPPLIQWFKNYELINESFT--KIKILNDGNLLLVQVTREDKGIYHCQAQNTNGLRLSDPSTLDITSYPISPNSLII----ERFASDNVEIS------------WRSGLNDVTEQENFILHYREVPENITEKQIMSKFVYLTISEKKSIYKYNLKDLFPFTTYCIWMESENPLGVSPPTIALTVKTLPTSPQLSPRSITATSISNTAILVAWRPPERKFGKFKYYQIIYTNNDGFLPQHWRQFAVKDDNVMLTHLIAS----ELYHIRVKIVNEIGHGPLSKTISIKTIAGTLSQCP-DFKITEIFQSHIKLQWGTPDPVKLFKLIQYNLLCWDVRLKIVNATAKSSTLFPILN---HNLSMNEMEYVLYLKNEKEIKCRLSAINSDGKG-MPTEIQASTVNKGVNYQNL-IHIDKIGSTYITFQWRPPSKFSFDYFLWIYQIFDSEKLDRAVKLPKIKINISDSASAENGWFVYNYTNAFS-SSRYILGLRYLCRDSTDILREYVHRSDLVSTMKSVPSDSPKDLVVKEIDSNSALVSWKPLDQVHSNGIITHYEVRY 2316
              C +TG P P ++W     K+N    E +                     +VL I  L      +V  C A+N+ G  +   +L V+  E  +P GFP         +       T++C A GNP P I WFK++  ++ S +  +IK L  G L +      D+G Y C A N+ G+R S P+ L +    ++P   I+    E     NV I+            W  G  D+T +++       V  N+ E         LT          ++KD   +T  C+ M S   LGV      +TVK+LP +P     +   T  + T+I V W           YY I Y +     P     + +K+D     + I        Y I V  VN IG GP S+++  +T     +  P + +   +  + + +QW   +PV+   LI+   + + +  +            P+ N   HN+  + +  V  L  ++    R+ A  S G G +   IQ  T  +GV  Q + +  +    T I   W  P + S   +  +++  D  +       P     + D           N   AF  ++R   GL       T ++R+         T++++   SPK+  VK I   S L+SW+  D  +S    T Y+++Y
Sbjct:   52 FVCQATGDPKPRVTWNKKGKKVNSQRFETI--------------DFDESSGAVLRIQPLRTPRDENVYECVAQNSVGEITIHAKLTVLR-EDQLPPGFPNIDMGPQLKVVERTRTATMLCAASGNPDPEITWFKDFLPVDPSASNGRIKQLRSGALQIESSEETDQGKYECVATNSAGVRYSSPANLYVRVRRVAPRFSILPMSHEIMPGGNVNITCVAVGSPMPYVKWMQGAEDLTPEDDM-----PVGRNVLE---------LT----------DVKDSANYT--CVAMSS---LGVIEAVAQITVKSLPKAPG----TPVVTENTATSITVTWD--SGNPDPVSYYVIEYKSKSQDGP-----YQIKEDITTTRYSIGGLSPNSEYEIWVSAVNSIGQGPPSESVVTRTGEQAPASAPRNVQARMLSATTMIVQW--EEPVEPNGLIRGYRVYYTMEPE-----------HPVGNWQKHNVDDSLLTTVGSLLEDETYTVRVLAFTSVGDGPLSDPIQVKT-QQGVPGQPMNLRAEAKSETSIGLSWSAPRQESVIKYELLFREGDRGREVGRTFDPTTAFVVEDLKP--------NTEYAFRLAARSPQGLGAF----TAVVRQ--------RTLQAI---SPKNFKVKMIMKTSVLLSWEFPDNYNSP---TPYKIQY 639          

HSP 5 Score: 63.5438 bits (153), Expect = 3.203e-9
Identity = 66/265 (24.91%), Postives = 125/265 (47.17%), Query Frame = 1
Query: 2164 SDLVSTMKSVPSDSPKDLVVKEIDSNSALVSWKPLDQVHSNGIITHYEVRYYAPKKEESTERF----INVSETSAILSNLKYFHYVIYVRAFTKVGGGSWSNPKNYYRQNLEEFP-IPTTIKGERKSETEINISWELPVLSEKNLAHAAIEGFIILYAPVESSPKWIKYTVQSKNLSAVIKGLEPDLRYQFQIAATNYAGFNGNFSEIVQEM------PKNFPNLNLKTVPDLRCSVQSSNRLKVEWSSPSISTDLLKFEIRYSG 2925
            S +  T +  P+ +P+++  + + + + +V W+  + V  NG+I  Y V YY  + E     +    ++ S  + + S L+   Y + V AFT VG G  S+P     Q  +  P  P  ++ E KSET I +SW  P          ++  + +L+   +   + +  T      + V++ L+P+  Y F++AA +  G  G F+ +V++       PKNF    +K +  ++ SV  S      ++SP+       ++I+Y+G
Sbjct:  403 SVVTRTGEQAPASAPRNVQARMLSATTMIVQWE--EPVEPNGLIRGYRV-YYTMEPEHPVGNWQKHNVDDSLLTTVGSLLEDETYTVRVLAFTSVGDGPLSDPIQVKTQ--QGVPGQPMNLRAEAKSETSIGLSWSAP-------RQESVIKYELLFREGDRG-REVGRTFDPTT-AFVVEDLKPNTEYAFRLAARSPQGL-GAFTAVVRQRTLQAISPKNF---KVKMI--MKTSVLLSWEFPDNYNSPT------PYKIQYNG 641          
BLAST of Protein tyrosine phosphatase receptor type D vs. Ensembl Mouse
Match: Ptprf (protein tyrosine phosphatase, receptor type, F [Source:MGI Symbol;Acc:MGI:102695])

HSP 1 Score: 718.383 bits (1853), Expect = 0.000e+0
Identity = 335/606 (55.28%), Postives = 434/606 (71.62%), Query Frame = 1
Query: 4006 SDSIKLRIGSQKSENISDRPSISICNLYQYVTDLKANDCTLLQAEFETLNTNLDDRFTWQRSNIDSNKSKNRYANVVAYDHTSVLLTPVDDVIGSDYINANYIDGYQRQNAYIATQGPLPDTTDDFWRMVWEQRSNCIVMMTRLEERSGIKCHQYWPNRGFICYGQMIVSHIDTFVLAYYTIRLFEIRHSKYSEKREIQHFQFTAWPDHGVPKLSTPLLMFIRRVRSIGKIESCPKIVHCSAGVGRTGAFIVVDAQLERIKQEKNIDVFNYVSKIRCQRNYMVQTQAQYQFILETLLEAVEDGNTEVMACNFHAHVTKLSQIGISGSNQLSGFEMEFSKLNSLASNRGRHGVMLADFVKAAGNQAVNMTKNRVRNIIPYEWNRVVLNAIRGIEGSDYINASYIDGYRDRRAYIAAQSPIPSTVEDFWRMLWDQHCGVVIVLNQPHE---DKSHIYWPINKSIRYQFFVVDPVVEYNMPNYILREFKVTDARDGEFRALRQFQFTQWPNHGCPKESESILDFIRQVHKTKEQFGHMEPMVIHCNTGSGRTGVFIALSIVLDRLQQESVVDMYQTVKLLHKQRIGLVQTEEQYEFCYMAVLDYLSNYE 5814
            SD +++R  + ++  + D P I I +L   +  LKAND      E+E+++     +FTW+ SN + NK KNRYANV+AYDH+ VLLT +D V GSDYINANYIDGY++QNAYIATQGPLP+T  DFWRMVWEQR+  +VMMTRLEE+S +KC QYWP RG   YG + V+ +DT  LA YT+R F +  S  SEKRE++ FQF AWPDHGVP+  TP+L F+RRV++   +++ P +VHCSAGVGRTG FIV+DA LER+K EK +D++ +V+ +R QRNYMVQT+ QY FI E LLEA   G+TEV+A N +AH+ KL Q+    S  ++  E+EF  L +  ++  R       FV A  N   N  KNR+ NI+PYE  RV L  IRG+EGSDYINAS++DGYR ++AYIA Q P+  + EDFWRMLW+ +  ++++L +  E   +K H YWP  +S RYQ+FVVDP+ EYNMP YILREFKVTDARDG+ R +RQFQFT WP  G PK  E  +DFI QVHKTKEQFG   P+ +HC+ G GRTGVFI LSIVL+R++ E VVDM+QTVK L  QR  +VQTE+QY+ CY A L+YL +++
Sbjct: 1302 SDPVEMRRLNYQTPGMRDHPPIPITDLADNIERLKANDGLKFSQEYESIDPG--QQFTWENSNSEVNKPKNRYANVIAYDHSRVLLTSIDGVPGSDYINANYIDGYRKQNAYIATQGPLPETMGDFWRMVWEQRTATVVMMTRLEEKSRVKCDQYWPVRGTETYGLIQVTLVDTVELATYTMRTFALHKSGSSEKRELRQFQFMAWPDHGVPEYPTPILAFLRRVKACNPLDAGPMVVHCSAGVGRTGCFIVIDAMLERMKHEKTVDIYGHVTCMRSQRNYMVQTEDQYVFIHEALLEAAMCGHTEVLARNLYAHIQKLGQVPPGES--VTAMELEFKLLANSKAHTSR-------FVSA--NLPCNKFKNRLVNIMPYELTRVCLQPIRGVEGSDYINASFLDGYRQQKAYIATQGPLAESTEDFWRMLWEHNSTIIVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTIRQFQFTDWPEQGVPKTGEGFIDFIGQVHKTKEQFGQDGPITVHCSAGVGRTGVFITLSIVLERMRYEGVVDMFQTVKTLRTQRPAMVQTEDQYQLCYRAALEYLGSFD 1894          

HSP 2 Score: 161.384 bits (407), Expect = 7.019e-39
Identity = 226/964 (23.44%), Postives = 386/964 (40.04%), Query Frame = 1
Query:  277 NSQITFTENDEAPK----ISLIIQSPNVLLFKSMILACSSTGHPVPSISWKINESPIEELKSPLKKLQNPPRIFSIKNYQNSVLVITQLIESDSNSVLICEAENNAGFD-SRQQQLKVISTETDIPSGFPVFQNNFFPIIKPYNSNVTLVCQAYGNPPPLIQWFKNYELINESFTKIKILNDGN--LLLVQVTREDKGIYHCQAQNTNGLRLSDPSTLDITSYPISPNSLIIERFASDNVEISWRSGLNDVTEQENFI-LHYREVPENITEKQIMSKFVYLTISEKKSIYKYNLKDLFPFTTYCIWMESENPLGVSPPTIALTVKTLPTSPQLSPRSITATSISNTAILVAWRPPERKFGKFKYYQIIYTNNDGFLPQHWRQFAVKDDNVMLT---HLIASELYHIRVKIVNEIGHGPLSKTISIKTIAGTLSQCPDFKITEIFQSHIKLQWGTPDPVKLFKLIQYNLLCWDVRLKIVNATAKSSTLFPILNHNLSMNEMEYVLYLKNEKEIKCRLSAINSDGKGM--PT-EIQASTVNKGVNYQNLIHIDKIGSTYITFQWRPPSKFSFDYFLWIYQIFDSEKLDRAVKLPKIKINISDSASAENGWFVYNYTNAFSSSRYILGL------RYLCRDSTDILREYVHRSDLVSTMKSVPSDSPKDLVVKEIDSNSALVSWKPLDQVHSNGIITHYEVRYY-----APKKEESTERFINVSETSAILSNL-KYFHYVIYVRAFTKVGGGSWSNPKNYYRQNLEEFPIPTTIKGERKSETEINISWELPVLSEKNLAHAAIEGFIILYAPV-ESSPKWIKYTVQSKNLSAVIKGLEPDLRYQFQIAATNYAGFNGNFSEIV---QEMPKNFPNLNLKTVPDLRCSVQSSNRLKVEWSSPSISTDLLKFEIRYSGNLSYITEIGLKKSEFIDMESKSVNFETLVNRYDVTLENLQSNALYKIAVRA 3078
            +++++  E D+ P     I +  Q   V   ++  + C++ G+P P ISW  +  P++   S  +          IK  ++  L I    ESD      C A N+AG   S    L V           P       P       +V L C A G P P ++W     +  E  TK   +  G   L L  V R     Y C A ++ G+ +   + + + + P  P  L++    + +V ++W SG    TE  +F  + YR    +   +++          +  +  +Y++  L PF+ Y   + + N +G  PP+ A+  +T   +P   PR + A  +S + +LV W PPE   G  + Y++ YT +       W +     D  +LT    L+    Y +RV     +G GP S TI +KT  G  +Q  DF+      + I+L W  P      ++++Y L+ W    +         T  P  ++ L          LK +     +L+A +  G G+  PT E + +        Q +  +   GST +   W PP   S +  +  Y +        AV     K ++ D  S E+            SS  +LGL      R   R  TD+         LV T + VPS  P+ + V+ ++S +  VSWK       +G I  Y+V Y       P+ +   +  +        +S L     Y I V A+T  G G+ S PK            PT +       T + + W  P    K L    + G+ + Y    E+ P  I +    ++ +  + GL     Y F++AA N AG    F + +   +++P  FP        +LR +  +++  ++ W  P ++          +G+++  T +      + D+ S+ +  + + N   +TL  L+ +  Y I VRA
Sbjct:  119 SAKLSVLEEDQLPSGFPTIDMGPQLKVVEKGRTATMLCAAGGNPDPEISWFKDFLPVDPAASNGR----------IKQLRSGALQIESSEESDQGK-YECVATNSAGTRYSAPANLYVRVRRVAPRFSIPPSSQEVMP-----GGSVNLTCVAVGAPMPYVKWM----MGAEELTKEDEMPVGRNVLELSNVMRSAN--YTCVAISSLGM-IEATAQVTVKALPKPPIDLVVTETTATSVTLTWDSG---NTEPVSFYGIQYRAAGTDGPFQEV----------DGVASTRYSIGGLSPFSEYAFRVLAVNSIGRGPPSEAVRARTGEQAPSSPPRRVQARMLSASTMLVQWEPPEEPNGLVRGYRVYYTPDSRRPLSAWHKH--NTDAGLLTTVGSLLPGITYSLRVLAFTAVGDGPPSPTIQVKTQQGVPAQPADFQANAESDTRIQLSWLLP---PQERIVKYELVYWAAEDE---GQQHKVTFDPTSSYTLE--------DLKPDTLYHFQLAARSDLGVGVFTPTVEARTAQSTPSAPPQKVTCV-STGSTTVRVSWVPPPADSRNGIITQYSV-----AYEAVDGEDRKRHVVDGISREH------------SSWDLLGLEKWTEYRVWVRAHTDVGPGPESSPVLVRTDEDVPSGPPRKVEVEPLNSTAVHVSWKLPVPNKQHGQIRGYQVTYVRLENGEPRGQPIIQDVMLAEAQETTISGLTPETTYSITVAAYTTKGDGARSKPKVVTTTGAVPG-RPTMMVSTTAMHTAL-LQWHPP----KELP-GELLGYRLQYRRADEARPNTIDFGKDDQHFT--VTGLHKGATYVFRLAAKNRAGPGEEFEKEITTPEDVPSGFPQ-------NLRVTGLTTSTTELTWDPPVLA--------ERNGHITNYTVV------YRDINSQ-LELQNVTNDTHLTLLGLKPDTTYDIKVRA 981          

HSP 3 Score: 157.147 bits (396), Expect = 1.207e-37
Identity = 243/1122 (21.66%), Postives = 413/1122 (36.81%), Query Frame = 1
Query:  235 NR*MFWIITQLVLINSQITFTENDEAPKISLIIQSPNVLLFKSMILACSSTGHPVPSISWKINESPIEELKSPLKKLQNPPRIFSIKNYQNSVLVITQLIESDSNSVLICEAENNAGFDSRQQQLKVISTETDIPSGFPVFQNNFFPIIKPYNSNVTLVCQAYGNPPPLIQWFKNYELINESFT--KIKILNDGNLLLVQVTREDKGIYHCQAQNTNGLRLSDPSTLDI------TSYPISPNSLIIERFASDNVE----------ISWRSGLNDVTEQENFILHYREVPENITE-KQIMSKFVYLTISEKKSIYKYNLKDLFPFTTYCIWMESENPLGVSPPTIALTVKTLPTSPQLSPRSITATSISNTAILVAWRPPERKFGKFKYYQIIYTNNDGFLPQHWRQFAVKDDNVMLTHLIASELYHIRVKIVNEIGHGPLSKTISIKTIAGTLSQCP-DFKITEIFQSHIKLQWGTPDPVKLFKLIQYNLLCWDVRLKIVNATAKSSTLFPILNHNLSMNEMEYVLYLKNEKEIKCRLSAINSDGKGMPTEIQASTVNKGVNYQNL-IHIDKIGSTYITFQW-RPPSKFSFDYFLWIYQIFDSEKLDRAVKLPKIKINISDSASAENGWFVYNYTNAFSSSRYILGLRYLCRDSTDILREYVHRSDLVSTMKSVPSDSPKDLVVKEIDSNSALVSWKPLDQVHSNGIITHYEVRYYAPKKEESTERFIN--VSETSA--ILSNLKYFHYVIYVRAFTKVGGGSWSNPKNYYRQNLEEFP--IPTTIKGERKSETEINISWELPVLSEKNLAHAAIEGFIILYAPVESSPKWIKYTVQSKNLS----AVIKGLEPDLRYQFQIAATNYAGFNGNFSEIVQEMPKNFPNLNLKTVPDLRCSVQSSNRLKVEWSSP-SISTDLLKFEIRYSGNLSYITEIGLKKSEFIDMESKSVNFETLVNRYDVTLENLQSNALYKIAVRAIYQNKELYESHRETTCDTMPAVPNLVKPPIIVGLDEEKSKVIIKLHRCSQRNGKISYYFVIVAAFQGNKNQQISFQEDTES--YTFMELSVNT------RSNNAKG----------EYIAIMKDINDIFKVSGKDHSSVLL 3447
             R M  ++  LV++   +     D  P    + +    L        C +TG P P I+W         +K   K       +    +   SVL I  L      ++  C A N+ G  +   +L V+  E  +PSGFP         +       T++C A GNP P I WFK++  ++ + +  +IK L  G L +      D+G Y C A N+ G R S P+ L +        + I P+S  +    S N+           + W  G  ++T+++        V  N+ E   +M    Y                       C+ + S   LG+   T  +TVK LP  P      +  T  + T++ + W     +   F   Q      DG   +      V      +  L     Y  RV  VN IG GP S+ +  +T     S  P   +   +  S + +QW  P+        + N L    R+     + +  + +    HN     +  V  L        R+ A  + G G P+        +GV  Q      +    T I   W  PP +    Y L  +   D  +  +    P     + D         +Y++  A   +R  LG+         +    V       T +S PS  P+ +      S +  VSW P      NGIIT Y V Y A   E+     ++    E S+  +L   K+  Y ++VRA T VG G  S+P     +  E+ P   P  ++ E  + T +++SW+LPV    N  H  I G+ + Y  +E+     +  +Q   L+      I GL P+  Y   +AA    G        V       P       P +  S  + +   ++W  P  +  +LL + ++Y            ++++  +    +++F      + VT  +  +  ++++A +      E +E    T  D     P  ++   + GL    +++       ++RNG I+ Y V+      + N Q+  Q  T     T + L  +T      R++ +KG            + + +     F+V+    +SVLL
Sbjct:    8 GRRMVPLVPALVMLG-LMAGAHGDSKPVFVKVPEDQTGLSGGVASFVCQATGEPKPRITW---------MKKGKKVSSQRFEVIEFDDGAGSVLRIQPLRVQRDEAIYECTATNSLGEINTSAKLSVLE-EDQLPSGFPTIDMGPQLKVVEKGRTATMLCAAGGNPDPEISWFKDFLPVDPAASNGRIKQLRSGALQIESSEESDQGKYECVATNSAGTRYSAPANLYVRVRRVAPRFSIPPSSQEVMPGGSVNLTCVAVGAPMPYVKWMMGAEELTKEDEM-----PVGRNVLELSNVMRSANYT----------------------CVAISS---LGMIEATAQVTVKALPKPPI----DLVVTETTATSVTLTWDSGNTEPVSFYGIQYRAAGTDGPFQE---VDGVASTRYSIGGLSPFSEYAFRVLAVNSIGRGPPSEAVRARTGEQAPSSPPRRVQARMLSASTMLVQWEPPE--------EPNGLVRGYRVYYTPDSRRPLSAW--HKHNTDAGLLTTVGSLLPGITYSLRVLAFTAVGDGPPSPTIQVKTQQGVPAQPADFQANAESDTRIQLSWLLPPQERIVKYELVYWAAEDEGQQHKVTFDPTSSYTLEDLKPDT----LYHFQLA---ARSDLGV--------GVFTPTVE----ARTAQSTPSAPPQKVTCVSTGSTTVRVSWVPPPADSRNGIITQYSVAYEAVDGEDRKRHVVDGISREHSSWDLLGLEKWTEYRVWVRAHTDVGPGPESSP--VLVRTDEDVPSGPPRKVEVEPLNSTAVHVSWKLPV---PNKQHGQIRGYQVTYVRLENGEPRGQPIIQDVMLAEAQETTISGLTPETTYSITVAAYTTKGDGARSKPKVVTTTGAVPGR-----PTMMVSTTAMHTALLQWHPPKELPGELLGYRLQY------------RRAD--EARPNTIDFGKDDQHFTVTGLHKGATYVFRLAAKNRAGPGEEFEKEITTPEDVPSGFPQNLR---VTGLTTSTTELTWDPPVLAERNGHITNYTVVYR----DINSQLELQNVTNDTHLTLLGLKPDTTYDIKVRAHTSKGAGPLSPSIQSRTMPVEQVFAKNFRVAAAMKTSVLL 1021          

HSP 4 Score: 54.6842 bits (130), Expect = 1.734e-6
Identity = 62/295 (21.02%), Postives = 121/295 (41.02%), Query Frame = 1
Query: 1096 TISEKKSIYKYNLKDLFPFTTYCIWMESENPLGVSPPTIALTVKTLPTSPQLSPRSITATSISNTAILVAWRPP--ERKFGKFKYYQIIYTNNDGFLPQHWRQFAVKDDNVMLTHLIASELYHIRVKIVNEIGHGPLSKTISIKTIAGTLSQCPDFKITEIFQSHIKLQWGTPDPVK---LFKLIQYNLLCWDV-----RLKIVNATAKSSTLFPILNHNLSMNEMEYVLYLKNEKEI----KCRLSAINSDGK---GMPTEIQASTVNKGVNYQNLIHIDKIGSTYITFQWRPP 1929
            TI   K    + +  L    TY   + ++N  G         + T    P   P+++  T ++ +   + W PP    + G    Y ++Y + +    Q   Q    D ++ L  L     Y I+V+     G GPLS +I  +T+        +F++    ++ + L W  PD  K    FK++ YN    +V     R  I +    +   F ++N   S   +++++ ++   ++        SA   DG+    MP ++Q  ++ +   Y  ++ ID++G   +  +W  P
Sbjct:  858 TIDFGKDDQHFTVTGLHKGATYVFRLAAKNRAGPGE-EFEKEITTPEDVPSGFPQNLRVTGLTTSTTELTWDPPVLAERNGHITNYTVVYRDINS---QLELQNVTNDTHLTLLGLKPDTTYDIKVRAHTSKGAGPLSPSIQSRTMPVEQVFAKNFRVAAAMKTSVLLSWEVPDSYKSAVPFKIL-YNGQSVEVDGHSMRKLIADLQPNTEYSFVLMNRGSSAGGLQHLVSIRTAPDLLPQKPLPASAFIEDGRFSLSMP-QVQDPSLVRWF-YIVVVPIDRVGGNLLAPRWNTP 1145          
BLAST of Protein tyrosine phosphatase receptor type D vs. Ensembl Mouse
Match: Ptprs (protein tyrosine phosphatase, receptor type, S [Source:MGI Symbol;Acc:MGI:97815])

HSP 1 Score: 717.998 bits (1852), Expect = 0.000e+0
Identity = 334/612 (54.58%), Postives = 444/612 (72.55%), Query Frame = 1
Query: 3988 LSPVLVSDSIKLRIGSQKSENISDRPSISICNLYQYVTDLKANDCTLLQAEFETLNTNLDDRFTWQRSNIDSNKSKNRYANVVAYDHTSVLLTPVDDVIGSDYINANYIDGYQRQNAYIATQGPLPDTTDDFWRMVWEQRSNCIVMMTRLEERSGIKCHQYWPNRGFICYGQMIVSHIDTFVLAYYTIRLFEIRHSKYSEKREIQHFQFTAWPDHGVPKLSTPLLMFIRRVRSIGKIESCPKIVHCSAGVGRTGAFIVVDAQLERIKQEKNIDVFNYVSKIRCQRNYMVQTQAQYQFILETLLEAVEDGNTEVMACNFHAHVTKLSQIGISGSNQLSGFEMEFSKLNSLASNRGRHGVMLADFVKAAGNQAVNMTKNRVRNIIPYEWNRVVLNAIRGIEGSDYINASYIDGYRDRRAYIAAQSPIPSTVEDFWRMLWDQHCGVVIVLNQPHE---DKSHIYWPINKSIRYQFFVVDPVVEYNMPNYILREFKVTDARDGEFRALRQFQFTQWPNHGCPKESESILDFIRQVHKTKEQFGHMEPMVIHCNTGSGRTGVFIALSIVLDRLQQESVVDMYQTVKLLHKQRIGLVQTEEQYEFCYMAVLDYLSNYE 5814
            L+P    D +++R  + ++  +   P I I ++ +++  LKAND   L  E+E+++     +FTW+ SN+++NK KNRYANV+AYDH+ V+L P++ ++GSDYINANY+DGY+RQNAYIATQGPLP+T  DFWRMVWEQRS  +VMMTRLEE+S IKC QYWPNRG   YG + V+ +DT  LA + +R F +  +  SEKRE++HFQFTAWPDHGVP+  TP L F+RRV++    ++ P +VHCSAGVGRTG FIV+DA LERIK EK +DV+ +V+ +R QRNYMVQT+ QY FI E LLEAV  GNTEV A + + ++ KL+Q  +     ++G E+EF +L S  ++  R       F+ A+     N  KNR+ NI+PYE +RV L  IRG+EGSDYINAS+IDGYR ++AYIA Q P+  T EDFWR LW+ +  +V++L +  E   +K H YWP  +S RYQ+FVVDP+ EYNMP YILREFKVTDARDG+ R +RQFQFT WP  G PK  E  +DFI QVHKTKEQFG   P+ +HC+ G GRTGVFI LSIVL+R++ E VVD++QTVK+L  QR  +VQTE++Y+FC+ A L+YL +++
Sbjct:  895 LAPHHPKDPVEMRRINFQTPGMLSHPPIPITDMAEHMERLKANDSLKLSQEYESIDPG--QQFTWEHSNLEANKPKNRYANVIAYDHSRVILQPLEGIMGSDYINANYVDGYRRQNAYIATQGPLPETFGDFWRMVWEQRSATVVMMTRLEEKSRIKCDQYWPNRGTETYGFIQVTLLDTMELATFCVRTFSLHKNGSSEKREVRHFQFTAWPDHGVPEYPTPFLAFLRRVKTCNPPDAGPIVVHCSAGVGRTGCFIVIDAMLERIKTEKTVDVYGHVTLMRSQRNYMVQTEDQYGFIHEALLEAVGCGNTEVPARSLYTYIQKLAQ--VEPGEHVTGMELEFKRLASSKAHTSR-------FITAS--LPCNKFKNRLVNILPYESSRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRALWENNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPEQGAPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKVLRTQRPAMVQTEDEYQFCFQAALEYLGSFD 1493          

HSP 2 Score: 201.445 bits (511), Expect = 2.619e-51
Identity = 103/262 (39.31%), Postives = 149/262 (56.87%), Query Frame = 1
Query: 5092 NQAVNMTKNRVRNIIPYEWNRVVLNAIRGIEGSDYINASYIDGYRDRRAYIAAQSPIPSTVEDFWRMLWDQHCGVVIVLNQPHEDKSHI----YWPINKSIRYQFFVVDPVVEYNMPNYILREFKVTDARDGEFRALRQFQFTQWPNHGCPKESESILDFIRQVHKTKEQFGHMEPMVIHCNTGSGRTGVFIALSIVLDRLQQESVVDMYQTVKLLHKQRIGLVQTEEQYEFCYMAVLDYLSNYEKILEKSHLY*TYQDLSE 5865
            N   N  KNR  N+I Y+ +RV+L  + GI GSDYINA+Y+DGYR + AYIA Q P+P T  DFWRM+W+Q    V+++ +  E+KS I    YWP   +  Y F  V  +    +  + +R F +      E R +R FQFT WP+HG P+     L F+R+V           P+V+HC+ G GRTG FI +  +L+R++ E  VD+Y  V L+  QR  +VQTE+QY F + A+L+ +      +    LY   Q L++
Sbjct:  961 NLEANKPKNRYANVIAYDHSRVILQPLEGIMGSDYINANYVDGYRRQNAYIATQGPLPETFGDFWRMVWEQRSATVVMMTR-LEEKSRIKCDQYWPNRGTETYGFIQVTLLDTMELATFCVRTFSLHKNGSSEKREVRHFQFTAWPDHGVPEYPTPFLAFLRRVKTCNPP--DAGPIVVHCSAGVGRTGCFIVIDAMLERIKTEKTVDVYGHVTLMRSQRNYMVQTEDQYGFIHEALLEAVGCGNTEVPARSLYTYIQKLAQ 1219          

HSP 3 Score: 131.724 bits (330), Expect = 6.740e-30
Identity = 129/567 (22.75%), Postives = 240/567 (42.33%), Query Frame = 1
Query:  268 VLINSQITFTENDEAP----KISLIIQSPNVLLFKSMILACSSTGHPVPSISWKINESPIEELKSPLKKLQNPPRIFSIKNYQNSVLVITQLIESDSNSVLICEAENNAGFDSRQQQLKVISTETDIP--SGFPVFQNNFFPIIKPYNSNVTLVCQAYGNPPPLIQWFKNYELINESFTKIKILNDGNLLLVQVTREDKGIYHCQAQNTNGLRLSDPSTLDITSYPISPNSLIIERFASDNVEISWRSGLNDVTEQENFILHYREVPENITEKQIMSKFVYLTISEKKSIYKYNLKDLFPFTTYCIWMESENPLGVSPPTIALTVKTLPTSPQLSPRSITATSISNTAILVAWRPPERKFGKFKYYQIIYTNNDGFLPQHWRQFAVKDDNVMLT--HLIASELYHIRVKIVNEIGHGPLSKTISIKTIAGTLSQCPDFKITEIFQSHIKLQWGTPDPVKLFKLIQYNLLCWDV-RLKIVNATAKSSTLFPILNHNLSMNEMEYVLYLKNEKEIKCRLSAINSDGKGMPTEIQASTVNKGVNYQNLIHIDKIGSTYITFQWRPPSKFS 1941
            + I++++T    D+ P     I +  Q   V   ++  + C+++G+P P I+W  +  P++   S  +          IK  ++  L I    E+D      C A N+AG          +      P  S  P+        I P   NV + C A G+P P ++W +      E  T    +  G  +L     +D   Y C A ++ G+ +   + + + S P +P + ++    + ++ ++W SG  D      +++ Y+   ++   +          I E  +  +Y++  L P + Y IW+ + N +G  PP+ ++  +T   +P  +PR++ A  +S T ++V W  P    G  + Y++ YT        +W++  V DD+++ T   L+  E Y +RV     +G GPLS  I +KT  G   Q  + +     ++ I L W  P   +   +I+Y LL  +  R + V  T   +T F + +             LK   E   RL+A +  G G  T +      + ++ +N   +  I  T +   W  P  ++
Sbjct:  116 ITIHAKLTVLREDQLPPGFPNIDMGPQLKVVERTRTATMLCAASGNPDPEITWFKDFLPVDPSASNGR----------IKQLRSGALQIESSEETDQGKYE-CVATNSAGVRYSSPANLYVRVRRVAPRFSILPMSHE-----IMP-GGNVNITCVAVGSPMPYVKWMQG----AEDLTPEDDMPVGRNVLELTDVKDSANYTCVAMSSLGV-IEAVAQITVKSLPKAPGTPVVTENTATSITVTWDSGNPDPVSY--YVIEYKSKSQDGPYQ----------IKEDITTTRYSIGGLSPNSEYEIWVSAVNSIGQGPPSESVVTRTGEQAPASAPRNVQARMLSATTMIVQWEEPVEPNGLIRGYRVYYTMEPEHPVGNWQKHNV-DDSLLTTVGSLLEDETYTVRVLAFTSVGDGPLSDPIQVKTQQGVPGQPMNLRAEAKSETSIGLSWSAP---RQESVIKYELLFREGDRGREVGRTFDPTTAFVVED-------------LKPNTEYAFRLAARSPQGLGAFTAVVRQRTLQAISPKNF-KVKMIMKTSVLLSWEFPDNYN 630          

HSP 4 Score: 107.071 bits (266), Expect = 2.079e-22
Identity = 163/683 (23.87%), Postives = 268/683 (39.24%), Query Frame = 1
Query:  370 LACSSTGHPVPSISW-----KINESPIEELKSPLKKLQNPPRIFSIKNYQNSVLVITQLIESDSNSVLICEAENNAGFDSRQQQLKVISTETDIPSGFPVFQNNFFPIIKPYNSNVTLVCQAYGNPPPLIQWFKNYELINESFT--KIKILNDGNLLLVQVTREDKGIYHCQAQNTNGLRLSDPSTLDITSYPISPNSLII----ERFASDNVEIS------------WRSGLNDVTEQENFILHYREVPENITEKQIMSKFVYLTISEKKSIYKYNLKDLFPFTTYCIWMESENPLGVSPPTIALTVKTLPTSPQLSPRSITATSISNTAILVAWRPPERKFGKFKYYQIIYTNNDGFLPQHWRQFAVKDDNVMLTHLIAS----ELYHIRVKIVNEIGHGPLSKTISIKTIAGTLSQCP-DFKITEIFQSHIKLQWGTPDPVKLFKLIQYNLLCWDVRLKIVNATAKSSTLFPILN---HNLSMNEMEYVLYLKNEKEIKCRLSAINSDGKG-MPTEIQASTVNKGVNYQNL-IHIDKIGSTYITFQWRPPSKFSFDYFLWIYQIFDSEKLDRAVKLPKIKINISDSASAENGWFVYNYTNAFS-SSRYILGLRYLCRDSTDILREYVHRSDLVSTMKSVPSDSPKDLVVKEIDSNSALVSWKPLDQVHSNGIITHYEVRY 2316
              C +TG P P ++W     K+N    E +                     +VL I  L      +V  C A+N+ G  +   +L V+  E  +P GFP         +       T++C A GNP P I WFK++  ++ S +  +IK L  G L +      D+G Y C A N+ G+R S P+ L +    ++P   I+    E     NV I+            W  G  D+T +++       V  N+ E         LT          ++KD   +T  C+ M S   LGV      +TVK+LP +P     +   T  + T+I V W           YY I Y +     P     + +K+D     + I        Y I V  VN IG GP S+++  +T     +  P + +   +  + + +QW   +PV+   LI+   + + +  +            P+ N   HN+  + +  V  L  ++    R+ A  S G G +   IQ  T  +GV  Q + +  +    T I   W  P + S   +  +++  D  +       P     + D           N   AF  ++R   GL       T ++R+         T++++   SPK+  VK I   S L+SW+  D  +S    T Y+++Y
Sbjct:   52 FVCQATGDPKPRVTWNKKGKKVNSQRFETI--------------DFDESSGAVLRIQPLRTPRDENVYECVAQNSVGEITIHAKLTVLR-EDQLPPGFPNIDMGPQLKVVERTRTATMLCAASGNPDPEITWFKDFLPVDPSASNGRIKQLRSGALQIESSEETDQGKYECVATNSAGVRYSSPANLYVRVRRVAPRFSILPMSHEIMPGGNVNITCVAVGSPMPYVKWMQGAEDLTPEDDM-----PVGRNVLE---------LT----------DVKDSANYT--CVAMSS---LGVIEAVAQITVKSLPKAPG----TPVVTENTATSITVTWD--SGNPDPVSYYVIEYKSKSQDGP-----YQIKEDITTTRYSIGGLSPNSEYEIWVSAVNSIGQGPPSESVVTRTGEQAPASAPRNVQARMLSATTMIVQW--EEPVEPNGLIRGYRVYYTMEPE-----------HPVGNWQKHNVDDSLLTTVGSLLEDETYTVRVLAFTSVGDGPLSDPIQVKT-QQGVPGQPMNLRAEAKSETSIGLSWSAPRQESVIKYELLFREGDRGREVGRTFDPTTAFVVEDLKP--------NTEYAFRLAARSPQGLGAF----TAVVRQ--------RTLQAI---SPKNFKVKMIMKTSVLLSWEFPDNYNSP---TPYKIQY 639          

HSP 5 Score: 63.5438 bits (153), Expect = 3.095e-9
Identity = 66/265 (24.91%), Postives = 125/265 (47.17%), Query Frame = 1
Query: 2164 SDLVSTMKSVPSDSPKDLVVKEIDSNSALVSWKPLDQVHSNGIITHYEVRYYAPKKEESTERF----INVSETSAILSNLKYFHYVIYVRAFTKVGGGSWSNPKNYYRQNLEEFP-IPTTIKGERKSETEINISWELPVLSEKNLAHAAIEGFIILYAPVESSPKWIKYTVQSKNLSAVIKGLEPDLRYQFQIAATNYAGFNGNFSEIVQEM------PKNFPNLNLKTVPDLRCSVQSSNRLKVEWSSPSISTDLLKFEIRYSG 2925
            S +  T +  P+ +P+++  + + + + +V W+  + V  NG+I  Y V YY  + E     +    ++ S  + + S L+   Y + V AFT VG G  S+P     Q  +  P  P  ++ E KSET I +SW  P          ++  + +L+   +   + +  T      + V++ L+P+  Y F++AA +  G  G F+ +V++       PKNF    +K +  ++ SV  S      ++SP+       ++I+Y+G
Sbjct:  403 SVVTRTGEQAPASAPRNVQARMLSATTMIVQWE--EPVEPNGLIRGYRV-YYTMEPEHPVGNWQKHNVDDSLLTTVGSLLEDETYTVRVLAFTSVGDGPLSDPIQVKTQ--QGVPGQPMNLRAEAKSETSIGLSWSAP-------RQESVIKYELLFREGDRG-REVGRTFDPTT-AFVVEDLKPNTEYAFRLAARSPQGL-GAFTAVVRQRTLQAISPKNF---KVKMI--MKTSVLLSWEFPDNYNSPT------PYKIQYNG 641          
BLAST of Protein tyrosine phosphatase receptor type D vs. Ensembl Mouse
Match: Ptprd (protein tyrosine phosphatase, receptor type, D [Source:MGI Symbol;Acc:MGI:97812])

HSP 1 Score: 713.375 bits (1840), Expect = 0.000e+0
Identity = 333/606 (54.95%), Postives = 440/606 (72.61%), Query Frame = 1
Query: 4006 SDSIKLRIGSQKSENISDRPSISICNLYQYVTDLKANDCTLLQAEFETLNTNLDDRFTWQRSNIDSNKSKNRYANVVAYDHTSVLLTPVDDVIGSDYINANYIDGYQRQNAYIATQGPLPDTTDDFWRMVWEQRSNCIVMMTRLEERSGIKCHQYWPNRGFICYGQMIVSHIDTFVLAYYTIRLFEIRHSKYSEKREIQHFQFTAWPDHGVPKLSTPLLMFIRRVRSIGKIESCPKIVHCSAGVGRTGAFIVVDAQLERIKQEKNIDVFNYVSKIRCQRNYMVQTQAQYQFILETLLEAVEDGNTEVMACNFHAHVTKLSQIGISGSNQLSGFEMEFSKLNSLASNRGRHGVMLADFVKAAGNQAVNMTKNRVRNIIPYEWNRVVLNAIRGIEGSDYINASYIDGYRDRRAYIAAQSPIPSTVEDFWRMLWDQHCGVVIVLNQPHE---DKSHIYWPINKSIRYQFFVVDPVVEYNMPNYILREFKVTDARDGEFRALRQFQFTQWPNHGCPKESESILDFIRQVHKTKEQFGHMEPMVIHCNTGSGRTGVFIALSIVLDRLQQESVVDMYQTVKLLHKQRIGLVQTEEQYEFCYMAVLDYLSNYE 5814
            +D ++LR  + ++  ++  P I I  L  ++  LKAND      E+E+++     +FTW+ SN++ NK KNRYANV+AYDH+ VLL+ ++ + GSDY+NANYIDGY++QNAYIATQG LP+T  DFWRM+WEQRS  +VMMT+LEERS +KC QYWP+RG   +G + V+ +DT  LA Y +R F +  +  SEKRE++ FQFTAWPDHGVP+  TP L F+RRV++    ++ P +VHCSAGVGRTG FIV+DA LERIK EK +D++ +V+ +R QRNYMVQT+ QY FI + LLEAV  GNTEV A N +A++ KL+QI  +G N ++G E+EF +L S  ++  R       F+ A  N   N  KNR+ NI+PYE  RV L  IRG+EGSDYINAS++DGYR ++AYIA Q P+  T EDFWRMLW+ +  +V++L +  E   +K H YWP  +S RYQ+FVVDP+ EYNMP YILREFKVTDARDG+ R +RQFQFT WP  G PK  E  +DFI QVHKTKEQFG   P+ +HC+ G GRTGVFI LSIVL+R++ E VVD++QTVK+L  QR  +VQTE+QY+FCY A L+YL +++
Sbjct: 1316 TDPVELRRLNFQTPGMASHPPIPILELADHIERLKANDNLKFSQEYESIDPG--QQFTWEHSNLEVNKPKNRYANVIAYDHSRVLLSAIEGIPGSDYVNANYIDGYRKQNAYIATQGSLPETFGDFWRMIWEQRSATVVMMTKLEERSRVKCDQYWPSRGTETHGLVQVTLLDTVELATYCVRTFALYKNGSSEKREVRQFQFTAWPDHGVPEHPTPFLAFLRRVKTCNPPDAGPMVVHCSAGVGRTGCFIVIDAMLERIKHEKTVDIYGHVTLMRAQRNYMVQTEDQYIFIHDALLEAVTCGNTEVPARNLYAYIQKLTQIE-TGEN-VTGMELEFKRLASSKAHTSR-------FISA--NLPCNKFKNRLVNIMPYESTRVCLQPIRGVEGSDYINASFLDGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDQYQFCYRAALEYLGSFD 1908          

HSP 2 Score: 204.142 bits (518), Expect = 5.407e-52
Identity = 104/262 (39.69%), Postives = 153/262 (58.40%), Query Frame = 1
Query: 5092 NQAVNMTKNRVRNIIPYEWNRVVLNAIRGIEGSDYINASYIDGYRDRRAYIAAQSPIPSTVEDFWRMLWDQHCGVVIVLNQPHEDKSHI----YWPINKSIRYQFFVVDPVVEYNMPNYILREFKVTDARDGEFRALRQFQFTQWPNHGCPKESESILDFIRQVHKTKEQFGHMEPMVIHCNTGSGRTGVFIALSIVLDRLQQESVVDMYQTVKLLHKQRIGLVQTEEQYEFCYMAVLDYLSNYEKILEKSHLY*TYQDLSE 5865
            N  VN  KNR  N+I Y+ +RV+L+AI GI GSDY+NA+YIDGYR + AYIA Q  +P T  DFWRM+W+Q    V+++ +  E++S +    YWP   +  +    V  +    +  Y +R F +      E R +RQFQFT WP+HG P+     L F+R+V           PMV+HC+ G GRTG FI +  +L+R++ E  VD+Y  V L+  QR  +VQTE+QY F + A+L+ ++     +   +LY   Q L++
Sbjct: 1376 NLEVNKPKNRYANVIAYDHSRVLLSAIEGIPGSDYVNANYIDGYRKQNAYIATQGSLPETFGDFWRMIWEQRSATVVMMTK-LEERSRVKCDQYWPSRGTETHGLVQVTLLDTVELATYCVRTFALYKNGSSEKREVRQFQFTAWPDHGVPEHPTPFLAFLRRVKTCNPP--DAGPMVVHCSAGVGRTGCFIVIDAMLERIKHEKTVDIYGHVTLMRAQRNYMVQTEDQYIFIHDALLEAVTCGNTEVPARNLYAYIQKLTQ 1634          

HSP 3 Score: 138.272 bits (347), Expect = 7.020e-32
Identity = 208/853 (24.38%), Postives = 316/853 (37.05%), Query Frame = 1
Query:  376 CSSTGHPVPSISWKINESPIEELKSPLKKLQNPP-RIFSIKNYQNSVLVITQLIESDSNSVLICEAENNAGFDSRQQQLKVISTETDIPSGFPVFQNNFFPIIKPYNSNVTLVCQAYGNPPPLIQWFKNYELINESFT--KIKILND---------GNLLLVQVTREDKGIYHCQAQNTNGLRLSDPSTLDITS----------YPISPNSLIIERFASDNVE----------ISWRSGLNDVTEQENFILHYREVPENITEKQIMSKFVYLTISEKKSIYKYNLKDLFPFTTY-CIWMESENPLGVSPPTIALTVKTLPTSPQLSPRSITATSISNTAILVAWRP--PERKFGKFKYYQIIYTNNDGFLPQHWRQFAVKDDNVMLTHLIASEL-----YHIRVKIVNEIGHGPLSKTISIKTIAGTLSQCP-DFKITEIFQSHIKLQWGTPDPVKLFKLIQYNLLCWDVRLKIVNATAKSSTLFPILNHNLSMNEMEYVLYLKNEKEIKCRLSAINSDGKG-MPTEIQASTVNKGVNYQNL-IHIDKIGSTYITFQWRPPSKFSFDYFLWIYQIFDSEKLDRAVKLPKIKINISDSASAENGWFVYNYTNAFSSSRYILGLRYLCRDSTDILREYVHRSDLVSTMKSVPSDSPKDLVVKEIDSNSALVSWKPLDQVHSNGIITHYEVRYYAPKKEESTER---FINVSETSAILSNL-KYFHYVIYVRAFTKVGGGSWSNPKNYYRQNLEEFP--IPTTIKGERKSETEINISWELPVLSEKNLAHAAIEGFIILYAPVESSPKWIKYTVQSKNLS-------------AVIKGLEPDLRYQFQIAATNYAG 2748
            C +TG P P I W              KK+ N    +    +   SVL I  L      ++  C A NN G  S   +L V+  E  IP GFP         +       T++C A GNP P I WFK++  ++ S    +IK L           G L + Q    D+G Y C A N+ G R S P+ L +            + I P +  I    S N+           + W  G  D+T +++       +  N+ E                      L D+     Y C+ M +   LGV      +TVK LP  P     +   T  + T+I + W    PE       YY I +       P++  +   + D +  T    + L     Y  RV  VN IG GP S+ +  +T     S  P D +   +  + I +QW  P+        + N      R+       +    +  + HN++ +++  +  L  +K    ++ A  S G G + ++IQ  T   GV  Q L    +    T I   W PP   +   +  +Y+  D  +  R        I I    S       Y       +S Y    R   R    +       S    TM+S PS  P+D+      S S LVSW+P      NGIIT Y ++Y A   E+        I    T  +L  L K+  Y I V A T VG G  S   +   +  E+ P   P  ++ E  + T + +SW  PV    N  H  I G+ + Y  +E+     +  ++   L+              +I GL+P+  Y   + A    G
Sbjct:   45 CQATGDPRPKIVWNKKG----------KKVSNQRFEVIEFDDGSGSVLRIQPLRTPRDEAIYECVASNNVGEISVSTRLTVLR-EDQIPRGFPTIDMGPQLKVVERTRTATMLCAASGNPDPEITWFKDFLPVDTSNNNGRIKQLRSESIGGTPIRGALQIEQSEESDQGKYECVATNSAGTRYSAPANLYVRELREVRRVPPRFSIPPTNHEIMPGGSVNITCVAVGSPMPYVKWMLGAEDLTPEDDM-----PIGRNVLE----------------------LNDVRQSANYTCVAMST---LGVIEAIAQITVKALPKPPG----TPVVTESTATSITLTWDSGNPE----PVSYYIIQHK------PKNSEEPYKEIDGIATTRYSVAGLSPYSDYEFRVVAVNNIGRGPASEPVLTQTSEQAPSSAPRDVQARMLSSTTILVQWKEPE--------EPNGQIQGYRVYYTMDPTQHVNNW--MKHNVADSQITTIGNLVPQKTYSVKVLAFTSIGDGPLSSDIQVIT-QTGVPGQPLNFKAEPESETSILLSWTPPRSDTIASYELVYRDGDQGEEQR--------ITIEPGTS-------YRLQGLKPNSLYY--FRLSARSPQGLGASTAEIS--ARTMQSKPSAPPQDISCTSPSSTSILVSWQPPPVEKQNGIITEYSLKYAAVDGEDFKPHEILGIPSDTTKYLLEQLEKWTEYRITVTAHTDVGPGPES--LSVLIRTDEDVPSGPPRKVEVEAVNATAVKVSWRSPV---PNKQHGQIRGYQVHYVKMENGEPKGQPMLKDVMLADAQWEFDDTTEHDMIISGLQPETSYSLTVTAYTTKG 807          

HSP 4 Score: 137.887 bits (346), Expect = 8.595e-32
Identity = 218/978 (22.29%), Postives = 404/978 (41.31%), Query Frame = 1
Query:  268 VLINSQITFTENDEAPK----ISLIIQSPNVLLFKSMILACSSTGHPVPSISWKINESPIEELK--SPLKKLQNPPRIFSIKNYQ-NSVLVITQLIESDSNSVLICEAENNAGFD-SRQQQLKV--ISTETDIPSGFPVFQNNFFPIIKPYNSNVTLVCQAYGNPPPLIQWFKNYELINESFTKIKILNDG-NLLLVQVTREDKGIYHCQAQNTNGLRLSDPSTLDITSYPISPNSLIIERFASDNVEISWRSGLNDVTEQENFILHYREVPENITEKQIMSKFVYLTISEKKSIYKYNLKDLFPFTTYCIWMESENPLGVSPPTIALTVKTLPTSPQLSPRSITATSISNTAILVAWRPPERKFGKFKYYQIIYTNNDGFLPQHWRQFAVKDDNV-MLTHLIASELYHIRVKIVNEIGHGPLSKTISIKTIAGTLSQCPDFKITEIFQSHIKLQWGTPDPVKLFKLIQYNLLCWDVRLKIVNATAKSSTLFPILNHNLSMNEMEYVLYLKNEKEIKCRLSAINSDGKGMPT-EIQASTV-NKGVNYQNLIHIDKIGSTYITFQWRPPSKFSFDYFLWIYQIFDSEKLDRAVKLPKIKINISDSASAENGWFVYNYTNAFSSSRYILGLRYLCRDSTDILREYVHRSDLVSTMKSVPSDSPKDLVVKEIDSNSALVSWKPLDQVHSNGIITHYEVRYYA-----PKKE---------ESTERFINVSETSAILSNLK-YFHYVIYVRAFTKVGGGSWSNPKNYYRQNLEEFPIPTTIKGERK---SETEIN---ISWELPVLSEKNLAHAAIEGFIILYAPVESSP-KWIKYTVQSKNLSAVIKGLEPDLRYQFQIAATNYAGFNGNFSE---IVQEMPKNFPNLNLKTVPDLRCSVQSSNRLKVEWSSPSISTDLLKFEIRYSGNLSYITEIGLKKSEFIDMESKSVNFETLVNRYD--VTLENLQSNALYKIAVRA 3078
            + +++++T    D+ P+    I +  Q   V   ++  + C+++G+P P I+W  +  P++       +K+L    R  SI        L I Q  ESD      C A N+AG   S    L V  +     +P  F +   N    I P  S V + C A G+P P ++W     L  E  T    +  G N+L +   R+    Y C A +T G+ +   + + + + P  P + ++    + ++ ++W SG  +      +I+ ++  P+N  E        Y  I +  +  +Y++  L P++ Y   + + N +G  P +  +  +T   +P  +PR + A  +S+T ILV W+ PE   G+ + Y++ YT +      +W +  V D  +  + +L+  + Y ++V     IG GPLS  I + T  G   Q  +FK     ++ I L W  P   +   +  Y L+  D          +  T+ P  ++ L   +   + Y         RLSA +  G G  T EI A T+ +K       I      ST I   W+PP     +  +  Y +  +       K  +I    SD+       ++      ++  R  +         TD+       S L+ T + VPS  P+ + V+ +++ +  VSW+       +G I  Y+V Y       PK +         ++   F + +E   I+S L+    Y + V A+T  G G+ S PK               + G+ +   + T++N   I W  PV +        ++G+ + +   +  P   ++++ +  + +A    +     Y F+++A N  GF     +   + +E+P  FP        +L     +S  +++ W  P ++          +G ++  T +      + D+    +  E L+   D  +TL  L+S+  Y + VRA
Sbjct:  107 ISVSTRLTVLREDQIPRGFPTIDMGPQLKVVERTRTATMLCAASGNPDPEITWFKDFLPVDTSNNNGRIKQL----RSESIGGTPIRGALQIEQSEESDQGKYE-CVATNSAGTRYSAPANLYVRELREVRRVPPRFSIPPTNHE--IMPGGS-VNITCVAVGSPMPYVKWM----LGAEDLTPEDDMPIGRNVLELNDVRQSAN-YTCVAMSTLGV-IEAIAQITVKALPKPPGTPVVTESTATSITLTWDSGNPEPVSY--YIIQHK--PKNSEEP-------YKEI-DGIATTRYSVAGLSPYSDYEFRVVAVNNIGRGPASEPVLTQTSEQAPSSAPRDVQARMLSSTTILVQWKEPEEPNGQIQGYRVYYTMDPTQHVNNWMKHNVADSQITTIGNLVPQKTYSVKVLAFTSIGDGPLSSDIQVITQTGVPGQPLNFKAEPESETSILLSWTPP---RSDTIASYELVYRDGD----QGEEQRITIEPGTSYRLQGLKPNSLYYF--------RLSARSPQGLGASTAEISARTMQSKPSAPPQDISCTSPSSTSILVSWQPPPVEKQNGIITEYSLKYAAVDGEDFKPHEILGIPSDTTK-----YLLEQLEKWTEYRITVTAH------TDVGPGPESLSVLIRTDEDVPSGPPRKVEVEAVNATAVKVSWRSPVPNKQHGQIRGYQVHYVKMENGEPKGQPMLKDVMLADAQWEFDDTTEHDMIISGLQPETSYSLTVTAYTTKGDGARSKPKLVSTTG--------AVPGKPRLVINHTQMNTALIQWHPPVDT-----FGPLQGYRLKFGRKDMEPLTTLEFSEKEDHFTAT--DIHKGASYVFRLSARNKVGFGEEMVKEISVPEEIPTGFPQ-------NLHSEGTTSTSVQLSWQPPVLA--------ERNGVITKYTLL------YRDINVPLLPMEHLIVPADTSMTLTGLKSDTTYDVKVRA 996          
BLAST of Protein tyrosine phosphatase receptor type D vs. UniProt/SwissProt
Match: sp|B0V2N1|PTPRS_MOUSE (Receptor-type tyrosine-protein phosphatase S OS=Mus musculus OX=10090 GN=Ptprs PE=1 SV=1)

HSP 1 Score: 720.694 bits (1859), Expect = 0.000e+0
Identity = 339/635 (53.39%), Postives = 452/635 (71.18%), Query Frame = 1
Query: 3928 KSIPDLVNADS---VQMCQDGTKLSPVLVSDSIKLRIGSQKSENISDRPSISICNLYQYVTDLKANDCTLLQAEFETLNTNLDDRFTWQRSNIDSNKSKNRYANVVAYDHTSVLLTPVDDVIGSDYINANYIDGYQRQNAYIATQGPLPDTTDDFWRMVWEQRSNCIVMMTRLEERSGIKCHQYWPNRGFICYGQMIVSHIDTFVLAYYTIRLFEIRHSKYSEKREIQHFQFTAWPDHGVPKLSTPLLMFIRRVRSIGKIESCPKIVHCSAGVGRTGAFIVVDAQLERIKQEKNIDVFNYVSKIRCQRNYMVQTQAQYQFILETLLEAVEDGNTEVMACNFHAHVTKLSQIGISGSNQLSGFEMEFSKLNSLASNRGRHGVMLADFVKAAGNQAVNMTKNRVRNIIPYEWNRVVLNAIRGIEGSDYINASYIDGYRDRRAYIAAQSPIPSTVEDFWRMLWDQHCGVVIVLNQPHE---DKSHIYWPINKSIRYQFFVVDPVVEYNMPNYILREFKVTDARDGEFRALRQFQFTQWPNHGCPKESESILDFIRQVHKTKEQFGHMEPMVIHCNTGSGRTGVFIALSIVLDRLQQESVVDMYQTVKLLHKQRIGLVQTEEQYEFCYMAVLDYLSNYE 5814
            K+ PD    DS    +   +   L+P    D +++R  + ++  +   P I I ++ +++  LKAND   L  E+E+++     +FTW+ SN+++NK KNRYANV+AYDH+ V+L P++ ++GSDYINANY+DGY+RQNAYIATQGPLP+T  DFWRMVWEQRS  +VMMTRLEE+S IKC QYWPNRG   YG + V+ +DT  LA + +R F +  +  SEKRE++HFQFTAWPDHGVP+  TP L F+RRV++    ++ P +VHCSAGVGRTG FIV+DA LERIK EK +DV+ +V+ +R QRNYMVQT+ QY FI E LLEAV  GNTEV A + + ++ KL+Q  +     ++G E+EF +L S  ++  R       F+ A+     N  KNR+ NI+PYE +RV L  IRG+EGSDYINAS+IDGYR ++AYIA Q P+  T EDFWR LW+ +  +V++L +  E   +K H YWP  +S RYQ+FVVDP+ EYNMP YILREFKVTDARDG+ R +RQFQFT WP  G PK  E  +DFI QVHKTKEQFG   P+ +HC+ G GRTGVFI LSIVL+R++ E VVD++QTVK+L  QR  +VQTE++Y+FC+ A L+YL +++
Sbjct: 1282 KNKPDSKRKDSEPRTKCLLNNADLAPHHPKDPVEMRRINFQTPGMLSHPPIPITDMAEHMERLKANDSLKLSQEYESIDPG--QQFTWEHSNLEANKPKNRYANVIAYDHSRVILQPLEGIMGSDYINANYVDGYRRQNAYIATQGPLPETFGDFWRMVWEQRSATVVMMTRLEEKSRIKCDQYWPNRGTETYGFIQVTLLDTMELATFCVRTFSLHKNGSSEKREVRHFQFTAWPDHGVPEYPTPFLAFLRRVKTCNPPDAGPIVVHCSAGVGRTGCFIVIDAMLERIKTEKTVDVYGHVTLMRSQRNYMVQTEDQYGFIHEALLEAVGCGNTEVPARSLYTYIQKLAQ--VEPGEHVTGMELEFKRLASSKAHTSR-------FITAS--LPCNKFKNRLVNILPYESSRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRALWENNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPEQGAPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKVLRTQRPAMVQTEDEYQFCFQAALEYLGSFD 1903          

HSP 2 Score: 201.83 bits (512), Expect = 1.980e-50
Identity = 103/262 (39.31%), Postives = 149/262 (56.87%), Query Frame = 1
Query: 5092 NQAVNMTKNRVRNIIPYEWNRVVLNAIRGIEGSDYINASYIDGYRDRRAYIAAQSPIPSTVEDFWRMLWDQHCGVVIVLNQPHEDKSHI----YWPINKSIRYQFFVVDPVVEYNMPNYILREFKVTDARDGEFRALRQFQFTQWPNHGCPKESESILDFIRQVHKTKEQFGHMEPMVIHCNTGSGRTGVFIALSIVLDRLQQESVVDMYQTVKLLHKQRIGLVQTEEQYEFCYMAVLDYLSNYEKILEKSHLY*TYQDLSE 5865
            N   N  KNR  N+I Y+ +RV+L  + GI GSDYINA+Y+DGYR + AYIA Q P+P T  DFWRM+W+Q    V+++ +  E+KS I    YWP   +  Y F  V  +    +  + +R F +      E R +R FQFT WP+HG P+     L F+R+V           P+V+HC+ G GRTG FI +  +L+R++ E  VD+Y  V L+  QR  +VQTE+QY F + A+L+ +      +    LY   Q L++
Sbjct: 1371 NLEANKPKNRYANVIAYDHSRVILQPLEGIMGSDYINANYVDGYRRQNAYIATQGPLPETFGDFWRMVWEQRSATVVMMTR-LEEKSRIKCDQYWPNRGTETYGFIQVTLLDTMELATFCVRTFSLHKNGSSEKREVRHFQFTAWPDHGVPEYPTPFLAFLRRVKTCNPP--DAGPIVVHCSAGVGRTGCFIVIDAMLERIKTEKTVDVYGHVTLMRSQRNYMVQTEDQYGFIHEALLEAVGCGNTEVPARSLYTYIQKLAQ 1629          

HSP 3 Score: 153.295 bits (386), Expect = 1.325e-35
Identity = 202/837 (24.13%), Postives = 331/837 (39.55%), Query Frame = 1
Query:  370 LACSSTGHPVPSISW-----KINESPIEELKSPLKKLQNPPRIFSIKNYQNSVLVITQLIESDSNSVLICEAENNAGFDSRQQQLKVISTETDIPSGFPVFQNNFFPIIKPYNSNVTLVCQAYGNPPPLIQWFKNYELINESFT--KIKILNDGNLLLVQVTREDKGIYHCQAQNTNGLRLSDPSTLDITSYPISPNSLII----ERFASDNVEIS------------WRSGLNDVTEQENFILHYREVPENITEKQIMSKFVYLTISEKKSIYKYNLKDLFPFTTYCIWMESENPLGVSPPTIALTVKTLPTSPQLSPRSITATSISNTAILVAWRPPERKFGKFKYYQIIYTNNDGFLPQHWRQFAVKDDNVMLTHLIAS----ELYHIRVKIVNEIGHGPLSKTISIKTIAGTLSQCP-DFKITEIFQSHIKLQWGTPDPVKLFKLIQYNLLCWDVRLKIVNATAKSSTLFPILN---HNLSMNEMEYVLYLKNEKEIKCRLSAINSDGKG-MPTEIQASTVNKGVNYQNL-IHIDKIGSTYITFQWRPPSKFSFDYFLWIYQIFDSEKLDRAVKLPKIKINISDSASAENGWFVYNYTNAFS-SSRYILGLRYLCRDSTDILREYVHRSDLVSTMKSVPSDSPKDLVVKEIDSNSALVSWKPLDQVHSNGIITHYEVRYYAPKKEESTERFIN---VSETSAILSNL-KYFHYVIYVRAFTKVGGGSWSNPKNYYRQNLEEFP--IPTTIKGERKSETEINISWELPVLSEKNLAHAAIEGFIILYAPVESS----PKWIKYTVQSKNLSAVIKGLEPDLRYQFQIAATNYAG 2748
              C +TG P P ++W     K+N    E +                     +VL I  L      +V  C A+N+ G  +   +L V+  E  +P GFP         +       T++C A GNP P I WFK++  ++ S +  +IK L  G L +      D+G Y C A N+ G+R S P+ L +    ++P   I+    E     NV I+            W  G  D+T +++       V  N+ E         LT          ++KD   +T  C+ M S   LGV      +TVK+LP +P     +   T  + T+I V W           YY I Y +     P     + +K+D     + I        Y I V  VN IG GP S+++  +T     +  P + +   +  + + +QW   +PV+   LI+   + + +  +            P+ N   HN+  + +  V  L  ++    R+ A  S G G +   IQ  T  +GV  Q + +  +    T I   W  P + S   +  +++  D  +       P     + D           N   AF  ++R   GL       T ++R+         T+++ PS  P+D+    + S + LVSW+P      NG +  Y VRY     E+   + +N    + T  +L  L K+  Y +   A+T+VG G  S+P     +  E+ P   P  ++ E  + T I + W  P    +   H  I G+ + Y  +E +    P  IK  + +     VI  L+P+  Y   +AA    G
Sbjct:   52 FVCQATGDPKPRVTWNKKGKKVNSQRFETI--------------DFDESSGAVLRIQPLRTPRDENVYECVAQNSVGEITIHAKLTVLR-EDQLPPGFPNIDMGPQLKVVERTRTATMLCAASGNPDPEITWFKDFLPVDPSASNGRIKQLRSGALQIESSEETDQGKYECVATNSAGVRYSSPANLYVRVRRVAPRFSILPMSHEIMPGGNVNITCVAVGSPMPYVKWMQGAEDLTPEDDM-----PVGRNVLE---------LT----------DVKDSANYT--CVAMSS---LGVIEAVAQITVKSLPKAPG----TPVVTENTATSITVTWD--SGNPDPVSYYVIEYKSKSQDGP-----YQIKEDITTTRYSIGGLSPNSEYEIWVSAVNSIGQGPPSESVVTRTGEQAPASAPRNVQARMLSATTMIVQWE--EPVEPNGLIRGYRVYYTMEPE-----------HPVGNWQKHNVDDSLLTTVGSLLEDETYTVRVLAFTSVGDGPLSDPIQVKT-QQGVPGQPMNLRAEAKSETSIGLSWSAPRQESVIKYELLFREGDRGREVGRTFDPTTAFVVED--------LKPNTEYAFRLAARSPQGLGAF----TAVVRQ--------RTLQAKPSAPPQDVKCTSLRSTAILVSWRPPPPETHNGALVGYSVRYRPLGSEDPDPKEVNNIPPTTTQILLEALEKWTEYRVTAVAYTEVGPGPESSP--VVVRTDEDVPSAPPRKVEAEALNATAIRVLWRSPTPGRQ---HGQIRGYQVHYVRMEGAEARGPPRIKDIMLADAQEMVITNLQPETAYSITVAAYTMKG 794          

HSP 4 Score: 153.295 bits (386), Expect = 1.430e-35
Identity = 197/878 (22.44%), Postives = 359/878 (40.89%), Query Frame = 1
Query:  268 VLINSQITFTENDEAPK----ISLIIQSPNVLLFKSMILACSSTGHPVPSISWKINESPIEELKSPLKKLQNPPRIFSIKNYQNSVLVITQLIESDSNSVLICEAENNAGFDSRQQQLKVISTETDIPSGFPVFQNNFFPI---IKPYNSNVTLVCQAYGNPPPLIQWFKNYELINESFTKIKILNDGNLLLVQVTREDKGIYHCQAQNTNGLRLSDPSTLDITSYPISPNSLIIERFASDNVEISWRSGLNDVTEQENFILHYREVPENITEKQIMSKFVYLTISEKKSIYKYNLKDLFPFTTYCIWMESENPLGVSPPTIALTVKTLPTSPQLSPRSITATSISNTAILVAWRPPERKFGKFKYYQIIYTNNDGFLPQHWRQFAVKDDNVMLT--HLIASELYHIRVKIVNEIGHGPLSKTISIKTIAGTLSQCPDFKITEIFQSHIKLQWGTPDPVKLFKLIQYNLLCWDV-RLKIVNATAKSSTLFPILNHNLSMNEMEYVLYLKNEKEIKCRLSAINSDGKGMPTEI--QASTVNKGVNYQNLIHIDKIGSTYITFQWRPPSKFSFDYFLWIYQI----FDSEKLDRAVKLPKIKINISDSAS-----AENGWFVYNYTNAFSSSRYILGLRYLCRDSTDILREYVHRSDLVSTMKSVPSDSPKDLVVKEIDSNSALVSWKPLDQVHSNGIITHYEVRYYAPKKEES--TERFINVSETSA---ILSNLK-YFHYVIYVRAFTKVGGGSWSNPKNYYRQN-LEEFPIPTTIKGERKSETEINISWELPVLSEKNLAHAAIEGFIILYAPVESSPKWIKYTVQSKNLSAVI-KGLEPDLRYQFQIAATN---YAGFNGNFSEIVQEMPKNFPNL 2805
            + I++++T    D+ P     I +  Q   V   ++  + C+++G+P P I+W  +  P++   S  +          IK  ++  L I    E+D      C A N+AG          +      P      + +  P+   I P   NV + C A G+P P ++W +      E  T    +  G  +L     +D   Y C A ++ G+ +   + + + S P +P + ++    + ++ ++W SG  D      +++ Y+            S+     I E  +  +Y++  L P + Y IW+ + N +G  PP+ ++  +T   +P  +PR++ A  +S T ++V W  P    G  + Y++ YT        +W++  V DD+++ T   L+  E Y +RV     +G GPLS  I +KT  G   Q  + +     ++ I L W  P   +   +I+Y LL  +  R + V  T   +T F + +             LK   E   RL+A +  G G  T +  Q +   K       +    + ST I   WRPP   + +  L  Y +      SE  D     PK   NI  + +     A   W  Y  T A + +    G      +S+ +         +V T + VPS  P+ +  + +++ +  V W+       +G I  Y+V Y   +  E+    R  ++    A   +++NL+    Y I V A+T  G G+ S PK    +  +   P   T+  ++  E  +   WE P     + A   + G+ + +   +++P  ++     +  +A   KG      Y F++AA               I ++ P+ FP +
Sbjct:  116 ITIHAKLTVLREDQLPPGFPNIDMGPQLKVVERTRTATMLCAASGNPDPEITWFKDFLPVDPSASNGR----------IKQLRSGALQIESSEETDQGK-YECVATNSAGVRYSSPANLYVRVRRVAP------RFSILPMSHEIMP-GGNVNITCVAVGSPMPYVKWMQG----AEDLTPEDDMPVGRNVLELTDVKDSANYTCVAMSSLGV-IEAVAQITVKSLPKAPGTPVVTENTATSITVTWDSGNPDPVSY--YVIEYKS----------KSQDGPYQIKEDITTTRYSIGGLSPNSEYEIWVSAVNSIGQGPPSESVVTRTGEQAPASAPRNVQARMLSATTMIVQWEEPVEPNGLIRGYRVYYTMEPEHPVGNWQKHNV-DDSLLTTVGSLLEDETYTVRVLAFTSVGDGPLSDPIQVKTQQGVPGQPMNLRAEAKSETSIGLSWSAP---RQESVIKYELLFREGDRGREVGRTFDPTTAFVVED-------------LKPNTEYAFRLAARSPQGLGAFTAVVRQRTLQAKPSAPPQDVKCTSLRSTAILVSWRPPPPETHNGALVGYSVRYRPLGSEDPD-----PKEVNNIPPTTTQILLEALEKWTEYRVT-AVAYTEVGPG-----PESSPV---------VVRTDEDVPSAPPRKVEAEALNATAIRVLWRSPTPGRQHGQIRGYQVHYVRMEGAEARGPPRIKDIMLADAQEMVITNLQPETAYSITVAAYTMKGDGARSKPKVVVTKGAVLGRP---TLSVQQTPEGSLLARWEPPA----DAAEDPVLGYRLQFGREDAAPATLELAAWERRFAAPAHKGAT----YVFRLAARGRAGLGEEAAAALSIPEDAPRGFPQI 910          

HSP 5 Score: 68.9366 bits (167), Expect = 5.219e-10
Identity = 66/265 (24.91%), Postives = 119/265 (44.91%), Query Frame = 1
Query: 2164 SDLVSTMKSVPSDSPKDLVVKEIDSNSALVSWKPLDQVHSNGIITHYEVRYYAPKKEESTERF----INVSETSAILSNLKYFHYVIYVRAFTKVGGGSWSNPKNYYRQNLEEFP-IPTTIKGERKSETEINISWELPVLSEKNLAHAAIEGFIILYAPVESSPKWIKYTVQSKNLSAVIKGLEPDLRYQFQIAATNYAGFNGNFSEIV-----QEMPKNFPNLNLKTVPDLRCSVQSSNRLKVEWSSPSISTD---LLKFEIRY 2919
            S +  T +  P+ +P+++  + + + + +V W+  + V  NG+I  Y V YY  + E     +    ++ S  + + S L+   Y + V AFT VG G  S+P     Q  +  P  P  ++ E KSET I +SW  P          ++  + +L+   +   + +  T      + V++ L+P+  Y F++AA +  G  G F+ +V     Q  P   P        D++C+   S  + V W  P   T    L+ + +RY
Sbjct:  403 SVVTRTGEQAPASAPRNVQARMLSATTMIVQWE--EPVEPNGLIRGYRV-YYTMEPEHPVGNWQKHNVDDSLLTTVGSLLEDETYTVRVLAFTSVGDGPLSDPIQVKTQ--QGVPGQPMNLRAEAKSETSIGLSWSAP-------RQESVIKYELLFREGDRG-REVGRTFDPTT-AFVVEDLKPNTEYAFRLAARSPQGL-GAFTAVVRQRTLQAKPSAPPQ-------DVKCTSLRSTAILVSWRPPPPETHNGALVGYSVRY 645          
BLAST of Protein tyrosine phosphatase receptor type D vs. UniProt/SwissProt
Match: sp|Q64605|PTPRS_RAT (Receptor-type tyrosine-protein phosphatase S OS=Rattus norvegicus OX=10116 GN=Ptprs PE=1 SV=2)

HSP 1 Score: 719.924 bits (1857), Expect = 0.000e+0
Identity = 337/635 (53.07%), Postives = 452/635 (71.18%), Query Frame = 1
Query: 3928 KSIPDLVNADS---VQMCQDGTKLSPVLVSDSIKLRIGSQKSENISDRPSISICNLYQYVTDLKANDCTLLQAEFETLNTNLDDRFTWQRSNIDSNKSKNRYANVVAYDHTSVLLTPVDDVIGSDYINANYIDGYQRQNAYIATQGPLPDTTDDFWRMVWEQRSNCIVMMTRLEERSGIKCHQYWPNRGFICYGQMIVSHIDTFVLAYYTIRLFEIRHSKYSEKREIQHFQFTAWPDHGVPKLSTPLLMFIRRVRSIGKIESCPKIVHCSAGVGRTGAFIVVDAQLERIKQEKNIDVFNYVSKIRCQRNYMVQTQAQYQFILETLLEAVEDGNTEVMACNFHAHVTKLSQIGISGSNQLSGFEMEFSKLNSLASNRGRHGVMLADFVKAAGNQAVNMTKNRVRNIIPYEWNRVVLNAIRGIEGSDYINASYIDGYRDRRAYIAAQSPIPSTVEDFWRMLWDQHCGVVIVLNQPHE---DKSHIYWPINKSIRYQFFVVDPVVEYNMPNYILREFKVTDARDGEFRALRQFQFTQWPNHGCPKESESILDFIRQVHKTKEQFGHMEPMVIHCNTGSGRTGVFIALSIVLDRLQQESVVDMYQTVKLLHKQRIGLVQTEEQYEFCYMAVLDYLSNYE 5814
            K+ PD    DS    +   +   L+P    D +++R  + ++  +   P I I ++ +++  LKAND   L  E+E+++     +FTW+ SN+++NK KNRYANV+AYDH+ V+L P++ ++GSDYINANY+DGY+RQNAYIATQGPLP+T  DFWRMVWEQRS  +VMMTRLEE+S +KC QYWPNRG   YG + V+ +DT  LA + +R F +  +  SEKRE++HFQFTAWPDHGVP+  TP L F+RRV++    ++ P +VHCSAGVGRTG FIV+DA LERI+ EK +DV+ +V+ +R QRNYMVQT+ QY FI E LLEAV  GNTEV A + + ++ KL+Q  +     ++G E+EF +L S  ++  R       F+ A+     N  KNR+ NI+PYE +RV L  IRG+EGSDYINAS+IDGYR ++AYIA Q P+  T EDFWR LW+ +  +V++L +  E   +K H YWP  +S RYQ+FVVDP+ EYNMP YILREFKVTDARDG+ R +RQFQFT WP  G PK  E  +DFI QVHKTKEQFG   P+ +HC+ G GRTGVFI LSIVL+R++ E VVD++QTVK+L  QR  +VQTE++Y+FC+ A L+YL +++
Sbjct: 1282 KNKPDSKRKDSEPRTKCLLNNADLAPHHPKDPVEMRRINFQTPGMLSHPPIPITDMAEHMERLKANDSLKLSQEYESIDPG--QQFTWEHSNLEANKPKNRYANVIAYDHSRVILQPLEGIMGSDYINANYVDGYRRQNAYIATQGPLPETFGDFWRMVWEQRSATVVMMTRLEEKSRVKCDQYWPNRGTETYGFIQVTLLDTMELATFCVRTFSLHKNGSSEKREVRHFQFTAWPDHGVPEYPTPFLAFLRRVKTCNPPDAGPVVVHCSAGVGRTGCFIVIDAMLERIRTEKTVDVYGHVTLMRSQRNYMVQTEDQYSFIHEALLEAVGCGNTEVPARSLYTYIQKLAQ--VEPGEHVTGMELEFKRLASSKAHTSR-------FITAS--LPCNKFKNRLVNILPYESSRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRALWENNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPEQGAPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKVLRTQRPAMVQTEDEYQFCFQAALEYLGSFD 1903          

HSP 2 Score: 201.83 bits (512), Expect = 2.248e-50
Identity = 102/262 (38.93%), Postives = 149/262 (56.87%), Query Frame = 1
Query: 5092 NQAVNMTKNRVRNIIPYEWNRVVLNAIRGIEGSDYINASYIDGYRDRRAYIAAQSPIPSTVEDFWRMLWDQHCGVVIVLNQPHEDKSHI----YWPINKSIRYQFFVVDPVVEYNMPNYILREFKVTDARDGEFRALRQFQFTQWPNHGCPKESESILDFIRQVHKTKEQFGHMEPMVIHCNTGSGRTGVFIALSIVLDRLQQESVVDMYQTVKLLHKQRIGLVQTEEQYEFCYMAVLDYLSNYEKILEKSHLY*TYQDLSE 5865
            N   N  KNR  N+I Y+ +RV+L  + GI GSDYINA+Y+DGYR + AYIA Q P+P T  DFWRM+W+Q    V+++ +  E+KS +    YWP   +  Y F  V  +    +  + +R F +      E R +R FQFT WP+HG P+     L F+R+V           P+V+HC+ G GRTG FI +  +L+R++ E  VD+Y  V L+  QR  +VQTE+QY F + A+L+ +      +    LY   Q L++
Sbjct: 1371 NLEANKPKNRYANVIAYDHSRVILQPLEGIMGSDYINANYVDGYRRQNAYIATQGPLPETFGDFWRMVWEQRSATVVMMTR-LEEKSRVKCDQYWPNRGTETYGFIQVTLLDTMELATFCVRTFSLHKNGSSEKREVRHFQFTAWPDHGVPEYPTPFLAFLRRVKTCNPP--DAGPVVVHCSAGVGRTGCFIVIDAMLERIRTEKTVDVYGHVTLMRSQRNYMVQTEDQYSFIHEALLEAVGCGNTEVPARSLYTYIQKLAQ 1629          

HSP 3 Score: 160.614 bits (405), Expect = 7.967e-38
Identity = 199/878 (22.67%), Postives = 362/878 (41.23%), Query Frame = 1
Query:  268 VLINSQITFTENDEAPK----ISLIIQSPNVLLFKSMILACSSTGHPVPSISWKINESPIEELKSPLKKLQNPPRIFSIKNYQNSVLVITQLIESDSNSVLICEAENNAGFDSRQQQLKVISTETDIPSGFPVFQNNFFPI---IKPYNSNVTLVCQAYGNPPPLIQWFKNYELINESFTKIKILNDGNLLLVQVTREDKGIYHCQAQNTNGLRLSDPSTLDITSYPISPNSLIIERFASDNVEISWRSGLNDVTEQENFILHYREVPENITEKQIMSKFVYLTISEKKSIYKYNLKDLFPFTTYCIWMESENPLGVSPPTIALTVKTLPTSPQLSPRSITATSISNTAILVAWRPPERKFGKFKYYQIIYTNNDGFLPQHWRQFAVKDDNVMLT--HLIASELYHIRVKIVNEIGHGPLSKTISIKTIAGTLSQCPDFKITEIFQSHIKLQWGTPDPVKLFKLIQYNLLCWDV-RLKIVNATAKSSTLFPILNHNLSMNEMEYVLYLKNEKEIKCRLSAINSDGKGMPTEI--QASTVNKGVNYQNLIHIDKIGSTYITFQWRPPSKFSFDYFLWIYQI----FDSEKLDRAVKLPKIKINISDSAS-----AENGWFVYNYTNAFSSSRYILGLRYLCRDSTDILREYVHRSDLVSTMKSVPSDSPKDLVVKEIDSNSALVSWKPLDQVHSNGIITHYEVRYYAPKKEES--TERFINVSETSA---ILSNLK-YFHYVIYVRAFTKVGGGSWSNPKNYYRQN-LEEFPIPTTIKGERKSETEINISWELPVLSEKNLAHAAIEGFIILYAPVESSPKWIKYTVQSKNLSAVI-KGLEPDLRYQFQIAATNYAGFNGNFS---EIVQEMPKNFPNL 2805
            + +++++T    D+ P     I +  Q   V   ++  + C+++G+P P I+W  +  P++   S  +          IK  ++  L I    E+D      C A N+AG          +      P      + +  P+   I P   NV + C A G+P P ++W +      E  T    +  G  +L     +D   Y C A ++ G+ +   + + + S P +P + ++    + ++ ++W SG  D      +++ Y+            S+     I E  +  +Y++  L P + Y IW+ + N +G  PP+ ++  +T   +P  +PR++ A  +S T ++V W  P    G  + Y++ YT        +W++  V DD+++ T   L+  E Y +RV     +G GPLS  I +KT  G   Q  + +     ++ I L W  P   +   +I+Y LL  +  R + V  T   +T F + +             LK   E   RL+A +  G G  T +  Q +   K       +    + ST I   WRPP   + +  L  Y +      SE  D     PK   NI  + +     A   W  Y  T A + +    G      +S+ +         +V T + VPS  P+ +  + +++ +  V W+       +G I  Y+V Y   +  E+    R  ++    A   +++NL+    Y I V A+T  G G+ S PK    +  +   P   T+  ++  E  +   WE P     + A   + G+ + +   +++P  ++     +  +A   KG      Y F++AA   AG     S    I ++ P+ FP +
Sbjct:  116 ITVHAKLTVLREDQLPPGFPNIDMGPQLKVVERTRTATMLCAASGNPDPEITWFKDFLPVDPSASNGR----------IKQLRSGALQIESSEETDQGK-YECVATNSAGVRYSSPANLYVRVRRVAP------RFSILPMSHEIMP-GGNVNITCVAVGSPMPYVKWMQG----AEDLTPEDDMPVGRNVLELTDVKDSANYTCVAMSSLGV-IEAVAQITVKSLPKAPGTPVVTENTATSITVTWDSGNPDPVSY--YVIEYKS----------KSQDGPYQIKEDITTTRYSIGGLSPNSEYEIWVSAVNSIGQGPPSESVVTRTGEQAPASAPRNVQARMLSATTMIVQWEEPVEPNGLIRGYRVYYTMEPEHPVGNWQKHNV-DDSLLTTVGSLLEDETYTVRVLAFTSVGDGPLSDPIQVKTQQGVPGQPMNLRAEAKSETSIGLSWSAP---RQESVIKYELLFREGDRGREVGRTFDPTTAFVVED-------------LKPNTEYAFRLAARSPQGLGAFTAVVRQRTLQAKPSAPPQDVKCTSLRSTAILVSWRPPPPETHNGALVGYSVRYRPLGSEDPD-----PKEVNNIPPTTTQILLEALEKWTEYRVT-AVAYTEVGPG-----PESSPV---------VVRTDEDVPSAPPRKVEAEALNATAIRVLWRSPTPGRQHGQIRGYQVHYVRMEGAEARGPPRIKDIMLADAQEMVITNLQPETAYSITVAAYTMKGDGARSKPKVVVTKGAVLGRP---TLSVQQTPEGSLLARWEPPA----DAAEDPVLGYRLQFGREDAAPATLELAAWERRFAAPAHKGAT----YVFRLAARGRAGLGEEASAALSIPEDAPRGFPQI 910          

HSP 4 Score: 153.68 bits (387), Expect = 1.038e-35
Identity = 202/837 (24.13%), Postives = 331/837 (39.55%), Query Frame = 1
Query:  370 LACSSTGHPVPSISW-----KINESPIEELKSPLKKLQNPPRIFSIKNYQNSVLVITQLIESDSNSVLICEAENNAGFDSRQQQLKVISTETDIPSGFPVFQNNFFPIIKPYNSNVTLVCQAYGNPPPLIQWFKNYELINESFT--KIKILNDGNLLLVQVTREDKGIYHCQAQNTNGLRLSDPSTLDITSYPISPNSLII----ERFASDNVEIS------------WRSGLNDVTEQENFILHYREVPENITEKQIMSKFVYLTISEKKSIYKYNLKDLFPFTTYCIWMESENPLGVSPPTIALTVKTLPTSPQLSPRSITATSISNTAILVAWRPPERKFGKFKYYQIIYTNNDGFLPQHWRQFAVKDDNVMLTHLIAS----ELYHIRVKIVNEIGHGPLSKTISIKTIAGTLSQCP-DFKITEIFQSHIKLQWGTPDPVKLFKLIQYNLLCWDVRLKIVNATAKSSTLFPILN---HNLSMNEMEYVLYLKNEKEIKCRLSAINSDGKG-MPTEIQASTVNKGVNYQNL-IHIDKIGSTYITFQWRPPSKFSFDYFLWIYQIFDSEKLDRAVKLPKIKINISDSASAENGWFVYNYTNAFS-SSRYILGLRYLCRDSTDILREYVHRSDLVSTMKSVPSDSPKDLVVKEIDSNSALVSWKPLDQVHSNGIITHYEVRYYAPKKEESTERFIN---VSETSAILSNL-KYFHYVIYVRAFTKVGGGSWSNPKNYYRQNLEEFP--IPTTIKGERKSETEINISWELPVLSEKNLAHAAIEGFIILYAPVESS----PKWIKYTVQSKNLSAVIKGLEPDLRYQFQIAATNYAG 2748
              C +TG P P ++W     K+N    E +                     +VL I  L      +V  C A+N+ G  +   +L V+  E  +P GFP         +       T++C A GNP P I WFK++  ++ S +  +IK L  G L +      D+G Y C A N+ G+R S P+ L +    ++P   I+    E     NV I+            W  G  D+T +++       V  N+ E         LT          ++KD   +T  C+ M S   LGV      +TVK+LP +P     +   T  + T+I V W           YY I Y +     P     + +K+D     + I        Y I V  VN IG GP S+++  +T     +  P + +   +  + + +QW   +PV+   LI+   + + +  +            P+ N   HN+  + +  V  L  ++    R+ A  S G G +   IQ  T  +GV  Q + +  +    T I   W  P + S   +  +++  D  +       P     + D           N   AF  ++R   GL       T ++R+         T+++ PS  P+D+    + S + LVSW+P      NG +  Y VRY     E+   + +N    + T  +L  L K+  Y +   A+T+VG G  S+P     +  E+ P   P  ++ E  + T I + W  P    +   H  I G+ + Y  +E +    P  IK  + +     VI  L+P+  Y   +AA    G
Sbjct:   52 FVCQATGDPKPRVTWNKKGKKVNSQRFETI--------------DFDESSGAVLRIQPLRTPRDENVYECVAQNSVGEITVHAKLTVLR-EDQLPPGFPNIDMGPQLKVVERTRTATMLCAASGNPDPEITWFKDFLPVDPSASNGRIKQLRSGALQIESSEETDQGKYECVATNSAGVRYSSPANLYVRVRRVAPRFSILPMSHEIMPGGNVNITCVAVGSPMPYVKWMQGAEDLTPEDDM-----PVGRNVLE---------LT----------DVKDSANYT--CVAMSS---LGVIEAVAQITVKSLPKAPG----TPVVTENTATSITVTWD--SGNPDPVSYYVIEYKSKSQDGP-----YQIKEDITTTRYSIGGLSPNSEYEIWVSAVNSIGQGPPSESVVTRTGEQAPASAPRNVQARMLSATTMIVQWE--EPVEPNGLIRGYRVYYTMEPE-----------HPVGNWQKHNVDDSLLTTVGSLLEDETYTVRVLAFTSVGDGPLSDPIQVKT-QQGVPGQPMNLRAEAKSETSIGLSWSAPRQESVIKYELLFREGDRGREVGRTFDPTTAFVVED--------LKPNTEYAFRLAARSPQGLGAF----TAVVRQ--------RTLQAKPSAPPQDVKCTSLRSTAILVSWRPPPPETHNGALVGYSVRYRPLGSEDPDPKEVNNIPPTTTQILLEALEKWTEYRVTAVAYTEVGPGPESSP--VVVRTDEDVPSAPPRKVEAEALNATAIRVLWRSPTPGRQ---HGQIRGYQVHYVRMEGAEARGPPRIKDIMLADAQEMVITNLQPETAYSITVAAYTMKG 794          

HSP 5 Score: 68.9366 bits (167), Expect = 5.677e-10
Identity = 66/265 (24.91%), Postives = 119/265 (44.91%), Query Frame = 1
Query: 2164 SDLVSTMKSVPSDSPKDLVVKEIDSNSALVSWKPLDQVHSNGIITHYEVRYYAPKKEESTERF----INVSETSAILSNLKYFHYVIYVRAFTKVGGGSWSNPKNYYRQNLEEFP-IPTTIKGERKSETEINISWELPVLSEKNLAHAAIEGFIILYAPVESSPKWIKYTVQSKNLSAVIKGLEPDLRYQFQIAATNYAGFNGNFSEIV-----QEMPKNFPNLNLKTVPDLRCSVQSSNRLKVEWSSPSISTD---LLKFEIRY 2919
            S +  T +  P+ +P+++  + + + + +V W+  + V  NG+I  Y V YY  + E     +    ++ S  + + S L+   Y + V AFT VG G  S+P     Q  +  P  P  ++ E KSET I +SW  P          ++  + +L+   +   + +  T      + V++ L+P+  Y F++AA +  G  G F+ +V     Q  P   P        D++C+   S  + V W  P   T    L+ + +RY
Sbjct:  403 SVVTRTGEQAPASAPRNVQARMLSATTMIVQWE--EPVEPNGLIRGYRV-YYTMEPEHPVGNWQKHNVDDSLLTTVGSLLEDETYTVRVLAFTSVGDGPLSDPIQVKTQ--QGVPGQPMNLRAEAKSETSIGLSWSAP-------RQESVIKYELLFREGDRG-REVGRTFDPTT-AFVVEDLKPNTEYAFRLAARSPQGL-GAFTAVVRQRTLQAKPSAPPQ-------DVKCTSLRSTAILVSWRPPPPETHNGALVGYSVRY 645          
BLAST of Protein tyrosine phosphatase receptor type D vs. UniProt/SwissProt
Match: sp|A2A8L5|PTPRF_MOUSE (Receptor-type tyrosine-protein phosphatase F OS=Mus musculus OX=10090 GN=Ptprf PE=1 SV=1)

HSP 1 Score: 718.383 bits (1853), Expect = 0.000e+0
Identity = 335/606 (55.28%), Postives = 434/606 (71.62%), Query Frame = 1
Query: 4006 SDSIKLRIGSQKSENISDRPSISICNLYQYVTDLKANDCTLLQAEFETLNTNLDDRFTWQRSNIDSNKSKNRYANVVAYDHTSVLLTPVDDVIGSDYINANYIDGYQRQNAYIATQGPLPDTTDDFWRMVWEQRSNCIVMMTRLEERSGIKCHQYWPNRGFICYGQMIVSHIDTFVLAYYTIRLFEIRHSKYSEKREIQHFQFTAWPDHGVPKLSTPLLMFIRRVRSIGKIESCPKIVHCSAGVGRTGAFIVVDAQLERIKQEKNIDVFNYVSKIRCQRNYMVQTQAQYQFILETLLEAVEDGNTEVMACNFHAHVTKLSQIGISGSNQLSGFEMEFSKLNSLASNRGRHGVMLADFVKAAGNQAVNMTKNRVRNIIPYEWNRVVLNAIRGIEGSDYINASYIDGYRDRRAYIAAQSPIPSTVEDFWRMLWDQHCGVVIVLNQPHE---DKSHIYWPINKSIRYQFFVVDPVVEYNMPNYILREFKVTDARDGEFRALRQFQFTQWPNHGCPKESESILDFIRQVHKTKEQFGHMEPMVIHCNTGSGRTGVFIALSIVLDRLQQESVVDMYQTVKLLHKQRIGLVQTEEQYEFCYMAVLDYLSNYE 5814
            SD +++R  + ++  + D P I I +L   +  LKAND      E+E+++     +FTW+ SN + NK KNRYANV+AYDH+ VLLT +D V GSDYINANYIDGY++QNAYIATQGPLP+T  DFWRMVWEQR+  +VMMTRLEE+S +KC QYWP RG   YG + V+ +DT  LA YT+R F +  S  SEKRE++ FQF AWPDHGVP+  TP+L F+RRV++   +++ P +VHCSAGVGRTG FIV+DA LER+K EK +D++ +V+ +R QRNYMVQT+ QY FI E LLEA   G+TEV+A N +AH+ KL Q+    S  ++  E+EF  L +  ++  R       FV A  N   N  KNR+ NI+PYE  RV L  IRG+EGSDYINAS++DGYR ++AYIA Q P+  + EDFWRMLW+ +  ++++L +  E   +K H YWP  +S RYQ+FVVDP+ EYNMP YILREFKVTDARDG+ R +RQFQFT WP  G PK  E  +DFI QVHKTKEQFG   P+ +HC+ G GRTGVFI LSIVL+R++ E VVDM+QTVK L  QR  +VQTE+QY+ CY A L+YL +++
Sbjct: 1302 SDPVEMRRLNYQTPGMRDHPPIPITDLADNIERLKANDGLKFSQEYESIDPG--QQFTWENSNSEVNKPKNRYANVIAYDHSRVLLTSIDGVPGSDYINANYIDGYRKQNAYIATQGPLPETMGDFWRMVWEQRTATVVMMTRLEEKSRVKCDQYWPVRGTETYGLIQVTLVDTVELATYTMRTFALHKSGSSEKRELRQFQFMAWPDHGVPEYPTPILAFLRRVKACNPLDAGPMVVHCSAGVGRTGCFIVIDAMLERMKHEKTVDIYGHVTCMRSQRNYMVQTEDQYVFIHEALLEAAMCGHTEVLARNLYAHIQKLGQVPPGES--VTAMELEFKLLANSKAHTSR-------FVSA--NLPCNKFKNRLVNIMPYELTRVCLQPIRGVEGSDYINASFLDGYRQQKAYIATQGPLAESTEDFWRMLWEHNSTIIVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTIRQFQFTDWPEQGVPKTGEGFIDFIGQVHKTKEQFGQDGPITVHCSAGVGRTGVFITLSIVLERMRYEGVVDMFQTVKTLRTQRPAMVQTEDQYQLCYRAALEYLGSFD 1894          

HSP 2 Score: 161.384 bits (407), Expect = 4.910e-38
Identity = 226/964 (23.44%), Postives = 386/964 (40.04%), Query Frame = 1
Query:  277 NSQITFTENDEAPK----ISLIIQSPNVLLFKSMILACSSTGHPVPSISWKINESPIEELKSPLKKLQNPPRIFSIKNYQNSVLVITQLIESDSNSVLICEAENNAGFD-SRQQQLKVISTETDIPSGFPVFQNNFFPIIKPYNSNVTLVCQAYGNPPPLIQWFKNYELINESFTKIKILNDGN--LLLVQVTREDKGIYHCQAQNTNGLRLSDPSTLDITSYPISPNSLIIERFASDNVEISWRSGLNDVTEQENFI-LHYREVPENITEKQIMSKFVYLTISEKKSIYKYNLKDLFPFTTYCIWMESENPLGVSPPTIALTVKTLPTSPQLSPRSITATSISNTAILVAWRPPERKFGKFKYYQIIYTNNDGFLPQHWRQFAVKDDNVMLT---HLIASELYHIRVKIVNEIGHGPLSKTISIKTIAGTLSQCPDFKITEIFQSHIKLQWGTPDPVKLFKLIQYNLLCWDVRLKIVNATAKSSTLFPILNHNLSMNEMEYVLYLKNEKEIKCRLSAINSDGKGM--PT-EIQASTVNKGVNYQNLIHIDKIGSTYITFQWRPPSKFSFDYFLWIYQIFDSEKLDRAVKLPKIKINISDSASAENGWFVYNYTNAFSSSRYILGL------RYLCRDSTDILREYVHRSDLVSTMKSVPSDSPKDLVVKEIDSNSALVSWKPLDQVHSNGIITHYEVRYY-----APKKEESTERFINVSETSAILSNL-KYFHYVIYVRAFTKVGGGSWSNPKNYYRQNLEEFPIPTTIKGERKSETEINISWELPVLSEKNLAHAAIEGFIILYAPV-ESSPKWIKYTVQSKNLSAVIKGLEPDLRYQFQIAATNYAGFNGNFSEIV---QEMPKNFPNLNLKTVPDLRCSVQSSNRLKVEWSSPSISTDLLKFEIRYSGNLSYITEIGLKKSEFIDMESKSVNFETLVNRYDVTLENLQSNALYKIAVRA 3078
            +++++  E D+ P     I +  Q   V   ++  + C++ G+P P ISW  +  P++   S  +          IK  ++  L I    ESD      C A N+AG   S    L V           P       P       +V L C A G P P ++W     +  E  TK   +  G   L L  V R     Y C A ++ G+ +   + + + + P  P  L++    + +V ++W SG    TE  +F  + YR    +   +++          +  +  +Y++  L PF+ Y   + + N +G  PP+ A+  +T   +P   PR + A  +S + +LV W PPE   G  + Y++ YT +       W +     D  +LT    L+    Y +RV     +G GP S TI +KT  G  +Q  DF+      + I+L W  P      ++++Y L+ W    +         T  P  ++ L          LK +     +L+A +  G G+  PT E + +        Q +  +   GST +   W PP   S +  +  Y +        AV     K ++ D  S E+            SS  +LGL      R   R  TD+         LV T + VPS  P+ + V+ ++S +  VSWK       +G I  Y+V Y       P+ +   +  +        +S L     Y I V A+T  G G+ S PK            PT +       T + + W  P    K L    + G+ + Y    E+ P  I +    ++ +  + GL     Y F++AA N AG    F + +   +++P  FP        +LR +  +++  ++ W  P ++          +G+++  T +      + D+ S+ +  + + N   +TL  L+ +  Y I VRA
Sbjct:  119 SAKLSVLEEDQLPSGFPTIDMGPQLKVVEKGRTATMLCAAGGNPDPEISWFKDFLPVDPAASNGR----------IKQLRSGALQIESSEESDQGK-YECVATNSAGTRYSAPANLYVRVRRVAPRFSIPPSSQEVMP-----GGSVNLTCVAVGAPMPYVKWM----MGAEELTKEDEMPVGRNVLELSNVMRSAN--YTCVAISSLGM-IEATAQVTVKALPKPPIDLVVTETTATSVTLTWDSG---NTEPVSFYGIQYRAAGTDGPFQEV----------DGVASTRYSIGGLSPFSEYAFRVLAVNSIGRGPPSEAVRARTGEQAPSSPPRRVQARMLSASTMLVQWEPPEEPNGLVRGYRVYYTPDSRRPLSAWHKH--NTDAGLLTTVGSLLPGITYSLRVLAFTAVGDGPPSPTIQVKTQQGVPAQPADFQANAESDTRIQLSWLLP---PQERIVKYELVYWAAEDE---GQQHKVTFDPTSSYTLE--------DLKPDTLYHFQLAARSDLGVGVFTPTVEARTAQSTPSAPPQKVTCV-STGSTTVRVSWVPPPADSRNGIITQYSV-----AYEAVDGEDRKRHVVDGISREH------------SSWDLLGLEKWTEYRVWVRAHTDVGPGPESSPVLVRTDEDVPSGPPRKVEVEPLNSTAVHVSWKLPVPNKQHGQIRGYQVTYVRLENGEPRGQPIIQDVMLAEAQETTISGLTPETTYSITVAAYTTKGDGARSKPKVVTTTGAVPG-RPTMMVSTTAMHTAL-LQWHPP----KELP-GELLGYRLQYRRADEARPNTIDFGKDDQHFT--VTGLHKGATYVFRLAAKNRAGPGEEFEKEITTPEDVPSGFPQ-------NLRVTGLTTSTTELTWDPPVLA--------ERNGHITNYTVV------YRDINSQ-LELQNVTNDTHLTLLGLKPDTTYDIKVRA 981          

HSP 3 Score: 157.147 bits (396), Expect = 8.441e-37
Identity = 243/1122 (21.66%), Postives = 413/1122 (36.81%), Query Frame = 1
Query:  235 NR*MFWIITQLVLINSQITFTENDEAPKISLIIQSPNVLLFKSMILACSSTGHPVPSISWKINESPIEELKSPLKKLQNPPRIFSIKNYQNSVLVITQLIESDSNSVLICEAENNAGFDSRQQQLKVISTETDIPSGFPVFQNNFFPIIKPYNSNVTLVCQAYGNPPPLIQWFKNYELINESFT--KIKILNDGNLLLVQVTREDKGIYHCQAQNTNGLRLSDPSTLDI------TSYPISPNSLIIERFASDNVE----------ISWRSGLNDVTEQENFILHYREVPENITE-KQIMSKFVYLTISEKKSIYKYNLKDLFPFTTYCIWMESENPLGVSPPTIALTVKTLPTSPQLSPRSITATSISNTAILVAWRPPERKFGKFKYYQIIYTNNDGFLPQHWRQFAVKDDNVMLTHLIASELYHIRVKIVNEIGHGPLSKTISIKTIAGTLSQCP-DFKITEIFQSHIKLQWGTPDPVKLFKLIQYNLLCWDVRLKIVNATAKSSTLFPILNHNLSMNEMEYVLYLKNEKEIKCRLSAINSDGKGMPTEIQASTVNKGVNYQNL-IHIDKIGSTYITFQW-RPPSKFSFDYFLWIYQIFDSEKLDRAVKLPKIKINISDSASAENGWFVYNYTNAFSSSRYILGLRYLCRDSTDILREYVHRSDLVSTMKSVPSDSPKDLVVKEIDSNSALVSWKPLDQVHSNGIITHYEVRYYAPKKEESTERFIN--VSETSA--ILSNLKYFHYVIYVRAFTKVGGGSWSNPKNYYRQNLEEFP--IPTTIKGERKSETEINISWELPVLSEKNLAHAAIEGFIILYAPVESSPKWIKYTVQSKNLS----AVIKGLEPDLRYQFQIAATNYAGFNGNFSEIVQEMPKNFPNLNLKTVPDLRCSVQSSNRLKVEWSSP-SISTDLLKFEIRYSGNLSYITEIGLKKSEFIDMESKSVNFETLVNRYDVTLENLQSNALYKIAVRAIYQNKELYESHRETTCDTMPAVPNLVKPPIIVGLDEEKSKVIIKLHRCSQRNGKISYYFVIVAAFQGNKNQQISFQEDTES--YTFMELSVNT------RSNNAKG----------EYIAIMKDINDIFKVSGKDHSSVLL 3447
             R M  ++  LV++   +     D  P    + +    L        C +TG P P I+W         +K   K       +    +   SVL I  L      ++  C A N+ G  +   +L V+  E  +PSGFP         +       T++C A GNP P I WFK++  ++ + +  +IK L  G L +      D+G Y C A N+ G R S P+ L +        + I P+S  +    S N+           + W  G  ++T+++        V  N+ E   +M    Y                       C+ + S   LG+   T  +TVK LP  P      +  T  + T++ + W     +   F   Q      DG   +      V      +  L     Y  RV  VN IG GP S+ +  +T     S  P   +   +  S + +QW  P+        + N L    R+     + +  + +    HN     +  V  L        R+ A  + G G P+        +GV  Q      +    T I   W  PP +    Y L  +   D  +  +    P     + D         +Y++  A   +R  LG+         +    V       T +S PS  P+ +      S +  VSW P      NGIIT Y V Y A   E+     ++    E S+  +L   K+  Y ++VRA T VG G  S+P     +  E+ P   P  ++ E  + T +++SW+LPV    N  H  I G+ + Y  +E+     +  +Q   L+      I GL P+  Y   +AA    G        V       P       P +  S  + +   ++W  P  +  +LL + ++Y            ++++  +    +++F      + VT  +  +  ++++A +      E +E    T  D     P  ++   + GL    +++       ++RNG I+ Y V+      + N Q+  Q  T     T + L  +T      R++ +KG            + + +     F+V+    +SVLL
Sbjct:    8 GRRMVPLVPALVMLG-LMAGAHGDSKPVFVKVPEDQTGLSGGVASFVCQATGEPKPRITW---------MKKGKKVSSQRFEVIEFDDGAGSVLRIQPLRVQRDEAIYECTATNSLGEINTSAKLSVLE-EDQLPSGFPTIDMGPQLKVVEKGRTATMLCAAGGNPDPEISWFKDFLPVDPAASNGRIKQLRSGALQIESSEESDQGKYECVATNSAGTRYSAPANLYVRVRRVAPRFSIPPSSQEVMPGGSVNLTCVAVGAPMPYVKWMMGAEELTKEDEM-----PVGRNVLELSNVMRSANYT----------------------CVAISS---LGMIEATAQVTVKALPKPPI----DLVVTETTATSVTLTWDSGNTEPVSFYGIQYRAAGTDGPFQE---VDGVASTRYSIGGLSPFSEYAFRVLAVNSIGRGPPSEAVRARTGEQAPSSPPRRVQARMLSASTMLVQWEPPE--------EPNGLVRGYRVYYTPDSRRPLSAW--HKHNTDAGLLTTVGSLLPGITYSLRVLAFTAVGDGPPSPTIQVKTQQGVPAQPADFQANAESDTRIQLSWLLPPQERIVKYELVYWAAEDEGQQHKVTFDPTSSYTLEDLKPDT----LYHFQLA---ARSDLGV--------GVFTPTVE----ARTAQSTPSAPPQKVTCVSTGSTTVRVSWVPPPADSRNGIITQYSVAYEAVDGEDRKRHVVDGISREHSSWDLLGLEKWTEYRVWVRAHTDVGPGPESSP--VLVRTDEDVPSGPPRKVEVEPLNSTAVHVSWKLPV---PNKQHGQIRGYQVTYVRLENGEPRGQPIIQDVMLAEAQETTISGLTPETTYSITVAAYTTKGDGARSKPKVVTTTGAVPGR-----PTMMVSTTAMHTALLQWHPPKELPGELLGYRLQY------------RRAD--EARPNTIDFGKDDQHFTVTGLHKGATYVFRLAAKNRAGPGEEFEKEITTPEDVPSGFPQNLR---VTGLTTSTTELTWDPPVLAERNGHITNYTVVYR----DINSQLELQNVTNDTHLTLLGLKPDTTYDIKVRAHTSKGAGPLSPSIQSRTMPVEQVFAKNFRVAAAMKTSVLL 1021          
BLAST of Protein tyrosine phosphatase receptor type D vs. UniProt/SwissProt
Match: sp|Q13332|PTPRS_HUMAN (Receptor-type tyrosine-protein phosphatase S OS=Homo sapiens OX=9606 GN=PTPRS PE=1 SV=3)

HSP 1 Score: 717.227 bits (1850), Expect = 0.000e+0
Identity = 333/593 (56.16%), Postives = 432/593 (72.85%), Query Frame = 1
Query: 4045 ENISDRPSISICNLYQYVTDLKANDCTLLQAEFETLNTNLDDRFTWQRSNIDSNKSKNRYANVVAYDHTSVLLTPVDDVIGSDYINANYIDGYQRQNAYIATQGPLPDTTDDFWRMVWEQRSNCIVMMTRLEERSGIKCHQYWPNRGFICYGQMIVSHIDTFVLAYYTIRLFEIRHSKYSEKREIQHFQFTAWPDHGVPKLSTPLLMFIRRVRSIGKIESCPKIVHCSAGVGRTGAFIVVDAQLERIKQEKNIDVFNYVSKIRCQRNYMVQTQAQYQFILETLLEAVEDGNTEVMACNFHAHVTKLSQIGISGSNQLSGFEMEFSKLNSLASNRGRHGVMLADFVKAAGNQAVNMTKNRVRNIIPYEWNRVVLNAIRGIEGSDYINASYIDGYRDRRAYIAAQSPIPSTVEDFWRMLWDQHCGVVIVLNQPHE---DKSHIYWPINKSIRYQFFVVDPVVEYNMPNYILREFKVTDARDGEFRALRQFQFTQWPNHGCPKESESILDFIRQVHKTKEQFGHMEPMVIHCNTGSGRTGVFIALSIVLDRLQQESVVDMYQTVKLLHKQRIGLVQTEEQYEFCYMAVLDYLSNYE 5814
            E++   P I I ++ ++   LKAND   L  E+E+++     +FTW+ SN++ NK KNRYANV+AYDH+ V+L P++ ++GSDYINANY+DGY+ QNAYIATQGPLP+T  DFWRMVWEQRS  IVMMTRLEE+S IKC QYWPNRG   YG + V+ +DT  LA + +R F +  +  SEKRE++ FQFTAWPDHGVP+  TP L F+RRV++    ++ P +VHCSAGVGRTG FIV+DA LERIK EK +DV+ +V+ +R QRNYMVQT+ QY FI E LLEAV  GNTEV A + +A++ KL+Q  +     ++G E+EF +L +  ++  R       F+ A  N   N  KNR+ NI+PYE  RV L  IRG+EGSDYINAS+IDGYR ++AYIA Q P+  T EDFWRMLW+ +  +V++L +  E   +K H YWP  +S RYQ+FVVDP+ EYNMP YILREFKVTDARDG+ R +RQFQFT WP  G PK  E  +DFI QVHKTKEQFG   P+ +HC+ G GRTGVFI LSIVL+R++ E VVD++QTVK+L  QR  +VQTE++Y+FCY A L+YL +++
Sbjct: 1365 ESMLSHPPIPIADMAEHTERLKANDSLKLSQEYESIDPG--QQFTWEHSNLEVNKPKNRYANVIAYDHSRVILQPIEGIMGSDYINANYVDGYRCQNAYIATQGPLPETFGDFWRMVWEQRSATIVMMTRLEEKSRIKCDQYWPNRGTETYGFIQVTLLDTIELATFCVRTFSLHKNGSSEKREVRQFQFTAWPDHGVPEYPTPFLAFLRRVKTCNPPDAGPIVVHCSAGVGRTGCFIVIDAMLERIKPEKTVDVYGHVTLMRSQRNYMVQTEDQYSFIHEALLEAVGCGNTEVPARSLYAYIQKLAQ--VEPGEHVTGMELEFKRLANSKAHTSR-------FISA--NLPCNKFKNRLVNIMPYESTRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWENNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDEYQFCYQAALEYLGSFD 1944          

HSP 2 Score: 204.912 bits (520), Expect = 2.337e-51
Identity = 105/262 (40.08%), Postives = 151/262 (57.63%), Query Frame = 1
Query: 5092 NQAVNMTKNRVRNIIPYEWNRVVLNAIRGIEGSDYINASYIDGYRDRRAYIAAQSPIPSTVEDFWRMLWDQHCGVVIVLNQPHEDKSHI----YWPINKSIRYQFFVVDPVVEYNMPNYILREFKVTDARDGEFRALRQFQFTQWPNHGCPKESESILDFIRQVHKTKEQFGHMEPMVIHCNTGSGRTGVFIALSIVLDRLQQESVVDMYQTVKLLHKQRIGLVQTEEQYEFCYMAVLDYLSNYEKILEKSHLY*TYQDLSE 5865
            N  VN  KNR  N+I Y+ +RV+L  I GI GSDYINA+Y+DGYR + AYIA Q P+P T  DFWRM+W+Q    ++++ +  E+KS I    YWP   +  Y F  V  +    +  + +R F +      E R +RQFQFT WP+HG P+     L F+R+V           P+V+HC+ G GRTG FI +  +L+R++ E  VD+Y  V L+  QR  +VQTE+QY F + A+L+ +      +    LY   Q L++
Sbjct: 1412 NLEVNKPKNRYANVIAYDHSRVILQPIEGIMGSDYINANYVDGYRCQNAYIATQGPLPETFGDFWRMVWEQRSATIVMMTR-LEEKSRIKCDQYWPNRGTETYGFIQVTLLDTIELATFCVRTFSLHKNGSSEKREVRQFQFTAWPDHGVPEYPTPFLAFLRRVKTCNPP--DAGPIVVHCSAGVGRTGCFIVIDAMLERIKPEKTVDVYGHVTLMRSQRNYMVQTEDQYSFIHEALLEAVGCGNTEVPARSLYAYIQKLAQ 1670          

HSP 3 Score: 147.132 bits (370), Expect = 1.134e-33
Identity = 210/979 (21.45%), Postives = 393/979 (40.14%), Query Frame = 1
Query:  268 VLINSQITFTENDEAPK----ISLIIQSPNVLLFKSMILACSSTGHPVPSISWKINESPIEELKSPLKKLQNPPRIFSIKNYQNSVLVITQLIESDSNSVLICEAENNAGFDSRQQQLKVISTETDIPSGFPVFQNNFFPI---IKPYNSNVTLVCQAYGNPPPLIQWFKNYELINESFTKIKILNDGNLLLVQVTREDKGIYHCQAQNTNGLRLSDPSTLDITSYPISPNSLIIERFASDNVEISWRSGLNDVTEQENFILHYREVPENITEKQIMSKFVYLTISEKKSIYKYNLKDLFPFTTYCIWMESENPLGVSPPTIALTVKTLPTSPQLSPRSITATSISNTAILVAWRPPERKFGKFKYYQIIYTNNDGFLPQHWRQFAVKDDNVMLT--HLIASELYHIRVKIVNEIGHGPLSKTISIKTIAGTLSQCPDFKITEIFQSHIKLQWGTPDPVKLFKLIQYNLLCWDV-RLKIVNATAKSSTLFPILNHNLSMNEMEYVLYLKNEKEIKCRLSAINSDGKGMPTEI--QASTVNKGVNYQNLIHIDKIGSTYITFQWRPPSKFSFDYFLWIYQIFDSEKLDRAVKLPKIKINISDSAS-----AENGWFVYNYTNAFSSSRYILGLRYLCRDSTDILREYVHRSDLVSTMKSVPSDSPKDLVVKEIDSNSALVSWKPLDQVHSNGIITHYEVRYYAPKKEES--TERFINV------------SETSAILSNLK-YFHYVIYVRAFTKVGGGSWSNPKNYYRQN-LEEFPIPTTIKGERKSETEINISWELPVLSEKNLAHAAIEGFIILYAPVESSP-KWIKYTVQSKNLSAVIKGLEPDLRYQFQIAATNYAGFNGNFSEIV---QEMPKNFPNLNLKTVPDLRCSVQSSNRLKVEWSSPSIS---TDLLKF--EIRYSGNLSYITEIGLKKSEFIDMESKSVNFETLVNRYDVTLENLQSNALYKIAVRA 3078
            + +++++T    D+ P     I +  Q   V   ++  + C+++G+P P I+W  +  P++   S  +  Q     F     + + L I    E+D      C A N+AG          +    ++    P F  +  P+   I P   NV + C A G+P P ++W +      E  T    +  G  +L     +D   Y C A ++ G+ +   + + + S P +P + ++    + ++ I+W SG  D      +++ Y+            S+     I E  +  +Y++  L P + Y IW+ + N +G  PP+ ++  +T   +P  +PR++ A  +S T ++V W  P    G  + Y++ YT        +W++  V DD+++ T   L+  E Y +RV     +G GPLS  I +KT  G   Q  + +     ++ I L W  P   +   +I+Y LL  +    + V  T   +T + + +             LK   E   RL+A +  G G  T +  Q +  +K       +    + ST I   WRPP   + +  L  Y +     L      PK    I  + +     A   W  Y  T                   T++         +V T + VPS  P+ +  + +++ +  V W+       +G I  Y+V Y   +  E+    R  +V            +E   +++NL+    Y I V A+T  G G+ S PK    +  +   P   T+  ++  E  +   WE P       A   + G+ + +   +S+P   +++       +A   G+     Y F++AA +  G     +E++   ++ P+  P + L+   +      S+  + + W  P  +     ++K+   +R +G L    E  L  +     E+             +TL+ L+ +  Y + VRA
Sbjct:  116 ITVHAKLTVLREDQLPSGFPNIDMGPQLKVVERTRTATMLCAASGNPDPEITWFKDFLPVDPSASNGRIKQLRSETFESTPIRGA-LQIESSEETDQGKYE-CVATNSAGVRYSSPANLYVRELREVRRVAPRF--SILPMSHEIMP-GGNVNITCVAVGSPMPYVKWMQG----AEDLTPEDDMPVGRNVLELTDVKDSANYTCVAMSSLGV-IEAVAQITVKSLPKAPGTPMVTENTATSITITWDSGNPDPVSY--YVIEYKS----------KSQDGPYQIKEDITTTRYSIGGLSPNSEYEIWVSAVNSIGQGPPSESVVTRTGEQAPASAPRNVQARMLSATTMIVQWEEPVEPNGLIRGYRVYYTMEPEHPVGNWQKHNV-DDSLLTTVGSLLEDETYTVRVLAFTSVGDGPLSDPIQVKTQQGVPGQPMNLRAEARSETSITLSWSPP---RQESIIKYELLFREGDHGREVGRTFDPTTSYVVED-------------LKPNTEYAFRLAARSPQGLGAFTPVVRQRTLQSKPSAPPQDVKCVSVRSTAILVSWRPPPPETHNGALVGYSV-RYRPLGSEDPEPKEVNGIPPTTTQILLEALEKWTQYRITTV---------------AHTEVGPGPESSPVVVRTDEDVPSAPPRKVEAEALNATAIRVLWRSPAPGRQHGQIRGYQVHYVRMEGAEARGPPRIKDVMLADAQWETDDTAEYEMVITNLQPETAYSITVAAYTMKGDGARSKPKVVVTKGAVLGRP---TLSVQQTPEGSLLARWEPPA----GTAEDQVLGYRLQFGREDSTPLATLEFPPSEDRYTA--SGVHKGATYVFRLAARSRGGLGEEAAEVLSIPEDTPRGHPQI-LEAAGN-----ASAGTVLLRWLPPVPAERNGAIVKYTVAVREAGALGPARETELPAAAEPGAENA------------LTLQGLKPDTAYDLQVRA 1012          

HSP 4 Score: 142.124 bits (357), Expect = 3.198e-32
Identity = 224/973 (23.02%), Postives = 376/973 (38.64%), Query Frame = 1
Query:  370 LACSSTGHPVPSISW-----KINESPIEELKSPLKKLQNPPRIFSIKNYQNSVLVITQLIESDSNSVLICEAENNAGFDSRQQQLKVISTETDIPSGFPVFQNNFFPIIKPYNSNVTLVCQAYGNPPPLIQWFKNYELINESFT--KIKILND---------GNLLLVQVTREDKGIYHCQAQNTNGLRLSDPSTLDITSY----PISPNSLII----ERFASDNVEIS------------WRSGLNDVTEQENFILHYREVPENITEKQIMSKFVYLTISEKKSIYKYNLKDLFPFTTYCIWMESENPLGVSPPTIALTVKTLPTSPQLSPRSITATSISNTAILVAWRPPERKFGKFKYYQIIYTNNDGFLPQHWRQFAVKDDNVMLTHLIAS----ELYHIRVKIVNEIGHGPLSKTISIKTIAGTLSQCP-DFKITEIFQSHIKLQWGTPDPVKLFKLIQYNLLCWDVRLKIVNATAKSSTLFPILN---HNLSMNEMEYVLYLKNEKEIKCRLSAINSDGKG-MPTEIQASTVNKGVNYQNL-IHIDKIGSTYITFQWRPPSKFSFDYFLWIYQIFDSEKLDRAVKLPKIKINISDSASAENGWFVYNYTNAFS-SSRYILGLRYLCRDSTDILREYVHRSDLVSTMKSVPSDSPKDLVVKEIDSNSALVSWKPLDQVHSNGIITHYEVRYYAPKKEESTERFIN---VSETSAILSNL-KYFHYVIYVRAFTKVGGGSWSNPKNYYRQNLEEFP--IPTTIKGERKSETEINISWELPVLSEKNLAHAAIEGFIILYAPVESS----PKWIK---------YTVQSKNLSAVIKGLEPDLRYQFQIAATNYAGFNGNFSE----IVQEMPKNFPNLNLKTVPDLRCSVQSSNRLKVEWSSPSISTDLLKFEIRYSGNLSYITEIGLKKSEFIDMESKSVNFETLVNRYDVTLENLQSNALYKIAVRA 3078
              C +TG P P ++W     K+N    E ++                    +VL I  L      +V  C A+N+ G  +   +L V+  E  +PSGFP         +       T++C A GNP P I WFK++  ++ S +  +IK L           G L +      D+G Y C A N+ G+R S P+ L +        ++P   I+    E     NV I+            W  G  D+T +++       V  N+ E         LT          ++KD   +T  C+ M S   LGV      +TVK+LP +P     +   T  + T+I + W           YY I Y +     P     + +K+D     + I        Y I V  VN IG GP S+++  +T     +  P + +   +  + + +QW   +PV+   LI+   + + +  +            P+ N   HN+  + +  V  L  ++    R+ A  S G G +   IQ  T  +GV  Q + +  +    T IT  W PP + S   +  +++  D  +       P     + D           N   AF  ++R   GL       T ++R+         T++S PS  P+D+    + S + LVSW+P      NG +  Y VRY     E+   + +N    + T  +L  L K+  Y I   A T+VG G  S+P     +  E+ P   P  ++ E  + T I + W  P    +   H  I G+ + Y  +E +    P  IK          T  +     VI  L+P+  Y   +AA    G +G  S+    + +      P L+++  P+          L   W  P+ + +           L Y  + G + S  +     ++ F    +RY  +  +  +  ++++A R+
Sbjct:   52 FVCQATGDPKPRVTWNKKGKKVNSQRFETIE--------------FDESAGAVLRIQPLRTPRDENVYECVAQNSVGEITVHAKLTVLR-EDQLPSGFPNIDMGPQLKVVERTRTATMLCAASGNPDPEITWFKDFLPVDPSASNGRIKQLRSETFESTPIRGALQIESSEETDQGKYECVATNSAGVRYSSPANLYVRELREVRRVAPRFSILPMSHEIMPGGNVNITCVAVGSPMPYVKWMQGAEDLTPEDDM-----PVGRNVLE---------LT----------DVKDSANYT--CVAMSS---LGVIEAVAQITVKSLPKAPG----TPMVTENTATSITITWD--SGNPDPVSYYVIEYKSKSQDGP-----YQIKEDITTTRYSIGGLSPNSEYEIWVSAVNSIGQGPPSESVVTRTGEQAPASAPRNVQARMLSATTMIVQWE--EPVEPNGLIRGYRVYYTMEPE-----------HPVGNWQKHNVDDSLLTTVGSLLEDETYTVRVLAFTSVGDGPLSDPIQVKT-QQGVPGQPMNLRAEARSETSITLSWSPPRQESIIKYELLFREGDHGREVGRTFDPTTSYVVED--------LKPNTEYAFRLAARSPQGLGAF----TPVVRQ--------RTLQSKPSAPPQDVKCVSVRSTAILVSWRPPPPETHNGALVGYSVRYRPLGSEDPEPKEVNGIPPTTTQILLEALEKWTQYRITTVAHTEVGPGPESSP--VVVRTDEDVPSAPPRKVEAEALNATAIRVLWRSPAPGRQ---HGQIRGYQVHYVRMEGAEARGPPRIKDVMLADAQWETDDTAEYEMVITNLQPETAYSITVAAYTMKG-DGARSKPKVVVTKGAVLGRPTLSVQQTPE--------GSLLARWEPPAGTAE--------DQVLGYRLQFGREDSTPL----ATLEFPPSEDRYTASGVHKGATYVFRLAARS 909          
BLAST of Protein tyrosine phosphatase receptor type D vs. UniProt/SwissProt
Match: sp|Q64604|PTPRF_RAT (Receptor-type tyrosine-protein phosphatase F OS=Rattus norvegicus OX=10116 GN=Ptprf PE=2 SV=1)

HSP 1 Score: 717.227 bits (1850), Expect = 0.000e+0
Identity = 337/606 (55.61%), Postives = 436/606 (71.95%), Query Frame = 1
Query: 4006 SDSIKLRIGSQKSENISDRPSISICNLYQYVTDLKANDCTLLQAEFETLNTNLDDRFTWQRSNIDSNKSKNRYANVVAYDHTSVLLTPVDDVIGSDYINANYIDGYQRQNAYIATQGPLPDTTDDFWRMVWEQRSNCIVMMTRLEERSGIKCHQYWPNRGFICYGQMIVSHIDTFVLAYYTIRLFEIRHSKYSEKREIQHFQFTAWPDHGVPKLSTPLLMFIRRVRSIGKIESCPKIVHCSAGVGRTGAFIVVDAQLERIKQEKNIDVFNYVSKIRCQRNYMVQTQAQYQFILETLLEAVEDGNTEVMACNFHAHVTKLSQIGISGSNQLSGFEMEFSKLNSLASNRGRHGVMLADFVKAAGNQAVNMTKNRVRNIIPYEWNRVVLNAIRGIEGSDYINASYIDGYRDRRAYIAAQSPIPSTVEDFWRMLWDQHCGVVIVLNQPHE---DKSHIYWPINKSIRYQFFVVDPVVEYNMPNYILREFKVTDARDGEFRALRQFQFTQWPNHGCPKESESILDFIRQVHKTKEQFGHMEPMVIHCNTGSGRTGVFIALSIVLDRLQQESVVDMYQTVKLLHKQRIGLVQTEEQYEFCYMAVLDYLSNYE 5814
            SD +++R  + ++  + D P I I +L   +  LKAND      E+E+++     +FTW+ SN + NK KNRYANV+AYDH+ VLLT +D V GSDYINANYIDGY++QNAYIATQGPLP+T  DFWRMVWEQR   +VMMTRLEE+S +KC QYWP RG   YG + V+ +DT  LA YT+R F +  S  SEKRE++ FQF AWPDHGVP+  TP+L F+RRV++   +++ P +VHCSAGVGRTG FIV+DA LER+K EK +D++ +V+ +R QRNYMVQT+ QY FI E LLEA   G+TEV+A N +AH+ KL Q+    S  ++  E+EF KL  LA ++ R     + F+ A  N   N  KNR+ NI+PYE  RV L  IRG+EGSDYINAS++DGYR ++AYIA Q P+  + EDFWRMLW+ +  ++++L +  E   +K H YWP  +S RYQ+FVVDP+ EYNMP YILREFKVTDARDG+ R +RQFQFT WP  G PK  E  +DFI QVHKTKEQFG   P+ +HC+ G GRTGVFI LSIVL+R++ E VVDM+QTVK L  QR  +VQTE+QY+ CY A L+YL +++
Sbjct: 1302 SDPVEMRRLNYQTPGMRDHPPIPITDLADNIERLKANDGLKFSQEYESIDPG--QQFTWENSNSEVNKPKNRYANVIAYDHSRVLLTSIDGVPGSDYINANYIDGYRKQNAYIATQGPLPETMGDFWRMVWEQRIATVVMMTRLEEKSRVKCDQYWPARGTETYGLIQVTLVDTVELATYTMRTFALHKSGSSEKRELRQFQFMAWPDHGVPEYPTPILAFLRRVKACNPLDAGPMVVHCSAGVGRTGCFIVIDAMLERMKHEKTVDIYGHVTCMRSQRNYMVQTEDQYVFIHEALLEAAMCGHTEVLARNLYAHIQKLGQVPPGES--VTAMELEF-KL--LAGSKAR----ASRFISA--NLPCNKFKNRLVNIMPYELTRVCLQPIRGVEGSDYINASFLDGYRQQKAYIATQGPLAESTEDFWRMLWEHNSTIIVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTIRQFQFTDWPEQGVPKTGEGFIDFIGQVHKTKEQFGQDGPITVHCSAGVGRTGVFITLSIVLERMRYEGVVDMFQTVKTLRTQRPAMVQTEDQYQLCYRAALEYLGSFD 1894          

HSP 2 Score: 159.458 bits (402), Expect = 1.670e-37
Identity = 227/964 (23.55%), Postives = 382/964 (39.63%), Query Frame = 1
Query:  277 NSQITFTENDEAPK----ISLIIQSPNVLLFKSMILACSSTGHPVPSISWKINESPIEELKSPLKKLQNPPRIFSIKNYQNSVLVITQLIESDSNSVLICEAENNAGFD-SRQQQLKVISTETDIPSGFPVFQNNFFPIIKPYNSNVTLVCQAYGNPPPLIQWFKNYELINESFTKIKILNDGN--LLLVQVTREDKGIYHCQAQNTNGLRLSDPSTLDITSYPISPNSLIIERFASDNVEISWRSGLNDVTEQENFI-LHYREVPENITEKQIMSKFVYLTISEKKSIYKYNLKDLFPFTTYCIWMESENPLGVSPPTIALTVKTLPTSPQLSPRSITATSISNTAILVAWRPPERKFGKFKYYQIIYTNNDGFLPQHWRQFAVKDDNVMLT---HLIASELYHIRVKIVNEIGHGPLSKTISIKTIAGTLSQCPDFKITEIFQSHIKLQWGTPDPVKLFKLIQYNLLCWDVRLKIVNATAKSSTLFPILNHNLSMNEMEYVLYLKNEKEIKCRLSAINSDGKGM--PTEIQASTVNKGVNY-QNLIHIDKIGSTYITFQWRPPSKFSFDYFLWIYQIFDSEKLDRAVKLPKIKINISDSASAENGWFVYNYTNAFSSSRYILGL------RYLCRDSTDILREYVHRSDLVSTMKSVPSDSPKDLVVKEIDSNSALVSWKPLDQVHSNGIITHYEVRYY-----APKKEESTERFINVSETSAILSNL-KYFHYVIYVRAFTKVGGGSWSNPKNYYRQNLEEFPIPTTIKGERKSETEINISWELPVLSEKNLAHAAIEGFIILYAPV-ESSPKWIKYTVQSKNLSAVIKGLEPDLRYQFQIAATNYAGFNGNFSEIV---QEMPKNFPNLNLKTVPDLRCSVQSSNRLKVEWSSPSISTDLLKFEIRYSGNLSYITEIGLKKSEFIDMESKSVNFETLVNRYDVTLENLQSNALYKIAVRA 3078
            +++++  E D+ P     I +  Q   V   ++  + C++ G+P P ISW  +  P++   S  +          IK  ++  L I    ESD      C A N+AG   S    L V           P       P       NV L C A G P P ++W     +  E  TK   +  G   L L  V R     Y C A ++ G+ +   + + + + P  P  L++    + +V ++W SG    TE  +F  + YR    +   +++          +  +  +Y++  L PF+ Y   + + N +G  PP+ A+  +T   +P   PR + A  +S + +LV W PPE   G  + Y++ YT +       W +     D  +LT    L+    Y +RV     +G GP S TI +KT  G  +Q  DF+      + I+L W  P      ++I+Y L+ W    +         T  P  ++ L          LK +     +L+A +  G G+  PT ++A T     +     +     GST +   W PP   S +  +  Y +        AV     K ++ D  S E+            SS  +LGL      R   R  TD+         LV T + VPS  P+ + V+ ++S +  VSWK       +G I  Y+V Y       P+ +   +  +        +S L     Y I V A+T  G G+ S PK            PT +       T + + W  P    K L    + G+ + Y    E+ P  I +    ++ +  + GL     Y F++AA N AG    F + +   ++ P  FP        +LR +  +++  ++ W  P ++          +G ++  T +      + D+ S+    + +     +TL  L+ +  Y I VRA
Sbjct:  119 SAKLSVLEEDQLPSGFPTIDMGPQLKVVEKARTATMLCAAGGNPDPEISWFKDFLPVDPASSNGR----------IKQLRSGALQIESSEESDQGK-YECVATNSAGTRYSAPANLYVRVRRVAPRFSIPPSSQEVMP-----GGNVNLTCVAVGAPMPYVKWM----MGAEELTKEDEMPVGRNVLELSNVMRSAN--YTCVAISSLGM-IEATAQVTVKALPKPPIDLVVTETTATSVTLTWDSG---NTEPVSFYGIQYRAAGTDGPFQEV----------DGVASTRYSIGGLSPFSEYAFRVLAVNSIGRGPPSEAVRARTGEQAPSSPPRRVQARMLSASTMLVQWEPPEEPNGLVRGYRVYYTPDSRRPLSAWHKH--NTDAGLLTTVGSLLPGITYSLRVLAFTAVGDGPPSPTIQVKTQQGVPAQPADFQAKAESDTRIQLSWLLP---PQERIIKYELVYWAAEDE---GQQHKVTFDPTSSYTLE--------DLKPDTLYHFQLAARSDLGVGVFTPT-VEACTAQSTPSAPPQKVTCVSTGSTTVRVSWVPPPADSRNGIITQYSV-----AYEAVDGEDRKRHVVDGISREH------------SSWDLLGLEKWTEYRVWVRAHTDVGPGPESSPVLVRTDEDVPSGPPRKVEVEPLNSTAVHVSWKLPVPNKQHGQIRGYQVTYVRLENGEPRGQPIIQDVMLAEAQETTISGLTPETTYSITVAAYTTKGDGARSKPKVVTTTGAVPG-RPTMMVSTTAMHTAL-LQWHPP----KELP-GELLGYRLQYRRADEARPNTIDFGKDDQHFT--VTGLHKGATYIFRLAAKNRAGPGEEFEKEITTPEDAPSGFPQ-------NLRVTGLTTSTTELAWDPPVLA--------ERNGRITNYTVV------YRDINSQH-ELQNVTGDVHLTLLGLKPDTTYDIKVRA 981          

HSP 3 Score: 156.762 bits (395), Expect = 1.153e-36
Identity = 224/999 (22.42%), Postives = 374/999 (37.44%), Query Frame = 1
Query:  370 LACSSTGHPVPSISWKINESPIEELKSPLKKLQNPPRIFSIKNYQNSVLVITQLIESDSNSVLICEAENNAGFDSRQQQLKVISTETDIPSGFPVFQNNFFPIIKPYNS--NVTLVCQAYGNPPPLIQWFKNYELINESFT--KIKILNDGNLLLVQVTREDKGIYHCQAQNTNGLRLSDPSTLDITSYPISPNSLII----ERFASDNVEIS------------WRSGLNDVTEQENFILHYREVPENITE-KQIMSKFVYLTISEKKSIYKYNLKDLFPFTTYCIWMESENPLGVSPPTIALTVKTLPTSPQLSPRSITATSISNTAILVAWRPPERKFGKFKYYQIIYTNNDGFLPQHWRQFAVKDDNVMLTHLIASELYHIRVKIVNEIGHGPLSKTISIKTIAGTLSQCP-DFKITEIFQSHIKLQWGTPDPVKLFKLIQYNLLCWDVRLKIVNATAKSSTLFPILNHNLSMNEMEYVLYLKNEKEIKCRLSAINSDGKGMPTEIQASTVNKGVNYQNLIHIDKIGS-TYITFQW-RPPSKFSFDYFLWIYQIFDSEKLDRAVKLPKIKINISDSASAENGWFVYNYTNAFSSSRYILGLRYLCRDSTDILREYVHRSDLVSTMKSVPSDSPKDLVVKEIDSNSALVSWKPLDQVHSNGIITHYEVRYYAPKKEESTERFIN--VSETSA--ILSNLKYFHYVIYVRAFTKVGGGSWSNPKNYYRQNLEEFP--IPTTIKGERKSETEINISWELPVLSEKNLAHAAIEGFIILYAPVESSPKWIKYTVQSKNLS----AVIKGLEPDLRYQFQIAATNYAGFNGNFSEIVQEMPKNFPNLNLKTVPDLRCSVQSSNRLKVEWSSP-SISTDLLKFEIRYSGNLSYITEIGLKKSEFIDMESKSVNFETLVNRYDVTLENLQSNALYKIAVRAIYQNKELYESHRETTCDTMPAVPNLVKPPIIVGLDEEKSKVIIKLHRCSQRNGKISYYFVI 3261
              C +TG P P I+W         +K   K       +    +   SVL I  L      ++  C A N+ G  +   +L V+  E  +PSGFP    +  P +K        T++C A GNP P I WFK++  ++ + +  +IK L  G L +      D+G Y C A N+ G R S P+ L +    ++P   I     E     NV ++            W  G  ++T+++        V  N+ E   +M    Y                       C+ + S   LG+   T  +TVK LP  P      +  T  + T++ + W     +   F   Q      DG   +      V      +  L     Y  RV  VN IG GP S+ +  +T     S  P   +   +  S + +QW  P+        + N L    R+     + +  + +    HN     +  V  L        R+ A  + G G P+        +GV  Q      K  S T I   W  PP +    Y L  +   D  +  +    P     + D         +Y++  A   +R  LG+         +    V       T +S PS  P+ +      S +  VSW P      NGIIT Y V Y A   E+     ++    E S+  +L   K+  Y ++VRA T VG G  S+P     +  E+ P   P  ++ E  + T +++SW+LPV    N  H  I G+ + Y  +E+     +  +Q   L+      I GL P+  Y   +AA    G        V       P       P +  S  + +   ++W  P  +  +LL + ++Y            ++++  +    +++F      + VT  +  +  ++++A +      E +E    T  D     P  ++   + GL    +++       ++RNG+I+ Y V+
Sbjct:   52 FVCQATGEPKPRITW---------MKKGKKVSSQRFEVIEFDDGAGSVLRIQPLRVQRDEAIYECTATNSLGEINTSAKLSVLE-EDQLPSGFPTI--DMGPQLKVVEKARTATMLCAAGGNPDPEISWFKDFLPVDPASSNGRIKQLRSGALQIESSEESDQGKYECVATNSAGTRYSAPANLYVRVRRVAPRFSIPPSSQEVMPGGNVNLTCVAVGAPMPYVKWMMGAEELTKEDEM-----PVGRNVLELSNVMRSANYT----------------------CVAISS---LGMIEATAQVTVKALPKPPI----DLVVTETTATSVTLTWDSGNTEPVSFYGIQYRAAGTDGPFQE---VDGVASTRYSIGGLSPFSEYAFRVLAVNSIGRGPPSEAVRARTGEQAPSSPPRRVQARMLSASTMLVQWEPPE--------EPNGLVRGYRVYYTPDSRRPLSAW--HKHNTDAGLLTTVGSLLPGITYSLRVLAFTAVGDGPPSPTIQVKTQQGVPAQPADFQAKAESDTRIQLSWLLPPQERIIKYELVYWAAEDEGQQHKVTFDPTSSYTLEDLKPDT----LYHFQLA---ARSDLGV--------GVFTPTVE----ACTAQSTPSAPPQKVTCVSTGSTTVRVSWVPPPADSRNGIITQYSVAYEAVDGEDRKRHVVDGISREHSSWDLLGLEKWTEYRVWVRAHTDVGPGPESSP--VLVRTDEDVPSGPPRKVEVEPLNSTAVHVSWKLPV---PNKQHGQIRGYQVTYVRLENGEPRGQPIIQDVMLAEAQETTISGLTPETTYSITVAAYTTKGDGARSKPKVVTTTGAVPGR-----PTMMVSTTAMHTALLQWHPPKELPGELLGYRLQY------------RRAD--EARPNTIDFGKDDQHFTVTGLHKGATYIFRLAAKNRAGPGEEFEKEITTPEDAPSGFPQNLR---VTGLTTSTTELAWDPPVLAERNGRITNYTVV 945          

HSP 4 Score: 62.7734 bits (151), Expect = 3.810e-8
Identity = 64/295 (21.69%), Postives = 125/295 (42.37%), Query Frame = 1
Query: 1096 TISEKKSIYKYNLKDLFPFTTYCIWMESENPLGVSPPTIALTVKTLPTSPQLSPRSITATSISNTAILVAWRPP--ERKFGKFKYYQIIYTNNDGFLPQHWRQFAVKDDNVMLTHLIASELYHIRVKIVNEIGHGPLSKTISIKTIAGTLSQCPDFKITEIFQSHIKLQWGTPDPVK---LFKLIQYNLLCWDV-----RLKIVNATAKSSTLFPILNHNLSMNEMEYVLYLKNEKEI----KCRLSAINSDGK---GMPTEIQASTVNKGVNYQNLIHIDKIGSTYITFQWRPP 1929
            TI   K    + +  L    TY   + ++N  G         + T   +P   P+++  T ++ +   +AW PP    + G+   Y ++Y + +    QH  Q    D ++ L  L     Y I+V+     G GPLS +I  +T+        +F++    ++ + L W  PD  K    FK++ YN    +V     R  I +    +   F ++N   S   +++++ ++   ++        SA   DG+    MP ++Q  ++ +   Y  ++ ID++G   +  +W  P
Sbjct:  858 TIDFGKDDQHFTVTGLHKGATYIFRLAAKNRAGPGE-EFEKEITTPEDAPSGFPQNLRVTGLTTSTTELAWDPPVLAERNGRITNYTVVYRDINS---QHELQNVTGDVHLTLLGLKPDTTYDIKVRAHTSKGAGPLSPSIQSRTMPMEQVFAKNFRVAAAMKTSVLLSWEVPDSYKSAVPFKIL-YNGQSVEVDGHSMRKLIADLQPNTEYSFVLMNRGTSAGGLQHLVSIRTAPDLLPQKPLPASAFIEDGRFSLSMP-QVQDPSLVRWF-YIVVVPIDRVGGNLLAPRWSTP 1145          
BLAST of Protein tyrosine phosphatase receptor type D vs. TrEMBL
Match: A0A267H9B7 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig026250g1 PE=4 SV=1)

HSP 1 Score: 793.882 bits (2049), Expect = 0.000e+0
Identity = 488/1289 (37.86%), Postives = 695/1289 (53.92%), Query Frame = 1
Query: 2164 SDLVSTMKSV----PSDSPKDLVVK-EIDSNSALVSWKPLDQVHSNGIITHYEVRYYAPKK--EESTERFINVSETSAILSNLK-YFHYVIYVRAFTKVGGGSWSNPKNYYRQNLEEFPIPTTIKG---ERKSETEINISWELPVLSEK------NLAHAAIEGFIILYAPVESSPKWIKYTVQSKNLSA---VIKGLEPDLRYQFQIAATNYAGFNGNFSEIVQEMPKNFPNLNLKTVPDLRCSVQSSNRLKVEWSSPSISTDLLKFEIRYSGNLSYITEIGL--KKSEFIDMESKSVNFETLVNRYDVTLENLQSNALYKIAVRAIYQNKELYESHRETTCDTMPAVPNLVKPPIIVGLDEEKSKVIIKLHRCSQRNGKISYYFVIVAA-FQGNKNQQISFQE-DTESYTFMELSVNTRSNNAKGEYIAIMKDINDIFKVSGKDHSSVL-------LGDGTHDENHLSVNKKLEKNFNYRCFARVCLKYSNN--------SLCKSSPWSEPFRISDLILNRNVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXASIIIGCIVKRKKSKERFMHL----GNHDDIRSSIGM--KSSMLNGLMAADK-----IFVSAEVDEPFNS-----------------DKKYTSMSLKPDIKSIPDLVNADSVQMCQDGTKL--SPVLVSDSIKLRIGSQKSENISDRPSISICNLYQYVTDLKANDCTLLQAEFETLNTNLDDRFTWQRSNIDSNKSKNRYANVVAYDHTSVLLTPVDDVIGSDYINANYIDGYQRQNAYIATQGPLPDTTDDFWRMVWEQRSNCIVMMTRLEERSGIKCHQYWPNRGFICYGQMIVSHIDTFVLAYYTIRLFEIRHSKYSEKREIQHFQFTAWPDHGVPKLSTPLLMFIRRVRSIGKIESCPKIVHCSAGVGRTGAFIVVDAQLERIKQEKNIDVFNYVSKIRCQRNYMVQTQAQYQFILETLLEAVEDGNTEVMACNFHAHVTKLSQIGISGSNQLSGFEMEFSKLNSLASNRGRHGVMLADFVKAAGNQAVNMTKNRVRNIIPYEWNRVVLNAIRGIEGSDYINASYIDGYRDRRAYIAAQSPIPSTVEDFWRMLWDQHCGVVIVLNQPHE---DKSHIYWPINKSIRYQFFVVDPVVEYNMPNYILREFKVTDARDGEFRALRQFQFTQWPNHGCPKESESILDFIRQVHKTKEQFGHMEPMVIHCNTGSGRTGVFIALSIVLDRLQQESVVDMYQTVKLLHKQRIGLVQTEEQYEFCYMAVLDYLSNYE 5814
             D++S   +V    PS  P+   V  + D++  + + KP+     NG IT+ EV Y+ PK   +    +  +V  +SA++ +L     Y+  VRA+   G G WS+      +       P    G    R S T   I W LP           + A +AI    IL++P   +P      +Q+  +     +++ L+    Y  +     + G +G+    V E P      N +   +LRC  +  + L + W  P  S  L  FE  Y+    +I + G   +      +    ++++     +   L+ L  N LY I + A + N+E   +  E  C T  A P  ++ PI +  D ++  + ++L R S R G +  Y ++VA   Q   +Q + FQ  D E+     +SV+ R  ++K  YIA         ++S    +  +       L   T D    ++NK L  + +Y+ F   CL  + +        + C  SPWSE F     + +R++  + S          +  + L     I     I +GC V  +K  ER  +     G H + R  + +  + S+   L+ A +        +A       S                  +++ ++     + ++P L    S++           P   +D ++LR  + ++  ++  P + +  L  +V  LKA+D     AE+E+++     +FTW+ SN+D NK KNRYANV+AYDH+ V+L P+D + GSDYINANY+DGY+RQNAYIATQGPLPDT  DFWRM+WEQ+++ +VMMTRLEERS +KC  YWPN+G   +  M VS +DT  LAYYTIR F +  +  +EKREI HFQFTAWPDHGVP+   PLLMF RRVR+    ++ P +VHCSAGVGRTGAFIV+DA LER+KQEK +DV+ +V+ +R QRNYMVQT+ QY FI + LLEAV  GNTEV A    A V +LS I    +   +G E+EF  L         H    A           N  KNR+ NI+P+E NRV L  IRG+EGSDYINAS+IDGYR R  YIA Q P+P T EDFWRMLW+ +  +V+ L +  E   DK H YWP  +S RYQ+FVVDP+ EYNMPNYILREFKVTDARDG+ R +RQF  T WP  G PK  E  ++FI QVHKTKEQFG   P+ +HC+ G GRTGVF+ALS+VL+R++ E VVDMYQTV+ L  QR  +VQT+EQY+FCY A L+YLS+++
Sbjct:  828 GDVISCQATVREAPPSMKPESFSVNTKSDTSVEVFALKPI-LTGRNGQITNTEVAYW-PKNAIDGYGSKNFSVENSSAVIRHLNPSREYLFKVRAWNSAGPGPWSDVMPVRTRQQPAPQSPAPPAGIVVSRVSPTRARIDWSLPPPPPPPQQPPVSAAQSAIADLRILFSPDPGAPVEAFQQLQAGGVPDRPFILENLDSSAEYTLRF---QWIGADGSPVGPVSE-PHLLRLFNREAPRELRCFDRRPDSLGLRWLRPHDSAGLESFEYNYTATGRFIDDSGQEQRSRRLSPVMPVPLSWDAQPAEFQHMLKGLDPNKLYTIRLTARFPNRE---ASAEVACPTASAPPRSLQAPIAIDKDVDRRLITLRLRRASDRLGVVQRYLLVVAPEAQSATSQDLLFQRSDLET-----VSVDARIGSSKEPYIAACFTAQRFRQLSSPQSAGYIEFQLGTKLPTETCDSRQQALNKPLLSDASYKSFLAACLSPAGSGPVGSLVGAGCSYSPWSEAFGTHIALPSRSLGTAESGYFTLIVVLVTSALGLTAVVCISV-GCIALGCFVCGRKGTERGRNFRNGSGGHSNNRQPMQVLVEPSLKQPLIPASQQNSTSFCATAATGGTLQSVVGSATLQRQQQQQQQQQQQFGTLQSSSHVGTLPTL----SIRSASSSAAFHQGP---TDPVELRRINFQTPALTGHPPVPVAQLIDHVASLKASDNLKFSAEYESIDPG--QQFTWENSNLDVNKPKNRYANVIAYDHSRVVLQPLDGLPGSDYINANYMDGYRRQNAYIATQGPLPDTIGDFWRMIWEQKTSTVVMMTRLEERSRVKCDMYWPNKGSEVFDYMTVSLLDTLELAYYTIRTFALHRAGATEKREIHHFQFTAWPDHGVPEHCAPLLMFARRVRASNPPDAGPIVVHCSAGVGRTGAFIVIDAMLERMKQEKTLDVYGHVTCLRAQRNYMVQTEDQYIFIHDCLLEAVICGNTEVPARALAAQVQRLS-IPEPAAGGATGMELEFRSLAHTVKPTPAHKFTSASL-------PANKLKNRLVNILPFESNRVCLQPIRGVEGSDYINASWIDGYRQRSCYIATQGPLPDTAEDFWRMLWEHNSTIVVNLTKLREQGRDKCHQYWPGERSARYQYFVVDPMAEYNMPNYILREFKVTDARDGQSRTVRQFHCTDWPEQGVPKSGEGFIEFIGQVHKTKEQFGQDGPITVHCSAGVGRTGVFLALSVVLERMRYEGVVDMYQTVRTLRTQRSAMVQTDEQYQFCYGAALEYLSSFD 2084          

HSP 2 Score: 107.457 bits (267), Expect = 3.280e-19
Identity = 171/734 (23.30%), Postives = 291/734 (39.65%), Query Frame = 1
Query:  685 PYNSNVTLVCQAYGNPPPLIQWF--KNYELINESFTKIKILNDGNLLLVQVTREDKGIYHCQAQNTNGLRLSDPSTLDITSYPISPNSLIIERFASDNVEISWRSGLNDVTEQENFILHYREVPENITEKQIMSKFVYLTISEKKSIYKYNLKDLFPFTTYCIWMES-----ENPLGVSPPTIALTVKTLPTSPQLSPRSITATSISNTAILVAWRPPERKFGKFKYYQIIYT---------NNDGFLPQHWRQFAVKDDNVMLTHLIASELYHIRVKIVNEIGHGPLSKTISIKTIAGTLSQCPDFKITEIFQSHIKLQWGTPDPVKLFKLIQYNLLCWDVRLKIVNATAKSSTLFPILNHNLSMNEMEYVLY-LKNEKEIKCRLSAINSDGKGMPTEI---QAS--TVNKGVNYQNLIHIDKIGSTYITFQWRPPSKFSFDYFLWIYQIF-DSEKLDRAVKLPKIKINISDSASAENGWFVYNYTNAFSSSRYILGLRYLCRDSTDILREYVHRSDLVSTMKSVPSDSPKDLVVK-----EIDSNSALVSWKPLDQVHSNGIITHYEVRYYA--PKKEESTERFINV----SETSAILSNLKYFHYVIY---VRAFTKVGGGSWSNPKNYYRQNLEEFPIPTTIKGERKSETEINISWELPVLSEKNLAHAAIEGFIILYAPVESSPKWIKYTVQSKNLSAVIKGLEPDLRYQFQIAATNYAGFNGNFSEIV 2775
            P  SNV L C A G P P +QWF  K  +L      K +I     L+L  VT +D   Y CQAQN+ G  +    ++ +   P  P+ L + + A   VEI ++   +     +++ + YRE       ++   +   +  +E     +  +  L P T Y + ++S      +    S P +     TL T P  +P+ I   ++S   + +AW+ P+   G    Y+I YT         N    +P   R   +KD       L  +  Y+ R+   N +G GP+S    + T+ G  S+   F+        I+L W         +LI Y L      + + +       + P+       N+  Y+L  L+        L+     GKG+PTE    Q S  T  K VN Q       +    I   W PP + +     W+ + +  ++ +  AV   + K  + +    E G++ Y  +     + Y +G+      +  +   Y    + V+T+  VPS +PK          ++ S S  ++W   D +  +  I  Y + Y A  P    S+  +  V      TS  L   K     +Y   + A    G G   + +   R+       P +     KS+T + +    P+L+ +N     I    + Y P  +   +       +N SAVI+ L P   Y F++ A N AG  G +S+++
Sbjct:  236 PAGSNVNLTCVAVGAPMPRVQWFDSKGTDLGTNEPGKQQI-GRFVLMLTDVTSDDN--YTCQAQNSLGT-IHWMVSVTVQKMPEPPSDLQVIKHAPTTVEIEFKK--SRTPGVQSYTVSYREEASRTMNRRNWIQIENVPGNEPGDRVRTRVSSLRPHTKYQLKVDSVTANFSSKDNTSNPIVEFM--TLETFPAKAPKDIQVVAVSRADVNIAWKEPDDPNGIITKYRIYYTTERVTNIDSNIKVEVPGTQRMHTIKD-------LEYNTTYYFRMTASNMVGEGPVSDVYPVITVVGIASRPKGFQCATTGHDSIQLSWDPAASSDKGRLISYILSYKSSAIYLEDGMETREEVLPV------DNDSGYLLKNLRPGTTYHLTLTPSTEQGKGIPTETIVCQTSDFTPGKPVNVQ----ARALQGQQIEVTWSPPLE-ARGIQQWLVRYYRATDPMGTAVPSEETKKVVPN--LVEQGFYRYVISGLEPKTAYHIGVAASSGPAGGV-SSYESIREPVTTLGLVPS-APKRFEASVRYDPDLRSASIDLNWLAPDTLRGSR-IEEYRLLYRAVGPPDLVSSRTYTEVPLSHGRTSWTLPPNKVLFGAVYNFSLSAKNNEGYGDVISCQATVREAPPSMK-PESFSVNTKSDTSVEVFALKPILTGRN---GQITNTEVAYWPKNAIDGYGSKNFSVENSSAVIRHLNPSREYLFKVRAWNSAG-PGPWSDVM 933          
BLAST of Protein tyrosine phosphatase receptor type D vs. TrEMBL
Match: A0A267DSI9 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig026250g3 PE=4 SV=1)

HSP 1 Score: 791.571 bits (2043), Expect = 0.000e+0
Identity = 487/1288 (37.81%), Postives = 697/1288 (54.11%), Query Frame = 1
Query: 2164 SDLVSTMKSV----PSDSPKDLVVK-EIDSNSALVSWKPLDQVHSNGIITHYEVRYYAPKK--EESTERFINVSETSAILSNL-KYFHYVIYVRAFTKVGGGSWSNPKNYYRQNLEEFPIPTTIKG---ERKSETEINISWELPVLSEK-----NLAHAAIEGFIILYAPVESSPKWIKYTVQSKNL---SAVIKGLEPDLRYQFQIAATNYAGFNGNFSEIVQEMPKNFPNLNLKTVPDLRCSVQSSNRLKVEWSSPSISTDLLKFEIRYSGNLSYITEIGLKKS--EFIDMESKSVNFETLVNRYDVTLENLQSNALYKIAVRAIYQNKELYESHRETTCDTMPAVPNLVKPPIIVGLDEEKSKVIIKLHRCSQRNGKISYYFVIVAA-FQGNKNQQISFQE-DTESYTFMELSVNTRSNNAKGEYIAIMKDINDIFKVSGKDHSSVL-------LGDGTHDENHLSVNKKLEKNFNYRCFARVCLKYSNN--------SLCKSSPWSEPFRISDLILNRNVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXASIIIGCIVKRKKSKERFMHL----GNHDDIRSSIGM--KSSMLNGLMAADK-----IFVSAEVDEPFNS-----------------DKKYTSMSLKPDIKSIPDLVNADSVQMCQDGTKL--SPVLVSDSIKLRIGSQKSENISDRPSISICNLYQYVTDLKANDCTLLQAEFETLNTNLDDRFTWQRSNIDSNKSKNRYANVVAYDHTSVLLTPVDDVIGSDYINANYIDGYQRQNAYIATQGPLPDTTDDFWRMVWEQRSNCIVMMTRLEERSGIKCHQYWPNRGFICYGQMIVSHIDTFVLAYYTIRLFEIRHSKYSEKREIQHFQFTAWPDHGVPKLSTPLLMFIRRVRSIGKIESCPKIVHCSAGVGRTGAFIVVDAQLERIKQEKNIDVFNYVSKIRCQRNYMVQTQAQYQFILETLLEAVEDGNTEVMACNFHAHVTKLSQIGISGSNQLSGFEMEFSKLNSLASNRGRHGVMLADFVKAAGNQAVNMTKNRVRNIIPYEWNRVVLNAIRGIEGSDYINASYIDGYRDRRAYIAAQSPIPSTVEDFWRMLWDQHCGVVIVLNQPHE---DKSHIYWPINKSIRYQFFVVDPVVEYNMPNYILREFKVTDARDGEFRALRQFQFTQWPNHGCPKESESILDFIRQVHKTKEQFGHMEPMVIHCNTGSGRTGVFIALSIVLDRLQQESVVDMYQTVKLLHKQRIGLVQTEEQYEFCYMAVLDYLSNYE 5814
             D++S   +V    PS  P+   V  + D++  + + KP+     NG IT+ EV Y+ PK   +    +  +V  +SA++ +L     Y+  VRA+   G G WS+      +       P+   G    R S T   I W LP          + A +AI    IL++P   +P      +Q+  +     +++ L+    Y  +     + G +G+    V E P      N +   +LRC  +  + L + W  P  S  L  FE  Y+    +I + G ++       +    ++++     +   L+ L  N LY I + A + N+E   +  E  C T  A P  ++ PI +  D ++  + ++L R S R G +  Y ++VA   Q   +Q + FQ  D E+     +SV+ R  ++K  YIA         ++S    +  +       L   T D    ++NK L  + +Y+ F   CL  + +        + C  SPWSE F     + +R++  + S          +  + L     I     I +GC V  +K  ER  +     G H + R  + +  + S+   L+ A +        +A       S                  +++ ++     + ++P L    S++           P   +D ++LR  + ++  ++  P + +  L  +V  LKA+D     AE+E+++     +FTW+ SN+D NK KNRYANV+AYDH+ V+L P+D + GSDYINANY+DGY+RQNAYIATQGPLPDT  DFWRM+WEQ+++ +VMMTRLEERS +KC  YWPN+G   +  M VS +DT  LAYYTIR F +  +  +EKREI HFQFTAWPDHGVP+   PLLMF RRVR+    ++ P +VHCSAGVGRTGAFIV+DA LER+KQEK +DV+ +V+ +R QRNYMVQT+ QY FI + LLEAV  GNTEV A    + V +LS I    +   +G E+EF  L         H    A           N  KNR+ NI+P+E NRV L  IRG+EGSDYINAS+IDGYR R  YIA Q P+P T EDFWRMLW+ +  +V+ L +  E   DK H YWP  +S RYQ+FVVDP+ EYNMPNYILREFKVTDARDG+ R +RQF  T WP  G PK  E  ++FI QVHKTKEQFG   P+ +HC+ G GRTGVF+ALS+VL+R++ E VVDMYQTV+ L  QR  +VQT+EQY+FCY A L+YLS+++
Sbjct:  140 GDVISCQATVREAPPSMKPESFSVNTKSDTSVEVFALKPI-LTGRNGHITNTEVAYW-PKNAIDGYGSKNFSVENSSAVIRHLNPSREYLFKVRAWNSAGPGPWSDVMPVRTRQQPPPQSPSPPAGIVLSRVSPTRARIDWSLPPPPPPQQPPVSAAQSAIADLRILFSPDPGAPVEAFQQLQAGGVLDRPFILENLDSSAEYTLRF---QWIGADGSPVGPVSE-PHLLRLFNREAPRELRCFDRRPDSLGLRWLRPHDSAGLESFEYNYTATGRFIDDSGQEQRSRRLSPVMPVPLSWDAQPAEFQHVLKGLDPNKLYTIRLTARFPNRE---ASAEVACPTASAPPRSLQAPIAIDKDVDRRLITLRLRRASDRLGVVQRYLLVVAPEAQSATSQDLLFQRSDLET-----VSVDARIASSKEPYIAACFTAQRFRQLSSPQSAGYIEFQLGTKLPTETCDSRQQALNKPLLSDASYKSFLAACLSPAGSGPVGSLVGAGCSYSPWSEAFGTHIALPSRSLGTAESGYFTLIVVLVTSALGLTAVVCISV-GCIALGCFVCGRKGTERGRNFRNGSGGHSNNRQPMQVLVEPSLKQPLIPASQQNSTSFCATAATGGTLQSVVGSATLQRQQQQQQQQQQQFGTLQSSSHVGTLPTL----SIRSASSSAAFHQGP---TDPVELRRINFQTPALTSHPPVPVAQLIDHVASLKASDNLKFSAEYESIDPG--QQFTWENSNLDVNKPKNRYANVIAYDHSRVVLQPLDGLPGSDYINANYMDGYRRQNAYIATQGPLPDTIGDFWRMIWEQKTSTVVMMTRLEERSRVKCDMYWPNKGSEVFDYMTVSLLDTLELAYYTIRTFALHRAGATEKREIHHFQFTAWPDHGVPEHCAPLLMFARRVRASNPPDAGPIVVHCSAGVGRTGAFIVIDAMLERMKQEKTLDVYGHVTCLRAQRNYMVQTEDQYIFIHDCLLEAVICGNTEVPARALASQVQRLS-IPEPAAGGATGMELEFRSLAHTVKPTPAHKFTSASL-------PANKLKNRLVNILPFESNRVCLQPIRGVEGSDYINASWIDGYRQRSCYIATQGPLPDTAEDFWRMLWEHNSTIVVNLTKLREQGRDKCHQYWPGERSARYQYFVVDPMAEYNMPNYILREFKVTDARDGQSRTVRQFHCTDWPEQGVPKSGEGFIEFIGQVHKTKEQFGQDGPITVHCSAGVGRTGVFLALSVVLERMRYEGVVDMYQTVRTLRTQRSAMVQTDEQYQFCYGAALEYLSSFD 1395          
BLAST of Protein tyrosine phosphatase receptor type D vs. TrEMBL
Match: A0A267G0Z1 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig026250g5 PE=4 SV=1)

HSP 1 Score: 751.125 bits (1938), Expect = 0.000e+0
Identity = 417/978 (42.64%), Postives = 570/978 (58.28%), Query Frame = 1
Query: 3031 LENLQSNALYKIAVRAIYQNKELYESHRETTCDTMPAVPNLVKPPIIVGLDEEKSKVIIKLHRCSQRNGKISYYFVIVAA-FQGNKNQQISFQE-DTESYTFMELSVNTRSNNAKGEYIAIMKDINDIFKVSGKDHSSVL-------LGDGTHDENHLSVNKKLEKNFNYRCFARVCLKYSNN--------SLCKSSPWSEPFRISDLILNRNVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXASIIIGCIVKRKKSKERFMHL----GNHDDIRSSIGM--KSSMLNGLMAADK-----IFVSAEVDEPFNS-----------------DKKYTSMSLKPDIKSIPDLVNADSVQMCQDGTKL--SPVLVSDSIKLRIGSQKSENISDRPSISICNLYQYVTDLKANDCTLLQAEFETLNTNLDDRFTWQRSNIDSNKSKNRYANVVAYDHTSVLLTPVDDVIGSDYINANYIDGYQRQNAYIATQGPLPDTTDDFWRMVWEQRSNCIVMMTRLEERSGIKCHQYWPNRGFICYGQMIVSHIDTFVLAYYTIRLFEIRHSKYSEKREIQHFQFTAWPDHGVPKLSTPLLMFIRRVRSIGKIESCPKIVHCSAGVGRTGAFIVVDAQLERIKQEKNIDVFNYVSKIRCQRNYMVQTQAQYQFILETLLEAVEDGNTEVMACNFHAHVTKLSQIGISGSNQLSGFEMEFSKLNSLASNRGRHGVMLADFVKAAGNQAVNMTKNRVRNIIPYEWNRVVLNAIRGIEGSDYINASYIDGYRDRRAYIAAQSPIPSTVEDFWRMLWDQHCGVVIVLNQPHE---DKSHIYWPINKSIRYQFFVVDPVVEYNMPNYILREFKVTDARDGEFRALRQFQFTQWPNHGCPKESESILDFIRQVHKTKEQFGHMEPMVIHCNTGSGRTGVFIALSIVLDRLQQESVVDMYQTVKLLHKQRIGLVQTEEQYEFCYMAVLDYLSNYE 5814
            L+ L  N LY I + A + N+E   +  E  C T  A P  ++ PI +  D ++  + ++L R S R G +  Y ++VA   Q   +Q + FQ  D E+     +SV+ R  ++K  YIA         ++S    +  +       L   T D    ++NK L  + +Y+ F   CL  + +        + C  SPWSE F     + +R++  + S          +  + L     I     I +GC V  +K  ER  +     G H + R  + +  + S+   L+ A +        +A       S                  +++ ++     + ++P L    S++           P   +D ++LR  + ++  ++  P + +  L  +V  LKA+D     AE+E+++     +FTW+ SN+D NK KNRYANV+AYDH+ V+L P+D + GSDYINANY+DGY+RQNAYIATQGPLPDT  DFWRM+WEQ+++ +VMMTRLEERS +KC  YWPN+G   +  M VS +DT  LAYYTIR F +  +  +EKREI HFQFTAWPDHGVP+   PLLMF RRV +    ++ P + HCSAGVGRTGAFIV+DA LER+KQEK +DV+ +V+ +R QRNYMVQT+ QY FI + LLEAV  GNTEV A    A V +LS I    +   +G E+EF  L         H    A           N  KNR+ NI+P+E NRV L  IRG+EGSDYINAS+IDGYR R  YIA Q P+P T EDFWRMLW+ +  +V+ L +  E   DK H YWP  +S RYQ+FVVDP+ EYNMPNYILREFKVTDARDG+ R +RQF  T WP  G PK  E  ++FI QVHKTKEQFG   P+ +HC+ G GRTGVF+ALS+VL+R++ E VVDMYQTV+ L  QR  +VQT+EQY+FCY A L+YLS+++
Sbjct:   18 LKGLDPNKLYTIRLTARFPNRE---ASAEVACPTASAPPRSLQAPIAIDKDVDRRLITLRLRRASDRLGVVQRYLLVVAPEAQSATSQDLLFQRSDLET-----VSVDARIASSKEPYIAACFTAQRFRQLSSPQSAGYIEFQLGTKLPTETCDSRQQALNKPLLSDASYKSFLAACLSPAGSGPVGSLVGAGCSYSPWSEAFGTHIALPSRSLGTAESGYFTLIIVLVTSALGLTAVVCISV-GCIALGCFVCGRKGTERGRNFRNGSGGHSNNRQPMQVLVEPSLKQPLIPASQQNSTSFCATAATGGTLQSVVGSATLQRQQQQQQQQQQQFGTLQSSSHVGTLPTL----SIRSASSSAAFHQGP---TDPVELRRINFQTPALTGHPPVPVAQLIDHVASLKASDNLKFSAEYESIDPG--QQFTWENSNLDVNKPKNRYANVIAYDHSRVVLQPLDGLPGSDYINANYMDGYRRQNAYIATQGPLPDTIGDFWRMIWEQKTSTVVMMTRLEERSRVKCDMYWPNKGSEVFDYMTVSLLDTLELAYYTIRTFALHRAGATEKREIHHFQFTAWPDHGVPEHCAPLLMFARRVHASNPPDAGPIVAHCSAGVGRTGAFIVIDAMLERMKQEKTLDVYGHVTCLRAQRNYMVQTEDQYIFIHDCLLEAVICGNTEVPARALAAQVQRLS-IPEPAAGGATGMELEFRSLAHTVKPTPAHKFTSASL-------PANKLKNRLVNILPFESNRVCLQPIRGVEGSDYINASWIDGYRQRSCYIATQGPLPDTAEDFWRMLWEHNSTIVVNLTKLREQGRDKCHQYWPGERSARYQYFVVDPMAEYNMPNYILREFKVTDARDGQSRTVRQFHCTDWPEQGVPKSGEGFIEFIGQVHKTKEQFGQDGPITVHCSAGVGRTGVFLALSVVLERMRYEGVVDMYQTVRTLRTQRSAMVQTDEQYQFCYGAALEYLSSFD 969          
BLAST of Protein tyrosine phosphatase receptor type D vs. TrEMBL
Match: A0A3P8NJL3 (Protein tyrosine phosphatase receptor type Fa OS=Astatotilapia calliptera OX=8154 PE=4 SV=1)

HSP 1 Score: 727.243 bits (1876), Expect = 0.000e+0
Identity = 333/606 (54.95%), Postives = 441/606 (72.77%), Query Frame = 1
Query: 4006 SDSIKLRIGSQKSENISDRPSISICNLYQYVTDLKANDCTLLQAEFETLNTNLDDRFTWQRSNIDSNKSKNRYANVVAYDHTSVLLTPVDDVIGSDYINANYIDGYQRQNAYIATQGPLPDTTDDFWRMVWEQRSNCIVMMTRLEERSGIKCHQYWPNRGFICYGQMIVSHIDTFVLAYYTIRLFEIRHSKYSEKREIQHFQFTAWPDHGVPKLSTPLLMFIRRVRSIGKIESCPKIVHCSAGVGRTGAFIVVDAQLERIKQEKNIDVFNYVSKIRCQRNYMVQTQAQYQFILETLLEAVEDGNTEVMACNFHAHVTKLSQIGISGSNQLSGFEMEFSKLNSLASNRGRHGVMLADFVKAAGNQAVNMTKNRVRNIIPYEWNRVVLNAIRGIEGSDYINASYIDGYRDRRAYIAAQSPIPSTVEDFWRMLWDQHCGVVIVLNQPHE---DKSHIYWPINKSIRYQFFVVDPVVEYNMPNYILREFKVTDARDGEFRALRQFQFTQWPNHGCPKESESILDFIRQVHKTKEQFGHMEPMVIHCNTGSGRTGVFIALSIVLDRLQQESVVDMYQTVKLLHKQRIGLVQTEEQYEFCYMAVLDYLSNYE 5814
            SD +++R  + +++ + + P I++C+L  ++  LKAND      E+E+++     +FTW+ SN++ NK KNRYANV+AYDH+ V+LTPVD V GSDYINANYIDGY++QNAYIATQGPLP+T  DFWRMVWEQR+  IVMMTRLEE+S +KC QYWP+RG   YG + V+ +DT  LA Y++R F +  +  SEKRE++ FQF AWPDHGVP+  TP L F+RR++S    ++ P +VHCSAGVGRTG FIV+DA LER+K EK++D++ +V+ +R QRNYMVQT+ QY F+ E LLEA   GNTEV A N +AH+ KL+Q  ++    ++  E+EF KL +  ++  R       F+ A  N   N  KNR+ NI+P+E  RV L  IRG+EGSDYINAS+IDGYR ++AY+A Q P+  T EDFWRMLW+ +  +V++L +  E   +K H YWP  +S RYQ+FVVDP+ EYNMP YILREFKVTDARDG+ R +RQFQFT WP  G PK  E  +DFI QVHKTKEQFG   P+ +HC+ G GRTGVFI LSIVL+R++ E VVD++QTVK L  QR  +VQTE+QY+ CY A L+YL +++
Sbjct: 1310 SDPVEMRRLNYQTQGMREHPPIAVCDLADHIERLKANDGLHFSQEYESIDPG--QQFTWEHSNLEVNKPKNRYANVIAYDHSRVILTPVDGVPGSDYINANYIDGYRKQNAYIATQGPLPETLSDFWRMVWEQRTCTIVMMTRLEEKSRVKCDQYWPSRGTETYGMIQVTMLDTLELATYSVRTFALYKNGSSEKREVRQFQFLAWPDHGVPEYPTPTLAFLRRIKSCNPQDAGPMVVHCSAGVGRTGCFIVIDAMLERMKHEKSVDIYGHVTCMRAQRNYMVQTEDQYIFVHEALLEAAVCGNTEVPARNLYAHIQKLTQ--VAAGEAVTAMELEFKKLANSKAHTSR-------FISA--NLPCNKFKNRLVNIMPFESTRVCLQPIRGVEGSDYINASFIDGYRQQKAYMATQGPLAETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTIRQFQFTDWPEQGVPKTGEGFIDFIGQVHKTKEQFGQDGPITVHCSAGVGRTGVFITLSIVLERMRYEGVVDLFQTVKTLRTQRPAMVQTEDQYQLCYRAALEYLGSFD 1902          

HSP 2 Score: 136.346 bits (342), Expect = 5.462e-28
Identity = 232/1019 (22.77%), Postives = 379/1019 (37.19%), Query Frame = 1
Query:  370 LACSSTGHPVPSISWKINESPIEELKSPLKKLQNPPRIFSIKNYQNSVLVITQLIESDSNSVLICEAENNAGFDSRQQQLKVISTETDIPSGFPVFQNNFFPIIKPYNSNVTLVCQAYGNPPPLIQWFKNYEL--INESFTKIKILNDGN-----LLLVQVTRE-DKGIYHCQAQNTNGLRLSDPSTLDI------TSYPISPNSLIIERFASDNVE----------ISWRSGLNDVTEQENFILHYREVPENITEKQIMSKFVYLTISEKKSIYKYNLKDLFPFTTYCIWMESENPLGVSPPTIALTVKTLPTSPQLSPRSITATSISNTAILVAWRP--PERKFGKFKYYQIIYT---NNDGFLPQHWRQFAVKDDNVMLTHLIASEL-----YHIRVKIVNEIGHGPLSKTISIKTIAGTLSQCPDFKITEIFQSHIKL-QWGTPDPVKLFKLIQYNLLCWDVRLKIVNATAKSSTLFPILNHNLSMNEMEYVLYLKNEKEIKCRLSAINSDGKGMPTEIQASTVNKGV-----NYQNLIHIDKIGSTYITFQWRPPSK---FSFDYFLWIYQIFDSEKLDRAVKLPKIKINISDSASAENGWFVYNYTNAFSSSRYILGLRYLCRDSTDILREYVHRSDLVSTMKSVPSDSPKDLVVKEIDSNSALVSW--KPLDQVHSNGIITHYEVRYYAPKKEESTER---FINVSETSAILSNL-KYFHYVIYVRAFTKVGGGSWSNP-KNYYRQNLEEFPIPTTIKGERKSETEINISWELPVLSEKNLAHAAIEGFIILYAPVESSPKWIKYTVQSKNL----SAVIKGLEPDLRYQFQIAATNYAGFNGNFSEIVQEMPKNFPNLNLKTVPDLRCSVQSSNRLKVEWSSP-SISTDLLKFEIRYSGNLSYITEIGLKKSEFIDMESKSVNFETLVNRYDVTLENLQSNALYKIAVRAIYQNKELYESHRETTCDTMPAVPNLVKPPIIVGLDEEKSKVIIKLHRCSQRNGKISYYFVI 3261
              C + G P P I+W         +K   K       +    +   SVL I  L      ++  C A N+ G  +   +L V+  E  IP GFP         +       T++C A GNP P I WFK++    I+ S  +IK L  G       L ++ + E D+G Y C A N+ G R S P+ L +        + I P +  +    S N+           + W SG  ++T ++              E  I    + LT          N++    +T  C+ + S   LG+   T  +TVK LP  P     S+T T  + T++ + W    PE       YY I Y    + +GF          + D V  T      L     Y  RV  VN +G GP S  +  +T     S  P      +  S   L QW  P+     ++  Y         ++  ++   + L     HN   +    +  L  +     R+    S G G P++       +GV     ++     +D    + I   W  P +    SF+   W                P  K  ++  A+       Y        + Y+  L         +  + +       T +S PS  P+++ +  + S S  V W   P D  H  G I  Y + Y A   E+        I    TS IL +L K+  Y+++VRA T VG G  S+  K   ++++   P P  ++ E  + T + +SW+ P LS K   H  I G+ ++Y+ +E+     +  +   NL     A I GL P+  Y   +AA    G        V       P       P +  S    N   ++W  P  +  + + ++++Y            K++E      K  +F+   + + VT  +  +  ++K+  +    N E Y     T  D   + P  +    +VGL    +K+       ++RNGKI  Y V+
Sbjct:   53 FVCQAVGEPKPRITW---------MKKGKKVSSQRFEVIEFDDGSGSVLRIQPLRTHRDEAIYECTATNSVGEINTSAKLTVLE-EDQIPHGFPTIDMGPQLKVVERTRTATMLCAASGNPDPEIYWFKDFLPVDISSSNGRIKQLRSGGTPIRGALQIENSEESDQGKYECVAVNSAGTRYSAPANLYVRVRRVPPRFSIPPTNHEVMPGGSVNLTCVAVGAPMPYVKWISGEVELTRED--------------EMPIGRNVLELT----------NIRQSANYT--CVAISS---LGMIETTAQITVKALPKMPT----SLTVTETTATSVTLTWDSGNPE----PVSYYVIQYRAKLSENGFQ---------EVDGVATTRYSIGGLSPFSEYEFRVMAVNNVGRGPSSSIVDTRTSEQAPSSPPLHVQARMLSSSTMLVQWEPPEEPN-GQIRGY---------RVYYSSDHDAPLSAWQKHNTDDSHFTTISGLATDITYSLRVLGFTSVGDGPPSDTLQIKTRQGVPAQPSDFDGEAELD----SRIMLSWLWPVQEPIISFELVYW------------EANNPTDKHRVTFDAAGS-----YAVDGLKPDTLYVFSLAARSEMGLGVFTQPIE----CRTAQSTPSAPPQEVHLLSLSSTSVEVRWVAPPTDSQH--GEIVGYSLAYQALTGEDQKRHQVSGIGPDITSYILEDLEKWTEYLVWVRAHTDVGPGPESSAAKVRTKEDVPGAP-PRKVEVEALNSTALRVSWK-PPLSVKQ--HGQIRGYQLVYSRLENGEPHGQPVILDVNLPEAQEAFIAGLLPETTYSVTVAAYTTKGDGARSKAKVATTTGAVPGK-----PTMMISTTIGNTALIQWQPPKEMVGEHMGYQLQY------------KRAEEEAFTIK--HFKKTDDHFTVTGLHKGAVYIFKLCAKNRAGNGEEYVKEISTPEDIPSSYPQNLS---VVGLTATSTKLAWDPPPLAERNGKIVKYVVM 952          

HSP 3 Score: 129.798 bits (325), Expect = 5.592e-26
Identity = 218/964 (22.61%), Postives = 386/964 (40.04%), Query Frame = 1
Query:  277 NSQITFTENDEAP----KISLIIQSPNVLLFKSMILACSSTGHPVPSISWKINESPIEELKSPLKKLQNPPRIFSIKNYQNSVLVITQLIESDSNSVLICEAENNAGFD-SRQQQLKVISTETDIPSGFPVFQNNFFPIIKPYNSNVTLVCQAYGNPPPLIQWFKN-YELINESFTKIKILNDGNLLLVQVTREDKGIYHCQAQNTNGLRLSDPSTLDITSYPISPNSLIIERFASDNVEISWRSGLNDVTEQENFILHYR-EVPENITEKQIMSKFVYLTISEKKSIYKYNLKDLFPFTTYCIWMESENPLGVSPPTIALTVKTLPTSPQLSPRSITATSISNTAILVAWRPPERKFGKFKYYQIIYTNNDGFLPQHWRQFAVKDDNVMLTHLIASEL-YHIRVKIVNEIGHGPLSKTISIKTIAGTLSQCPDFKITEIFQSHIKLQWGTP--DPVKLFKLIQYNLLCWDVRLKIVNATAKSSTLFPILNHNLSMNEMEYVLYLKNEKEIKCRLSAINSDGKGM---PTEIQASTVNKGVNYQNLIHIDKIGSTYITFQWRPPSKFS-----FDYFLWIYQIFDSEKLDRAVKLPKIKINISDSASAENGWFVYNYTNAFSSSRYILGLRYLCRDSTDILREYVHRSDLVSTMKSVPSDSPKDLVVKEIDSNSALVSWKPLDQVHSNGIITHYEVRYYAPKKEESTERF----INVSET--SAILSNLKYFHYVIYVRAFTKVGGGSWSNPKNYYRQNLEEFP-IPTTIKGERKSETEINISWELPVLSEKNLAHAAIEGFIILYAPVESSPKWIKYTVQSKNLSAVIKGLEPDLRYQFQIAATNYAGFNGNFSEIVQEM--PKNFPNLNLKTVPDLRCSVQSSNRLKVEWSSPSIS---TDLLKFEIRYSGNLSYITEIGLKKSEFIDMESKSVNFETLVNRYDVTLENLQSNALYKIAVRA 3078
            ++++T  E D+ P     I +  Q   V   ++  + C+++G+P P I W  +  P++ + S   +++   ++ S        L I    ESD      C A N+AG   S    L V           P   +   P       +V L C A G P P ++W     EL  E    I      N+L +   R+    Y C A ++ G+ +   + + + + P  P SL +    + +V ++W SG  +      +++ YR ++ EN  ++            +  +  +Y++  L PF+ Y   + + N +G  P +  +  +T   +P   P  + A  +S++ +LV W PPE   G+ + Y++ Y+++       W++    D +      +A+++ Y +RV     +G GP S T+ IKT  G  +Q  DF       S I L W  P  +P+     I + L+ W+      N T K    F              V  LK +      L+A +  G G+   P E + +        Q  +H+  + ST +  +W  P   S       Y L  YQ    E   R  ++  I  +I+           Y   +    + Y++      R  TD+       +  V T + VP   P+ + V+ ++S +  VSWKP   V  +G I  Y++ Y   +  E   +     +N+ E   + I   L    Y + V A+T  G G+ S  K          P  PT +       T + I W+ P    K +    + G+ + Y   E     IK+  ++ +    + GL     Y F++ A N A   GN  E V+E+  P++ P+   + +  +  +  S+   K+ W  P ++     ++K+ + Y                 I+  + S N  T      +T+  LQ +  Y I V+A
Sbjct:  120 SAKLTVLEEDQIPHGFPTIDMGPQLKVVERTRTATMLCAASGNPDPEIYWFKDFLPVD-ISSSNGRIK---QLRSGGTPIRGALQIENSEESDQGKYE-CVAVNSAGTRYSAPANLYVRVRRVPPRFSIPPTNHEVMP-----GGSVNLTCVAVGAPMPYVKWISGEVELTREDEMPI----GRNVLELTNIRQSAN-YTCVAISSLGM-IETTAQITVKALPKMPTSLTVTETTATSVTLTWDSGNPEPVSY--YVIQYRAKLSENGFQE-----------VDGVATTRYSIGGLSPFSEYEFRVMAVNNVGRGPSSSIVDTRTSEQAPSSPPLHVQARMLSSSTMLVQWEPPEEPNGQIRGYRVYYSSDHDAPLSAWQKHNTDDSHFTTISGLATDITYSLRVLGFTSVGDGPPSDTLQIKTRQGVPAQPSDFDGEAELDSRIMLSWLWPVQEPI-----ISFELVYWEAN----NPTDKHRVTFDAAGSYA-------VDGLKPDTLYVFSLAARSEMGLGVFTQPIECRTAQSTPSAPPQE-VHLLSLSSTSVEVRWVAPPTDSQHGEIVGYSL-AYQALTGEDQKRH-QVSGIGPDITS----------YILEDLEKWTEYLV----WVRAHTDVGPGPESSAAKVRTKEDVPGAPPRKVEVEALNSTALRVSWKPPLSVKQHGQIRGYQLVYSRLENGEPHGQPVILDVNLPEAQEAFIAGLLPETTYSVTVAAYTTKGDGARSKAK--VATTTGAVPGKPTMMISTTIGNTAL-IQWQPP----KEMVGEHM-GYQLQYKRAEEEAFTIKHFKKTDD-HFTVTGLHKGAVYIFKLCAKNRA---GNGEEYVKEISTPEDIPSSYPQNLSVVGLTATST---KLAWDPPPLAERNGKIVKYVVMYRD---------------INSPNNSTNVTTDTQ---MTVYGLQPDTTYDIRVQA 988          

HSP 4 Score: 83.1889 bits (204), Expect = 7.584e-12
Identity = 129/597 (21.61%), Postives = 241/597 (40.37%), Query Frame = 1
Query: 1126 YNLKDLFPFTTYCIWMESENPLGVSPPTIALTVKTLPTSPQLSPRSITATSISNTAILVAW--RPPERKFGKFKYYQIIYTNNDGFLPQHWRQFAVKDDNVMLTHLIASEL-----YHIRVKIVNEIGHGPLSKTISIKTIAGTLSQCP-DFKITEIFQSHIKLQWGTPDPVKLFKLIQYNLLCWDVRLKIVNATAKSSTLFPILNHNLSMNEMEYVLYLKNEKEIKCRLSAINSDGKGMPTEIQASTVNKGVNYQNLIHIDK-IGSTYITFQWRPPSKFSFDYFLWIYQIFDSEKLDRAVKLPKIKINISDSASAENGWFVYNYTNAFSSSRYILGLRYLCRDSTDILREYVHRSDLVSTMKSVPSDSPKDLVVKEIDSNSALVSWKPLDQVHSNGIITHYEVRYYAPKKEESTERFINV-SETSAILSNLKY-FHYVIYVRAFTKVGGGSWSNPKNYYRQNLEEFP-IPTTIKG----ERKSETEINISWELPVLSEKNLAHAAIEGFIILYAPVESSPKWIKYTVQSKNLSAVIKGLEPDLRYQFQIAATNYAGFNGNFSEIVQEMPKNFPNLNLKTVPDLRCSVQSSNRLKVE 2868
            Y +  L P T Y   + + + +G+   T  +  +T  ++P   P+ +   S+S+T++ V W   P + + G+   Y + Y    G   +  ++  V      +T  I  +L     Y + V+   ++G GP S    ++T        P   ++  +  + +++ W  P  VK    I+   L +    ++ N       +  IL+ NL   +  ++  L  E      ++A  + G G  ++ + +T    V  +  + I   IG+T +  QW+PP +   ++  +  Q   +E+    +K        +D          +  T     + YI  L    ++      EYV     +ST + +PS  P++L V  + + S  ++W P      NG I  Y V Y   +   S     NV ++T   +  L+    Y I V+AFT  GGG  S P    R      P +P+        +  ++T + ++WE+P   E   +   ++   ILY             VQ      +I  L+PD  Y F + +       GN +  +Q+       ++++T PDL     + + + VE
Sbjct:  574 YAVDGLKPDTLYVFSLAARSEMGLGVFTQPIECRTAQSTPSAPPQEVHLLSLSSTSVEVRWVAPPTDSQHGEIVGYSLAYQALTG---EDQKRHQVSGIGPDITSYILEDLEKWTEYLVWVRAHTDVGPGPESSAAKVRTKEDVPGAPPRKVEVEALNSTALRVSWKPPLSVKQHGQIRGYQLVYS---RLENGEPHGQPV--ILDVNLPEAQEAFIAGLLPETTYSVTVAAYTTKGDGARSKAKVATTTGAVPGKPTMMISTTIGNTAL-IQWQPPKEMVGEHMGYQLQYKRAEEEAFTIK----HFKKTDDH--------FTVTGLHKGAVYIFKL--CAKNRAGNGEEYVKE---ISTPEDIPSSYPQNLSVVGLTATSTKLAWDPPPLAERNGKIVKYVVMY---RDINSPNNSTNVTTDTQMTVYGLQPDTTYDIRVQAFTSKGGGPIS-PSIQSRTMSTSMPDLPSVFTKNFGVKAVTKTSVLLTWEVP---ETYKSQVPVK---ILY-------NQQSVEVQGNLKRKLITQLQPDTDYSFVLMS------RGNSAGGLQQ------QVSIRTAPDLLTVKPAQHHIDVE 1115          
BLAST of Protein tyrosine phosphatase receptor type D vs. TrEMBL
Match: A0A3P9B2Z8 (Protein tyrosine phosphatase receptor type Fa OS=Maylandia zebra OX=106582 PE=4 SV=1)

HSP 1 Score: 726.472 bits (1874), Expect = 0.000e+0
Identity = 333/606 (54.95%), Postives = 441/606 (72.77%), Query Frame = 1
Query: 4006 SDSIKLRIGSQKSENISDRPSISICNLYQYVTDLKANDCTLLQAEFETLNTNLDDRFTWQRSNIDSNKSKNRYANVVAYDHTSVLLTPVDDVIGSDYINANYIDGYQRQNAYIATQGPLPDTTDDFWRMVWEQRSNCIVMMTRLEERSGIKCHQYWPNRGFICYGQMIVSHIDTFVLAYYTIRLFEIRHSKYSEKREIQHFQFTAWPDHGVPKLSTPLLMFIRRVRSIGKIESCPKIVHCSAGVGRTGAFIVVDAQLERIKQEKNIDVFNYVSKIRCQRNYMVQTQAQYQFILETLLEAVEDGNTEVMACNFHAHVTKLSQIGISGSNQLSGFEMEFSKLNSLASNRGRHGVMLADFVKAAGNQAVNMTKNRVRNIIPYEWNRVVLNAIRGIEGSDYINASYIDGYRDRRAYIAAQSPIPSTVEDFWRMLWDQHCGVVIVLNQPHE---DKSHIYWPINKSIRYQFFVVDPVVEYNMPNYILREFKVTDARDGEFRALRQFQFTQWPNHGCPKESESILDFIRQVHKTKEQFGHMEPMVIHCNTGSGRTGVFIALSIVLDRLQQESVVDMYQTVKLLHKQRIGLVQTEEQYEFCYMAVLDYLSNYE 5814
            SD +++R  + +++ + + P I++C+L  ++  LKAND      E+E+++     +FTW+ SN++ NK KNRYANV+AYDH+ V+LTPVD V GSDYINANYIDGY++QNAYIATQGPLP+T  DFWRMVWEQR+  IVMMTRLEE+S +KC QYWP+RG   YG + V+ +DT  LA Y++R F +  +  SEKRE++ FQF AWPDHGVP+  TP L F+RR++S    ++ P +VHCSAGVGRTG FIV+DA LER+K EK++D++ +V+ +R QRNYMVQT+ QY F+ E LLEA   GNTEV A N +AH+ KL+Q  ++    ++  E+EF KL +  ++  R       F+ A  N   N  KNR+ NI+P+E  RV L  IRG+EGSDYINAS+IDGYR ++AY+A Q P+  T EDFWRMLW+ +  +V++L +  E   +K H YWP  +S RYQ+FVVDP+ EYNMP YILREFKVTDARDG+ R +RQFQFT WP  G PK  E  +DFI QVHKTKEQFG   P+ +HC+ G GRTGVFI LSIVL+R++ E VVD++QTVK L  QR  +VQTE+QY+ CY A L+YL +++
Sbjct: 1274 SDPVEMRRLNYQTQGMREHPPIAVCDLADHIERLKANDGLHFSQEYESIDPG--QQFTWEHSNLEVNKPKNRYANVIAYDHSRVILTPVDGVPGSDYINANYIDGYRKQNAYIATQGPLPETLSDFWRMVWEQRTCTIVMMTRLEEKSRVKCDQYWPSRGTETYGMIQVTMLDTLELATYSVRTFALYKNGSSEKREVRQFQFLAWPDHGVPEYPTPTLAFLRRIKSCNPQDAGPMVVHCSAGVGRTGCFIVIDAMLERMKHEKSVDIYGHVTCMRAQRNYMVQTEDQYIFVHEALLEAAVCGNTEVPARNLYAHIQKLTQ--VAAGEAVTAMELEFKKLANSKAHTSR-------FISA--NLPCNKFKNRLVNIMPFESTRVCLQPIRGVEGSDYINASFIDGYRQQKAYMATQGPLAETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTIRQFQFTDWPEQGVPKTGEGFIDFIGQVHKTKEQFGQDGPITVHCSAGVGRTGVFITLSIVLERMRYEGVVDLFQTVKTLRTQRPAMVQTEDQYQLCYRAALEYLGSFD 1866          

HSP 2 Score: 145.591 bits (366), Expect = 8.387e-31
Identity = 285/1262 (22.58%), Postives = 461/1262 (36.53%), Query Frame = 1
Query:  370 LACSSTGHPVPSISWKINESPIEELKSPLKKLQNPPRIFSIKNYQNSVLVITQLIESDSNSVLICEAENNAGFDSRQQQLKVISTETDIPSGFPVFQNNFFPIIKPYNSNVTLVCQAYGNPPPLIQWFKNYEL--INESFTKIKILNDGNLLLVQVTREDKGIYHCQAQNTNGLRLSDPSTLDI------TSYPISPNSLIIERFASDNVE----------ISWRSG------------------LNDVTEQENFI------LHYREVPENITEKQIMSKFVYLTISEKKS---IYKYNLKDLFPFTTYCIWME---SENPL--------------GVSP------------------PTIALTVKTLPTSPQLSPRSITATSISNTAILVAWRPPERKFGKFKYYQIIYTNNDGFLPQHWRQFAVKDDNVMLTHLIASEL-YHIRVKIVNEIGHGPLSKTISIKTIAGTLSQCPDFKITEIFQSHIKLQWGTP--DPVKLFKLIQYNLLCWDVRLKIVNATAKSSTLFPILNHNLSMNEMEYVLYLKNEKEIKCRLSAINSDGKGM---PTEIQASTVNKGVNYQNLIHIDKIGSTYITFQWRPPSKFS-----FDYFLWIYQIFDSEKLDRAVKLPKIKINISDSASAENGWFVYNYTNAFSSSRYILGLRYLCRDSTDILREYVHRSDLVSTMKSVPSDSPKDLVVKEIDSNSALVSWKPLDQVHSNGIITHYEVRYYAPKKEESTERF----INVSET--SAILSNLKYFHYVIYVRAFTKVGGGSWSNPKNYYRQNLEEFP-IPTTIKGERKSETEINISWELPVLSEKNLAHAAIEGFIILYAPVESSPKWIKYTVQSKNLSAVIKGLEPDLRYQFQIAATNYAGFNGNFSEIVQEM--PKNFPNLNLKTVPDLRCSVQSSNRLKVEWSSPSIS---TDLLKFEIRY--------SGNLSYITEI---GLKKSEFIDME------------SKSVNFETLVNRYDVTLENLQSNALYKIAVRAIYQNKELYESH-------------------RETTCDTMP-------------------------AVPNL--VKPPIIVGLDEEKSKVIIKLHRCSQRNGKISYYFVIVAAF-----QGNKNQQISFQEDTESYTFMELSVNTR-SNNAKGEYIAIMKD-INDIFKVSGKDHSSVLLGDGTHDENHLS--VNKKLEKNFNYRCFARVCLKYSNNSLCKSSPWSEPF--RISDLI 3606
              C + G P P I+W         +K   K       +    +   SVL I  L      ++  C A N+ G  +   +L V+  E  IP GFP         +       T++C A GNP P I WFK++    I+ S  +IK L  G L +      D+G Y C A N+ G R S P+ L +        + I P +  +    S N+           + W SG                  L ++ +  N+       L   E    IT K +      LT++E  +      ++  +  P + Y I      SEN                G+SP                  P+  +  +T   +P   P  + A  +S++ +LV W PPE   G+ + Y++ Y+++       W++    D +      +A+++ Y +RV     +G GP S T+ IKT  G  +Q  DF       S I L W  P  +P+     I + L+ W+      N T K    F              V  LK +      L+A +  G G+   P E + +        Q  +H+  + ST +  +W  P   S       Y L  YQ    E   R  ++  I  +I+           Y   +    + Y++      R  TD+       +  V T + VP   P+ + V+ ++S +  VSWKP   V  +G I  Y++ Y   +  E   +     +N+ E   + I   L    Y + V A+T  G G+ S  K          P  PT +       T + I W+ P    K +    + G+ + Y   E     IK+  ++ +    + GL     Y F++ A N A   GN  E V+E+  P++ P+   + +  +  +  S+   K+ W  P ++     ++K+ + Y        S N++  T++   GL+     D+             S S+   T+     V  +N    A+ K +V   ++  E Y+S                    R+      P                           P+L  VKP       EE  KV I L +         YY V+V        +    + +  QE  ES     L    R SN+    YIA   D + +IF +               DE   S   NK L     YRCF  V    +++    +SP+S+PF  +IS +I
Sbjct:   30 FVCQAVGEPKPRITW---------MKKGKKVSSQRFEVIEFDDGSGSVLRIQPLRTHRDEAIYECTATNSVGEINTSAKLTVLE-EDQIPHGFPTIDMGPQLKVVERTRTATMLCAASGNPDPEIYWFKDFLPVDISSSNGRIKQLRSGALQIENSEESDQGKYECVAVNSAGTRYSAPANLYVRVRRVPPRFSIPPTNHEVMPGGSVNLTCVAVGAPMPYVKWISGEVELTREDEMPIGRNVLELTNIRQSANYTCVAISSLGMIETTAQITVKALPKMPTSLTVTETTATSVTLTWDSGNPEPVSYYVIQYRAKLSENGFQEVDGVATTRYSIGGLSPFSEYEFRVMAVNNVGRGPPSSIVDTRTSEQAPSSPPLHVQARMLSSSTMLVQWEPPEEPNGQIRGYRVYYSSDHDAPLSAWQKHNTDDSHFTTISGLATDITYSLRVLGFTSVGDGPPSDTLQIKTRQGVPAQPSDFDGEAELDSRIMLSWLWPVQEPI-----ISFELVYWEAN----NPTDKHRVTFDAAGSYA-------VDGLKPDTLYVFSLAARSEMGLGVFTQPIECRTAQSTPSAPPQE-VHLLSLSSTSVEVRWVAPPTDSQHGEIVGYSL-AYQALTGEDQKRH-QVSGIGPDITS----------YILEDLEKWTEYLV----WVRAHTDVGPGPESSAAKVRTKEDVPGAPPRKVEVEALNSTALRVSWKPPLSVKQHGQIRGYQLVYSRLENGEPHGQPVILDVNLPEAQEAFIAGLLPETTYSVTVAAYTTKGDGARSKAK--VATTTGAVPGKPTMMISTTIGNTAL-IQWQPP----KEMVGEHM-GYQLQYKRAEEEAFTIKHFKKTDD-HFTVTGLHKGAVYIFKLCAKNRA---GNGEEYVKEISTPEDIPSSYPQNLSVVGLTATST---KLAWDPPPLAERNGKIVKYVVMYRDINSPNNSTNVTTDTQMTVYGLQPDTTYDIRVQAFTSKGGGPISPSIQSRTMSTSMPVFTKNFGVKAVTKTSVLLTWEVPETYKSQVPVKILYNQQSVEVQGNLKRKLITQLQPDTDYSFVLMSRGNSAGGLQQQVSIRTAPDLLTVKPAQHHIDVEEGGKVTISLPKVPDAAAVRWYYIVVVPVTPVSLRRWENPEDMDIQELLESGADSSLQRRKRQSNDFLQPYIAAKLDTLPEIFTLG--------------DEKKYSGFYNKPLPGQQQYRCF--VLADLTDHETFAASPFSDPFTVKISGVI 1217          
BLAST of Protein tyrosine phosphatase receptor type D vs. Ensembl Cavefish
Match: ptprfa (protein tyrosine phosphatase receptor type Fa [Source:ZFIN;Acc:ZDB-GENE-020107-2])

HSP 1 Score: 724.546 bits (1869), Expect = 0.000e+0
Identity = 331/606 (54.62%), Postives = 440/606 (72.61%), Query Frame = 1
Query: 4006 SDSIKLRIGSQKSENISDRPSISICNLYQYVTDLKANDCTLLQAEFETLNTNLDDRFTWQRSNIDSNKSKNRYANVVAYDHTSVLLTPVDDVIGSDYINANYIDGYQRQNAYIATQGPLPDTTDDFWRMVWEQRSNCIVMMTRLEERSGIKCHQYWPNRGFICYGQMIVSHIDTFVLAYYTIRLFEIRHSKYSEKREIQHFQFTAWPDHGVPKLSTPLLMFIRRVRSIGKIESCPKIVHCSAGVGRTGAFIVVDAQLERIKQEKNIDVFNYVSKIRCQRNYMVQTQAQYQFILETLLEAVEDGNTEVMACNFHAHVTKLSQIGISGSNQLSGFEMEFSKLNSLASNRGRHGVMLADFVKAAGNQAVNMTKNRVRNIIPYEWNRVVLNAIRGIEGSDYINASYIDGYRDRRAYIAAQSPIPSTVEDFWRMLWDQHCGVVIVLNQPHE---DKSHIYWPINKSIRYQFFVVDPVVEYNMPNYILREFKVTDARDGEFRALRQFQFTQWPNHGCPKESESILDFIRQVHKTKEQFGHMEPMVIHCNTGSGRTGVFIALSIVLDRLQQESVVDMYQTVKLLHKQRIGLVQTEEQYEFCYMAVLDYLSNYE 5814
            SD +++R  + +S+ + + P I +C+L  ++  LKAND      E+E+++     +FTW+ SN++ NK KNRYANV+AYDH+ V+LTPVD V GSDYINANY+DGY++QNAYI TQGPLP+T  DFWRMVWEQR+N IVMMT+LEE+S +KC QYWP+RG   YG + VS +DT  LA Y++R F +  +  SEKRE++ FQF AWPDHGVP+  TP+L F+RRV++    ++ P +VHCSAGVGRTG FIV+DA LER+K EK++D++ +V+ +R QRNYMVQT+ QY FI E LLEA   G+TEV A + + H+ KL+Q  +   + ++  E+EF KL +  ++  R       F+ A  N   N  KNR+ NI+P+E  RV L  IRG+EGSDYINAS++DGYR ++AYIA Q P+  T EDFWRMLW+ +  +V++L +  E   +K H YWP  +S RYQ+FVVDP+ EYNMP YILREFKVTDARDG+ R +RQFQFT WP  G PK  E  +DFI QVHKTKEQFG   P+ +HC+ G GRTGVFI LSIVL+R++ E VVD++QTVK L  QR  +VQTE+QY+ CY A L+YL +++
Sbjct: 1317 SDPVEMRRLNYQSQGMREHPPIPVCDLADHIERLKANDGLRFSQEYESIDPG--QQFTWEHSNLEVNKPKNRYANVIAYDHSRVILTPVDGVPGSDYINANYVDGYRKQNAYIGTQGPLPETLSDFWRMVWEQRTNTIVMMTKLEEKSRVKCDQYWPSRGTETYGMIQVSMLDTVELATYSVRTFALYKNGSSEKREVRQFQFMAWPDHGVPEYPTPILAFLRRVKACNPPDAGPMVVHCSAGVGRTGCFIVIDAMLERMKHEKSVDIYGHVTCMRAQRNYMVQTEDQYVFIHEALLEAATCGHTEVPARSLYTHIQKLTQ--VPPGDTVTAMELEFKKLANSKAHTSR-------FISA--NLPCNKFKNRLVNIMPFESTRVCLQPIRGVEGSDYINASFLDGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTIRQFQFTDWPEQGVPKTGEGFIDFIGQVHKTKEQFGQDGPITVHCSAGVGRTGVFITLSIVLERMRYEGVVDLFQTVKTLRTQRPAMVQTEDQYQLCYRAALEYLGSFD 1909          

HSP 2 Score: 152.91 bits (385), Expect = 2.020e-36
Identity = 228/996 (22.89%), Postives = 376/996 (37.75%), Query Frame = 1
Query:  370 LACSSTGHPVPSISWKINESPIEELKSPLKKLQNPPRIFSIKNYQNSVLVITQLIESDSNSVLICEAENNAGFDSRQQQLKVISTETDIPSGFPVFQNNFFPIIKPYNSNVTLVCQAYGNPPPLIQWFKNYEL--INESFTKIKILNDGNLLLVQVTREDKGIYHCQAQNTNGLRLSDPSTLDITSYPISPNSLIIERFASDNVEISWRSGLNDVTEQENFILHYREVPENITEKQIMSKFVYLTISEKKSIYK-----YNLKDLFPFTTYCIWMESENPLGVSPPTIALTVKTLPTSPQLSPRSITATSISNTAILVAW---RPPERKFGKFKYYQIIYTNNDGFLPQHWRQFAVKDDNVMLTHLIASELYHIRVKIVNEIGHGPLSKTISIKTIAGTLSQCP-DFKITEIFQSHIKLQWGTPDPVKLFKLIQYNLLCWDVRLKIVNATAKSSTLFPILN-HNLSMNEMEYVLYLKNEKEIKCRLSAINSDGKGMPTEIQASTVNKGVNYQNL-IHIDKIGSTYITFQWRPPSKFSFDYFLWIYQIFDSEKLDRAVKLPKIKINISDSASAENGWFVYNYTNAFSSSRYILGLRYLCRDSTDILREYVHRSDLVSTMKSVPSDSPKDLVVKEIDSNSALVSWKPLDQVHSNGIITHYEVRYYAPKKEESTE---RFINVSETSAILSNL-KYFHYVIYVRAFTKVGGGSWSNPKNYYRQNLEEFPIPTTIKGERKSETEINISWELPVLSEKNLAHAAIEGFIILYAPVESSPKWIKYTVQSKNL----SAVIKGLEPDLRYQFQIAATNYAGFNGNFSEIVQEMPKNFPNLNLKTVPDLRCSVQSSNRLKVEWSSP-SISTDLLKFEIRYSGNLSYITEIGLKKSEFIDMESKSVNFETLVNRYDVTLENLQSNALYKIAVRAIYQNKELYESHRETTCDTMPAVPNLVKPPIIVGLDEEKSKVIIKLHRCSQRNGKISYYFVIVAAFQGNKNQ 3291
              C + G P P I+W         +K   K       +    +   SVL I  L      ++  C A N+ G  +   +L V+  E  IP GFP         +       T++C A GNP P I WFK++    IN S  +IK L  G L +      D+G Y C A N+ G R S P+ L +    + P      RF+   +        ++V    +  L    V   +   + M+  V LT  E+  I +      N++    +T  C+ + S   LG+   T  +TVK LP  P     S+  T  + T++ + W    P    +   +Y  II  +++GF         V      +  L     Y  RV  VN IG GP S T+  +T     S  P   +   +  + + +QW  P+    F           +R   V  T +  T     + HN   + +  +  L  +     R+    S G G P+++      +GV  Q      +    T I   W  P +     +  IY   DS         P     + +S   +    +Y +T A   +R  +GL    +                 T +S PS  P+++ +  + S S  VSW        +G I  Y + Y A   E+      + I+   +S +L  L K+  Y ++V+A T VG G  S+      +       P  ++ +  + T + +SW+ P L++K   H  + G+ ++Y+ VE+     + T+    L     A I GL+ +  Y   +AA    G        V       P       P +  S    N   ++W  P  +  DLL + ++Y            K+ E  D       F+   + + VT  +  +  ++K++ R    N E Y     T  D   + P  +    +VGL    +++       ++RNGKI  Y V+       +N 
Sbjct:   64 FVCQAVGEPKPRITW---------MKKGKKVSSQRFEVIEFDDGSGSVLRIQPLRTHRDEAIYECTATNSVGEINTSAKLIVLE-EDQIPHGFPTIDMGPQLKVVERTRTATMLCAASGNPDPEISWFKDFLPVDINGSNGRIKQLRSGALQIENSEESDQGKYECVAMNSAGTRYSAPANLYVRVRRVPP------RFSIPPIN-------HEVMPGGSLNLTCVAVGAPMPYVKWMTGEVELTKEEEMPIGRNVLELTNIRQSANYT--CVAISS---LGMIETTAQITVKALPRPPT----SLIVTETTATSVTLTWDSGNPEPVSYYVIQYRAII--SDNGFQEVD----GVASTRYSIGGLSPYSEYEFRVMAVNNIGRGPPSGTVETRTSEQAPSSPPLSVQARMLSATTMLVQWEPPEEPNGF-----------IRGYRVYYTHELHTPLSTWHKHNTDDSRLTTISGLVPDITYSLRVLGFTSVGDGPPSDVLQVKTQQGVPAQPTDFEAEAELDTRIMLTWLWPVQDQITKYELIYWEADSGDKTHVTFEPAGSYAV-ESLKPDT---LYKFTLA---ARSEMGLGVYTQPIE------------ARTAQSTPSAPPQEVHLLSLSSTSIQVSWVAPPAASRHGNIVRYSLAYQALSGEDQERHEVKDISADTSSYLLEGLEKWTEYQVWVKAHTDVGPGPESSSTRIRTKEDVPGAPPRRVEVDIINSTTLRVSWK-PPLAQKQ--HGQVRGYQVVYSRVENGEPRGQPTILDVALPEAQDAFITGLQAETSYSITVAAYTTKGDGARSKAKVVTTSGAVPGK-----PTMIISTTIGNTALIQWQPPKEMVGDLLGYTLQY------------KREE--DASFTVREFKRTDDHFTVTGLHKGATYIFKLSARNRAGNGEEYTKEVTTPEDVPGSYPQNLS---VVGLTTSSTELAWDPPPLAERNGKIVRYVVVYRDINSQQNH 966          

HSP 3 Score: 138.272 bits (347), Expect = 4.942e-32
Identity = 217/963 (22.53%), Postives = 382/963 (39.67%), Query Frame = 1
Query:  265 LVLINSQIT--FTENDEAPKISLIIQSPNVLLFKSMILACSSTGHPVPSISWKINESPIEELKSPLKKLQNPPRIFSIKNYQNSVLVITQLIESDSNSVLICEAENNAGFD-SRQQQLKVISTETDIPSGFPVFQNNFFPIIKPYNSNVTLVCQAYGNPPPLIQWFKN-YELINESFTKIKILNDGNLLLVQVTREDKGIYHCQAQNTNGLRLSDPSTLDITSYPISPNSLIIERFASDNVEISWRSGLNDVTEQENFILHYREVPENITEKQIMSKFVYLTISEKKSIYKYNLKDLFPFTTYCIWMESENPLGVSPPTIALTVKTLPTSPQLSPRSITATSISNTAILVAWRPPERKFGKFKYYQIIYTNNDGFLPQHWRQFAVKDDNV-MLTHLIASELYHIRVKIVNEIGHGPLSKTISIKTIAGTLSQCPDFKITEIFQSHIKLQWGTPDPVKLFKLIQYNLLCWDVRLKIVNATAKSSTLF-PILNHNLSMNEMEYVLYLKNEKEIKCRLSAINSDGKGMPTE-IQASTVNKGVNY-QNLIHIDKIGSTYITFQWRPPSKFS----FDYFLWIYQIFDSEKLDRAVKLPKIKINISDSAS----AENGWFVYNYTNAFSSSRYILGLRYLCRDSTDILREYVHRSDLVSTMKSVPSDSPKDLVVKEIDSNSALVSWKPLDQVHSNGIITHYEVRYY-----APKKEESTERFINVSETSAILSNLKY-FHYVIYVRAFTKVGGGSWSNPKNYYRQNLEEFPIPTTIKGERKSETEINISWELPVLSEKNLAHAAIEGFIILYAPVESSPKWIKYTVQSKNLSAVIKGLEPDLRYQFQIAATNYAGFNGNFSEIV---QEMPKNFPNLNLKTVPDLRCSVQSSNRLKVEWSSPSISTDLLKFEIRYSGNLSYITEIGLKKSEFIDMESKSVNFETLVNRYDVTLENLQSNALYKIAVRA 3078
            +VL   QI   F   D  P++ ++ ++      ++  + C+++G+P P ISW  +  P++   S  +          IK  ++  L I    ESD      C A N+AG   S    L V           P   +   P       ++ L C A G P P ++W     EL  E    I      N+L +   R+    Y C A ++ G+ +   + + + + P  P SLI+    + +V ++W SG  +      +++ YR          I+S   +  +    S  +Y++  L P++ Y   + + N +G  PP+  +  +T   +P   P S+ A  +S T +LV W PPE   G  + Y++ YT+        W +    D  +  ++ L+    Y +RV     +G GP S  + +KT  G  +Q  DF+      + I L W  P   ++ K   Y L+ W+      ++  K+   F P  ++         V  LK +   K  L+A +  G G+ T+ I+A T     +     +H+  + ST I   W  P   S       +   YQ    E  +R     ++K   +D++S        W  Y               +   +  TD+       S  + T + VP   P+ + V  I+S +  VSWKP      +G +  Y+V Y       P+ + +           A ++ L+    Y I V A+T  G G+ S  K            PT I       T + I W+ P     +L      G+ + Y   E +   ++   ++ +    + GL     Y F+++A N AG    +++ V   +++P ++P  NL  V        +++  ++ W  P ++    K  +RY                + D+ S+  N      +  +T+  LQ++  Y I VRA
Sbjct:  135 IVLEEDQIPHGFPTIDMGPQLKVVERT------RTATMLCAASGNPDPEISWFKDFLPVDINGSNGR----------IKQLRSGALQIENSEESDQGKYE-CVAMNSAGTRYSAPANLYVRVRRVPPRFSIPPINHEVMP-----GGSLNLTCVAVGAPMPYVKWMTGEVELTKEEEMPI----GRNVLELTNIRQSAN-YTCVAISSLGM-IETTAQITVKALPRPPTSLIVTETTATSVTLTWDSGNPEPVSY--YVIQYRA---------IISDNGFQEVDGVAST-RYSIGGLSPYSEYEFRVMAVNNIGRGPPSGTVETRTSEQAPSSPPLSVQARMLSATTMLVQWEPPEEPNGFIRGYRVYYTHELHTPLSTWHKHNTDDSRLTTISGLVPDITYSLRVLGFTSVGDGPPSDVLQVKTQQGVPAQPTDFEAEAELDTRIMLTWLWPVQDQITK---YELIYWE-----ADSGDKTHVTFEPAGSYA--------VESLKPDTLYKFTLAARSEMGLGVYTQPIEARTAQSTPSAPPQEVHLLSLSSTSIQVSWVAPPAASRHGNIVRYSLAYQALSGEDQERH----EVKDISADTSSYLLEGLEKWTEY---------------QVWVKAHTDVGPGPESSSTRIRTKEDVPGAPPRRVEVDIINSTTLRVSWKPPLAQKQHGQVRGYQVVYSRVENGEPRGQPTILDVALPEAQDAFITGLQAETSYSITVAAYTTKGDGARSKAKVVTTSGAVPGK-PTMIISTTIGNTAL-IQWQPPKEMVGDLL-----GYTLQYKREEDASFTVREFKRTDD-HFTVTGLHKGATYIFKLSARNRAGNGEEYTKEVTTPEDVPGSYPQ-NLSVV------GLTTSSTELAWDPPPLAERNGKI-VRYV-------------VVYRDINSQQ-NHTNTTAQTRMTINGLQADTTYDIRVRA 992          

HSP 4 Score: 88.9669 bits (219), Expect = 4.971e-17
Identity = 132/584 (22.60%), Postives = 231/584 (39.55%), Query Frame = 1
Query: 1126 YNLKDLFPFTTYCIWMESENPLGVSPPTIALTVKTLPTSPQLSPRSITATSISNTAILVAW--RPPERKFGKFKYYQIIYTNNDGFLPQHWRQFAVKD-----DNVMLTHLIASELYHIRVKIVNEIGHGPLSKTISIKTIAGTLSQCPDFKITEIFQSH-IKLQWGTPDPVKLFKLIQYNLLCWDVRLKIVNATAKSSTLFPILNHNLSMNEMEYVLYLKNEKEIKCRLSAINSDGKGMPTEIQASTVNKGV-NYQNLIHIDKIGSTYITFQWRPPSKFSFDYFLWIYQIFDSEKLDRAVKLPKIKINISDSASAENGWFVYNYTNAFSSSRYILGLRYLCRDSTDILREYVHRSDLVSTMKSVPSDSPKDLVVKEIDSNSALVSWKPLDQVHSNGIITHYEVRYYAPKKEESTERFIN-VSETSAILSNLKY-FHYVIYVRAFTKVGGG--SWSNPKNYYRQNLEEFPIPTTIKGERKSETEINISWELPVLSEKNLAHAAIEGFIILYAPVESSPKWIKYTVQSKNLSAVIKGLEPDLRYQFQIAATNYAGFNGNFSEIVQEMPKNFPNLNLKTVPDLRCS 2838
            Y ++ L P T Y   + + + +G+   T  +  +T  ++P   P+ +   S+S+T+I V+W   P   + G    Y + Y    G   +   +  VKD      + +L  L     Y + VK   ++G GP S +  I+T        P     +I  S  +++ W  P   K    ++   + +    ++ N   +      IL+  L   +  ++  L+ E      ++A  + G G  ++ +  T +  V     +I    IG+T +  QW+PP +   D   +  Q    E     V+    +   +D          +  T     + YI  L    R+      EY      V+T + VP   P++L V  + ++S  ++W P      NG I  Y V Y   +   S +   N  ++T   ++ L+    Y I VRAFT  GGG  S S        ++ EF     +K   KS   + ++WE+P   +  +       F ILY             VQ      +I  L+PD  Y F + +       GN +  +Q+       ++++T PDL  S
Sbjct:  578 YAVESLKPDTLYKFTLAARSEMGLGVYTQPIEARTAQSTPSAPPQEVHLLSLSSTSIQVSWVAPPAASRHGNIVRYSLAYQALSG---EDQERHEVKDISADTSSYLLEGLEKWTEYQVWVKAHTDVGPGPESSSTRIRTKEDVPGAPPRRVEVDIINSTTLRVSWKPPLAQKQHGQVRGYQVVYS---RVENGEPRGQPT--ILDVALPEAQDAFITGLQAETSYSITVAAYTTKGDGARSKAKVVTTSGAVPGKPTMIISTTIGNTAL-IQWQPPKEMVGDLLGYTLQYKREEDASFTVR----EFKRTDDH--------FTVTGLHKGATYIFKLS--ARNRAGNGEEYTKE---VTTPEDVPGSYPQNLSVVGLTTSSTELAWDPPPLAERNGKIVRYVVVY---RDINSQQNHTNTTAQTRMTINGLQADTTYDIRVRAFTSKGGGPISPSIQSRTMATSMPEFTKNFGVKAVMKS--SVLLTWEVPETYKSQVP------FKILY-------NQQSVEVQGDLKRKLITRLQPDTDYSFVLMS------RGNSAGGLQQ------QVSIRTAPDLLTS 1105          
BLAST of Protein tyrosine phosphatase receptor type D vs. Ensembl Cavefish
Match: ptprfa (protein tyrosine phosphatase receptor type Fa [Source:ZFIN;Acc:ZDB-GENE-020107-2])

HSP 1 Score: 716.842 bits (1849), Expect = 0.000e+0
Identity = 327/591 (55.33%), Postives = 430/591 (72.76%), Query Frame = 1
Query: 4051 ISDRPSISICNLYQYVTDLKANDCTLLQAEFETLNTNLDDRFTWQRSNIDSNKSKNRYANVVAYDHTSVLLTPVDDVIGSDYINANYIDGYQRQNAYIATQGPLPDTTDDFWRMVWEQRSNCIVMMTRLEERSGIKCHQYWPNRGFICYGQMIVSHIDTFVLAYYTIRLFEIRHSKYSEKREIQHFQFTAWPDHGVPKLSTPLLMFIRRVRSIGKIESCPKIVHCSAGVGRTGAFIVVDAQLERIKQEKNIDVFNYVSKIRCQRNYMVQTQAQYQFILETLLEAVEDGNTEVMACNFHAHVTKLSQIGISGSNQLSGFEMEFSKLNSLASNRGRHGVMLADFVKAAGNQAVNMTKNRVRNIIPYEWNRVVLNAIRGIEGSDYINASYIDGYRDRRAYIAAQSPIPSTVEDFWRMLWDQHCGVVIVLNQPHE---DKSHIYWPINKSIRYQFFVVDPVVEYNMPNYILREFKVTDARDGEFRALRQFQFTQWPNHGCPKESESILDFIRQVHKTKEQFGHMEPMVIHCNTGSGRTGVFIALSIVLDRLQQESVVDMYQTVKLLHKQRIGLVQTEEQYEFCYMAVLDYLSNYE 5814
            + + P I +C+L  ++  LKAND      E+E+++     +FTW+ SN++ NK KNRYANV+AYDH+ V+LTPVD V GSDYINANY+DGY++QNAYI TQGPLP+T  DFWRMVWEQR+N IVMMT+LEE+S +KC QYWP+RG   YG + VS +DT  LA Y++R F +  +  SEKRE++ FQF AWPDHGVP+  TP+L F+RRV++    ++ P +VHCSAGVGRTG FIV+DA LER+K EK++D++ +V+ +R QRNYMVQT+ QY FI E LLEA   G+TEV A + + H+ KL+Q  +   + ++  E+EF KL +  ++  R       F+ A  N   N  KNR+ NI+P+E  RV L  IRG+EGSDYINAS++DGYR ++AYIA Q P+  T EDFWRMLW+ +  +V++L +  E   +K H YWP  +S RYQ+FVVDP+ EYNMP YILREFKVTDARDG+ R +RQFQFT WP  G PK  E  +DFI QVHKTKEQFG   P+ +HC+ G GRTGVFI LSIVL+R++ E VVD++QTVK L  QR  +VQTE+QY+ CY A L+YL +++
Sbjct: 1265 MREHPPIPVCDLADHIERLKANDGLRFSQEYESIDPG--QQFTWEHSNLEVNKPKNRYANVIAYDHSRVILTPVDGVPGSDYINANYVDGYRKQNAYIGTQGPLPETLSDFWRMVWEQRTNTIVMMTKLEEKSRVKCDQYWPSRGTETYGMIQVSMLDTVELATYSVRTFALYKNGSSEKREVRQFQFMAWPDHGVPEYPTPILAFLRRVKACNPPDAGPMVVHCSAGVGRTGCFIVIDAMLERMKHEKSVDIYGHVTCMRAQRNYMVQTEDQYVFIHEALLEAATCGHTEVPARSLYTHIQKLTQ--VPPGDTVTAMELEFKKLANSKAHTSR-------FISA--NLPCNKFKNRLVNIMPFESTRVCLQPIRGVEGSDYINASFLDGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTIRQFQFTDWPEQGVPKTGEGFIDFIGQVHKTKEQFGQDGPITVHCSAGVGRTGVFITLSIVLERMRYEGVVDLFQTVKTLRTQRPAMVQTEDQYQLCYRAALEYLGSFD 1842          

HSP 2 Score: 145.591 bits (366), Expect = 3.346e-34
Identity = 220/959 (22.94%), Postives = 365/959 (38.06%), Query Frame = 1
Query:  481 IFSIKNYQNSVLVITQLIESDSNSVLICEAENNAGFDSRQQQLKVISTETDIPSGFPVFQNNFFPIIKPYNSNVTLVCQAYGNPPPLIQWFKNYEL--INESFTKIKILNDGNLLLVQVTREDKGIYHCQAQNTNGLRLSDPSTLDITSYPISPNSLIIERFASDNVEISWRSGLNDVTEQENFILHYREVPENITEKQIMSKFVYLTISEKKSIYK-----YNLKDLFPFTTYCIWMESENPLGVSPPTIALTVKTLPTSPQLSPRSITATSISNTAILVAW---RPPERKFGKFKYYQIIYTNNDGFLPQHWRQFAVKDDNVMLTHLIASELYHIRVKIVNEIGHGPLSKTISIKTIAGTLSQCP-DFKITEIFQSHIKLQWGTPDPVKLFKLIQYNLLCWDVRLKIVNATAKSSTLFPILN-HNLSMNEMEYVLYLKNEKEIKCRLSAINSDGKGMPTEIQASTVNKGVNYQNL-IHIDKIGSTYITFQWRPPSKFSFDYFLWIYQIFDSEKLDRAVKLPKIKINISDSASAENGWFVYNYTNAFSSSRYILGLRYLCRDSTDILREYVHRSDLVSTMKSVPSDSPKDLVVKEIDSNSALVSWKPLDQVHSNGIITHYEVRYYAPKKEESTE---RFINVSETSAILSNL-KYFHYVIYVRAFTKVGGGSWSNPKNYYRQNLEEFPIPTTIKGERKSETEINISWELPVLSEKNLAHAAIEGFIILYAPVESSPKWIKYTVQSKNL----SAVIKGLEPDLRYQFQIAATNYAGFNGNFSEIVQEMPKNFPNLNLKTVPDLRCSVQSSNRLKVEWSSP-SISTDLLKFEIRYSGNLSYITEIGLKKSEFIDMESKSVNFETLVNRYDVTLENLQSNALYKIAVRAIYQNKELYESHRETTCDTMPAVPNLVKPPIIVGLDEEKSKVIIKLHRCSQRNGKISYYFVIVAAFQGNKNQ 3291
            +    +   SVL I  L      ++  C A N+ G  +   +L V+  E  IP GFP         +       T++C A GNP P I WFK++    IN S  +IK L  G L +      D+G Y C A N+ G R S P+ L +    + P      RF+   +        ++V    +  L    V   +   + M+  V LT  E+  I +      N++    +T  C+ + S   LG+   T  +TVK LP  P     S+  T  + T++ + W    P    +   +Y  II  +++GF         V      +  L     Y  RV  VN IG GP S T+  +T     S  P   +   +  + + +QW  P+    F           +R   V  T +  T     + HN   + +  +  L  +     R+    S G G P+++      +GV  Q      +    T I   W  P +     +  IY   DS         P     + +S   +    +Y +T A   +R  +GL    +                 T +S PS  P+++ +  + S S  VSW        +G I  Y + Y A   E+      + I+   +S +L  L K+  Y ++V+A T VG G  S+      +       P  ++ +  + T + +SW+ P L++K   H  + G+ ++Y+ VE+     + T+    L     A I GL+ +  Y   +AA    G        V       P       P +  S    N   ++W  P  +  DLL + ++Y            K+ E  D       F+   + + VT  +  +  ++K++ R    N E Y     T  D   + P  +    +VGL    +++       ++RNGKI  Y V+       +N 
Sbjct:   14 VIEFDDGSGSVLRIQPLRTHRDEAIYECTATNSVGEINTSAKLIVLE-EDQIPHGFPTIDMGPQLKVVERTRTATMLCAASGNPDPEISWFKDFLPVDINGSNGRIKQLRSGALQIENSEESDQGKYECVAMNSAGTRYSAPANLYVRVRRVPP------RFSIPPIN-------HEVMPGGSLNLTCVAVGAPMPYVKWMTGEVELTKEEEMPIGRNVLELTNIRQSANYT--CVAISS---LGMIETTAQITVKALPRPPT----SLIVTETTATSVTLTWDSGNPEPVSYYVIQYRAII--SDNGFQEVD----GVASTRYSIGGLSPYSEYEFRVMAVNNIGRGPPSGTVETRTSEQAPSSPPLSVQARMLSATTMLVQWEPPEEPNGF-----------IRGYRVYYTHELHTPLSTWHKHNTDDSRLTTISGLVPDITYSLRVLGFTSVGDGPPSDVLQVKTQQGVPAQPTDFEAEAELDTRIMLTWLWPVQDQITKYELIYWEADSGDKTHVTFEPAGSYAV-ESLKPDT---LYKFTLA---ARSEMGLGVYTQPIE------------ARTAQSTPSAPPQEVHLLSLSSTSIQVSWVAPPAASRHGNIVRYSLAYQALSGEDQERHEVKDISADTSSYLLEGLEKWTEYQVWVKAHTDVGPGPESSSTRIRTKEDVPGAPPRRVEVDIINSTTLRVSWK-PPLAQKQ--HGQVRGYQVVYSRVENGEPRGQPTILDVALPEAQDAFITGLQAETSYSITVAAYTTKGDGARSKAKVVTTSGAVPGK-----PTMIISTTIGNTALIQWQPPKEMVGDLLGYTLQY------------KREE--DASFTVREFKRTDDHFTVTGLHKGATYIFKLSARNRAGNGEEYTKEVTTPEDVPGSYPQNLS---VVGLTTSSTELAWDPPPLAERNGKIVRYVVVYRDINSQQNH 888          

HSP 3 Score: 137.887 bits (346), Expect = 6.634e-32
Identity = 217/963 (22.53%), Postives = 382/963 (39.67%), Query Frame = 1
Query:  265 LVLINSQIT--FTENDEAPKISLIIQSPNVLLFKSMILACSSTGHPVPSISWKINESPIEELKSPLKKLQNPPRIFSIKNYQNSVLVITQLIESDSNSVLICEAENNAGFD-SRQQQLKVISTETDIPSGFPVFQNNFFPIIKPYNSNVTLVCQAYGNPPPLIQWFKN-YELINESFTKIKILNDGNLLLVQVTREDKGIYHCQAQNTNGLRLSDPSTLDITSYPISPNSLIIERFASDNVEISWRSGLNDVTEQENFILHYREVPENITEKQIMSKFVYLTISEKKSIYKYNLKDLFPFTTYCIWMESENPLGVSPPTIALTVKTLPTSPQLSPRSITATSISNTAILVAWRPPERKFGKFKYYQIIYTNNDGFLPQHWRQFAVKDDNV-MLTHLIASELYHIRVKIVNEIGHGPLSKTISIKTIAGTLSQCPDFKITEIFQSHIKLQWGTPDPVKLFKLIQYNLLCWDVRLKIVNATAKSSTLF-PILNHNLSMNEMEYVLYLKNEKEIKCRLSAINSDGKGMPTE-IQASTVNKGVNY-QNLIHIDKIGSTYITFQWRPPSKFS----FDYFLWIYQIFDSEKLDRAVKLPKIKINISDSAS----AENGWFVYNYTNAFSSSRYILGLRYLCRDSTDILREYVHRSDLVSTMKSVPSDSPKDLVVKEIDSNSALVSWKPLDQVHSNGIITHYEVRYY-----APKKEESTERFINVSETSAILSNLKY-FHYVIYVRAFTKVGGGSWSNPKNYYRQNLEEFPIPTTIKGERKSETEINISWELPVLSEKNLAHAAIEGFIILYAPVESSPKWIKYTVQSKNLSAVIKGLEPDLRYQFQIAATNYAGFNGNFSEIV---QEMPKNFPNLNLKTVPDLRCSVQSSNRLKVEWSSPSISTDLLKFEIRYSGNLSYITEIGLKKSEFIDMESKSVNFETLVNRYDVTLENLQSNALYKIAVRA 3078
            +VL   QI   F   D  P++ ++ ++      ++  + C+++G+P P ISW  +  P++   S  +          IK  ++  L I    ESD      C A N+AG   S    L V           P   +   P       ++ L C A G P P ++W     EL  E    I      N+L +   R+    Y C A ++ G+ +   + + + + P  P SLI+    + +V ++W SG  +      +++ YR          I+S   +  +    S  +Y++  L P++ Y   + + N +G  PP+  +  +T   +P   P S+ A  +S T +LV W PPE   G  + Y++ YT+        W +    D  +  ++ L+    Y +RV     +G GP S  + +KT  G  +Q  DF+      + I L W  P   ++ K   Y L+ W+      ++  K+   F P  ++         V  LK +   K  L+A +  G G+ T+ I+A T     +     +H+  + ST I   W  P   S       +   YQ    E  +R     ++K   +D++S        W  Y               +   +  TD+       S  + T + VP   P+ + V  I+S +  VSWKP      +G +  Y+V Y       P+ + +           A ++ L+    Y I V A+T  G G+ S  K            PT I       T + I W+ P     +L      G+ + Y   E +   ++   ++ +    + GL     Y F+++A N AG    +++ V   +++P ++P  NL  V        +++  ++ W  P ++    K  +RY                + D+ S+  N      +  +T+  LQ++  Y I VRA
Sbjct:   57 IVLEEDQIPHGFPTIDMGPQLKVVERT------RTATMLCAASGNPDPEISWFKDFLPVDINGSNGR----------IKQLRSGALQIENSEESDQGKYE-CVAMNSAGTRYSAPANLYVRVRRVPPRFSIPPINHEVMP-----GGSLNLTCVAVGAPMPYVKWMTGEVELTKEEEMPI----GRNVLELTNIRQSAN-YTCVAISSLGM-IETTAQITVKALPRPPTSLIVTETTATSVTLTWDSGNPEPVSY--YVIQYRA---------IISDNGFQEVDGVAST-RYSIGGLSPYSEYEFRVMAVNNIGRGPPSGTVETRTSEQAPSSPPLSVQARMLSATTMLVQWEPPEEPNGFIRGYRVYYTHELHTPLSTWHKHNTDDSRLTTISGLVPDITYSLRVLGFTSVGDGPPSDVLQVKTQQGVPAQPTDFEAEAELDTRIMLTWLWPVQDQITK---YELIYWE-----ADSGDKTHVTFEPAGSYA--------VESLKPDTLYKFTLAARSEMGLGVYTQPIEARTAQSTPSAPPQEVHLLSLSSTSIQVSWVAPPAASRHGNIVRYSLAYQALSGEDQERH----EVKDISADTSSYLLEGLEKWTEY---------------QVWVKAHTDVGPGPESSSTRIRTKEDVPGAPPRRVEVDIINSTTLRVSWKPPLAQKQHGQVRGYQVVYSRVENGEPRGQPTILDVALPEAQDAFITGLQAETSYSITVAAYTTKGDGARSKAKVVTTSGAVPGK-PTMIISTTIGNTAL-IQWQPPKEMVGDLL-----GYTLQYKREEDASFTVREFKRTDD-HFTVTGLHKGATYIFKLSARNRAGNGEEYTKEVTTPEDVPGSYPQ-NLSVV------GLTTSSTELAWDPPPLAERNGKI-VRYV-------------VVYRDINSQQ-NHTNTTAQTRMTINGLQADTTYDIRVRA 914          

HSP 4 Score: 88.5817 bits (218), Expect = 6.080e-17
Identity = 132/584 (22.60%), Postives = 231/584 (39.55%), Query Frame = 1
Query: 1126 YNLKDLFPFTTYCIWMESENPLGVSPPTIALTVKTLPTSPQLSPRSITATSISNTAILVAW--RPPERKFGKFKYYQIIYTNNDGFLPQHWRQFAVKD-----DNVMLTHLIASELYHIRVKIVNEIGHGPLSKTISIKTIAGTLSQCPDFKITEIFQSH-IKLQWGTPDPVKLFKLIQYNLLCWDVRLKIVNATAKSSTLFPILNHNLSMNEMEYVLYLKNEKEIKCRLSAINSDGKGMPTEIQASTVNKGV-NYQNLIHIDKIGSTYITFQWRPPSKFSFDYFLWIYQIFDSEKLDRAVKLPKIKINISDSASAENGWFVYNYTNAFSSSRYILGLRYLCRDSTDILREYVHRSDLVSTMKSVPSDSPKDLVVKEIDSNSALVSWKPLDQVHSNGIITHYEVRYYAPKKEESTERFIN-VSETSAILSNLKY-FHYVIYVRAFTKVGGG--SWSNPKNYYRQNLEEFPIPTTIKGERKSETEINISWELPVLSEKNLAHAAIEGFIILYAPVESSPKWIKYTVQSKNLSAVIKGLEPDLRYQFQIAATNYAGFNGNFSEIVQEMPKNFPNLNLKTVPDLRCS 2838
            Y ++ L P T Y   + + + +G+   T  +  +T  ++P   P+ +   S+S+T+I V+W   P   + G    Y + Y    G   +   +  VKD      + +L  L     Y + VK   ++G GP S +  I+T        P     +I  S  +++ W  P   K    ++   + +    ++ N   +      IL+  L   +  ++  L+ E      ++A  + G G  ++ +  T +  V     +I    IG+T +  QW+PP +   D   +  Q    E     V+    +   +D          +  T     + YI  L    R+      EY      V+T + VP   P++L V  + ++S  ++W P      NG I  Y V Y   +   S +   N  ++T   ++ L+    Y I VRAFT  GGG  S S        ++ EF     +K   KS   + ++WE+P   +  +       F ILY             VQ      +I  L+PD  Y F + +       GN +  +Q+       ++++T PDL  S
Sbjct:  500 YAVESLKPDTLYKFTLAARSEMGLGVYTQPIEARTAQSTPSAPPQEVHLLSLSSTSIQVSWVAPPAASRHGNIVRYSLAYQALSG---EDQERHEVKDISADTSSYLLEGLEKWTEYQVWVKAHTDVGPGPESSSTRIRTKEDVPGAPPRRVEVDIINSTTLRVSWKPPLAQKQHGQVRGYQVVYS---RVENGEPRGQPT--ILDVALPEAQDAFITGLQAETSYSITVAAYTTKGDGARSKAKVVTTSGAVPGKPTMIISTTIGNTAL-IQWQPPKEMVGDLLGYTLQYKREEDASFTVR----EFKRTDDH--------FTVTGLHKGATYIFKLS--ARNRAGNGEEYTKE---VTTPEDVPGSYPQNLSVVGLTTSSTELAWDPPPLAERNGKIVRYVVVY---RDINSQQNHTNTTAQTRMTINGLQADTTYDIRVRAFTSKGGGPISPSIQSRTMATSMPEFTKNFGVKAVMKS--SVLLTWEVPETYKSQVP------FKILY-------NQQSVEVQGDLKRKLITRLQPDTDYSFVLMS------RGNSAGGLQQ------QVSIRTAPDLLTS 1027          
BLAST of Protein tyrosine phosphatase receptor type D vs. Ensembl Cavefish
Match: ptprfa (protein tyrosine phosphatase receptor type Fa [Source:ZFIN;Acc:ZDB-GENE-020107-2])

HSP 1 Score: 716.842 bits (1849), Expect = 0.000e+0
Identity = 327/591 (55.33%), Postives = 430/591 (72.76%), Query Frame = 1
Query: 4051 ISDRPSISICNLYQYVTDLKANDCTLLQAEFETLNTNLDDRFTWQRSNIDSNKSKNRYANVVAYDHTSVLLTPVDDVIGSDYINANYIDGYQRQNAYIATQGPLPDTTDDFWRMVWEQRSNCIVMMTRLEERSGIKCHQYWPNRGFICYGQMIVSHIDTFVLAYYTIRLFEIRHSKYSEKREIQHFQFTAWPDHGVPKLSTPLLMFIRRVRSIGKIESCPKIVHCSAGVGRTGAFIVVDAQLERIKQEKNIDVFNYVSKIRCQRNYMVQTQAQYQFILETLLEAVEDGNTEVMACNFHAHVTKLSQIGISGSNQLSGFEMEFSKLNSLASNRGRHGVMLADFVKAAGNQAVNMTKNRVRNIIPYEWNRVVLNAIRGIEGSDYINASYIDGYRDRRAYIAAQSPIPSTVEDFWRMLWDQHCGVVIVLNQPHE---DKSHIYWPINKSIRYQFFVVDPVVEYNMPNYILREFKVTDARDGEFRALRQFQFTQWPNHGCPKESESILDFIRQVHKTKEQFGHMEPMVIHCNTGSGRTGVFIALSIVLDRLQQESVVDMYQTVKLLHKQRIGLVQTEEQYEFCYMAVLDYLSNYE 5814
            + + P I +C+L  ++  LKAND      E+E+++     +FTW+ SN++ NK KNRYANV+AYDH+ V+LTPVD V GSDYINANY+DGY++QNAYI TQGPLP+T  DFWRMVWEQR+N IVMMT+LEE+S +KC QYWP+RG   YG + VS +DT  LA Y++R F +  +  SEKRE++ FQF AWPDHGVP+  TP+L F+RRV++    ++ P +VHCSAGVGRTG FIV+DA LER+K EK++D++ +V+ +R QRNYMVQT+ QY FI E LLEA   G+TEV A + + H+ KL+Q  +   + ++  E+EF KL +  ++  R       F+ A  N   N  KNR+ NI+P+E  RV L  IRG+EGSDYINAS++DGYR ++AYIA Q P+  T EDFWRMLW+ +  +V++L +  E   +K H YWP  +S RYQ+FVVDP+ EYNMP YILREFKVTDARDG+ R +RQFQFT WP  G PK  E  +DFI QVHKTKEQFG   P+ +HC+ G GRTGVFI LSIVL+R++ E VVD++QTVK L  QR  +VQTE+QY+ CY A L+YL +++
Sbjct: 1339 MREHPPIPVCDLADHIERLKANDGLRFSQEYESIDPG--QQFTWEHSNLEVNKPKNRYANVIAYDHSRVILTPVDGVPGSDYINANYVDGYRKQNAYIGTQGPLPETLSDFWRMVWEQRTNTIVMMTKLEEKSRVKCDQYWPSRGTETYGMIQVSMLDTVELATYSVRTFALYKNGSSEKREVRQFQFMAWPDHGVPEYPTPILAFLRRVKACNPPDAGPMVVHCSAGVGRTGCFIVIDAMLERMKHEKSVDIYGHVTCMRAQRNYMVQTEDQYVFIHEALLEAATCGHTEVPARSLYTHIQKLTQ--VPPGDTVTAMELEFKKLANSKAHTSR-------FISA--NLPCNKFKNRLVNIMPFESTRVCLQPIRGVEGSDYINASFLDGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTIRQFQFTDWPEQGVPKTGEGFIDFIGQVHKTKEQFGQDGPITVHCSAGVGRTGVFITLSIVLERMRYEGVVDLFQTVKTLRTQRPAMVQTEDQYQLCYRAALEYLGSFD 1916          

HSP 2 Score: 152.91 bits (385), Expect = 2.202e-36
Identity = 228/996 (22.89%), Postives = 376/996 (37.75%), Query Frame = 1
Query:  370 LACSSTGHPVPSISWKINESPIEELKSPLKKLQNPPRIFSIKNYQNSVLVITQLIESDSNSVLICEAENNAGFDSRQQQLKVISTETDIPSGFPVFQNNFFPIIKPYNSNVTLVCQAYGNPPPLIQWFKNYEL--INESFTKIKILNDGNLLLVQVTREDKGIYHCQAQNTNGLRLSDPSTLDITSYPISPNSLIIERFASDNVEISWRSGLNDVTEQENFILHYREVPENITEKQIMSKFVYLTISEKKSIYK-----YNLKDLFPFTTYCIWMESENPLGVSPPTIALTVKTLPTSPQLSPRSITATSISNTAILVAW---RPPERKFGKFKYYQIIYTNNDGFLPQHWRQFAVKDDNVMLTHLIASELYHIRVKIVNEIGHGPLSKTISIKTIAGTLSQCP-DFKITEIFQSHIKLQWGTPDPVKLFKLIQYNLLCWDVRLKIVNATAKSSTLFPILN-HNLSMNEMEYVLYLKNEKEIKCRLSAINSDGKGMPTEIQASTVNKGVNYQNL-IHIDKIGSTYITFQWRPPSKFSFDYFLWIYQIFDSEKLDRAVKLPKIKINISDSASAENGWFVYNYTNAFSSSRYILGLRYLCRDSTDILREYVHRSDLVSTMKSVPSDSPKDLVVKEIDSNSALVSWKPLDQVHSNGIITHYEVRYYAPKKEESTE---RFINVSETSAILSNL-KYFHYVIYVRAFTKVGGGSWSNPKNYYRQNLEEFPIPTTIKGERKSETEINISWELPVLSEKNLAHAAIEGFIILYAPVESSPKWIKYTVQSKNL----SAVIKGLEPDLRYQFQIAATNYAGFNGNFSEIVQEMPKNFPNLNLKTVPDLRCSVQSSNRLKVEWSSP-SISTDLLKFEIRYSGNLSYITEIGLKKSEFIDMESKSVNFETLVNRYDVTLENLQSNALYKIAVRAIYQNKELYESHRETTCDTMPAVPNLVKPPIIVGLDEEKSKVIIKLHRCSQRNGKISYYFVIVAAFQGNKNQ 3291
              C + G P P I+W         +K   K       +    +   SVL I  L      ++  C A N+ G  +   +L V+  E  IP GFP         +       T++C A GNP P I WFK++    IN S  +IK L  G L +      D+G Y C A N+ G R S P+ L +    + P      RF+   +        ++V    +  L    V   +   + M+  V LT  E+  I +      N++    +T  C+ + S   LG+   T  +TVK LP  P     S+  T  + T++ + W    P    +   +Y  II  +++GF         V      +  L     Y  RV  VN IG GP S T+  +T     S  P   +   +  + + +QW  P+    F           +R   V  T +  T     + HN   + +  +  L  +     R+    S G G P+++      +GV  Q      +    T I   W  P +     +  IY   DS         P     + +S   +    +Y +T A   +R  +GL    +                 T +S PS  P+++ +  + S S  VSW        +G I  Y + Y A   E+      + I+   +S +L  L K+  Y ++V+A T VG G  S+      +       P  ++ +  + T + +SW+ P L++K   H  + G+ ++Y+ VE+     + T+    L     A I GL+ +  Y   +AA    G        V       P       P +  S    N   ++W  P  +  DLL + ++Y            K+ E  D       F+   + + VT  +  +  ++K++ R    N E Y     T  D   + P  +    +VGL    +++       ++RNGKI  Y V+       +N 
Sbjct:   64 FVCQAVGEPKPRITW---------MKKGKKVSSQRFEVIEFDDGSGSVLRIQPLRTHRDEAIYECTATNSVGEINTSAKLIVLE-EDQIPHGFPTIDMGPQLKVVERTRTATMLCAASGNPDPEISWFKDFLPVDINGSNGRIKQLRSGALQIENSEESDQGKYECVAMNSAGTRYSAPANLYVRVRRVPP------RFSIPPIN-------HEVMPGGSLNLTCVAVGAPMPYVKWMTGEVELTKEEEMPIGRNVLELTNIRQSANYT--CVAISS---LGMIETTAQITVKALPRPPT----SLIVTETTATSVTLTWDSGNPEPVSYYVIQYRAII--SDNGFQEVD----GVASTRYSIGGLSPYSEYEFRVMAVNNIGRGPPSGTVETRTSEQAPSSPPLSVQARMLSATTMLVQWEPPEEPNGF-----------IRGYRVYYTHELHTPLSTWHKHNTDDSRLTTISGLVPDITYSLRVLGFTSVGDGPPSDVLQVKTQQGVPAQPTDFEAEAELDTRIMLTWLWPVQDQITKYELIYWEADSGDKTHVTFEPAGSYAV-ESLKPDT---LYKFTLA---ARSEMGLGVYTQPIE------------ARTAQSTPSAPPQEVHLLSLSSTSIQVSWVAPPAASRHGNIVRYSLAYQALSGEDQERHEVKDISADTSSYLLEGLEKWTEYQVWVKAHTDVGPGPESSSTRIRTKEDVPGAPPRRVEVDIINSTTLRVSWK-PPLAQKQ--HGQVRGYQVVYSRVENGEPRGQPTILDVALPEAQDAFITGLQAETSYSITVAAYTTKGDGARSKAKVVTTSGAVPGK-----PTMIISTTIGNTALIQWQPPKEMVGDLLGYTLQY------------KREE--DASFTVREFKRTDDHFTVTGLHKGATYIFKLSARNRAGNGEEYTKEVTTPEDVPGSYPQNLS---VVGLTTSSTELAWDPPPLAERNGKIVRYVVVYRDINSQQNH 966          

HSP 3 Score: 138.272 bits (347), Expect = 5.164e-32
Identity = 217/963 (22.53%), Postives = 382/963 (39.67%), Query Frame = 1
Query:  265 LVLINSQIT--FTENDEAPKISLIIQSPNVLLFKSMILACSSTGHPVPSISWKINESPIEELKSPLKKLQNPPRIFSIKNYQNSVLVITQLIESDSNSVLICEAENNAGFD-SRQQQLKVISTETDIPSGFPVFQNNFFPIIKPYNSNVTLVCQAYGNPPPLIQWFKN-YELINESFTKIKILNDGNLLLVQVTREDKGIYHCQAQNTNGLRLSDPSTLDITSYPISPNSLIIERFASDNVEISWRSGLNDVTEQENFILHYREVPENITEKQIMSKFVYLTISEKKSIYKYNLKDLFPFTTYCIWMESENPLGVSPPTIALTVKTLPTSPQLSPRSITATSISNTAILVAWRPPERKFGKFKYYQIIYTNNDGFLPQHWRQFAVKDDNV-MLTHLIASELYHIRVKIVNEIGHGPLSKTISIKTIAGTLSQCPDFKITEIFQSHIKLQWGTPDPVKLFKLIQYNLLCWDVRLKIVNATAKSSTLF-PILNHNLSMNEMEYVLYLKNEKEIKCRLSAINSDGKGMPTE-IQASTVNKGVNY-QNLIHIDKIGSTYITFQWRPPSKFS----FDYFLWIYQIFDSEKLDRAVKLPKIKINISDSAS----AENGWFVYNYTNAFSSSRYILGLRYLCRDSTDILREYVHRSDLVSTMKSVPSDSPKDLVVKEIDSNSALVSWKPLDQVHSNGIITHYEVRYY-----APKKEESTERFINVSETSAILSNLKY-FHYVIYVRAFTKVGGGSWSNPKNYYRQNLEEFPIPTTIKGERKSETEINISWELPVLSEKNLAHAAIEGFIILYAPVESSPKWIKYTVQSKNLSAVIKGLEPDLRYQFQIAATNYAGFNGNFSEIV---QEMPKNFPNLNLKTVPDLRCSVQSSNRLKVEWSSPSISTDLLKFEIRYSGNLSYITEIGLKKSEFIDMESKSVNFETLVNRYDVTLENLQSNALYKIAVRA 3078
            +VL   QI   F   D  P++ ++ ++      ++  + C+++G+P P ISW  +  P++   S  +          IK  ++  L I    ESD      C A N+AG   S    L V           P   +   P       ++ L C A G P P ++W     EL  E    I      N+L +   R+    Y C A ++ G+ +   + + + + P  P SLI+    + +V ++W SG  +      +++ YR          I+S   +  +    S  +Y++  L P++ Y   + + N +G  PP+  +  +T   +P   P S+ A  +S T +LV W PPE   G  + Y++ YT+        W +    D  +  ++ L+    Y +RV     +G GP S  + +KT  G  +Q  DF+      + I L W  P   ++ K   Y L+ W+      ++  K+   F P  ++         V  LK +   K  L+A +  G G+ T+ I+A T     +     +H+  + ST I   W  P   S       +   YQ    E  +R     ++K   +D++S        W  Y               +   +  TD+       S  + T + VP   P+ + V  I+S +  VSWKP      +G +  Y+V Y       P+ + +           A ++ L+    Y I V A+T  G G+ S  K            PT I       T + I W+ P     +L      G+ + Y   E +   ++   ++ +    + GL     Y F+++A N AG    +++ V   +++P ++P  NL  V        +++  ++ W  P ++    K  +RY                + D+ S+  N      +  +T+  LQ++  Y I VRA
Sbjct:  135 IVLEEDQIPHGFPTIDMGPQLKVVERT------RTATMLCAASGNPDPEISWFKDFLPVDINGSNGR----------IKQLRSGALQIENSEESDQGKYE-CVAMNSAGTRYSAPANLYVRVRRVPPRFSIPPINHEVMP-----GGSLNLTCVAVGAPMPYVKWMTGEVELTKEEEMPI----GRNVLELTNIRQSAN-YTCVAISSLGM-IETTAQITVKALPRPPTSLIVTETTATSVTLTWDSGNPEPVSY--YVIQYRA---------IISDNGFQEVDGVAST-RYSIGGLSPYSEYEFRVMAVNNIGRGPPSGTVETRTSEQAPSSPPLSVQARMLSATTMLVQWEPPEEPNGFIRGYRVYYTHELHTPLSTWHKHNTDDSRLTTISGLVPDITYSLRVLGFTSVGDGPPSDVLQVKTQQGVPAQPTDFEAEAELDTRIMLTWLWPVQDQITK---YELIYWE-----ADSGDKTHVTFEPAGSYA--------VESLKPDTLYKFTLAARSEMGLGVYTQPIEARTAQSTPSAPPQEVHLLSLSSTSIQVSWVAPPAASRHGNIVRYSLAYQALSGEDQERH----EVKDISADTSSYLLEGLEKWTEY---------------QVWVKAHTDVGPGPESSSTRIRTKEDVPGAPPRRVEVDIINSTTLRVSWKPPLAQKQHGQVRGYQVVYSRVENGEPRGQPTILDVALPEAQDAFITGLQAETSYSITVAAYTTKGDGARSKAKVVTTSGAVPGK-PTMIISTTIGNTAL-IQWQPPKEMVGDLL-----GYTLQYKREEDASFTVREFKRTDD-HFTVTGLHKGATYIFKLSARNRAGNGEEYTKEVTTPEDVPGSYPQ-NLSVV------GLTTSSTELAWDPPPLAERNGKI-VRYV-------------VVYRDINSQQ-NHTNTTAQTRMTINGLQADTTYDIRVRA 992          

HSP 4 Score: 88.9669 bits (219), Expect = 5.551e-17
Identity = 132/584 (22.60%), Postives = 231/584 (39.55%), Query Frame = 1
Query: 1126 YNLKDLFPFTTYCIWMESENPLGVSPPTIALTVKTLPTSPQLSPRSITATSISNTAILVAW--RPPERKFGKFKYYQIIYTNNDGFLPQHWRQFAVKD-----DNVMLTHLIASELYHIRVKIVNEIGHGPLSKTISIKTIAGTLSQCPDFKITEIFQSH-IKLQWGTPDPVKLFKLIQYNLLCWDVRLKIVNATAKSSTLFPILNHNLSMNEMEYVLYLKNEKEIKCRLSAINSDGKGMPTEIQASTVNKGV-NYQNLIHIDKIGSTYITFQWRPPSKFSFDYFLWIYQIFDSEKLDRAVKLPKIKINISDSASAENGWFVYNYTNAFSSSRYILGLRYLCRDSTDILREYVHRSDLVSTMKSVPSDSPKDLVVKEIDSNSALVSWKPLDQVHSNGIITHYEVRYYAPKKEESTERFIN-VSETSAILSNLKY-FHYVIYVRAFTKVGGG--SWSNPKNYYRQNLEEFPIPTTIKGERKSETEINISWELPVLSEKNLAHAAIEGFIILYAPVESSPKWIKYTVQSKNLSAVIKGLEPDLRYQFQIAATNYAGFNGNFSEIVQEMPKNFPNLNLKTVPDLRCS 2838
            Y ++ L P T Y   + + + +G+   T  +  +T  ++P   P+ +   S+S+T+I V+W   P   + G    Y + Y    G   +   +  VKD      + +L  L     Y + VK   ++G GP S +  I+T        P     +I  S  +++ W  P   K    ++   + +    ++ N   +      IL+  L   +  ++  L+ E      ++A  + G G  ++ +  T +  V     +I    IG+T +  QW+PP +   D   +  Q    E     V+    +   +D          +  T     + YI  L    R+      EY      V+T + VP   P++L V  + ++S  ++W P      NG I  Y V Y   +   S +   N  ++T   ++ L+    Y I VRAFT  GGG  S S        ++ EF     +K   KS   + ++WE+P   +  +       F ILY             VQ      +I  L+PD  Y F + +       GN +  +Q+       ++++T PDL  S
Sbjct:  578 YAVESLKPDTLYKFTLAARSEMGLGVYTQPIEARTAQSTPSAPPQEVHLLSLSSTSIQVSWVAPPAASRHGNIVRYSLAYQALSG---EDQERHEVKDISADTSSYLLEGLEKWTEYQVWVKAHTDVGPGPESSSTRIRTKEDVPGAPPRRVEVDIINSTTLRVSWKPPLAQKQHGQVRGYQVVYS---RVENGEPRGQPT--ILDVALPEAQDAFITGLQAETSYSITVAAYTTKGDGARSKAKVVTTSGAVPGKPTMIISTTIGNTAL-IQWQPPKEMVGDLLGYTLQYKREEDASFTVR----EFKRTDDH--------FTVTGLHKGATYIFKLS--ARNRAGNGEEYTKE---VTTPEDVPGSYPQNLSVVGLTTSSTELAWDPPPLAERNGKIVRYVVVY---RDINSQQNHTNTTAQTRMTINGLQADTTYDIRVRAFTSKGGGPISPSIQSRTMATSMPEFTKNFGVKAVMKS--SVLLTWEVPETYKSQVP------FKILY-------NQQSVEVQGDLKRKLITRLQPDTDYSFVLMS------RGNSAGGLQQ------QVSIRTAPDLLTS 1105          
BLAST of Protein tyrosine phosphatase receptor type D vs. Ensembl Cavefish
Match: ptprfa (protein tyrosine phosphatase receptor type Fa [Source:ZFIN;Acc:ZDB-GENE-020107-2])

HSP 1 Score: 716.842 bits (1849), Expect = 0.000e+0
Identity = 327/591 (55.33%), Postives = 430/591 (72.76%), Query Frame = 1
Query: 4051 ISDRPSISICNLYQYVTDLKANDCTLLQAEFETLNTNLDDRFTWQRSNIDSNKSKNRYANVVAYDHTSVLLTPVDDVIGSDYINANYIDGYQRQNAYIATQGPLPDTTDDFWRMVWEQRSNCIVMMTRLEERSGIKCHQYWPNRGFICYGQMIVSHIDTFVLAYYTIRLFEIRHSKYSEKREIQHFQFTAWPDHGVPKLSTPLLMFIRRVRSIGKIESCPKIVHCSAGVGRTGAFIVVDAQLERIKQEKNIDVFNYVSKIRCQRNYMVQTQAQYQFILETLLEAVEDGNTEVMACNFHAHVTKLSQIGISGSNQLSGFEMEFSKLNSLASNRGRHGVMLADFVKAAGNQAVNMTKNRVRNIIPYEWNRVVLNAIRGIEGSDYINASYIDGYRDRRAYIAAQSPIPSTVEDFWRMLWDQHCGVVIVLNQPHE---DKSHIYWPINKSIRYQFFVVDPVVEYNMPNYILREFKVTDARDGEFRALRQFQFTQWPNHGCPKESESILDFIRQVHKTKEQFGHMEPMVIHCNTGSGRTGVFIALSIVLDRLQQESVVDMYQTVKLLHKQRIGLVQTEEQYEFCYMAVLDYLSNYE 5814
            + + P I +C+L  ++  LKAND      E+E+++     +FTW+ SN++ NK KNRYANV+AYDH+ V+LTPVD V GSDYINANY+DGY++QNAYI TQGPLP+T  DFWRMVWEQR+N IVMMT+LEE+S +KC QYWP+RG   YG + VS +DT  LA Y++R F +  +  SEKRE++ FQF AWPDHGVP+  TP+L F+RRV++    ++ P +VHCSAGVGRTG FIV+DA LER+K EK++D++ +V+ +R QRNYMVQT+ QY FI E LLEA   G+TEV A + + H+ KL+Q  +   + ++  E+EF KL +  ++  R       F+ A  N   N  KNR+ NI+P+E  RV L  IRG+EGSDYINAS++DGYR ++AYIA Q P+  T EDFWRMLW+ +  +V++L +  E   +K H YWP  +S RYQ+FVVDP+ EYNMP YILREFKVTDARDG+ R +RQFQFT WP  G PK  E  +DFI QVHKTKEQFG   P+ +HC+ G GRTGVFI LSIVL+R++ E VVD++QTVK L  QR  +VQTE+QY+ CY A L+YL +++
Sbjct: 1343 MREHPPIPVCDLADHIERLKANDGLRFSQEYESIDPG--QQFTWEHSNLEVNKPKNRYANVIAYDHSRVILTPVDGVPGSDYINANYVDGYRKQNAYIGTQGPLPETLSDFWRMVWEQRTNTIVMMTKLEEKSRVKCDQYWPSRGTETYGMIQVSMLDTVELATYSVRTFALYKNGSSEKREVRQFQFMAWPDHGVPEYPTPILAFLRRVKACNPPDAGPMVVHCSAGVGRTGCFIVIDAMLERMKHEKSVDIYGHVTCMRAQRNYMVQTEDQYVFIHEALLEAATCGHTEVPARSLYTHIQKLTQ--VPPGDTVTAMELEFKKLANSKAHTSR-------FISA--NLPCNKFKNRLVNIMPFESTRVCLQPIRGVEGSDYINASFLDGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTIRQFQFTDWPEQGVPKTGEGFIDFIGQVHKTKEQFGQDGPITVHCSAGVGRTGVFITLSIVLERMRYEGVVDLFQTVKTLRTQRPAMVQTEDQYQLCYRAALEYLGSFD 1920          

HSP 2 Score: 152.14 bits (383), Expect = 2.912e-36
Identity = 228/996 (22.89%), Postives = 376/996 (37.75%), Query Frame = 1
Query:  370 LACSSTGHPVPSISWKINESPIEELKSPLKKLQNPPRIFSIKNYQNSVLVITQLIESDSNSVLICEAENNAGFDSRQQQLKVISTETDIPSGFPVFQNNFFPIIKPYNSNVTLVCQAYGNPPPLIQWFKNYEL--INESFTKIKILNDGNLLLVQVTREDKGIYHCQAQNTNGLRLSDPSTLDITSYPISPNSLIIERFASDNVEISWRSGLNDVTEQENFILHYREVPENITEKQIMSKFVYLTISEKKSIYK-----YNLKDLFPFTTYCIWMESENPLGVSPPTIALTVKTLPTSPQLSPRSITATSISNTAILVAW---RPPERKFGKFKYYQIIYTNNDGFLPQHWRQFAVKDDNVMLTHLIASELYHIRVKIVNEIGHGPLSKTISIKTIAGTLSQCP-DFKITEIFQSHIKLQWGTPDPVKLFKLIQYNLLCWDVRLKIVNATAKSSTLFPILN-HNLSMNEMEYVLYLKNEKEIKCRLSAINSDGKGMPTEIQASTVNKGVNYQNL-IHIDKIGSTYITFQWRPPSKFSFDYFLWIYQIFDSEKLDRAVKLPKIKINISDSASAENGWFVYNYTNAFSSSRYILGLRYLCRDSTDILREYVHRSDLVSTMKSVPSDSPKDLVVKEIDSNSALVSWKPLDQVHSNGIITHYEVRYYAPKKEESTE---RFINVSETSAILSNL-KYFHYVIYVRAFTKVGGGSWSNPKNYYRQNLEEFPIPTTIKGERKSETEINISWELPVLSEKNLAHAAIEGFIILYAPVESSPKWIKYTVQSKNL----SAVIKGLEPDLRYQFQIAATNYAGFNGNFSEIVQEMPKNFPNLNLKTVPDLRCSVQSSNRLKVEWSSP-SISTDLLKFEIRYSGNLSYITEIGLKKSEFIDMESKSVNFETLVNRYDVTLENLQSNALYKIAVRAIYQNKELYESHRETTCDTMPAVPNLVKPPIIVGLDEEKSKVIIKLHRCSQRNGKISYYFVIVAAFQGNKNQ 3291
              C + G P P I+W         +K   K       +    +   SVL I  L      ++  C A N+ G  +   +L V+  E  IP GFP         +       T++C A GNP P I WFK++    IN S  +IK L  G L +      D+G Y C A N+ G R S P+ L +    + P      RF+   +        ++V    +  L    V   +   + M+  V LT  E+  I +      N++    +T  C+ + S   LG+   T  +TVK LP  P     S+  T  + T++ + W    P    +   +Y  II  +++GF         V      +  L     Y  RV  VN IG GP S T+  +T     S  P   +   +  + + +QW  P+    F           +R   V  T +  T     + HN   + +  +  L  +     R+    S G G P+++      +GV  Q      +    T I   W  P +     +  IY   DS         P     + +S   +    +Y +T A   +R  +GL    +                 T +S PS  P+++ +  + S S  VSW        +G I  Y + Y A   E+      + I+   +S +L  L K+  Y ++V+A T VG G  S+      +       P  ++ +  + T + +SW+ P L++K   H  + G+ ++Y+ VE+     + T+    L     A I GL+ +  Y   +AA    G        V       P       P +  S    N   ++W  P  +  DLL + ++Y            K+ E  D       F+   + + VT  +  +  ++K++ R    N E Y     T  D   + P  +    +VGL    +++       ++RNGKI  Y V+       +N 
Sbjct:   64 FVCQAVGEPKPRITW---------MKKGKKVSSQRFEVIEFDDGSGSVLRIQPLRTHRDEAIYECTATNSVGEINTSAKLIVLE-EDQIPHGFPTIDMGPQLKVVERTRTATMLCAASGNPDPEISWFKDFLPVDINGSNGRIKQLRSGALQIENSEESDQGKYECVAMNSAGTRYSAPANLYVRVRRVPP------RFSIPPIN-------HEVMPGGSLNLTCVAVGAPMPYVKWMTGEVELTKEEEMPIGRNVLELTNIRQSANYT--CVAISS---LGMIETTAQITVKALPRPPT----SLIVTETTATSVTLTWDSGNPEPVSYYVIQYRAII--SDNGFQEVD----GVASTRYSIGGLSPYSEYEFRVMAVNNIGRGPPSGTVETRTSEQAPSSPPLSVQARMLSATTMLVQWEPPEEPNGF-----------IRGYRVYYTHELHTPLSTWHKHNTDDSRLTTISGLVPDITYSLRVLGFTSVGDGPPSDVLQVKTQQGVPAQPTDFEAEAELDTRIMLTWLWPVQDQITKYELIYWEADSGDKTHVTFEPAGSYAV-ESLKPDT---LYKFTLA---ARSEMGLGVYTQPIE------------ARTAQSTPSAPPQEVHLLSLSSTSIQVSWVAPPAASRHGNIVRYSLAYQALSGEDQERHEVKDISADTSSYLLEGLEKWTEYQVWVKAHTDVGPGPESSSTRIRTKEDVPGAPPRRVEVDIINSTTLRVSWK-PPLAQKQ--HGQVRGYQVVYSRVENGEPRGQPTILDVALPEAQDAFITGLQAETSYSITVAAYTTKGDGARSKAKVVTTSGAVPGK-----PTMIISTTIGNTALIQWQPPKEMVGDLLGYTLQY------------KREE--DASFTVREFKRTDDHFTVTGLHKGATYIFKLSARNRAGNGEEYTKEVTTPEDVPGSYPQNLS---VVGLTTSSTELAWDPPPLAERNGKIVRYVVVYRDINSQQNH 966          

HSP 3 Score: 138.272 bits (347), Expect = 5.916e-32
Identity = 217/963 (22.53%), Postives = 382/963 (39.67%), Query Frame = 1
Query:  265 LVLINSQIT--FTENDEAPKISLIIQSPNVLLFKSMILACSSTGHPVPSISWKINESPIEELKSPLKKLQNPPRIFSIKNYQNSVLVITQLIESDSNSVLICEAENNAGFD-SRQQQLKVISTETDIPSGFPVFQNNFFPIIKPYNSNVTLVCQAYGNPPPLIQWFKN-YELINESFTKIKILNDGNLLLVQVTREDKGIYHCQAQNTNGLRLSDPSTLDITSYPISPNSLIIERFASDNVEISWRSGLNDVTEQENFILHYREVPENITEKQIMSKFVYLTISEKKSIYKYNLKDLFPFTTYCIWMESENPLGVSPPTIALTVKTLPTSPQLSPRSITATSISNTAILVAWRPPERKFGKFKYYQIIYTNNDGFLPQHWRQFAVKDDNV-MLTHLIASELYHIRVKIVNEIGHGPLSKTISIKTIAGTLSQCPDFKITEIFQSHIKLQWGTPDPVKLFKLIQYNLLCWDVRLKIVNATAKSSTLF-PILNHNLSMNEMEYVLYLKNEKEIKCRLSAINSDGKGMPTE-IQASTVNKGVNY-QNLIHIDKIGSTYITFQWRPPSKFS----FDYFLWIYQIFDSEKLDRAVKLPKIKINISDSAS----AENGWFVYNYTNAFSSSRYILGLRYLCRDSTDILREYVHRSDLVSTMKSVPSDSPKDLVVKEIDSNSALVSWKPLDQVHSNGIITHYEVRYY-----APKKEESTERFINVSETSAILSNLKY-FHYVIYVRAFTKVGGGSWSNPKNYYRQNLEEFPIPTTIKGERKSETEINISWELPVLSEKNLAHAAIEGFIILYAPVESSPKWIKYTVQSKNLSAVIKGLEPDLRYQFQIAATNYAGFNGNFSEIV---QEMPKNFPNLNLKTVPDLRCSVQSSNRLKVEWSSPSISTDLLKFEIRYSGNLSYITEIGLKKSEFIDMESKSVNFETLVNRYDVTLENLQSNALYKIAVRA 3078
            +VL   QI   F   D  P++ ++ ++      ++  + C+++G+P P ISW  +  P++   S  +          IK  ++  L I    ESD      C A N+AG   S    L V           P   +   P       ++ L C A G P P ++W     EL  E    I      N+L +   R+    Y C A ++ G+ +   + + + + P  P SLI+    + +V ++W SG  +      +++ YR          I+S   +  +    S  +Y++  L P++ Y   + + N +G  PP+  +  +T   +P   P S+ A  +S T +LV W PPE   G  + Y++ YT+        W +    D  +  ++ L+    Y +RV     +G GP S  + +KT  G  +Q  DF+      + I L W  P   ++ K   Y L+ W+      ++  K+   F P  ++         V  LK +   K  L+A +  G G+ T+ I+A T     +     +H+  + ST I   W  P   S       +   YQ    E  +R     ++K   +D++S        W  Y               +   +  TD+       S  + T + VP   P+ + V  I+S +  VSWKP      +G +  Y+V Y       P+ + +           A ++ L+    Y I V A+T  G G+ S  K            PT I       T + I W+ P     +L      G+ + Y   E +   ++   ++ +    + GL     Y F+++A N AG    +++ V   +++P ++P  NL  V        +++  ++ W  P ++    K  +RY                + D+ S+  N      +  +T+  LQ++  Y I VRA
Sbjct:  135 IVLEEDQIPHGFPTIDMGPQLKVVERT------RTATMLCAASGNPDPEISWFKDFLPVDINGSNGR----------IKQLRSGALQIENSEESDQGKYE-CVAMNSAGTRYSAPANLYVRVRRVPPRFSIPPINHEVMP-----GGSLNLTCVAVGAPMPYVKWMTGEVELTKEEEMPI----GRNVLELTNIRQSAN-YTCVAISSLGM-IETTAQITVKALPRPPTSLIVTETTATSVTLTWDSGNPEPVSY--YVIQYRA---------IISDNGFQEVDGVAST-RYSIGGLSPYSEYEFRVMAVNNIGRGPPSGTVETRTSEQAPSSPPLSVQARMLSATTMLVQWEPPEEPNGFIRGYRVYYTHELHTPLSTWHKHNTDDSRLTTISGLVPDITYSLRVLGFTSVGDGPPSDVLQVKTQQGVPAQPTDFEAEAELDTRIMLTWLWPVQDQITK---YELIYWE-----ADSGDKTHVTFEPAGSYA--------VESLKPDTLYKFTLAARSEMGLGVYTQPIEARTAQSTPSAPPQEVHLLSLSSTSIQVSWVAPPAASRHGNIVRYSLAYQALSGEDQERH----EVKDISADTSSYLLEGLEKWTEY---------------QVWVKAHTDVGPGPESSSTRIRTKEDVPGAPPRRVEVDIINSTTLRVSWKPPLAQKQHGQVRGYQVVYSRVENGEPRGQPTILDVALPEAQDAFITGLQAETSYSITVAAYTTKGDGARSKAKVVTTSGAVPGK-PTMIISTTIGNTAL-IQWQPPKEMVGDLL-----GYTLQYKREEDASFTVREFKRTDD-HFTVTGLHKGATYIFKLSARNRAGNGEEYTKEVTTPEDVPGSYPQ-NLSVV------GLTTSSTELAWDPPPLAERNGKI-VRYV-------------VVYRDINSQQ-NHTNTTAQTRMTINGLQADTTYDIRVRA 992          

HSP 4 Score: 88.9669 bits (219), Expect = 5.696e-17
Identity = 132/584 (22.60%), Postives = 231/584 (39.55%), Query Frame = 1
Query: 1126 YNLKDLFPFTTYCIWMESENPLGVSPPTIALTVKTLPTSPQLSPRSITATSISNTAILVAW--RPPERKFGKFKYYQIIYTNNDGFLPQHWRQFAVKD-----DNVMLTHLIASELYHIRVKIVNEIGHGPLSKTISIKTIAGTLSQCPDFKITEIFQSH-IKLQWGTPDPVKLFKLIQYNLLCWDVRLKIVNATAKSSTLFPILNHNLSMNEMEYVLYLKNEKEIKCRLSAINSDGKGMPTEIQASTVNKGV-NYQNLIHIDKIGSTYITFQWRPPSKFSFDYFLWIYQIFDSEKLDRAVKLPKIKINISDSASAENGWFVYNYTNAFSSSRYILGLRYLCRDSTDILREYVHRSDLVSTMKSVPSDSPKDLVVKEIDSNSALVSWKPLDQVHSNGIITHYEVRYYAPKKEESTERFIN-VSETSAILSNLKY-FHYVIYVRAFTKVGGG--SWSNPKNYYRQNLEEFPIPTTIKGERKSETEINISWELPVLSEKNLAHAAIEGFIILYAPVESSPKWIKYTVQSKNLSAVIKGLEPDLRYQFQIAATNYAGFNGNFSEIVQEMPKNFPNLNLKTVPDLRCS 2838
            Y ++ L P T Y   + + + +G+   T  +  +T  ++P   P+ +   S+S+T+I V+W   P   + G    Y + Y    G   +   +  VKD      + +L  L     Y + VK   ++G GP S +  I+T        P     +I  S  +++ W  P   K    ++   + +    ++ N   +      IL+  L   +  ++  L+ E      ++A  + G G  ++ +  T +  V     +I    IG+T +  QW+PP +   D   +  Q    E     V+    +   +D          +  T     + YI  L    R+      EY      V+T + VP   P++L V  + ++S  ++W P      NG I  Y V Y   +   S +   N  ++T   ++ L+    Y I VRAFT  GGG  S S        ++ EF     +K   KS   + ++WE+P   +  +       F ILY             VQ      +I  L+PD  Y F + +       GN +  +Q+       ++++T PDL  S
Sbjct:  578 YAVESLKPDTLYKFTLAARSEMGLGVYTQPIEARTAQSTPSAPPQEVHLLSLSSTSIQVSWVAPPAASRHGNIVRYSLAYQALSG---EDQERHEVKDISADTSSYLLEGLEKWTEYQVWVKAHTDVGPGPESSSTRIRTKEDVPGAPPRRVEVDIINSTTLRVSWKPPLAQKQHGQVRGYQVVYS---RVENGEPRGQPT--ILDVALPEAQDAFITGLQAETSYSITVAAYTTKGDGARSKAKVVTTSGAVPGKPTMIISTTIGNTAL-IQWQPPKEMVGDLLGYTLQYKREEDASFTVR----EFKRTDDH--------FTVTGLHKGATYIFKLS--ARNRAGNGEEYTKE---VTTPEDVPGSYPQNLSVVGLTTSSTELAWDPPPLAERNGKIVRYVVVY---RDINSQQNHTNTTAQTRMTINGLQADTTYDIRVRAFTSKGGGPISPSIQSRTMATSMPEFTKNFGVKAVMKS--SVLLTWEVPETYKSQVP------FKILY-------NQQSVEVQGDLKRKLITRLQPDTDYSFVLMS------RGNSAGGLQQ------QVSIRTAPDLLTS 1105          
BLAST of Protein tyrosine phosphatase receptor type D vs. Ensembl Cavefish
Match: PTPRD (protein tyrosine phosphatase receptor type D [Source:HGNC Symbol;Acc:HGNC:9668])

HSP 1 Score: 716.842 bits (1849), Expect = 0.000e+0
Identity = 338/606 (55.78%), Postives = 441/606 (72.77%), Query Frame = 1
Query: 4006 SDSIKLRIGSQKSENISDRPSISICNLYQYVTDLKANDCTLLQAEFETLNTNLDDRFTWQRSNIDSNKSKNRYANVVAYDHTSVLLTPVDDVIGSDYINANYIDGYQRQNAYIATQGPLPDTTDDFWRMVWEQRSNCIVMMTRLEERSGIKCHQYWPNRGFICYGQMIVSHIDTFVLAYYTIRLFEIRHSKYSEKREIQHFQFTAWPDHGVPKLSTPLLMFIRRVRSIGKIESCPKIVHCSAGVGRTGAFIVVDAQLERIKQEKNIDVFNYVSKIRCQRNYMVQTQAQYQFILETLLEAVEDGNTEVMACNFHAHVTKLSQIGISGSNQLSGFEMEFSKLNSLASNRGRHGVMLADFVKAAGNQAVNMTKNRVRNIIPYEWNRVVLNAIRGIEGSDYINASYIDGYRDRRAYIAAQSPIPSTVEDFWRMLWDQHCGVVIVLNQPHE---DKSHIYWPINKSIRYQFFVVDPVVEYNMPNYILREFKVTDARDGEFRALRQFQFTQWPNHGCPKESESILDFIRQVHKTKEQFGHMEPMVIHCNTGSGRTGVFIALSIVLDRLQQESVVDMYQTVKLLHKQRIGLVQTEEQYEFCYMAVLDYLSNYE 5814
            +D ++LR  + ++  ++  P I I +L  ++  LKAND      E+E+++     +FTW+ SN++ NK+KNRYANV+AYDH+ VLL+ +D + GSDYINANYIDGY++QNAYIATQG LP+T  DFWRMVWEQRS  IVMMT+LEERS +KC QYWP RG   YG + V+ +DT  LA Y +R F +  +  SEKRE++ FQFTAWPDHGVP+  TP L F+RRV++    ++ P +VHCSAGVGRTG FIV+DA LERIK EK +D++ +V+ +R QRNYMVQT+ QY FI + LLEAV  GNTEV A N +A++ KL+QI  +G N ++G E+EF +L +  ++  R       F+ A  N   N  KNR+ NI+PYE  RV L  IRG+EGSDYINAS+IDGYR ++AYIA Q P+  T EDFWRMLW+ +  +V++L +  E   +K H YWP  +S RYQ+FVVDP+ EYNMP YILREFKVTDARDG+ R +RQFQFT WP  G PK  E  +DFI QVHKTKEQFG   P+ +HC+ G GRTGVFI LSIVL+R++ E VVD++QTVK+L  QR  +VQTE+QY+FCY A L+YL +++
Sbjct: 1316 TDPVELRRLNFQTPGMASHPPIPIMDLADHLERLKANDNLKFSQEYESIDPG--QQFTWEHSNLEVNKAKNRYANVIAYDHSRVLLSAIDGIPGSDYINANYIDGYRKQNAYIATQGSLPETFGDFWRMVWEQRSANIVMMTKLEERSRVKCDQYWPTRGTETYGLIQVTLLDTVELATYCVRTFALYKNGSSEKREVRQFQFTAWPDHGVPEHPTPFLAFLRRVKACNPPDAGPMVVHCSAGVGRTGCFIVIDAMLERIKHEKTVDIYGHVTLMRAQRNYMVQTEDQYVFIHDALLEAVTCGNTEVPARNLYAYIQKLTQIE-TGEN-VTGMELEFKRLANTKAHTSR-------FISA--NLPCNKFKNRLVNIMPYESTRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDQYQFCYRAGLEYLGSFD 1908          

HSP 2 Score: 205.297 bits (521), Expect = 1.966e-52
Identity = 105/262 (40.08%), Postives = 153/262 (58.40%), Query Frame = 1
Query: 5092 NQAVNMTKNRVRNIIPYEWNRVVLNAIRGIEGSDYINASYIDGYRDRRAYIAAQSPIPSTVEDFWRMLWDQHCGVVIVLNQPHEDKSHI----YWPINKSIRYQFFVVDPVVEYNMPNYILREFKVTDARDGEFRALRQFQFTQWPNHGCPKESESILDFIRQVHKTKEQFGHMEPMVIHCNTGSGRTGVFIALSIVLDRLQQESVVDMYQTVKLLHKQRIGLVQTEEQYEFCYMAVLDYLSNYEKILEKSHLY*TYQDLSE 5865
            N  VN  KNR  N+I Y+ +RV+L+AI GI GSDYINA+YIDGYR + AYIA Q  +P T  DFWRM+W+Q    ++++ +  E++S +    YWP   +  Y    V  +    +  Y +R F +      E R +RQFQFT WP+HG P+     L F+R+V           PMV+HC+ G GRTG FI +  +L+R++ E  VD+Y  V L+  QR  +VQTE+QY F + A+L+ ++     +   +LY   Q L++
Sbjct: 1376 NLEVNKAKNRYANVIAYDHSRVLLSAIDGIPGSDYINANYIDGYRKQNAYIATQGSLPETFGDFWRMVWEQRSANIVMMTK-LEERSRVKCDQYWPTRGTETYGLIQVTLLDTVELATYCVRTFALYKNGSSEKREVRQFQFTAWPDHGVPEHPTPFLAFLRRVKACNPP--DAGPMVVHCSAGVGRTGCFIVIDAMLERIKHEKTVDIYGHVTLMRAQRNYMVQTEDQYVFIHDALLEAVTCGNTEVPARNLYAYIQKLTQ 1634          

HSP 3 Score: 124.02 bits (310), Expect = 1.330e-27
Identity = 181/783 (23.12%), Postives = 288/783 (36.78%), Query Frame = 1
Query:  376 CSSTGHPVPSISWKINESPIEELKSPLKKLQNPPRIFSIKNYQNSVLVITQLIESDSNSVLICEAENNAGFDSRQQQLKVISTETDIPSGFPVFQNNFFPIIKPYNSNVTLVCQAYGNPPPLIQWFKNYELINESFT--KIKILNDGNLLLVQVTREDKGIYHCQAQNTNGLRLSDPSTLDITS----------YPISPNSLIIERFASDNVE----------ISWRSGLNDVTEQENFILHYREVPENITEKQIMSKFVYLTISEKKSIYKYNLKDLFPFTTYCIWMESENPLGVSPPTIALTVKTLPTSPQLSPRSITATSISNTAILVAW---RPPERKF----GKFKYYQIIYTNNDGFLPQHWRQFAVKDDNVMLTHLIASELYHIRVKIVNEIGHGPLSKTISIKTIAGTLSQCP-DFKITEIFQSHIKLQWGTPDPVKLFKLIQYNLLCWDVRLKIVNATAKSSTLFPILNHNLSMNEMEYVLYLKNEKEIKCRLSAINSDGKGMPTEIQASTVNKGVNYQNL-IHIDKIGSTYITFQWRPPSKFSFDYFLWIYQIFDSEKLDRAVKLPKIKINISDSASAENGWFVYNYTNAFSSSRYILGLRYLCRDSTDILREYVHRSDLVSTMKSVPSDSPKDLVVKEIDSNSALVSWKPLDQVHSNGIITHYEVRYYAPKKEESTERFIN---VSETSAILSNL-KYFHYVIYVRAFTKVGGGSWSNPKNYYRQNLEEFPIPTTIKGERKSETEINISWELPVLSEKNLAHAAIEGFIILY 2619
            C +TG P P I W      +   +           +    +   SVL I  L      ++  C A N  G  S   +L V+  E  +P+GFP         +       T++C A GNP P I WFK++  +N +    +IK L  G L + Q    D+G Y C A N +G R S P+ L +            + I P    I    S N+           + W  G  D+T +++       +  N+ E         LT   + + Y             C+ M +   LGV      +TVK LP  P +    +  T  + T+I + W    P    +     K KY +  Y   DG          V      +  L     Y  RV  VN IG GP S+ I  KT     S  P   +   +  +   + W  P+     +++ Y +       + VN   K      + N N        +  L   K    ++ A  S G G  +         GV  Q +    +    T I   W  P +   D  +  Y++    K ++  K    +++   + +     ++      F++  + L  R     S   +  Y +      T ++ PS  P+++      S + LVSWKP      NGII  Y ++Y A + E++T R I+         +L NL K+  Y + V A T VG G  S P+    +       P  ++ E  + + + + W  PV    N  H  I G+ + Y
Sbjct:   50 CQATGDPRPKIVWNKKGKRVSNQRF---------EVIEFDDGSGSVLRIQPLRTPRDEAIYECVASNTVGEISATTRLTVLR-EDQLPAGFPTIDMGPQLKVVERTRTATMLCAASGNPDPDISWFKDFLPVNTTNNNGRIKQLRSGALQIEQSEESDQGKYECVATNNDGTRYSAPANLYVRELREVRRVPPRFSIPPTDSEIMPGGSVNITCVAVGSPMPYVKWMLGSEDLTPEDDM-----PIGRNVLE---------LTDVRQSANYT------------CVAMST---LGVIEAVAQITVKALPKPPGV----LVVTERTATSITLTWDSGNPEPVSYYIIQHKSKYSEDSYKEIDG----------VATTRYSVGGLSPYSDYEFRVVAVNNIGRGPASEAIEDKTAEQAPSTAPRQVRGRMLSATTAIIHWEEPEEAN-GQIMGYRVYYTMDPSQHVNQWEKQI----VRNANFLT-----IQGLTPNKTYYIKVLAYTSVGDGPLSSDLQIIAKTGVPSQPMDFKAEAKSETSILLSWVAPPQSGQDNQITGYELLYKRKDEKEEK----RVSFESTTT-----YLLKDLRPFTTYSFQLAAR-----SRHGIGAYTNEIS-AETPQTQPSAPPQEVTCSSPSSTNILVSWKPPPVELQNGIIIKYTIQYAATEGEDTTTREISEIPPENVQYLLENLEKWTEYRVTVTAHTDVGPGPESLPQLIRTEEDVPSGPPRKVEVEAVNSSSVKVLWRSPV---PNRQHGQIRGYQVHY 751          

HSP 4 Score: 119.783 bits (299), Expect = 2.075e-26
Identity = 186/868 (21.43%), Postives = 333/868 (38.36%), Query Frame = 1
Query:  313 PKISLIIQSPNVLLFKSMILACSSTGHPVPSISWKINESPIEELKSPLKKLQNPPRIFSIKNYQNSVLVITQLIESDSNSVLICEAENNAGFD-SRQQQLKV--ISTETDIPSGF--PVFQNNFFPIIKPYNSNVTLVCQAYGNPPPLIQWFKNYELINESFTKIKILNDGNLLLVQVTREDKGIYHCQAQNTNGLRLSDPSTLDITSYPISPNSLIIERFASDNVEISWRSGLNDVTEQENFILHYREVPENITEKQIMSKFVYLTISEKK----SIYKYNLKDLFPFTTYCIWMESENPLGVSPPTIALTVKTLPTSPQLSPRSITATSISNTAILVAWRPPERKFGKFKYYQIIYTNNDGFLPQHWRQFAVKDDNVM-LTHLIASELYHIRVKIVNEIGHGPLSKTISIKTIAGTLSQCPDFKITEIFQSHIKLQW-GTPDPVKLFKLIQYNLLCWDVRLKIVNATAKSSTLFPILNHNLSMNEMEYVLYLKNEKEIKCRLSAINSDG-----KGMPTEIQASTVNKGVNYQNLIHIDKIGSTYITFQWRPPSKFSFDYFLWIY--QIFDSEKLDRAVKLPKIKINISDSASAENGWFVYNYTNAFSSSRYILGLRYLCRDSTDILREYVHRSDLVSTMKSVPSDSPKDLVVKEIDSNSALVSWKPLDQVHSNGIITHYEVRYY-----APKK---------EESTERFINVSETSAILSNLKY-FHYVIYVRAFTKVGGGSWSNPKNYYRQNLEEFPIPTTIKGERKSETEINISWELPVLSEKNLAHAAIEGFIILYAPVESSPKWIKYTVQSKNLSAVIKGLEPDLRYQFQIAATNYAGFNGNFSEIVQEM------PKNFP 2799
            P I +  Q   V   ++  + C+++G+P P ISW  +  P+    +  +          IK  ++  L I Q  ESD      C A NN G   S    L V  +     +P  F  P   +   P       +V + C A G+P P ++W     L +E  T    +  G  +L          Y C A +T G+ +   + + + + P  P  L++    + ++ ++W SG                 PE ++   I  K  Y   S K+    +  +Y++  L P++ Y   + + N +G  P + A+  KT   +P  +PR +    +S T  ++ W  PE   G+   Y++ YT +       W +  V++ N + +  L  ++ Y+I+V     +G GPLS  + I    G  SQ  DFK     ++ I L W   P   +  ++  Y LL      K     +  ST   +L          + L  ++   I    + I+++         P E+  S+ +               ST I   W+PP     +  +  Y  Q   +E  D   +       IS+    EN  ++      ++  R  +         TD+         L+ T + VPS  P+ + V+ ++S+S  V W+       +G I  Y+V Y       P           +++   + + +E   +L++L+    Y + V A+T  G G+ S PK      +   P    +     +     + W  P  +     H  ++G+ + +   +  P  +    + +N     K +     Y F+++A N  GF     E V+E+      P  FP
Sbjct:  131 PTIDMGPQLKVVERTRTATMLCAASGNPDPDISWFKDFLPVNTTNNNGR----------IKQLRSGALQIEQSEESDQGKYE-CVATNNDGTRYSAPANLYVRELREVRRVPPRFSIPPTDSEIMP-----GGSVNITCVAVGSPMPYVKWM----LGSEDLTPEDDMPIGRNVLELTDVRQSANYTCVAMSTLGV-IEAVAQITVKALPKPPGVLVVTERTATSITLTWDSG----------------NPEPVSYYIIQHKSKYSEDSYKEIDGVATTRYSVGGLSPYSDYEFRVVAVNNIGRGPASEAIEDKTAEQAPSTAPRQVRGRMLSATTAIIHWEEPEEANGQIMGYRVYYTMDPSQHVNQWEKQIVRNANFLTIQGLTPNKTYYIKVLAYTSVGDGPLSSDLQIIAKTGVPSQPMDFKAEAKSETSILLSWVAPPQSGQDNQITGYELLYKRKDEKEEKRVSFESTTTYLLKDLRPFTTYSFQLAARSRHGIGAYTNEISAETPQTQPSAPPQEVTCSSPS---------------STNILVSWKPPPVELQNGIIIKYTIQYAATEGEDTTTR------EISE-IPPENVQYLLENLEKWTEYRVTVTAH------TDVGPGPESLPQLIRTEEDVPSGPPRKVEVEAVNSSSVKVLWRSPVPNRQHGQIRGYQVHYVRMFNGEPVGHPVIKDILIDDAQWEYDDSTEYEMVLTDLQAETTYSVTVAAYTTKGDGARSKPK--LVTTMGAVPEKPRLMVSPTNMGTALLQWHPPPNT-----HGPLQGYRLRFGRKDVEPLTVIEFPEREN-HYTTKEIHKGASYTFRLSARNKVGFG---EETVKEISTSEDTPSGFP 922          

HSP 5 Score: 112.464 bits (280), Expect = 4.300e-24
Identity = 178/723 (24.62%), Postives = 285/723 (39.42%), Query Frame = 1
Query:  793 KILNDGNLLLVQVTREDKGIYHCQAQNT---NGLRLSDPSTLDITSYPISPNSLIIERFASDNVEISWRSGLNDVTEQENFILHYREVPENITEKQIMSKFVYLTISEKKSIYKYNLKDLFPFTTYCIWMESENPLGVSPPTIALTVKTLPTSPQLSPRSITATSISNTAILVAWRPP--ERKFGKFKYYQIIYTNNDGFLPQHWRQFAVKDDNV--MLTHLIASELYHIRVKIVNEIGHGPLSKTISIKTIAGTLSQCP-DFKITEIFQSHIKLQWGTPDPVKLFKLIQYNLLCWDVRLKIVNATAKSSTLFPILNHNL---------SMNEMEYVLY-LKNEKEIKCRLSAINSDGKGMPTEIQASTVNKGVNYQNLIHIDKIGSTYITFQWRPP--SKFSFDYFLWIYQIFDSEKLDRAVKLPKIKINISDSASAENGWFVYNYTNAFSSSRYILGLRYLCRDSTDILREYVHRSDLVSTMKSVPSDSPKDLVVKEIDSNSALVSWKPLDQVHSNGIITHYEVRYYAPKKEES-TERFINVSETSAILSNLKY-FHYVIYVRAFTKVGGGSWSNPKNYYRQNLEE-FPIPTTIKGERKSETEINISWELPVLSEKNLAHAAIEGFIILYAPVESSPKWIKYTVQSKNLSAVIKGLEPDLRYQFQIAATNYAGFNGNFSEIVQEMPKNFPNLNLKTVPDLRCSVQSSNRLKVEWSSPSIST 2892
            +I+ + N L +Q    +K  Y      T   +G   SD   +  T  P  P     E  +  ++ +SW +     + Q+N I  Y  + +   EK+   K V       +S   Y LKDL PFTTY   + + +  G+   T  ++ +T  T P   P+ +T +S S+T ILV+W+PP  E + G    Y I Y   +G          +  +NV  +L +L     Y + V    ++G GP S    I+T     S  P   ++  +  S +K+ W +P P +    I+        ++  V          P++   L            E E VL  L+ E      ++A  + G G  ++ +  T    V  +  + +          QW PP  +      +   +   D E L   ++ P+           EN     +YT            R   R+      E V     +ST +  PS  P+ +V +   + +  VSW+P+     NGII  Y ++Y       S +E FI   E++ IL  LK    Y I + AFT  G G +S    +  Q L++ F     +K   K  T + ++WE+P     N A      F ILY   +S        V  K    +I  L+P+ +Y F +  TN     G     V  M    P++ L+T P L     S   + V+   PS+ T
Sbjct:  465 QIVRNANFLTIQGLTPNKTYYIKVLAYTSVGDGPLSSDLQIIAKTGVPSQPMDFKAEAKSETSILLSWVAPPQ--SGQDNQITGYELLYKRKDEKE--EKRVSF-----ESTTTYLLKDLRPFTTYSFQLAARSRHGIGAYTNEISAETPQTQPSAPPQEVTCSSPSSTNILVSWKPPPVELQNGIIIKYTIQYAATEGEDTTTREISEIPPENVQYLLENLEKWTEYRVTVTAHTDVGPGPESLPQLIRTEEDVPSGPPRKVEVEAVNSSSVKVLWRSPVPNRQHGQIR------GYQVHYVRMFNGEPVGHPVIKDILIDDAQWEYDDSTEYEMVLTDLQAETTYSVTVAAYTTKGDGARSKPKLVTTMGAVPEKPRLMVSPTNMGTALLQWHPPPNTHGPLQGYRLRFGRKDVEPLT-VIEFPE----------REN-----HYTTKEIHKGASYTFRLSARNKVGFGEETVKE---ISTSEDTPSGFPQSIVAESATTTTIQVSWQPVLLAERNGIIIKYALQYKDINSPRSPSELFIAAPESTVILDGLKADTTYDIKMCAFTSKGPGPYSPSIQFRTQPLDQVFAKNFHVKAAMK--TSVLLTWEIP--DNYNPAQP----FTILYDNGQS------VEVDGKLTQKLITNLQPETQYSFLL--TNRGNSAGGLQHRVSTM--TAPDI-LRTKPYLIGKTNSDGMVTVQL--PSVQT 1132          

HSP 6 Score: 59.3066 bits (142), Expect = 6.165e-8
Identity = 187/904 (20.69%), Postives = 339/904 (37.50%), Query Frame = 1
Query: 1027 ILHYREVPENITEKQIMSKFVYLTISEKKSIYKY-----------NLKDLFPFTTYCIWMESENPLGVSPPTIALTVKTLPTSPQLSPRSITATSISNTAILVAW-RPPER-KFGKFKYYQIIYTNNDGFLPQHWRQFAVKDDNVMLTHLIASELYHIRVKIVNEIGHGPLSKTISIKTIAGTLSQCP-DFKITEIFQSHIKLQWGTPDPVKLFKLIQYNLLCWDVRLKIVNATAKSSTLFPILNHNLSMNEMEYVLY-LKNEKEIKCRLSAINSDGKGMPTEIQASTVNKGV--NYQNLIHIDKIGSTYITFQWRPPSKFSFDYFLWIYQI-----FDSEKLDRAVKLPKIKINISDSASAENGWFVYNYTNAFSSSRYILGLRYLCRDST--DILREYVHRSD-------LVSTMKSVPSDSPKDLVVKEIDSNSALVSWKPLDQVHSNGIITHYEVRYYAPKKEESTERFINVSETSAILSNL-KYFHYVIYVRAFTKVGGGSWSNPKNYYRQNLEEFP--IPTTIKGERKSETEINISWELPVLSEKNLAHAAIEGFIILYAPVESSPKWIKYTVQSKNLSAVIKGLEPDLRYQFQIAATNYAGFNGNFSEIVQEMPKNFPNLNLKTVPDLRCSVQSSNRLKVEWSSPSISTDLLKFEIRYSGNLSYITEIGLKKSEFIDMESKSVNFETLVNRYDVTLENLQSNALYKIAVRAIYQNKELYESHRETTCDTMPAVPNLVKPPIIVGLDEEKSKVIIKLHRCSQRNGKISYYFVIVAAFQGNKNQQISFQEDTESYTFMELSVNT-----------RSNNAKGEYIAIMKDINDIFKVSGKDHSSVLLGDGTHDENHLSVNKKLEKNFNYRCFARVCLKYSNNSLCKSSPWSEPFRISDL 3603
            I+H+ E PE     QIM   VY T+   + + ++            ++ L P  TY I + +   +G  P +  L +      P   P    A + S T+IL++W  PP+  +  +   Y+++Y   D    +  R         +L  L     Y  ++   +  G G  +  IS +T     S  P +   +    ++I + W  P PV+L   I           +  + T +  +  P  N       ++Y+L  L+   E +  ++A    G G  +  Q     + V       + ++ + S+ +   WR P        +  YQ+     F+ E     V  P IK  + D A  E     Y+      S+ Y + L  L  ++T    +  Y  + D       LV+TM +VP + P+ L+V   +  +AL+ W P    H  G +  Y +R+     E  T       E       + K   Y   + A  KVG G  +  +       E+ P   P +I  E  + T I +SW+  +L+E+N     I  + + Y  + S     +  + +   + ++ GL+ D  Y  ++ A    G  G +S  +Q   +    +  K    ++ ++++S  + + W  P        F I Y    S   +  L +    +++ ++     L NR + +   LQ                     HR     TM A   L   P ++G       V ++L    Q + K+  Y+++V   +  +  + +   D+     +E  +             R    K    A  K++   F +      S + GD          NK+L     Y  F    L+ S N++  +SP+S+P   +D+
Sbjct:  431 IIHWEE-PEE-ANGQIMGYRVYYTMDPSQHVNQWEKQIVRNANFLTIQGLTPNKTYYIKVLAYTSVGDGPLSSDLQIIAKTGVPS-QPMDFKAEAKSETSILLSWVAPPQSGQDNQITGYELLYKRKDE--KEEKRVSFESTTTYLLKDLRPFTTYSFQLAARSRHGIGAYTNEISAETPQTQPSAPPQEVTCSSPSSTNILVSW-KPPPVELQNGIIIKYTIQYAATEGEDTTTREISEIPPEN-------VQYLLENLEKWTEYRVTVTAHTDVGPGPESLPQLIRTEEDVPSGPPRKVEVEAVNSSSVKVLWRSPVPNRQHGQIRGYQVHYVRMFNGE----PVGHPVIKDILIDDAQWE-----YD-----DSTEYEMVLTDLQAETTYSVTVAAYTTKGDGARSKPKLVTTMGAVP-EKPR-LMVSPTNMGTALLQWHPPPNTH--GPLQGYRLRFGRKDVEPLTVIEFPERENHYTTKEIHKGASYTFRLSARNKVGFGEETVKEI---STSEDTPSGFPQSIVAESATTTTIQVSWQPVLLAERN---GIIIKYALQYKDINSPRSPSELFIAAPESTVILDGLKADTTYDIKMCAFTSKG-PGPYSPSIQFRTQPLDQVFAKNF-HVKAAMKTS--VLLTWEIPDNYNPAQPFTILYDNGQSVEVDGKLTQKLITNLQPETQYSFLLTNRGN-SAGGLQ---------------------HR---VSTMTAPDILRTKPYLIGKTNSDGMVTVQLPSV-QTSEKVRGYYIVVVPLKKQRTGKFAKPWDSPDEMNLEELLKEINRTSGILRFRRQVEPKPYIAAYFKELPTEFTLG----DSKMYGDFE--------NKQLLNGHEYIFFVLAVLEISENTMYATSPYSDPVVSADI 1255          
BLAST of Protein tyrosine phosphatase receptor type D vs. Ensembl Sea Lamprey
Match: ptpra (protein tyrosine phosphatase receptor type A [Source:ZFIN;Acc:ZDB-GENE-020107-1])

HSP 1 Score: 463.766 bits (1192), Expect = 1.408e-143
Identity = 241/592 (40.71%), Postives = 359/592 (60.64%), Query Frame = 1
Query: 4063 PSISICNLYQYVTDLKANDCTLLQAEFETLNTNLDDRFTWQRSNIDSNKSKNRYANVVAYDHTSVLLTPVDDVIGSDYINANYIDGYQRQNAYIATQG--PLPDTTDDFWRMVWEQRSNCIVMMTRLEERSGIKCHQYWPNRGFICYGQMIVSHIDTFVLAYYTIRLFEIRH----SKYSEKREIQHFQFTAWPDHGVPKLSTPLLMFIRRVRSIGKIESCPKIVHCSAGVGRTGAFIVVDAQLERIKQEKNIDVFNYVSKIRCQRNYMVQTQAQYQFILETLLEAVEDGNTEVMACNFHAHVTKLSQIGISGSNQLSGFEMEFSKLNSLASNRGRHGVMLADFVKAAGNQAVNMTKNRVRNIIPYEWNRVVLNAIRGIEGSDYINASYIDGYRDRRAYIAAQSPIPSTVEDFWRMLWD-QHCGVVIV--LNQPHEDKSHIYWPINKSIRYQFFVVDPVVEYNMPNYILREFKVTDARDGEFRALRQFQFTQWPNHGCPKESESILDFIRQVHKTKEQFGHMEPMVIHCNTGSGRTGVFIALSIVLDRLQQESVVDMYQTVKLLHKQRIGLVQTEEQYEFCYMAVLDYLSNY 5811
            P +++  L +      A+D  L + EF +L  +   + T + ++ + NK KNRY N++ YD+  V LT ++ V  SDYINA+Y++GYQ +N +IA QG  P  +T +D+WRM+WE  +  IVM+T L+ER   KC QYWP++G   YG + VS  D  VL  YTIR F I+           R I  F FT+WPD GVP     +L F+++V++     + P +VHCSAGVGRTG FIV+DA L+ I+ E+ +DVF +V++IR QR  MVQT  QY FI + LLE    G+TE+   +  +H+ KL     +     +G E EF KL +         V + +     GN   NM KNRV  IIPY++NRV++   RG E +DYIN S+IDGYR + A++A Q P+  TVEDFWRM+W+ + C +V++  L +  ++K   YWP   +I Y   +++   E +  +Y +R+F V++ R+ + R +RQF F  WP  G P++ + ++  I  V K ++  G+  P+ +HC+ G+GRTG F AL  +L+R++ E ++D++QTVK L  QR  +VQT EQYEFCY  V +Y+  +
Sbjct:  165 PPLAVDRLEEEFNRRSADDNKLFREEFNSL-PSCPIQATCEAASKEENKEKNRYVNILPYDNFRVHLTSLEGVPDSDYINASYVNGYQEKNKFIAAQGKGPKEETLNDYWRMIWELNTATIVMVTNLKERKECKCAQYWPDQGCWTYGNLRVSVEDVTVLVDYTIRKFLIQVVGDIPNKKPPRLITQFHFTSWPDFGVPFAPIGMLKFLKKVKTCNPPYAGPIVVHCSAGVGRTGTFIVIDAMLDMIQTERKVDVFGFVTRIRAQRCQMVQTDMQYVFIYQALLEFQLYGDTELEVTSLESHLQKL--YNKNTPTGCTGLEDEFKKLTT---------VKIQNEKMRTGNLPANMKKNRVLQIIPYDFNRVIIPMKRGEEFTDYINGSFIDGYRQKDAFLAGQGPLQQTVEDFWRMVWEWRSCSIVMLTELEERGQEKCARYWPTEGTITYGDIIIELKQENSHDSYTVRDFSVSNTRENKSRQIRQFHFHGWPEIGIPEDGKGMISLIAAVQKQQQHTGN-HPITVHCSAGAGRTGTFCALCTILERVKTEGILDVFQTVKSLRTQRPHMVQTLEQYEFCYKVVQEYIEAF 743          
BLAST of Protein tyrosine phosphatase receptor type D vs. Ensembl Sea Lamprey
Match: ptprsa (protein tyrosine phosphatase receptor type Sa [Source:ZFIN;Acc:ZDB-GENE-020107-3])

HSP 1 Score: 416.001 bits (1068), Expect = 1.890e-128
Identity = 212/449 (47.22%), Postives = 281/449 (62.58%), Query Frame = 1
Query: 4006 SDSIKLRIGSQKSENISDRPSISICNLYQYVTDLKANDCTLLQAEFETLNTNLDDRFTWQRSNIDSNKSKNRYANVVAYDHTSVLLTPVDDVIGSDYINANYIDGYQRQNAYIATQGPLPDTTDDFWRMVWEQRSNCIVMMTRLEERSGIKCHQYWPNRGFICYGQMIVSHIDTFVLAYYTIRLFEIRHSKYSEKREIQHFQFTAWPDHGVPKLSTPLLMFIRRVRSI--GKIESCPKIVHCSAGVGRTGAFIVVDAQLERIKQEKNIDVFNYVSKIRCQRNYMVQTQAQYQFILETLLEAVEDGNTEVMACNFHAHVTKLSQIGISGSNQLSGFEMEFSKLNSLASNRGRHGVMLADFVKAAGNQAVNMTKNRVRNIIPYEWNRVVLNAIRGIEGSDYINASYIDGYRD-RRAYIAAQSPIPSTVEDFWRMLWDQHCGVVIVLNQPHE 5343
            +D +++R  + ++  +   P I +     +V  LKAND  L   E+E+++     +FTW  SN++ NK KNRYANVVAYDH+ V+L  +D V GSDYINANYIDGY+R NAYIA+QGPL DT  DFWRMVWEQRS+ IVMMT+LEER+ +KC QYWPNRG   YG + V+  DT  LA Y+ R F +  S  +E+R+++ FQFTAWPDHGVP+  TP+L F+RRVR+      +  P IVHC       G F V     E       + ++  V+ +R QRNYMVQT+ QY F+   L+EAV  G TE  A + HAH+ +LSQ       + +G  +EF +L             L      +G    N  KNR+  +IP + +RV L AIRG +GSDYINASYIDGYR  +RAYIA Q P+P T ED WRMLW+Q+  +V++L +  E
Sbjct:  159 ADPVQMRRLNHQTPGMEMHPPIPVSEFAGHVERLKANDNMLFSQEYESIDPG--QQFTWDHSNLEINKHKNRYANVVAYDHSRVILHTIDGVPGSDYINANYIDGYRRHNAYIASQGPLADTVADFWRMVWEQRSSTIVMMTKLEERARVKCDQYWPNRGSESYGLVQVTLTDTVELATYSTRSFTLTRSGCTERRDVRQFQFTAWPDHGVPEFPTPVLAFLRRVRAAWGSSADGGPLIVHCRQRSDVCGCFFVGLFMQEGHYGCITVSLYLQVTCMRAQRNYMVQTEEQYAFVHTALVEAVSSGCTETPARSLHAHLQRLSQSVSHTEPRTTGLHLEFQRLQM---------SKLRVSTAPSGALPCNKLKNRLLTVIPPDSSRVALQAIRGTQGSDYINASYIDGYRSQQRAYIATQGPLPETTEDLWRMLWEQNSTIVVMLTKLRE 596          

HSP 2 Score: 172.94 bits (437), Expect = 3.904e-45
Identity = 95/262 (36.26%), Postives = 138/262 (52.67%), Query Frame = 1
Query: 5092 NQAVNMTKNRVRNIIPYEWNRVVLNAIRGIEGSDYINASYIDGYRDRRAYIAAQSPIPSTVEDFWRMLWDQHCGVVIVLNQPHED---KSHIYWPINKSIRYQFFVVDPVVEYNMPNYILREFKVTDARDGEFRALRQFQFTQWPNHGCPKESESILDFIRQVHKTKEQFGHMEPMVIHCNTGSGRTGVFIALSIVLDRLQQESVVDMYQTVKLLHKQRIGLVQTEEQYEFCYMAVLDYLSNYEKILEKSHLY*TYQDLSES 5868
            N  +N  KNR  N++ Y+ +RV+L+ I G+ GSDYINA+YIDGYR   AYIA+Q P+  TV DFWRM+W+Q    ++++ +  E    K   YWP   S  Y    V       +  Y  R F +T +   E R +RQFQFT WP+HG P+    +L F+R+V           P+++HC   S   G F     + +       V +Y  V  +  QR  +VQTEEQY F + A+++ +S+         L+   Q LS+S
Sbjct:  219 NLEINKHKNRYANVVAYDHSRVILHTIDGVPGSDYINANYIDGYRRHNAYIASQGPLADTVADFWRMVWEQRSSTIVMMTKLEERARVKCDQYWPNRGSESYGLVQVTLTDTVELATYSTRSFTLTRSGCTERRDVRQFQFTAWPDHGVPEFPTPVLAFLRRVRAAWGSSADGGPLIVHCRQRSDVCGCFFVGLFMQEGHYGCITVSLYLQVTCMRAQRNYMVQTEEQYAFVHTALVEAVSSGCTETPARSLHAHLQRLSQS 480          
BLAST of Protein tyrosine phosphatase receptor type D vs. Ensembl Sea Lamprey
Match: ca16b (carbonic anhydrase XVI b [Source:ZFIN;Acc:ZDB-GENE-080818-1])

HSP 1 Score: 377.481 bits (968), Expect = 1.140e-113
Identity = 220/613 (35.89%), Postives = 326/613 (53.18%), Query Frame = 1
Query: 4057 DRPSISICNLYQYVTDLKANDCTLLQAEFETLN-TNLDDRFTWQRSNIDSNKSKNRYANVVAYDHTSVLLTPV--DDVIGSDYINANYIDGYQRQNAYIATQGPLPDTTDDFWRMVWEQRSNCIVMMTRLEERSGIKCHQYWPNRGFICYGQMIVSHIDTFVLAYYTIRLFEIRHSKYSE-------------KREIQHFQFTAWPDHGVPKLSTPLLMFIRRVRSIGKIESCPKIVHC--SAGVGRTGAFIVVDAQLERIKQEKNIDVFNYVSKIRCQRNYMVQTQAQYQFILETLLEAVEDGNTEVMACNFHAHVTKLSQIGISGSNQLSGFEMEFSKLNSLASNRGRHGVMLADFVKAAGNQAVNMTKNRVRNIIPYEWNRVVLNAIRGIEGSDYINASYIDGYRDRRAYIAAQSPIPSTVEDFWRMLWDQHCGVVIVL--NQPHEDKSHIYWP-INKSIRYQFFVV-----DPVVEYNMPNYILREFKVTDARDGEFRALRQFQFTQWPNHGCP-KESESILDFIRQVHKTKEQFGHMEPMVIHCNTGSGRTGVFIALSIVLDRLQQESVVDMYQTVKLLHKQRIGLVQTEEQYEFCYMAVLDYLSNYE 5814
            D  ++ +    ++V ++          EFE +     D   T + SN   NK KNRY N+VAYDH+ V L P+   D   SDYINANY+DGY RQ AYIA QGPL  T  DFWRMVWEQ +  IVM+T L E+   KC QYWP+     YG ++V+   T  LA YT+R F IR++K  +             +R +  F +T WPD G P  + P+L F+R+  +       P +VHC  SAGVGRTG +IV+D+ L++I+    ++V  ++  IR QRNY+VQ Q QY FI E+LLEAV  G TEV     HA+ T +     +   +      E + L        +  V  ++F  A   +  N  KNR  +I+P E +RV L+++ G+EG+DYINASYI GY     +I  Q P+P T  DFWRM+WD +  ++++L   Q   +   +YWP   +++    F V     D +   N    ++ +F +   +D     +R +Q  +WP+   P   +  I++ IR+   T++      P ++H   G    G F AL+ +L +L+++  VD++Q  K+++  R G+    EQY F Y A L  +   E
Sbjct:   67 DGEALPVKLFARHVGEMHEGALHSFSQEFEEVQRCTADLGITAEHSNHPENKHKNRYVNIVAYDHSRVRLRPLPGKDSKHSDYINANYVDGYNRQKAYIAAQGPLKATFADFWRMVWEQNTGIIVMITNLVEKGRRKCDQYWPSESNEEYGNILVTLKSTRTLACYTVRHFTIRNTKLRKGTSQKSSARGRQNERLVVQFHYTQWPDMGTPDYALPVLTFVRKSSATRTDLMGPVVVHCRRSAGVGRTGTYIVLDSMLQQIRDSGTVNVLGFLKHIRTQRNYLVQPQEQYTFIHESLLEAVLTGETEVAPGQLHAYYTSILSPAATDVTRPVVTATENTHLEKQFRLVTQCSVRQSEFFSA--TKHCNKEKNRNSSIVPVERSRVGLSSLSGLEGTDYINASYITGYYRSNEFIVTQHPLPHTTRDFWRMIWDHNAQIIVMLPDGQGLAEDESVYWPGREEAMNCDDFTVTLINEDRLCLANEEQLVIHDFILECLQDDYVLEVRHYQCPRWPDTEGPLSNAFEIINVIREEATTRDG-----PTILHDEFGGVSAGTFCALTTLLHQLEEQESVDVFQVCKMVNLMRPGVFTDIEQYHFVYRAALSLIGTRE 672          

HSP 2 Score: 158.303 bits (399), Expect = 7.820e-40
Identity = 98/318 (30.82%), Postives = 156/318 (49.06%), Query Frame = 1
Query: 4966 QIGISGSNQLSGFEMEFSKLNSLASNRGRHGVMLADFVKAAGNQAVNMTKNRVRNIIPYEWNRVVLNAIRGIEG--SDYINASYIDGYRDRRAYIAAQSPIPSTVEDFWRMLWDQHCGVVIVLNQPHED---KSHIYWPINKSIRYQFFVVDPVVEYNMPNYILREFKV--TDARDGEF-----------RALRQFQFTQWPNHGCPKESESILDFIRQVHKTKEQFGHMEPMVIHC--NTGSGRTGVFIALSIVLDRLQQESVVDMYQTVKLLHKQRIGLVQTEEQYEFCYMAVLDYLSNYEKILEKSHLY*TYQDL 5859
             +G      L  F  EF ++    ++ G              N   N  KNR  NI+ Y+ +RV L  + G +   SDYINA+Y+DGY  ++AYIAAQ P+ +T  DFWRM+W+Q+ G+++++    E    K   YWP   +  Y   +V       +  Y +R F +  T  R G             R + QF +TQWP+ G P  +  +L F+R+   T+     M P+V+HC  + G GRTG +I L  +L +++    V++   +K +  QR  LVQ +EQY F + ++L+ +   E  +    L+  Y  +
Sbjct:   79 HVGEMHEGALHSFSQEFEEVQRCTADLG--------ITAEHSNHPENKHKNRYVNIVAYDHSRVRLRPLPGKDSKHSDYINANYVDGYNRQKAYIAAQGPLKATFADFWRMVWEQNTGIIVMITNLVEKGRRKCDQYWPSESNEEYGNILVTLKSTRTLACYTVRHFTIRNTKLRKGTSQKSSARGRQNERLVVQFHYTQWPDMGTPDYALPVLTFVRKSSATRTDL--MGPVVVHCRRSAGVGRTGTYIVLDSMLQQIRDSGTVNVLGFLKHIRTQRNYLVQPQEQYTFIHESLLEAVLTGETEVAPGQLHAYYTSI 386          
BLAST of Protein tyrosine phosphatase receptor type D vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002738.1 (pep scaffold:Pmarinus_7.0:GL477626:22501:55781:-1 gene:ENSPMAG00000002497.1 transcript:ENSPMAT00000002738.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 355.525 bits (911), Expect = 9.374e-108
Identity = 205/578 (35.47%), Postives = 325/578 (56.23%), Query Frame = 1
Query: 4063 PSISICNLYQYVTDLKANDCTLLQAEFETLNTNLDDRFT-WQRSNIDSNKSKNRYANVVAYDHTSVLLTPVDDVIGSDYINANYID--GYQRQNAYIATQGPLPDTTDDFWRMVWEQRSNCIVMMTRLEERSGIKCHQYWPNRGFICYGQMIVSHIDTFVLAYYTIRLFEIRHSKYSEKREIQHFQFTAWPDHGVPKLSTPLLMFIRRVRSIGKIESCPKIVHC--SAGVGRTGAFIVVDAQLERIKQEKNIDVFNYVSKIRCQRNYMVQTQAQYQFILETLLEAVEDGNTEVMACNFHAHVTKLSQIGISGSNQLSGFEMEFSKLNSLASNRGRHGVMLADFVKAAGNQAVNMTKNRVRNIIPYEWNRVVLNAIRGIEGSDYINASYIDGYRDRRAYIAAQSPIPSTVEDFWRMLWDQHCGVVIVLNQ--PHEDKSHIYWPINKSIRYQFFVVDPVV---EYNMPNYILREFKVTDARDG--EFRALRQFQFTQWPNH-GCPKESESILDFIRQVHKTKEQFGHMEP-MVIHCNTGSGRTGVFIALSIVLDRLQQESVVDMYQTVKLLHKQRIGLVQ 5754
            P+I + +L Q++  +K+ +    + E+E+    LD +   WQ +  D N+ +NRY N++A  H+  L      V+  DY  A Y++  GYQ+Q  YIATQGPL +T  DFWRMVW+++S+ IVM+T L E   +KC +YWP+      G + V+ + T +LA Y IR F ++   Y +  E++ F FT WPDHGVP  +T LL F+RRV++    E+ P I HC  SAG GRTG ++V+D  LE   +E  IDV+N V ++R QR  MVQT+ QY FI + LLEA   G+T + A NF +   +L++  +      +  + EF  LN++          +A   +       N +KNRV+  +P +     L  + G + S+YINA+ +D Y    A+I  Q P+P+TV+DFWR+++D HC  VI+LN+  P E     YWP   S++Y    V+ +    + ++ + I R   ++  +DG  E + ++  Q+  WP+H   P    S L    +V +   +    E   ++HC +G GR+G + A+S++ D ++ +SVVD++  VK L   +  +V+
Sbjct:    1 PAIRVADLLQHIGQMKSTEGCGFKEEYESF---LDGQSAPWQVAKKDENRGRNRYGNIIALKHSQKLKVRKQRVLSQDYTEA-YVEQHGYQKQRQYIATQGPLQETAVDFWRMVWQEKSSSIVMVTNLVEVGRVKCFKYWPD-DTQQLGDIAVTLLHTELLAEYVIRTFSVKRKGYFDALEVRQFHFTGWPDHGVPAFATGLLSFVRRVKASNPPEAGPIITHCRDSAGAGRTGCYVVIDVMLEMAGREGVIDVYNCVRELRLQRVNMVQTEEQYVFIHDVLLEACLCGDTAIPAANFRSAYLELTR--LDPQTHSTPLKEEFMTLNTVTPALRAEDCSIALLPR-------NSSKNRVKEALPPDRCLPFLLTLEG-DSSNYINAALLDSYHRPSAFIVTQHPLPNTVKDFWRLVFDYHCTSVIMLNEMRPSETCPQ-YWPEEGSLQYGAVHVETLSCCRDGDIISRIFRIHNISRPQDGHREVQHVQHLQYLGWPSHRDAPASPLSFLRVAGRVRRWHAELAEEEGRTLVHCLSGGGRSGTYCAVSVLCDMVKGQSVVDVFTAVKTLRNNKPDMVE 562          

HSP 2 Score: 133.65 bits (335), Expect = 2.320e-32
Identity = 82/240 (34.17%), Postives = 132/240 (55.00%), Query Frame = 1
Query: 5104 NMTKNRVRNIIPYEWNRVVLNAIRGIEGSDYINASYID--GYRDRRAYIAAQSPIPSTVEDFWRMLW-DQHCGVVIVLN--QPHEDKSHIYWPINKSIRYQFFVVDPVVEYNMPNYILREFKVTDARDGEFRAL--RQFQFTQWPNHGCPKESESILDFIRQVHKTKEQFGHMEPMVIHC--NTGSGRTGVFIALSIVLDRLQQESVVDMYQTVKLLHKQRIGLVQTEEQYEFCYMAVLD 5796
            N  +NR  NII  + ++ +    + +   DY  A Y++  GY+ +R YIA Q P+  T  DFWRM+W ++   +V+V N  +    K   YWP + + +     V  +    +  Y++R F V   R G F AL  RQF FT WP+HG P  +  +L F+R+V  +        P++ HC  + G+GRTG ++ + ++L+   +E V+D+Y  V+ L  QR+ +VQTEEQY F +  +L+
Sbjct:   46 NRGRNRYGNIIALKHSQKLKVRKQRVLSQDYTEA-YVEQHGYQKQRQYIATQGPLQETAVDFWRMVWQEKSSSIVMVTNLVEVGRVKCFKYWP-DDTQQLGDIAVTLLHTELLAEYVIRTFSVK--RKGYFDALEVRQFHFTGWPDHGVPAFATGLLSFVRRVKASNPP--EAGPIITHCRDSAGAGRTGCYVVIDVMLEMAGREGVIDVYNCVRELRLQRVNMVQTEEQYVFIHDVLLE 279          
BLAST of Protein tyrosine phosphatase receptor type D vs. Ensembl Sea Lamprey
Match: ptprk (protein tyrosine phosphatase receptor type K [Source:ZFIN;Acc:ZDB-GENE-030131-9834])

HSP 1 Score: 366.311 bits (939), Expect = 8.587e-104
Identity = 208/590 (35.25%), Postives = 327/590 (55.42%), Query Frame = 1
Query: 4063 PSISICNLYQYVTDLKANDCTLLQAEFETLNTNLDDRFTWQRSNIDSNKSKNRYANVVAYDHTSVLLTPVDDVIGSDYINANYIDGYQRQNAYIATQGPLPDTTDDFWRMVWEQRSNCIVMMTRLEERSGIKCHQYWPNRGFICYGQMIVSHIDTFVLAYYTIRLFEIRHSKYSEKREIQHFQFTAWPDHGVPKLSTPLLMFIRRVRSIGKIESCPKIVHCSAGVGRTGAFIVVDAQLERIKQEKNIDVFNYVSKIRCQRNYMVQTQAQYQFILETLLEAVEDGNTEVMACNFH-AHVTKLSQIGISGSNQLSGFEMEFSKLNSLASNRGRHGVMLADFVKAAGNQAVNMTKNRVRNIIPYEWNRVVLNAIRGIEGSDYINASYIDGYRDRRAYIAAQSPIPSTVEDFWRMLWDQHCGVVIVLNQPHEDK-SHIYWPINKSIRYQFFVVDPVVEYNMP-NYILREFKVTD---ARDGEFRALRQFQFTQWP-NHGCPKESESILDFIRQVHKTKEQFGHMEPMVIHC---NTGSGRTGVFIALSIVLDRLQQESVVDMYQTVKLLHKQRIGLVQTEEQYEFCYMAVLDYL 5802
            P++ + +L +++  +K  +    + E+E+          W  +  D N++KNRY N++AYDH+ V+L  +D+   SDYINANY+DGY R + YIATQGPLPDT   FWRM+W++RS  I+M+T L E   IKC +YWP+ G   YG + V+  DT +L+ Y IR F +  +   + RE++ F FT WPDHGVP  +T LL FIRR++++    + P +VHCSAG GRTG ++V+D  L+  + E  ID++N V ++R +R  MVQT+ QY FI + +LEA   G+T + A +F  A+   L     S SN +     EF  LN +          +A   +       N  KNR  +++P +     L  I G + S+YINA+ +D YR   A+I  Q P+P+TV+DFWR+++D HC  +++LN+   +K    YWP    + +    V+  V +NM  + I R F++ +    +DG  R + QF +  WP     P    S L  +    + +E++G     V+HC           +   ++   + + Q  + ++ + +  ++K   GLV  + QY+FCY   L+YL
Sbjct:  896 PAVRVADLLEHIGQMKTGEGYGFKEEYESFFEG--QSAPWDVAKRDENRAKNRYGNIIAYDHSRVMLNVLDEEQNSDYINANYVDGYYRTHHYIATQGPLPDTVGGFWRMIWQERSASIIMVTNLVEVGRIKCCKYWPD-GSDVYGDIKVTLADTEMLSEYIIRTFRVERAGQEDIREVRQFHFTGWPDHGVPYHATGLLAFIRRIKALDPPHAGPLVVHCSAGAGRTGCYMVIDIMLDMAESEGVIDIYNCVRELRTRRVNMVQTEEQYVFIHDAMLEACLCGDTCIPAGDFRAAYAEMLRPDPQSSSNHIKD---EFQTLNMVTPPLRVEDCSIALLPR-------NHEKNRYHDVLPPDRCLPFLITING-DSSNYINAALMDSYRQPSAFIVTQHPLPNTVKDFWRLVFDYHCTSIVMLNELDSNKYCPQYWPEEGMLCHGPIQVE-FVAFNMEGDIITRTFRICNVARPQDG-CRMVEQFHYLGWPAGREVPTSRHSFLRLVLAAERWREEYGMDGRTVVHCLNPPPRLLSLPLLSLMATANNHMYQIIITELVEKIMAIYK---GLVNLQSQYQFCYDVALEYL 1466          
BLAST of Protein tyrosine phosphatase receptor type D vs. Ensembl Yeast
Match: PTP1 (Phosphotyrosine-specific protein phosphatase; dephosphorylates a broad range of substrates in vivo, including Fpr3p; localized to the cytoplasm and the mitochondria; proposed to be a negative regulator of filamentation [Source:SGD;Acc:S000002389])

HSP 1 Score: 110.538 bits (275), Expect = 2.721e-26
Identity = 93/303 (30.69%), Postives = 131/303 (43.23%), Query Frame = 1
Query: 4144 ETLNTNLDDRFTWQRSNIDSNKSKNRYANVVAYDHTSVLLTPVDDVIGSDYINANYID----------GYQRQNAYIATQGPLPDTTDDFWRMVWEQRSNC------IVMMTRLEERSGIKCHQYWPNRGFICYGQMIVSHIDT----------------------FVLAYYTIRLFEIRHSK--YSEKREIQHFQFTAWPDHGVPKLSTPLLMFIRRVRSIGKIESCPKIVHCSAGVGRTGAFIVVDAQLERIKQEKNID-----------------VFNYVSKIRCQRNYMVQTQAQYQFI 4881
            E  N  ++ R++   S    N ++NRY N++ Y+   V L  +    G+DYINA+Y+           GY     YIATQGP   T D FW+M +    NC      IVM+T L E +  KC+QYWP RG +     I S  ++                       V  YYT+   ++  +       + + HF F  W D   P+   P++       S+      P IVHCSAGVGRTG FI +D  +      KNI                  +   V ++R QR  MVQT+ Q+ FI
Sbjct:   32 EATNGTVNSRWSLGVSIEPRNDARNRYVNIMPYERNRVHLKTLS---GNDYINASYVKVNVPGQSIEPGY-----YIATQGPTRKTWDQFWQMCYH---NCPLDNIVIVMVTPLVEYNREKCYQYWP-RGGVDDTVRIASKWESPGGANDMTQFPSDLKIEFVNVHKVKDYYTVTDIKLTPTDPLVGPVKTVHHFYFDLWKDMNKPEEVVPIMELCAHSHSLNS-RGNPIIVHCSAGVGRTGTFIALDHLMHDTLDFKNITERSRHSDRATEEYTRDLIEQIVLQLRSQRMKMVQTKDQFLFI 321          

HSP 2 Score: 100.523 bits (249), Expect = 6.489e-23
Identity = 84/290 (28.97%), Postives = 130/290 (44.83%), Query Frame = 1
Query: 5104 NMTKNRVRNIIPYEWNRVVLNAIRGIEGSDYINASYID----------GYRDRRAYIAAQSPIPSTVEDFWRMLWDQHC---GVVIVLNQP----HEDKSHIYWP---INKSIRY----------------------QFFVVDPVVEYNMPNYILREFKVT--DARDGEFRALRQFQFTQWPNHGCPKESESILDFIRQVHKTKEQFGHMEPMVIHCNTGSGRTGVFIALSIVL----------------DRLQQESVVDMYQTVKL-LHKQRIGLVQTEEQYEFCYMAV 5790
            N  +NR  NI+PYE NRV L   + + G+DYINASY+           GY     YIA Q P   T + FW+M +  +C    +VIV+  P    + +K + YWP   ++ ++R                       +F  V  V +Y    Y + + K+T  D   G  + +  F F  W +   P+E   I++     H    +     P+++HC+ G GRTG FIAL  ++                DR  +E   D+ + + L L  QR+ +VQT++Q+ F Y A 
Sbjct:   52 NDARNRYVNIMPYERNRVHL---KTLSGNDYINASYVKVNVPGQSIEPGY-----YIATQGPTRKTWDQFWQMCY-HNCPLDNIVIVMVTPLVEYNREKCYQYWPRGGVDDTVRIASKWESPGGANDMTQFPSDLKIEFVNVHKVKDY----YTVTDIKLTPTDPLVGPVKTVHHFYFDLWKDMNKPEEVVPIMELCAHSHSLNSR---GNPIIVHCSAGVGRTGTFIALDHLMHDTLDFKNITERSRHSDRATEEYTRDLIEQIVLQLRSQRMKMVQTKDQFLFIYHAA 325          
BLAST of Protein tyrosine phosphatase receptor type D vs. Ensembl Yeast
Match: PTP2 (Nuclear phosphotyrosine-specific phosphatase involved in osmosensing; involved in the inactivation of mitogen-activated protein kinase (MAPK) during osmolarity sensing; dephosporylates Hog1p MAPK and regulates its localization; with Msg5p co-regulates the calcium signaling pathway [Source:SGD;Acc:S000005734])

HSP 1 Score: 84.7297 bits (208), Expect = 8.620e-17
Identity = 86/326 (26.38%), Postives = 128/326 (39.26%), Query Frame = 1
Query: 4210 SKNRYANVVAYDHTSVLLT-------------------------PVD----DVIGSDYINANYIDGYQRQN--AYIATQGPLPDTTDDFWRMVWEQRSNCIVMMTRLEERSGIKCHQYWPNRGFICYGQMI------VSHIDTFVLAYYTIRLFEIRHSKYSEKREIQH-------------------FQFTAWPDH-GVP--------KLSTPLLM----FIRRVRS----------------IGKIESCPKIVHCSAGVGRTGAFIVVDAQLERIKQEKN----IDVFNY--------VSKIRCQRNYMVQTQAQYQFILETLL 4896
            +KNRY+N++ Y+H+ V L                          PVD        +DYINANY+   Q      YIATQ PLP T DDFW+++   +   I+ +   +E +  K   YW N  +  +   +      + +I+  VL  + ++    ++   S+  ++ H                    Q+  W D  GV         K+   LL     FI  +                  +    S P +VHCSAG GRTG F+ +D  L  +    N    IDV+N         V+++R QR  MVQ   QY    E LL
Sbjct:  410 TKNRYSNILPYEHSRVKLPHSPKPPAVSEASTTETKTDKSYPMCPVDAKNHSCKPNDYINANYLKLTQINPDFKYIATQAPLPSTMDDFWKVITLNKVKVIISLNSDDELNLRKWDIYWNNLSYSNHTIKLQNTWENICNINGCVLRVFQVKKTAPQNDNISQDCDLPHNGDLTSITMAVSEPFIVYQLQYKNWLDSCGVDMNDIIKLHKVKNSLLFNPQSFITSLEKDVCKPDLIDDNNSELHLDTANSSPLLVHCSAGCGRTGVFVTLDFLLSILSPTTNHSNKIDVWNMTQDLIFIIVNELRKQRISMVQNLTQYIACYEALL 735          

HSP 2 Score: 57.3806 bits (137), Expect = 2.355e-8
Identity = 31/83 (37.35%), Postives = 44/83 (53.01%), Query Frame = 1
Query: 5593 GHMEPMVIHCNTGSGRTGVFIALSIVLDRLQQES-------VVDMYQ-----TVKLLHKQRIGLVQTEEQYEFCYMAVLDYLS 5805
             +  P+++HC+ G GRTGVF+ L  +L  L   +       V +M Q      V  L KQRI +VQ   QY  CY A+L+Y +
Sbjct:  657 ANSSPLLVHCSAGCGRTGVFVTLDFLLSILSPTTNHSNKIDVWNMTQDLIFIIVNELRKQRISMVQNLTQYIACYEALLNYFA 739          

HSP 3 Score: 53.5286 bits (127), Expect = 3.561e-7
Identity = 42/134 (31.34%), Postives = 60/134 (44.78%), Query Frame = 1
Query: 5065 LADFVKAAGNQAVNMTKNRVRNIIPYEWNRVVLN------AI-----------------------RGIEGSDYINASYID--GYRDRRAYIAAQSPIPSTVEDFWRMLWDQHCGVVIVLNQPHE---DKSHIYW 5364
            + D+    G Q+   TKNR  NI+PYE +RV L       A+                          + +DYINA+Y+          YIA Q+P+PST++DFW+++      V+I LN   E    K  IYW
Sbjct:  397 INDYELTEGIQS--FTKNRYSNILPYEHSRVKLPHSPKPPAVSEASTTETKTDKSYPMCPVDAKNHSCKPNDYINANYLKLTQINPDFKYIATQAPLPSTMDDFWKVITLNKVKVIISLNSDDELNLRKWDIYW 528          
BLAST of Protein tyrosine phosphatase receptor type D vs. Ensembl Yeast
Match: PTP3 (Phosphotyrosine-specific protein phosphatase; involved in the inactivation of mitogen-activated protein kinase (MAPK) during osmolarity sensing; dephosporylates Hog1p MAPK and regulates its localization; localized to the cytoplasm [Source:SGD;Acc:S000000877])

HSP 1 Score: 53.5286 bits (127), Expect = 3.518e-7
Identity = 34/118 (28.81%), Postives = 53/118 (44.92%), Query Frame = 1
Query: 4210 SKNRYANVVAYDHTSVLL--------------TPVDDVIGSDYINANYID----------GYQ------RQNAYIATQGPLPDTTDDFWRMVWEQRSNCIVMMTRLEERSGIKCHQYW 4473
            +KNRY ++  Y+H+ V+L              +  D  I  +YINANY+            +Q      R+  YIATQ P+P T  DF+  +       ++ +T   E    KC++YW
Sbjct:  529 AKNRYKDIFPYEHSRVILKKGLQSSKGIKHSHSTSDGGILDNYINANYLSLPRFSVEQNSSFQTTTTTTRRVRYIATQAPMPSTVHDFYTCILNNGVPLVLSLTNDFENGIEKCYRYW 646          

HSP 2 Score: 52.373 bits (124), Expect = 7.597e-7
Identity = 37/117 (31.62%), Postives = 56/117 (47.86%), Query Frame = 1
Query: 5113 KNRVRNIIPYEWNRVVLN----AIRGIEGS----------DYINASYIDGYR----------------DRRAYIAAQSPIPSTVEDFWRMLWDQHCGVVIVLNQPHE---DKSHIYW 5364
            KNR ++I PYE +RV+L     + +GI+ S          +YINA+Y+   R                 R  YIA Q+P+PSTV DF+  + +    +V+ L    E   +K + YW
Sbjct:  530 KNRYKDIFPYEHSRVILKKGLQSSKGIKHSHSTSDGGILDNYINANYLSLPRFSVEQNSSFQTTTTTTRRVRYIATQAPMPSTVHDFYTCILNNGVPLVLSLTNDFENGIEKCYRYW 646          
BLAST of Protein tyrosine phosphatase receptor type D vs. Ensembl Nematostella
Match: EDO46961 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNP0])

HSP 1 Score: 605.52 bits (1560), Expect = 0.000e+0
Identity = 287/618 (46.44%), Postives = 409/618 (66.18%), Query Frame = 1
Query: 3970 CQDGTKLSPVLVSDSIKLRIGSQKSENISDRPSISICNLYQYVTDLKANDCTLLQAEFETLNTNLDDRFTWQRSNIDSNKSKNRYANVVAYDHTSVLLTPVDDVIGSDYINANYIDGYQRQNAYIATQGPLPDTTDDFWRMVWEQRSNCIVMMTRLEERSGIKCHQYWPNRGFICYGQMIVSHIDTFVLAYYTIRLFEIRHSKYSEKREIQHFQFTAWPDHGVPKLSTPLLMFIRRVRSIGKIESCPKIVHCSAGVGRTGAFIVVDAQLERIKQEKNIDVFNYVSKIRCQRNYMVQTQAQYQFILETLLEAVEDGNTEVMACNFHAHVTKLSQIGISGSNQLSGFEMEFSKLNSLASNRGRHGVMLADFVKAAGNQAVNMTKNRVRNIIPYEWNRVVLNAIRGIEGSDYINASYIDGYRDRRAYIAAQSPIPSTVEDFWRMLWDQHCGVVIVLNQPHE---DKSHIYWPINKSIRYQFFVVDPVVEYNMPNYILREFKVTDARDGEFRALRQFQFTQWPNHGCPKESESILDFIRQVHKTKEQFGHMEPMVIHCNTGSGRTGVFIALSIVLDRLQQESVVDMYQTVKLLHKQRIGLVQTEEQYEFCYMAVLDYLSNYE 5814
            C+D  K  P   SD +++R  + ++  + D P IS+ +L +++  LKA++ +    E+E++       FT   S ++ NK KNRY N+ AYDH+ V L+ ++ + GSDYINAN+ DGY+++ AYIATQGP+  T  DFWRMVWEQR+  IVM+TR EER  +KC QYWP  G   Y  + VS +D   LA YTI   +I     S+ RE++HFQFT WPDHGVP   TP L F+RRV+     ++ P +VHCSAGVGRTG FIV+D+ LER++ E+ +D++ +V+ +R QRNYMVQTQ QY F  + +LEAV  GNTEV A N   H+ KL+++   G  +++G E EF  ++   + + ++G         A   A+N  KNR+ NI+PYE  RV ++ +RG+EGSDYINAS+IDGYR R  +IA Q P+  TV+DFWRML +Q+  ++++L Q HE   +K + YWP ++S R+Q+++VDP+ E+  P +++R+FKV DAR    R ++QF F  WP  G PK  E I+D I QV +  EQ     P+ +HC+ G GRTGVF AL IVL+R++ E VVD++QTVKLL  QR  +VQ++EQY FCY   L+YL +++
Sbjct: 1270 CKDEEKSEP---SDPVEMRRLNFQTPAMIDHPPISVLDLPKHIAILKADNNSQFTQEYESIEPG--QTFTADSSQMECNKGKNRYPNIHAYDHSRVRLSYINGIEGSDYINANFCDGYRKERAYIATQGPMQHTAADFWRMVWEQRTFTIVMLTREEERGRVKCDQYWPTDGTDVYEGIEVSLVDWVELANYTISTLQICKEGASQPREVKHFQFTGWPDHGVPAHPTPFLAFLRRVKFYNPPDAGPIVVHCSAGVGRTGCFIVIDSMLERLRHEETVDIYGHVTVLRTQRNYMVQTQEQYIFSHDAILEAVSCGNTEVHARNLLHHIKKLTEL---GKGEVTGLEEEFKVVDPSQAKKHKYG---------AATLAINRPKNRLANILPYETTRVHISPVRGVEGSDYINASFIDGYRQRGLFIATQGPLQDTVDDFWRMLMEQNSNIIVMLTQLHEGEWEKCYKYWPTDRSARHQYYIVDPIAEHEYPQFVIRDFKVKDARSDTVRNIKQFHFLGWPETGVPKSGEGIIDLIGQVQRAYEQQEEEGPITVHCSDGVGRTGVFTALFIVLERMRSEGVVDLFQTVKLLRTQRPAMVQSQEQYLFCYKTALEYLGSFD 1870          

HSP 2 Score: 124.405 bits (311), Expect = 3.107e-28
Identity = 203/936 (21.69%), Postives = 370/936 (39.53%), Query Frame = 1
Query:  364 MILACSSTGHPVPSISWKINESPIEELKSPLKKLQNPPRIFSIKNYQNSVLVITQLIESDSNSVLICEAENNAG--FDSRQQQLKV-ISTETDIPSGFPVFQNNFFPIIKPYNSNVTLVCQAYGNPPPLIQWFKNYELINESFTKIKILNDGNLLLVQVTREDKGIYHCQAQNTNGLRLSDPSTLDITSYPISPNSLIIERFASDNVEISWRS-GLNDVTEQENFILHYREVPENITEKQIMSKFVYLTISEKKSIYKYNLKDLFPFTTYCIWMESENPLGVSPPTIALTVKTLPTSPQLSPRSITATSISNTAILVAWRPPERKFGKFKYYQIIYTNNDGFLPQHWRQFAVKDDNVMLTHLIASELYHIRVKIVNEIGHGPLSKTISIKTIAGTLSQCPDFKITEIFQSHIKLQWGTPDPVKLFKLIQYNLLCWDVRLKIVNATAKSSTLFPILNHNLSMNEMEYVLYLKNEKEIKCRLSAINSDGKG-MPTEIQAST-VNKGVNYQNLIHIDKIGSTYITFQWRPPSKFSFDYFLWIYQIFDSEKLDRAVKLPKIKINISDSASAENGWFVYNYTNAFSSSRYILGLRYLCRDSTDILREYVHRSDLVSTMKSVPSDSPKDLVVKEIDSNSALVSWKPLDQVHSNGIITHYEVRY----------YAPKKEESTERFINVSETSAILSNLKYFHYVIYVRAFTKVGGGSWSNPKNYYRQNLEEFPIPTTIKGERKSE---TEINISWELPVLSEKNLAHAAIEGFIILYAPV--------ESSPKWIKYTVQSKNLSAVIKGLEPDLRYQFQIAATNYAGFNGNFSEIVQEMPKNFPNLNLKTVPDLRCSVQSSNRLKVEWSSPSI---STDLLKFEIRYSGNLSYITEIGLKKSEFIDMESKSVNFETLVNRYDVTLENLQSNALYKIAVRAI 3081
            +   C++ G P P+I+W  +  PI         + N PR+  + + +   L IT L ESD N    C A N  G  F S+    ++ I     +    P F           +++V L C A G+P P I W  +   I+          +G L++  + R   G Y C A +  G R+   + + +   P +P+        SD ++I+W   G + VT  E   + YR          +  K  +  I+  + +    +  L PF++Y   + + N LG S P++     T  T P  +PR+I A  +S+T+    W PP    G+ + Y++ Y+ +       WR  A   ++  +T L     +  R+   N  G GPLS+ +++KT  G   Q    +++ +  + I++ W  P      +     +  +DV         KS      +     MN  E ++ L      K  ++A +  G G M   + A T  ++  +    I      ST +   W PP     +  +  + I    K  R  K   + ++ + ++       V +  + F++  Y + ++   +       +       VST + VP+ +P+D+ ++  +S +  V W P      +G I  Y V Y            P + ES +     +    +        Y I V A+T  G G+ S  +    + + + P P  +  ER S    +++ ++W       +  A   IE + + YA          + + K  +   +S       + L   + Y F ++    AG++   S  ++  P       L    ++R    SS  ++V WS+P I      +L + + Y+             ++  D+  K+V   T  N + V L+ L+    Y++ VRAI
Sbjct:  119 VTFTCAAVGTPTPNITWFKDRLPI---------VLNDPRVSVLSDGRK--LRITDLRESD-NGKYSCVARNALGMVFSSQAMPARLFIYLTLSVVRSKPEFTLRPQDKTVDPDTDVELKCSARGSPTPSIVWEVDGSRISG--------QNGELIIRGIQRS--GNYSCIADSNMG-RVQAYAYVTVRLLPFAPSRPNAASITSDAIKITWHPRGAHVVTSYE---VQYR----------LKGKTEWQEITNVRGMQSLVVSGLRPFSSYEFRVFAVNSLGRSRPSLMAEYTTSETKPGSAPRNIEAMGVSDTSFKAGWLPPISANGRIRGYRLYYSLDLLEDISQWRFMASSTNSTTVTGLTRQTTHFFRILAYNIAGDGPLSEVVAVKTQKGVPGQPRSVQLSVLSSTAIRVTWSPP------RYPGDGIFGYDVYYN------KSKQDMDTVIGAFQMNTKE-IMGLTPYTVYKVAVAAKSDKGVGPMSFVLTARTDEDRPSDAPQNIQGRSRDSTTLEISWDPPRPEHRNGLITHFTIKYRAKGQRGAKY--LTVDATKTS------VVLHNLDKFTN--YFIWVQASTKQGDGPFSD----KHTVSTAEDVPNGAPRDVRIRVHNSTTMTVKWNP-PTTKQDGKILGYMVFYTRVDDQGNQLRPPAQPESKDSMSEENHKVHLTGLAPETTYQIEVAAYTIKGDGARSVTR--LAKTMAQSPDPPFVYLERASGDPISDVTLAW-------RTSATGVIE-YKVRYAKSVRRLRGRDQGNLKMKEIKFKSHTTKQKFQSLANGIWYLFNVSLRTKAGWSPETSRWIEIPPGPPSGPPL----NVRAVAVSSTSVEVTWSAPDIWNRGGPILGYSVMYN-----------PANKRGDVTVKNV---TSPNIFKVVLKRLKKFREYEVRVRAI 962          

HSP 3 Score: 81.6481 bits (200), Expect = 2.967e-15
Identity = 238/1139 (20.90%), Postives = 426/1139 (37.40%), Query Frame = 1
Query:  313 PKISLIIQSPNVLLFKSMILACSSTGHPVPSISWKINESPIEELKSPLKKLQNPPRIFSIKNYQNSVLVITQLIESDSNSVLICEAENNAGFDSRQQQ-----LKVISTETDIPSGFPVFQNNFFPIIKPYNSNVTLVCQAYGNPPPLIQWFKNYELINESFTKIKILNDGNLLLVQVTREDKGIYHCQAQNTNGLRLSDPSTL-DITSYPISPNSLIIERFASDNVEISWRSGLNDVTEQENFILHYR-----EVPENITEKQIMSKFVYLTISEKKSIYKYNLKDLFPFTTYCIWMESENPLGVSPPTIALTVKTLPTSPQLSPRSITATSISNTAILVAWRPPERKFGKFKYYQIIYTNNDGFLPQHWRQFAVKDDNVMLTHLIASELYHIRVKIVNEIGHGPLSKTISIKTIAGTLSQCP-DFKITEIFQSHIKLQWGTPDPVKLFKLIQYNLLCWDVRLK------IVNATAKSSTLFPILNHNLSMNEMEYVLYLKNEKEIKCRLSAINSDG--KGMPTEIQASTVNKGVNYQNLIHIDKIGSTYITFQWRPPSKFSFDYFLWIYQIFDSEKLDRAVKL-PKIKINISDSASAENGWF--------------VYNYTNAFSSSRYILGLRYLCRDSTDILREYVHRS--DLVSTMKSVPSDSPKDLVVKEIDSNSALVSWKPLDQVHSNGIITHYEVRYYAPKKEESTERFINVSETSAILSNLKYFHYVIYVRAFTKVGGGSWSNPKNYYRQ--NLEEFPIPTTIKGERKSETEINISWELPVLSEKNLAHAAIEGFIILYAPVESSPKWIKYTVQSKNL-SAVIKGLEPDLRYQFQIAATNYAGFNGNFSEIVQEMPKNFPNLNLKTVPDLRCSVQSSNRLKVEWSSPSISTDLLKFEIRYSGNLSYITEIGLKKSEFIDMESKSVNFETLVNRYDVTLENLQSNALYKIAVRAIYQNKELYESHRETTCDTMPAVPNLVKPPIIVGLDEEKSKVIIKLHRCSQRNGKISYYFVIVAAFQGNKNQQISFQEDTESYTFMELSVNTRSNNAKGE---YIAIMKDINDIFKVSGKDHSSVLLGDGTHDENHLSVNKKLEKNFNYRCFARVCLKYSNNSLC-KSSPWSEPFRIS 3597
            P+ +L  Q   V     + L CS+ G P PSI W+++ S I                      QN  L+I  +  S + S   C A++N G   R Q      ++++      P+   +  +       P  ++V    +         +W        +  T ++ +     L+V   R     Y  +    N L  S PS + + T+    P S      A    + S+++G          I  YR     ++ E+I++ + M+           S     +  L   TT+   + + N  G  P +  + VKT    P   PRS+  + +S+TAI V W PP         Y + Y  +   +      F +    +M   L    +Y + V   ++ G GP+S  ++ +T     S  P + +      + +++ W  P P     LI +  + +  + +       V+AT  S  L     HNL     ++  Y      I  + S    DG      T   A  V  G      I +    ST +T +W PP+    D  +  Y +F +   D+  +L P  +    DS S EN                 V  YT     +R +  L      S D    Y+ R+  D +S +      S   ++  ++    ++   +  DQ    G +   E+++   K   + ++F +       L+N  ++ + + +R  TK G   WS   + + +         P  ++    S T + ++W  P +  +      I G+ ++Y P           V S N+   V+K L+    Y+ ++ A    G  G  SE   +  K     + +   D+R     S+ + +EW  P I   +          L++  E+   + + +  + ++   + LV     T+    SNA+ +   RA            E +  T    P  +  P ++  +     + ++LHR S++NG ISYY V+V     +K+ +     + + Y F +  V  RS    G+   YIA  K + D F          L+GD      +   NK+L  N  Y  F+R  ++  +      SSP+++P  I+
Sbjct:  205 PEFTLRPQDKTVDPDTDVELKCSARGSPTPSIVWEVDGSRISG--------------------QNGELIIRGIQRSGNYS---CIADSNMG---RVQAYAYVTVRLLPFAPSRPNAASITSDAIKITWHPRGAHVVTSYEVQYRLKGKTEW--------QEITNVRGMQS---LVVSGLRPFSS-YEFRVFAVNSLGRSRPSLMAEYTTSETKPGSAPRNIEAMGVSDTSFKAGWLPPISANGRIRGYRLYYSLDLLEDISQWRFMAS----------STNSTTVTGLTRQTTHFFRILAYNIAGDGPLSEVVAVKTQKGVPG-QPRSVQLSVLSSTAIRVTWSPPRYPGDGIFGYDVYYNKSKQDMDTVIGAFQMNTKEIM--GLTPYTVYKVAVAAKSDKGVGPMSFVLTARTDEDRPSDAPQNIQGRSRDSTTLEISWDPPRPEHRNGLITHFTIKYRAKGQRGAKYLTVDATKTSVVL-----HNLD----KFTNYF-----IWVQASTKQGDGPFSDKHTVSTAEDVPNGAPRDVRIRVHN--STTMTVKWNPPTTKQ-DGKILGYMVFYTRVDDQGNQLRPPAQPESKDSMSEENHKVHLTGLAPETTYQIEVAAYTIKGDGARSVTRLAKTMAQSPDPPFVYLERASGDPISDVTLAWRTSATGVIEYKVRYAKSVRRLRGRDQ----GNLKMKEIKF---KSHTTKQKFQS-------LANGIWYLFNVSLR--TKAG---WSPETSRWIEIPPGPPSGPPLNVRAVAVSSTSVEVTWSAPDIWNRG---GPILGYSVMYNPANKRGDVTVKNVTSPNIFKVVLKRLKKFREYEVRVRAIGMLGM-GPASEPFIDRTKEDGKCHCR---DVRPRTVGSDWVILEWLPPRIDAGI-------DTPLTHADEV---RVDALTADVQTFKVQGLVPHMKYTVRLSASNAMGE-GPRA------------ELSISTKKGKPPALAKPTMLRDEMNNGLIPVELHRASEKNGPISYYLVVVVPL--DKDGKYPQGSNPDEY-FKK--VRRRSAREAGQVKPYIA-AKFLADQFP------KKFLVGDEGFKNQYGYYNKRLVANSYYTVFSRAYVQTDDGDFVYTSSPFTDPVLIT 1214          

HSP 4 Score: 75.485 bits (184), Expect = 2.506e-13
Identity = 54/178 (30.34%), Postives = 83/178 (46.63%), Query Frame = 1
Query:  370 LACSSTGHPVPSISWKINESPIEELKSPLKKLQNPPRIFSIKNYQNSVLVITQLIESDSNSVLICEAENNAGFDSRQQQLKVISTETDIPSGFPVFQNNFFPIIKPYNS--NVTLVCQAYGNPPPLIQWFKNYELINESFTKIKILNDGNLLLVQVTRE-DKGIYHCQAQNTNGLRLS 894
            + C+ TG P+P+++W  N S I        ++Q    IF++      ++ I  L      +   CEA+N  G   R     ++ T +  P+GFP    +  P  K   S  +VT  C A G P P I WFK+   I  +  ++ +L+DG  L +   RE D G Y C A+N  G+  S
Sbjct:   20 MICNVTGSPMPTLTWYKNGSVIRN-----SRIQ----IFTMP--YGGLIRIGPLRAKIHKATYECEADNGVGPPLRDSSTLIVHTASTKPAGFPRIAKH--PSFKQRRSGDDVTFTCAAVGTPTPNITWFKDRLPIVLNDPRVSVLSDGRKLRITDLRESDNGKYSCVARNALGMVFS 184          
BLAST of Protein tyrosine phosphatase receptor type D vs. Ensembl Nematostella
Match: EDO43854 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXI9])

HSP 1 Score: 516.924 bits (1330), Expect = 6.074e-165
Identity = 261/564 (46.28%), Postives = 367/564 (65.07%), Query Frame = 1
Query: 4138 EFETLNTNLDDRFTWQRSNIDSNKSKNRYANVVAYDHTSVLLTPVDDVIGSDYINANYIDGYQRQNAYIATQGPLPDTTDDFWRMVWEQRSNCIVMMTRLEERSGIKCHQYWPNRGFICYGQMIVSHIDTFVLAYYTIRLFEIRHSKYSEK-REIQHFQFTAWPDHGVPKLSTPLLMFIRRVRSIGKIESCPKIVHCSAGVGRTGAFIVVDAQLERIKQEKNIDVFNYVSKIRCQRNYMVQTQAQYQFILETLLEAVEDGNTEVMACNFHAHVTKLSQIGIS-GSNQLSGFEMEFSKLNSLASNRGRHGVMLADFVKAAGNQAVNMTKNRVRNIIPYEWNRVVLNAIRGIEGSDYINASYIDGYRDRRAYIAAQSPIPSTVEDFWRMLWDQHCGVVIVLNQPHED---KSHIYWPINKSIRYQFFVVDPVVEYNMPNYILREFKVTDARDGEFRALRQFQFTQWPNHGCPKESESILDFIRQVHKTKEQFGHMEPMVIHCNTGSGRTGVFIALSIVLDRLQQESVVDMYQTVKLLHKQRIGLVQTEEQYEFCYMAVLDYLSNYE 5814
            E+E +  N D+ FTW  S   +NK KNRYAN+VAYDH+ VLLTP++ V+ SDYINANYIDGY R  A+IA+QGPLP+T DDFWRMVWEQ S  IVM+T+LEER   KC QYWP+RG   YG + V+  +TF ++YY +R F + H +  E+ R+++ + +T+WPDHGVP    PLL  +R V S     + P IVHCSAGVGRTG FI +D+ L+R  QE  IDVF +V ++R +RN MVQT++QY FI + L+EAV  G TEV A    + + +L ++  + G+  +   ++EF +L    +   RH          +   + N  KNR  NI+PYE  RV L+   G  GSDYINAS+IDG    +AYIA Q+P+P T EDFWRMLW+Q   V+++L +  E    K H YWP + S  Y   +V+   E    +Y+LR+F +T   +   R +RQFQ T WP+ G P+    ++D I QV K ++Q G+   + +HC+ G GRTGVF A+SI+++R++ E ++D++QTV+ L  QR  +VQT++QYEFCY  + +YL +++
Sbjct:   25 EYEMVQPN-DETFTWHHSLHPANKYKNRYANIVAYDHSRVLLTPLEGVLESDYINANYIDGYNRSGAFIASQGPLPETFDDFWRMVWEQGSAIIVMLTQLEERGRRKCDQYWPDRGTRNYGALRVTANETFHMSYYVLRTFLVSHMQEEEEPRQVRQYHYTSWPDHGVPAHPAPLLSMVRTVSSANPPTAGPMIVHCSAGVGRTGTFITLDSMLQRAAQEGTIDVFGFVRQMRNKRNLMVQTESQYVFIHDALVEAVICGVTEVDANKLASRIRELREVDPNIGTTYM---DLEFERL----TRDERHPTQF-----KSAMLSCNAAKNRYANILPYERTRVALHMRPGEVGSDYINASFIDGNHRLKAYIATQAPVPRTFEDFWRMLWEQESAVIVMLTREEEAGKLKCHRYWPSDGSRLYDKILVELTEELTYSDYVLRQFSLTHTEEKSSRIVRQFQCTDWPDSGLPESGVGLIDLIGQVEKWQQQSGNT-CITVHCSGGVGRTGVFCAVSILIERVKAEGLIDVFQTVQHLRLQRPAMVQTKDQYEFCYTTIQEYLESFD 574          

HSP 2 Score: 220.705 bits (561), Expect = 5.219e-61
Identity = 115/275 (41.82%), Postives = 160/275 (58.18%), Query Frame = 1
Query: 4123 TLLQAEFETLNTNLDDRFTWQRSNIDSNKSKNRYANVVAYDHTSVLLTPVDDVIGSDYINANYIDGYQRQNAYIATQGPLPDTTDDFWRMVWEQRSNCIVMMTRLEERSGIKCHQYWPNRGFICYGQMIVSHIDTFVLAYYTIRLFEIRHSKYSEKREIQHFQFTAWPDHGVPKLSTPLLMFIRRVRSIGKIESCPKI-VHCSAGVGRTGAFIVVDAQLERIKQEKNIDVFNYVSKIRCQRNYMVQTQAQYQFILETLLEAVEDGNTEVMACNFH 4944
            T +  EFE L  +      ++ + +  N +KNRYAN++ Y+ T V L      +GSDYINA++IDG  R  AYIATQ P+P T +DFWRM+WEQ S  IVM+TR EE   +KCH+YWP+ G   Y +++V   +    + Y +R F + H++    R ++ FQ T WPD G+P+    L+  I +V    +      I VHCS GVGRTG F  V   +ER+K E  IDVF  V  +R QR  MVQT+ QY+F   T+ E +E  +   +  NFH
Sbjct:  309 TYMDLEFERLTRDERHPTQFKSAMLSCNAAKNRYANILPYERTRVALHMRPGEVGSDYINASFIDGNHRLKAYIATQAPVPRTFEDFWRMLWEQESAVIVMLTREEEAGKLKCHRYWPSDGSRLYDKILVELTEELTYSDYVLRQFSLTHTEEKSSRIVRQFQCTDWPDSGLPESGVGLIDLIGQVEKWQQQSGNTCITVHCSGGVGRTGVFCAVSILIERVKAEGLIDVFQTVQHLRLQRPAMVQTKDQYEFCYTTIQEYLESFD---LYANFH 580          
BLAST of Protein tyrosine phosphatase receptor type D vs. Ensembl Nematostella
Match: EDO45382 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RT25])

HSP 1 Score: 504.597 bits (1298), Expect = 2.209e-160
Identity = 257/579 (44.39%), Postives = 366/579 (63.21%), Query Frame = 1
Query: 4090 QYVTDLKANDCTLLQAEFETLNTNLDDRFTWQRSNIDSNKSKNRYANVVAYDHTSVLLTPVDDVIGSDYINANYIDGYQRQNAYIATQGPLPDTTDDFWRMVWEQRSNCIVMMTRLEERSGIKCHQYWPNRGFICYGQMIVSHIDTFVLAYYTIRLFEIRHSKYSEKREIQHFQFTAWPDHGVPKLSTPLLMFIRRVRSIGKIES-CPKIVHCSAGVGRTGAFIVVDAQLERIKQEKNIDVFNYVSKIRCQRNYMVQTQAQYQFILETLLEAVEDGNTEVMACNFHAHVTKLSQIGISGSNQLSGFEMEFSKLNSLASNRGRHGVMLADFVKAAGNQAVNMTKNRVRNIIPYEWNRVVLNAIRGIEGSDYINASYIDGYRDRRAYIAAQSPIPSTVEDFWRMLWDQHCGVVIVLNQPHED---KSHIYWPINKSIRYQFFVVDPVVEYNMPNYILREFKVTDARDGEFRALRQFQFTQWPNHGCPKESESILDFIRQVHKTKEQFGHMEPMVIHCNTGSGRTGVFIALSIVLDRLQQESVVDMYQTVKLLHKQRIGLVQTEEQYEFCYMAVLDYLSNYE 5814
            ++V  L AN   L   E+    +   D  T   S   +N+ KNRY N+ A+DH  VLL P++    SDYINANY+DGY++Q  YIA QGPLP+T  DFWRMVWEQ S  IVM+T  EER  IKCHQYWP+ G   YG + V+ + T  L+ YTIR F ++ S   E+R +  + +TAWPDHGVP   T +L F+R+  ++   E   P +VHCSAGVGRTG ++V+DAQL+RI+ E  +DV+NYV  +R QRN MVQ + QY  I + LLEA+  G+TE+ A +    + +L  +  S     +  + EF +L+       R+    + F  A  N  VN  KNR  N++PY+  RV L      EGSDYINA+YIDGY  ++A+IA Q+PIP T+ DFWRM+W+Q C  +++L+Q  E    K H YWP  +       VV+ + +    +YI+REFKVT+ ++   R +RQ+QFT WP+ G P     ++D I QV + +++ G ++   +HC+ G GRTGVF A+SI+++RL+ E++VD++QTVK L +QR  +VQT+EQYEFCY  + +YL +++
Sbjct:    8 EHVRRLHANGELLFSQEYGAFRS--PDTVTSHHSLNQANRFKNRYNNITAFDHCRVLLQPIEGDPTSDYINANYLDGYRKQREYIAAQGPLPETCHDFWRMVWEQNSRVIVMVTNCEERGRIKCHQYWPSSGSQNYGVIHVNMMSTVELSDYTIRSFGVKRSGSPEERMVLQYHYTAWPDHGVPNSVTSVLNFVRKSSAVNLTEDYGPMVVHCSAGVGRTGTYVVIDAQLKRIQAEATVDVYNYVMMLRGQRNLMVQVEDQYVLIHDVLLEAIACGDTEIQARDLRQRIKEL--MRPSTDTGQTEMDAEFQRLS-------RNKAPPSKFQSA--NLPVNKHKNRYANVLPYDDTRVRLTMQAVTEGSDYINANYIDGYMSKKAFIATQAPIPDTIPDFWRMIWEQDCCTIVMLSQEMESGKVKVHRYWPGKQPTSIGNLVVEMLHDKQFDDYIMREFKVTNTKESASRVVRQYQFTAWPDIGSPDSGGGLIDLIGQVQRWQQKCG-VQLTAVHCSAGVGRTGVFCAVSILIERLKAEAMVDVFQTVKQLREQRPAMVQTKEQYEFCYQTLGEYLHSFD 572          
BLAST of Protein tyrosine phosphatase receptor type D vs. Ensembl Nematostella
Match: EDO48187 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RK45])

HSP 1 Score: 472.241 bits (1214), Expect = 1.254e-148
Identity = 242/588 (41.16%), Postives = 354/588 (60.20%), Query Frame = 1
Query: 4069 ISICNLYQYVTDLKANDCTLLQAEFETLNTNLDDRFTWQRSNIDSNKSKNRYANVVAYDHTSVLLTPVDDVIGSDYINANYIDGYQRQNAYIATQGPLPDTTDDFWRMVWEQRSNCIVMMTRLEERSGIKCHQYWPNRGFICYGQMIVSHIDTFVLAYYTIRLFEIRHSKYSEKREIQHFQFTAWPDHGVPKLSTPLLMFIRRVRSIGKIESCPKIVHCSAGVGRTGAFIVVDAQLERIKQEKNIDVFNYVSKIRCQRNYMVQTQAQYQFILETLLEAVEDGNTEVMACNFHAHVTKLSQIGISGSNQLSGFEMEFSKLNSLASNRGRHGVMLADFVKAAGNQAVNMTKNRVRNIIPYEWNRVVLNAIRGIEGSDYINASYIDGYRDRRAYIAAQSPIPSTVEDFWRMLWDQHCGVVIVLNQPHED---KSHIYWPINKSIRYQFFVVDPVVEYNMPNYILREFKVTDARDGEFRALRQFQFTQWPNHGCPKESES---ILDFIRQVHKTKEQFGHMEPMVIHCNTGSGRTGVFIALSIVLDRLQQESVVDMYQTVKLLHKQRIGLVQTEEQYEFCYMAVLDYLSNYE 5814
            ISI +  Q+V  ++ +       E+E +   + +  T   S    N+ KNRY N+VAYDH+ V L   +D  GSDYINAN++ GY+R NAYIA QGPL +T  DFWRMVWEQ S  I+M+T L+ER   KC QYWP+RG + Y  + V+      L  Y +R   ++     + R+++ F FT+WPDHGVP     LL F+R         + P +VHCSAGVGRTG FIV+D  L++I +EK +D+  +VS +R  RN MVQT+ QY FI + LL+A+  G TE  A +  +H+ +L +      +  SG+   F++   L+        + +     A    VN  KNR  N++PY+  RV L+   G+EGSDYINA+YIDGY  +R +IA Q+PIP T+ DFWRM+W+Q+C  ++ L Q  E    K H YWP  + I +   VV+   +    + ++R FK+T+      R +RQF +T W      ++  S   ++D I QV   + + G   P+++HC+ G GRTGVF A+SI+++RL+ E++VD++QTVK L +QR  +VQT+ QY+FCY  VL+YL+++E
Sbjct:    1 ISIDDFEQHVARMRRSGDLFFTTEYERIP--VPEHVTATHSLDPVNQHKNRYINIVAYDHSRVKLQDFEDEPGSDYINANFLPGYRRDNAYIAAQGPLAETCRDFWRMVWEQNSRTIIMLTNLKERCRDKCAQYWPSRGSLSYEDITVTLDSVTELTPYIVRTLSVQREGCDDVRQVKQFHFTSWPDHGVPTSVCNLLAFVRDSTRADPPGAGPMVVHCSAGVGRTGTFIVIDVMLQQIHEEKTVDILGFVSTLRRHRNLMVQTEQQYIFIHDALLDAIISGETETSASDLRSHIRRLQE-----QDPESGYTPMFTEFQKLSR------CINSSLSLNAATHPVNKRKNRYANVLPYDVTRVRLSMQVGVEGSDYINANYIDGYMAKRTFIATQAPIPETIPDFWRMVWEQNCCTIVTLAQEVEQAKAKMHRYWPGKQPITFGSLVVEMQDKVKSGHLVVRIFKLTNTEVSASRDVRQFHYTSWTEENPLEDGLSRCQLIDLIGQVQYWQAESGR-HPIIVHCSAGVGRTGVFCAVSILIERLKAEAMVDVFQTVKQLREQRPAMVQTKGQYDFCYQVVLEYLASFE 574          

HSP 2 Score: 179.489 bits (454), Expect = 3.288e-47
Identity = 100/251 (39.84%), Postives = 140/251 (55.78%), Query Frame = 1
Query: 5101 VNMTKNRVRNIIPYEWNRVVLNAIRGIEGSDYINASYIDGYRDRRAYIAAQSPIPSTVEDFWRMLWDQHCGVVIVLNQPHE---DKSHIYWPINKSIRYQFFVV--DPVVEYNMPNYILREFKVTDARDGEFRALRQFQFTQWPNHGCPKESESILDFIRQVHKTKEQFGHMEPMVIHCNTGSGRTGVFIALSIVLDRLQQESVVDMYQTVKLLHKQRIGLVQTEEQYEFCYMAVLDYLSNYEKILEKSHL 5838
            VN  KNR  NI+ Y+ +RV L       GSDYINA+++ GYR   AYIAAQ P+  T  DFWRM+W+Q+   +I+L    E   DK   YWP   S+ Y+   V  D V E  +  YI+R   V      + R ++QF FT WP+HG P    ++L F+R    T+       PMV+HC+ G GRTG FI + ++L ++ +E  VD+   V  L + R  +VQTE+QY F + A+LD + + E     S L
Sbjct:   43 VNQHKNRYINIVAYDHSRVKLQDFEDEPGSDYINANFLPGYRRDNAYIAAQGPLAETCRDFWRMVWEQNSRTIIMLTNLKERCRDKCAQYWPSRGSLSYEDITVTLDSVTE--LTPYIVRTLSVQREGCDDVRQVKQFHFTSWPDHGVPTSVCNLLAFVRD--STRADPPGAGPMVVHCSAGVGRTGTFIVIDVMLQQIHEEKTVDILGFVSTLRRHRNLMVQTEQQYIFIHDALLDAIISGETETSASDL 289          
BLAST of Protein tyrosine phosphatase receptor type D vs. Ensembl Nematostella
Match: EDO31736 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SX30])

HSP 1 Score: 435.261 bits (1118), Expect = 2.709e-135
Identity = 229/584 (39.21%), Postives = 350/584 (59.93%), Query Frame = 1
Query: 4069 ISICNLYQYVTDLKANDCTLLQAEFETLNTNLDDRFTWQRSNIDSNKSKNRYANVVAYDHTSVLLTPVDDVIGSDYINANYIDGYQ-RQNAYIATQGPLPDTTDDFWRMVWEQRSNCIVMMTRLEERSGIKCHQYWPNRGFICYGQMIVSHIDTFVLAYYTIRLFEIRHSKYSEKREIQHFQFTAWPDHGVPKLSTPLLMFIRRVRSIGKIESCPKIVHCSAGVGRTGAFIVVDAQLERIKQEKNIDVFNYVSKIRCQRNYMVQTQAQYQFILETLLEAVEDGNTEVMACNFHAHVTKLSQIGISGSNQLSGFEMEFSKLNSLASNRGRHGVMLADFVKAAGNQAVNMTKNRVRNIIPYEWNRVVLNAIRGIEGSDYINASYIDGYRDRRAYIAAQSPIPSTVEDFWRMLWDQHCGVVIVLNQPHE-DKSHI-YWPINKSIRYQFFVVDPVVEYNMPNYILREFKVTDARDGEFRALRQFQFTQWPNHGCPKESESILDFIRQVHKTKEQFGHMEPMVIHCNTGSGRTGVFIALSIVLDRLQQESVVDMYQTVKLLHKQRIGLVQTEEQYEFCYMAVLDYLSNY 5811
            I I    +YV  ++AN    L+ E++  +     +F W+ +   +NK+KNRYAN+VAYDH+ V+L  V+    SDYINA++I GY     ++IA+QGPLP   +DFWRMVWEQ S  IVM+T L E    KCH+YWP++    YG + V+   + + A Y IR F +  +K S  R ++ F FT WPD GVP+ +T +L F R+VR++   ++ P IVHCSAGVGRTGA+IV+DA LE+ K+ + +D+ NY+  +R  R +MVQT+ QY FI   +LEA+  GNTE+ + N +  + KL+   ++   Q++G+ +EF K ++     G+       F   A  +  N  KNR  NI+ Y+ +R+VL  + G E SDYINAS+I  +R R A+IA Q P+  TVEDFWRM+ D   G +++LN  HE D+ +  YWP +   +Y    V  + +    + I  + KVT  +      +R      WP+   P+ + S+LD + +   +++Q G+  P+++ C+ G GR+G F A+S VL+RL+ E V+D++Q +K +     G V++  QY FCY  +  YL ++
Sbjct:    2 IPIALFPEYVAKMQANGGIRLETEYKKFDNG--QQFPWEAARKPANKNKNRYANIVAYDHSRVVLERVNGDEDSDYINASFIHGYDGTPRSFIASQGPLPPAFEDFWRMVWEQNSQSIVMLTNLVELGKTKCHKYWPDKTET-YGGVTVTLHQSEIFAEYEIRTFILSKAKQSGSRMVRQFHFTVWPDKGVPQYATAVLAFRRKVRALNPRDAGPVIVHCSAGVGRTGAYIVIDAMLEQAKKSRTVDIRNYLIALRKDRPHMVQTKEQYSFIHSAVLEALTCGNTEIQSENCNQAMQKLA--SVNRKFQMTGYALEFQKFDN-----GQQ------FPWEAARKPANKNKNRYANIVAYDHSRLVLERVNGNEDSDYINASFIHAHRGRNAFIATQHPLLETVEDFWRMVTDYDIGTIVMLNNLHELDQEYPKYWPDHGPTKYGHIGVSVLSKQEQGDVICTKLKVTRKKVRRTHEVRHLHHVSWPDKCIPEVACSVLDLLDEAQTSQQQCGNA-PVLVQCSNGVGRSGTFCAISSVLERLKTEQVIDVFQVIKRIRVNLPGAVESPTQYMFCYQIIQKYLDSF 568          
BLAST of Protein tyrosine phosphatase receptor type D vs. Ensembl Medaka
Match: PTPRD (receptor-type tyrosine-protein phosphatase delta [Source:NCBI gene;Acc:101165843])

HSP 1 Score: 714.146 bits (1842), Expect = 0.000e+0
Identity = 333/606 (54.95%), Postives = 437/606 (72.11%), Query Frame = 1
Query: 4006 SDSIKLRIGSQKSENISDRPSISICNLYQYVTDLKANDCTLLQAEFETLNTNLDDRFTWQRSNIDSNKSKNRYANVVAYDHTSVLLTPVDDVIGSDYINANYIDGYQRQNAYIATQGPLPDTTDDFWRMVWEQRSNCIVMMTRLEERSGIKCHQYWPNRGFICYGQMIVSHIDTFVLAYYTIRLFEIRHSKYSEKREIQHFQFTAWPDHGVPKLSTPLLMFIRRVRSIGKIESCPKIVHCSAGVGRTGAFIVVDAQLERIKQEKNIDVFNYVSKIRCQRNYMVQTQAQYQFILETLLEAVEDGNTEVMACNFHAHVTKLSQIGISGSNQLSGFEMEFSKLNSLASNRGRHGVMLADFVKAAGNQAVNMTKNRVRNIIPYEWNRVVLNAIRGIEGSDYINASYIDGYRDRRAYIAAQSPIPSTVEDFWRMLWDQHCGVVIVLNQPHE---DKSHIYWPINKSIRYQFFVVDPVVEYNMPNYILREFKVTDARDGEFRALRQFQFTQWPNHGCPKESESILDFIRQVHKTKEQFGHMEPMVIHCNTGSGRTGVFIALSIVLDRLQQESVVDMYQTVKLLHKQRIGLVQTEEQYEFCYMAVLDYLSNYE 5814
            +D ++LR  + ++  +++ P I I  L  ++  LKAND      E+E+++     +FTW+ SN++ NK KNRYANV+AYDH+ +LL+ +D + GSDYINANYIDGY++QNAYIATQGPLP+T  +FWRM+WEQRS  +VMMT+LEERS +KC QYWP RG   YG + VS +DT  LA Y +R F +  +  SEKRE++ FQFTAWPDHGVP+  TP L F+RRV++    ++ P +VHCSAGVGRTG FIV+DA LER K EK +D++ +V+ +R QRNYMVQT+ QY FI + LLEAV  G TEV A N +A++ KL+Q  I G   ++G E+EF +L +  ++  R       F+ A  N   N  KNR+ NI+PYE  RV L  IRG+EGSDYINAS+IDGYR ++AYIA Q P+  T EDFWRMLW+ +  +V++L +  E   +K H YWP  +S RYQ+FVVDP+ EYNMP YILREFKVTDARDG+ R +RQFQFT WP  G PK  E  +DFI QVHKTKEQFG   P+ +HC+ G GRTGVFI LSIVL+R++ E VVD++QTVK+L  QR  +VQTE+QY+FCY A L+YL +++
Sbjct: 1325 TDPVELRRLNFQTPGMANHPPIPISELADHLERLKANDNLKFSQEYESIDPA--QQFTWEHSNLEVNKPKNRYANVIAYDHSRILLSAIDGIPGSDYINANYIDGYRKQNAYIATQGPLPETFGEFWRMIWEQRSAVVVMMTKLEERSRVKCDQYWPTRGTETYGLIQVSLLDTVELATYCVRTFSLFKNGSSEKREVRQFQFTAWPDHGVPEHPTPFLAFLRRVKACNPPDAGPMVVHCSAGVGRTGCFIVIDAMLERNKHEKTVDIYGHVTLMRAQRNYMVQTEDQYVFIHDALLEAVNCGTTEVPARNLYAYIQKLTQ--IEGGENVTGMELEFKRLANTKAHTSR-------FISA--NLPCNKFKNRLVNIMPYESTRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDQYQFCYRAGLEYLGSFD 1917          

HSP 2 Score: 207.608 bits (527), Expect = 4.069e-53
Identity = 106/262 (40.46%), Postives = 154/262 (58.78%), Query Frame = 1
Query: 5092 NQAVNMTKNRVRNIIPYEWNRVVLNAIRGIEGSDYINASYIDGYRDRRAYIAAQSPIPSTVEDFWRMLWDQHCGVVIVLNQPHEDKSHI----YWPINKSIRYQFFVVDPVVEYNMPNYILREFKVTDARDGEFRALRQFQFTQWPNHGCPKESESILDFIRQVHKTKEQFGHMEPMVIHCNTGSGRTGVFIALSIVLDRLQQESVVDMYQTVKLLHKQRIGLVQTEEQYEFCYMAVLDYLSNYEKILEKSHLY*TYQDLSE 5865
            N  VN  KNR  N+I Y+ +R++L+AI GI GSDYINA+YIDGYR + AYIA Q P+P T  +FWRM+W+Q   VV+++ +  E++S +    YWP   +  Y    V  +    +  Y +R F +      E R +RQFQFT WP+HG P+     L F+R+V           PMV+HC+ G GRTG FI +  +L+R + E  VD+Y  V L+  QR  +VQTE+QY F + A+L+ ++     +   +LY   Q L++
Sbjct: 1385 NLEVNKPKNRYANVIAYDHSRILLSAIDGIPGSDYINANYIDGYRKQNAYIATQGPLPETFGEFWRMIWEQRSAVVVMMTK-LEERSRVKCDQYWPTRGTETYGLIQVSLLDTVELATYCVRTFSLFKNGSSEKREVRQFQFTAWPDHGVPEHPTPFLAFLRRVKACNPP--DAGPMVVHCSAGVGRTGCFIVIDAMLERNKHEKTVDIYGHVTLMRAQRNYMVQTEDQYVFIHDALLEAVNCGTTEVPARNLYAYIQKLTQ 1643          

HSP 3 Score: 130.568 bits (327), Expect = 1.104e-29
Identity = 195/887 (21.98%), Postives = 338/887 (38.11%), Query Frame = 1
Query:  313 PKISLIIQSPNVLLFKSMILACSSTGHPVPSISWKINESPIEELKSPLKKLQNPPRIFSIKNYQNSVLVITQLIESDSNSVLICEAENNAGFD-SRQQQLKVISTETDIPSGFPVFQNNFFPIIKPYNSNVTLVCQAYGNPPPLIQWFKNYELINESFTKIKILNDGNLLLVQVTREDKGIYHCQAQNTNGLRLSDPSTLDITSYPISPNSLIIERFASDNVEISWRSGLNDVTEQENFILHYREVPENITEKQIMSKFVYLTISEKK----SIYKYNLKDLFPFTTYCIWMESENPLGVSPPTIALTVKTLPTSPQLSPRSITATSISNTAILVAWRPPERKFGKFKYYQIIYTNNDGFLPQHWRQFAVKDDNVMLTH-LIASELYHIRVKIVNEIGHGPLSKTISIKTIAGTLSQCPDFKITEIFQSHIKLQWGTPDPV-KLFKLIQYNLLCWDVRLKIVNATAKSSTLFPILNHNLSMNEMEYVLYLKNEKEIKCRLSAINSDGKGMPT-EIQAST--VNKGVNYQNLIHIDKIGSTYITFQWRPPSKFSFDYFLWIYQI--FDSEKLDRAVKLPKIKINISDSASAENGWFVYNYTNAFSSSRYILGLRYLCRDSTDILREYVHRSDLVSTMKSVPSDSPKDLVVKEIDSNSALVSWKPLDQVHSNGIITHYEVRYYAPKKEESTER--------------FINVSETSAILSNL-KYFHYVIYVRAFTKVGGGSWSNPKNYYRQN-LEEFP---IPTTIKGERKSETEINISWELPVLSEKNLAHAAIEGFIILYAPVESSPKWIKYTVQSKNLSAVIKGLEPDLRYQFQIAATNYAGFN-GNFSEIV--QEMPKNFPNLNLKTVPDLRCSVQSSNRLKVEW 2871
            P I +  Q   V   ++  + C+++G+P P ISW  +  P+    +  +          IK  ++  L I Q  ESD      C A NN G   S    L V           P   N   P       +V + C A G+P P ++W     L  E  T    +  G  +L     +    Y C A +T G+ +   + + + + P +P   ++    + ++ ++W SG                 PE +T   I  K  Y     K+    +  +Y++  L P++ Y   + + N +G  PP+ ++  KT   +P  +PR +    +S T  ++ W  PE   G+   Y++ YT +       W +  V+  N +  H LI ++ Y+I+V     +G GPLS  + I    G  SQ  DFK     ++ + L W TP    +  ++  Y L    +  K  +   K  +  P   + L          LK       RL+A +  G G  T EI A T    +       +      ST I   WR P     +  +  Y +    +E  D A +       IS+     + + + N              R      TD+         L+ T + VPS  P+ + V+ ++S+S  V W+       +G I  Y+V Y      E T +              F + +E   I++ L     Y + V A+T  G G+ S PK       + E P   + TT  G         + W  P ++     H  ++G+ + +   +  P  +    Q ++       +     Y F+++A N  GF      EI   +++P  +P        +++    +++ ++V W
Sbjct:  142 PTIDMGPQLKVVERTRTATMLCAASGNPDPDISWFKDFLPVNTSNNNGR----------IKQLRSGALQIEQSEESDQGKYE-CVATNNDGTRYSAPANLYVRVRRVPPRFSIPPTDNEIMP-----GGSVNITCVAVGSPMPYVKWM----LGAEDLTPEDDMPIGRNVLELTDVQQSANYTCVAMSTLGV-IEAVAQITVKALPKAPGIPVVTERTATSITLTWDSG----------------NPEPVTYYIIQHKSKYSDDLYKEINGVATTRYSVGGLSPYSDYEFRVVAVNNIGRGPPSESIEAKTAEQAPSTAPRHVRGHMMSATTAVIQWDEPEEANGQIMGYRVYYTMDPTQHVNIWEKQIVRGSNFVTIHGLIPNKTYNIKVLAYTSVGDGPLSPDLQIIAKTGVPSQPTDFKGEAKSETSVLLSWNTPSQTGQENQVTGYEL----IYRKRDDKEEKQISFEPTTTYLLKD--------LKPFTTYTFRLAARSKHGVGAYTSEISAETPQTPEPAGPPEEVKCSSPSSTKILVSWRAPPVELRNGIITQYTVSYAPTEGEDTAAR------QISNIPPESSQYLLENLEKWTE-------YRVTVTAHTDVGAGPESLPHLIRTEEDVPSGPPRKVEVEAVNSSSIKVIWRSPVPTKQHGQIRGYQVHYVRMVNGEPTGQPVIKDILIDDAQWEFEDSTEHEMIITGLMAETTYSVTVAAYTTKGDGARSKPKLITTTGAVPEKPRLMVSTTNMGTAL------LQWHPPAVT-----HGPLQGYRLRFGRKDVDPLTV-IEFQERDNHYTTSEIHKGASYTFRLSARNKVGFGEETVKEITTNEDVPSGYPQ-------NIKAEGATTSTIQVSW 947          

HSP 4 Score: 123.25 bits (308), Expect = 1.952e-27
Identity = 187/786 (23.79%), Postives = 294/786 (37.40%), Query Frame = 1
Query:  376 CSSTGHPVPSISWKINESPIEELKSPLKKLQNPP-RIFSIKNYQNSVLVITQLIESDSNSVLICEAENNAGFDSRQQQLKVISTETDIPSGFPVFQNNFFPIIKPYNSNVTLVCQAYGNPPPLIQWFKNYELINESFT--KIKILNDGNLLLVQVTREDKGIYHCQAQNTNGLRLSDPSTLDI------TSYPISPNSLIIERFASDNVE----------ISWRSGLNDVTEQENFILHYREVPENITEKQIMSKFVYLTISEKKSIYKYNLKDLFPFTTYCIWMESENPLGVSPPTIALTVKTLPTSPQLSPRSITATSISNTAILVAW---RPPERKF----GKFKYYQIIYTNNDGFLPQHWRQFAVKDDNVMLTHLIASELYHIRVKIVNEIGHGPLSKTISIKTIAGTLSQCPDFKITEIFQSHIK-LQWGTPDPVKLFKLIQYNLLCWDVRLKIVN----ATAKSSTLFPILNHNLSMNEMEYVLYLKNEKEIKCRLSAINSDGKGMPTEIQASTVNKGVNYQNLIHIDKIGS-TYITFQWRPPSKFSFDYFLWIYQIFDSEKLDRAVKLPKIKINISDSASAENGWFVYNYTNAFSSSRYILGLRYLCRDSTDILREYVHRSDLVSTMKSVPSDSPKDLVVKEIDSNSALVSWKPLDQVHSNGIITHYEVRYYAPKKEESTERFI-NVSETSA--ILSNL-KYFHYVIYVRAFTKVGGGSWSNPKNYYRQNLEEFP--IPTTIKGERKSETEINISWELPVLSEKNLAHAAIEGFIILY 2619
            C +TG P P I W              KK+ N    +    +   SVL I  L      ++  C A N  G  S   +L V+  E  +P GFP         +       T++C A GNP P I WFK++  +N S    +IK L  G L + Q    D+G Y C A N +G R S P+ L +        + I P    I    S N+           + W  G  D+T +++       +  N+ E         LT  ++ + Y             C+ M +   LGV      +TVK LP +P +       T  + T+I + W    P    +     K KY   +Y   +G          V      +  L     Y  RV  VN IG GP S++I  KT     S  P      +  +    +QW  P+     +++ Y +       + VN       + S    I  H L  N           K    ++ A  S G G  +         GV  Q      +  S T +   W  PS+   +  +  Y++   ++ D+  K    +I+   + +     ++      F++  + L  R     S   +  Y       +     P+  P+++      S   LVSW+       NGIIT Y V Y   + E++  R I N+   S+  +L NL K+  Y + V A T VG G  S P  +  +  E+ P   P  ++ E  + + I + W  PV +++   H  I G+ + Y
Sbjct:   61 CQATGDPRPKIVWNKKG----------KKVSNQRFEVIEFDDGSGSVLRIQPLRTPRDEAIYECVASNTVGEISASTRLTVLR-EDQLPPGFPTIDMGPQLKVVERTRTATMLCAASGNPDPDISWFKDFLPVNTSNNNGRIKQLRSGALQIEQSEESDQGKYECVATNNDGTRYSAPANLYVRVRRVPPRFSIPPTDNEIMPGGSVNITCVAVGSPMPYVKWMLGAEDLTPEDDM-----PIGRNVLE---------LTDVQQSANYT------------CVAMST---LGVIEAVAQITVKALPKAPGIP----VVTERTATSITLTWDSGNPEPVTYYIIQHKSKYSDDLYKEING----------VATTRYSVGGLSPYSDYEFRVVAVNNIGRGPPSESIEAKTAEQAPSTAPRHVRGHMMSATTAVIQWDEPEEAN-GQIMGYRVYYTMDPTQHVNIWEKQIVRGSNFVTI--HGLIPN-----------KTYNIKVLAYTSVGDGPLSPDLQIIAKTGVPSQPTDFKGEAKSETSVLLSWNTPSQTGQENQVTGYELIYRKRDDKEEK----QISFEPTTT-----YLLKDLKPFTTYTFRLAAR-----SKHGVGAYTSEISAETPQTPEPAGPPEEVKCSSPSSTKILVSWRAPPVELRNGIITQYTVSYAPTEGEDTAARQISNIPPESSQYLLENLEKWTEYRVTVTAHTDVGAGPESLP--HLIRTEEDVPSGPPRKVEVEAVNSSSIKVIWRSPVPTKQ---HGQIRGYQVHY 759          

HSP 5 Score: 103.99 bits (258), Expect = 1.493e-21
Identity = 160/681 (23.49%), Postives = 269/681 (39.50%), Query Frame = 1
Query:  916 TSYPISPNSLIIERFASDNVEISWRSGLNDVTEQENFILHYREV---PENITEKQIMSKFVYLTISEKKSIYKYNLKDLFPFTTYCIWMESENPLGVSPPTIALTVKTLPT-SPQLSPRSITATSISNTAILVAWRPP--ERKFGKFKYYQIIYTNNDG--FLPQHWRQFAVKDDNVMLTHLIASELYHIRVKIVNEIGHGPLSKTISIKTIAGTLSQCP-DFKITEIFQSHIKLQWGTPDPVKLFKLIQYNLLCWDVRLKIVNATAKSSTLFPILNHNL---------SMNEMEYVLY-LKNEKEIKCRLSAINSDGKGMPTEIQASTVNKGVNYQNLIHIDKIGSTYITFQWRPPSKFSFDYFLWIYQI-FDSEKLDRAVKLPKIKINISDSASAENGWFVYNYTNAFSSSRYILGLRYLCRDSTDILREYVHRSDLVSTMKSVPSDSPKDLVVKEIDSNSALVSWKPLDQVHSNGIITHYEVRYYAPKKEES-TERFINVSETSAILSNLKY-FHYVIYVRAFTKVGGGSWSNPKNYYRQNLEEFPIPTTIKGERKSETEINISWELPVLSEKNLAHAAIEGFIILYAPVESSPKWIKYTVQSKNLSAVIKGLEPDLRYQFQIAATNYAGFNGNFSEIVQEMPKNFPNLNLKTVPDLRCSVQSSNRLKVEWSSPSIST 2892
            T  P  P     E  +  +V +SW +     T QEN +  Y  +    ++  EKQI   F   T         Y LKDL PFTTY   + + +  GV   T  ++ +T  T  P   P  +  +S S+T ILV+WR P  E + G    Y + Y   +G     +       +    +L +L     Y + V    ++G GP S    I+T     S  P   ++  +  S IK+ W +P P K    I+   + +   +++VN      T  P++   L            E E ++  L  E      ++A  + G G  ++ +  T    V  +  + +          QW PP+       L  Y++ F  + +D    L  I+    D+          +YT +          R   R+      E V     ++T + VPS  P+++  +   +++  VSW+P+     NG I  Y ++Y       S +E FI   E++ +L  L+    Y I + AFT  G G +S    +  Q +++             ++ + ++WE+P        +   + F ILY   +S        V  +    +I GL+P+ +Y F +  TN     G     V  M    P++ L+T P L     S   + VE   P++ T
Sbjct:  516 TGVPSQPTDFKGEAKSETSVLLSWNTPSQ--TGQENQVTGYELIYRKRDDKEEKQI--SFEPTTT--------YLLKDLKPFTTYTFRLAARSKHGVGAYTSEISAETPQTPEPAGPPEEVKCSSPSSTKILVSWRAPPVELRNGIITQYTVSYAPTEGEDTAARQISNIPPESSQYLLENLEKWTEYRVTVTAHTDVGAGPESLPHLIRTEEDVPSGPPRKVEVEAVNSSSIKVIWRSPVPTKQHGQIRGYQVHY---VRMVNG---EPTGQPVIKDILIDDAQWEFEDSTEHEMIITGLMAETTYSVTVAAYTTKGDGARSKPKLITTTGAVPEKPRLMVSTTNMGTALLQWHPPAVTHGP--LQGYRLRFGRKDVD---PLTVIEFQERDN----------HYTTSEIHKGASYTFRLSARNKVGFGEETVKE---ITTNEDVPSGYPQNIKAEGATTSTIQVSWQPVLLAERNGKIVKYALQYKDINSPRSPSELFITAPESTVVLDGLRPDTTYDIKMCAFTSKGSGPYSPSVQFRTQPVDQAVFAKNFHVRAAMKSSVLLTWEIPD------TYNPAQPFTILYDKGQS------VEVDGRLTQKLITGLQPETQYSFLL--TNRGNSAGGLQHRVSTM--TAPDV-LRTKPYLIGKTNSDGMVTVEL--PTVQT 1141          

HSP 6 Score: 65.855 bits (159), Expect = 5.111e-10
Identity = 86/355 (24.23%), Postives = 147/355 (41.41%), Query Frame = 1
Query: 2062 VYNYTNAFSSSRYILG-------LRYLCRDSTDILREYVHRSDLVSTMKSVPSDSPKDLVVKEIDSNSALVSWKPLDQVHSNGIITHYEVRYYAPKKEESTERFINVSETSAIL-SNLKYFH-------YVIYVRAFTKVGGGSWSNPKNYYRQNLEEFPIPTTIKGERKSETEINISWELPVLSEKNLAHAAIEGFIILYAPVESSPKWIKYTVQSKNLSAVIKGLEPDLRYQFQIAATNYAGFNGNFSEIVQEMPKNFPNLNLKTVPDLRCSVQSSNRLKVEWSSPSISTDLLKFEIRYSGNLSYITEIGLKKSEFIDMESKSV-NFETLVNRYDVTLENLQSNALYKIAVRA 3078
            +Y   N  +++RY +G         +      +I R     S    T +  PS +P+ +    + + +A++ W   ++  +NG I  Y V Y          + +N+ E   +  SN    H       Y I V A+T VG G  S P             PT  KGE KSET + +SW  P    +      + G+ ++Y   +   K  K        + ++K L+P   Y F++AA +  G     SEI  E P+           +++CS  SS ++ V W +P +       E+R +G ++  T +    +E  D  ++ + N     ++Y   LENL+    Y++ V A
Sbjct:  369 LYKEINGVATTRYSVGGLSPYSDYEFRVVAVNNIGRGPPSESIEAKTAEQAPSTAPRHVRGHMMSATTAVIQWDEPEE--ANGQIMGYRVYYTM-----DPTQHVNIWEKQIVRGSNFVTIHGLIPNKTYNIKVLAYTSVGDGPLS-PDLQIIAKTGVPSQPTDFKGEAKSETSVLLSWNTP---SQTGQENQVTGYELIYR--KRDDKEEKQISFEPTTTYLLKDLKPFTTYTFRLAARSKHGVGAYTSEISAETPQTPEPAGPPE--EVKCSSPSSTKILVSWRAPPV-------ELR-NGIITQYT-VSYAPTEGEDTAARQISNIPPESSQY--LLENLEKWTEYRVTVTA 697          

HSP 7 Score: 63.1586 bits (152), Expect = 3.200e-9
Identity = 192/883 (21.74%), Postives = 338/883 (38.28%), Query Frame = 1
Query: 1054 NITEKQIMSKFVYLTISEKKSIYKYNLKDLFPFTTYCIWMESENPLGVSP--PTIALTVKT-LPTSPQLSPRSITATSISNTAILVAWRPPER--KFGKFKYYQIIYTNNDGFLPQHWRQFAVKDDNV-MLTHLIASELYHIRVKIVNEIGHGPLSKTISIKTIAGTLSQCP--DFKITEIFQSHIKLQWGTPDPVKLFKLI--QYNLLCWDVRLKIVNATAKSSTLFPILNHNLSMNEMEYVLY-LKNEKEIKCRLSAINSDGKG---MPTEIQAST-VNKGVNYQNLIHIDKIGSTYITFQWRPPSKFSFDYFLWIYQIFDSEKLD-RAVKLPKIKINISDSASAENGWFVYNYTNAFSSSRYILGLRYLCRDSTDILREYVHRSD-------LVSTMKSVPSDSPKDLVVKEIDSNSALVSWKPLDQVHSNGIITHYEVRYYAPKKEESTERFINVSE------TSAILSNLKYFHYVIYVRAFTKVGGGSWSNPKNYYRQNLEEFPIPTTIKGERKSETEINISWELPVLSEKNLAHAAIEGFIILYAPVESSPKWIKYTVQSKNLSAVIKGLEPDLRYQFQIAATNYAGFNGNFSEIVQEMPKNFPNLNLKTVPDLRCSVQSSNRLKVEWSSPSISTDLLKFEIRYSGNLSYITEIGLKKSEFIDMESKSVNFETLVNRYDVTLENLQSNALYKIAVRAIYQNKELYESHRETTCDTMPAVPNLVKPPIIVGLDEEKSKVIIKLHRCSQRNGKISYYFVIVAAFQGNKNQQ-ISFQEDTESYTFMEL--SVNTRSNNAKGEYIAIMKD-INDIFKVSGKDHSSVLLGDGTHDENHLSVNKKLEKNFNYRCFARVCLKYSNNSLCKSSPWSEPFRISDL 3603
            NI EKQI+    ++TI             L P  TY I + +   +G  P  P + +  KT +P+ P          + S T++L++W  P +  +  +   Y++IY   D    +  +Q + +     +L  L     Y  R+   ++ G G  +  IS +T        P  + K +    + I + W  P PV+L   I  QY +       +   A   S         N+     +Y+L  L+   E +  ++A    G G   +P  I+    V  G   +  + ++ + S+ I   WR P        +  YQ+     ++      P IK  + D A  E       + ++      I GL      S  +   Y  + D       L++T  +VP + P+ L+V   +  +AL+ W P    H  G +  Y +R+   +K+      I   E      TS I    K   Y   + A  KVG G  +  +    +++     P  IK E  + + I +SW+  +L+E+N     I  + + Y  + S     +  + +   + V+ GL PD  Y  ++ A    G +G +S  VQ   +            +R +++SS  + + W  P        F I Y    S   +  L +     ++ ++     L NR + +   LQ                     HR     TM A   L   P ++G       V ++L    Q + +I  Y+V+V   +  +  + +   ++ +     EL   +N  S   + +  A  K  I   FK   K+ +   LGDG    +    NK+L+    Y  F    L+ S N +  +SP+S+    +D+
Sbjct:  467 NIWEKQIVRGSNFVTI-----------HGLIPNKTYNIKVLAYTSVGDGPLSPDLQIIAKTGVPSQPT----DFKGEAKSETSVLLSWNTPSQTGQENQVTGYELIYRKRDD---KEEKQISFEPTTTYLLKDLKPFTTYTFRLAARSKHGVGAYTSEISAETPQTPEPAGPPEEVKCSSPSSTKILVSWRAP-PVELRNGIITQYTVSYAPTEGEDTAARQIS---------NIPPESSQYLLENLEKWTEYRVTVTAHTDVGAGPESLPHLIRTEEDVPSGPPRK--VEVEAVNSSSIKVIWRSPVPTKQHGQIRGYQVHYVRMVNGEPTGQPVIKDILIDDAQWE-------FEDSTEHEMIITGLMAETTYSVTVA-AYTTKGDGARSKPKLITTTGAVP-EKPR-LMVSTTNMGTALLQWHPPAVTH--GPLQGYRLRFG--RKDVDPLTVIEFQERDNHYTTSEIH---KGASYTFRLSARNKVGFGEETVKEITTNEDVPSG-YPQNIKAEGATTSTIQVSWQPVLLAERN---GKIVKYALQYKDINSPRSPSELFITAPESTVVLDGLRPDTTYDIKMCAFTSKG-SGPYSPSVQFRTQPVDQAVFAKNFHVRAAMKSS--VLLTWEIPDTYNPAQPFTILYDKGQSVEVDGRLTQKLITGLQPETQYSFLLTNRGN-SAGGLQ---------------------HR---VSTMTAPDVLRTKPYLIGKTNSDGMVTVELPTV-QTSERIRGYYVVVVPLKKQRTGKFLKPWDNPDEMNLEELLKEINRTSRGLRFQRHAEPKAYIAAYFKDLPKEFT---LGDGKIYGDF--ENKQLQNGQEYVFFVLAVLEMSENIMYATSPYSDSVISADI 1264          
BLAST of Protein tyrosine phosphatase receptor type D vs. Ensembl Medaka
Match: PTPRD (receptor-type tyrosine-protein phosphatase delta [Source:NCBI gene;Acc:101165843])

HSP 1 Score: 713.375 bits (1840), Expect = 0.000e+0
Identity = 333/606 (54.95%), Postives = 437/606 (72.11%), Query Frame = 1
Query: 4006 SDSIKLRIGSQKSENISDRPSISICNLYQYVTDLKANDCTLLQAEFETLNTNLDDRFTWQRSNIDSNKSKNRYANVVAYDHTSVLLTPVDDVIGSDYINANYIDGYQRQNAYIATQGPLPDTTDDFWRMVWEQRSNCIVMMTRLEERSGIKCHQYWPNRGFICYGQMIVSHIDTFVLAYYTIRLFEIRHSKYSEKREIQHFQFTAWPDHGVPKLSTPLLMFIRRVRSIGKIESCPKIVHCSAGVGRTGAFIVVDAQLERIKQEKNIDVFNYVSKIRCQRNYMVQTQAQYQFILETLLEAVEDGNTEVMACNFHAHVTKLSQIGISGSNQLSGFEMEFSKLNSLASNRGRHGVMLADFVKAAGNQAVNMTKNRVRNIIPYEWNRVVLNAIRGIEGSDYINASYIDGYRDRRAYIAAQSPIPSTVEDFWRMLWDQHCGVVIVLNQPHE---DKSHIYWPINKSIRYQFFVVDPVVEYNMPNYILREFKVTDARDGEFRALRQFQFTQWPNHGCPKESESILDFIRQVHKTKEQFGHMEPMVIHCNTGSGRTGVFIALSIVLDRLQQESVVDMYQTVKLLHKQRIGLVQTEEQYEFCYMAVLDYLSNYE 5814
            +D ++LR  + ++  +++ P I I  L  ++  LKAND      E+E+++     +FTW+ SN++ NK KNRYANV+AYDH+ +LL+ +D + GSDYINANYIDGY++QNAYIATQGPLP+T  +FWRM+WEQRS  +VMMT+LEERS +KC QYWP RG   YG + VS +DT  LA Y +R F +  +  SEKRE++ FQFTAWPDHGVP+  TP L F+RRV++    ++ P +VHCSAGVGRTG FIV+DA LER K EK +D++ +V+ +R QRNYMVQT+ QY FI + LLEAV  G TEV A N +A++ KL+Q  I G   ++G E+EF +L +  ++  R       F+ A  N   N  KNR+ NI+PYE  RV L  IRG+EGSDYINAS+IDGYR ++AYIA Q P+  T EDFWRMLW+ +  +V++L +  E   +K H YWP  +S RYQ+FVVDP+ EYNMP YILREFKVTDARDG+ R +RQFQFT WP  G PK  E  +DFI QVHKTKEQFG   P+ +HC+ G GRTGVFI LSIVL+R++ E VVD++QTVK+L  QR  +VQTE+QY+FCY A L+YL +++
Sbjct: 1186 TDPVELRRLNFQTPGMANHPPIPISELADHLERLKANDNLKFSQEYESIDPA--QQFTWEHSNLEVNKPKNRYANVIAYDHSRILLSAIDGIPGSDYINANYIDGYRKQNAYIATQGPLPETFGEFWRMIWEQRSAVVVMMTKLEERSRVKCDQYWPTRGTETYGLIQVSLLDTVELATYCVRTFSLFKNGSSEKREVRQFQFTAWPDHGVPEHPTPFLAFLRRVKACNPPDAGPMVVHCSAGVGRTGCFIVIDAMLERNKHEKTVDIYGHVTLMRAQRNYMVQTEDQYVFIHDALLEAVNCGTTEVPARNLYAYIQKLTQ--IEGGENVTGMELEFKRLANTKAHTSR-------FISA--NLPCNKFKNRLVNIMPYESTRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDQYQFCYRAGLEYLGSFD 1778          

HSP 2 Score: 207.608 bits (527), Expect = 3.662e-53
Identity = 106/262 (40.46%), Postives = 154/262 (58.78%), Query Frame = 1
Query: 5092 NQAVNMTKNRVRNIIPYEWNRVVLNAIRGIEGSDYINASYIDGYRDRRAYIAAQSPIPSTVEDFWRMLWDQHCGVVIVLNQPHEDKSHI----YWPINKSIRYQFFVVDPVVEYNMPNYILREFKVTDARDGEFRALRQFQFTQWPNHGCPKESESILDFIRQVHKTKEQFGHMEPMVIHCNTGSGRTGVFIALSIVLDRLQQESVVDMYQTVKLLHKQRIGLVQTEEQYEFCYMAVLDYLSNYEKILEKSHLY*TYQDLSE 5865
            N  VN  KNR  N+I Y+ +R++L+AI GI GSDYINA+YIDGYR + AYIA Q P+P T  +FWRM+W+Q   VV+++ +  E++S +    YWP   +  Y    V  +    +  Y +R F +      E R +RQFQFT WP+HG P+     L F+R+V           PMV+HC+ G GRTG FI +  +L+R + E  VD+Y  V L+  QR  +VQTE+QY F + A+L+ ++     +   +LY   Q L++
Sbjct: 1246 NLEVNKPKNRYANVIAYDHSRILLSAIDGIPGSDYINANYIDGYRKQNAYIATQGPLPETFGEFWRMIWEQRSAVVVMMTK-LEERSRVKCDQYWPTRGTETYGLIQVSLLDTVELATYCVRTFSLFKNGSSEKREVRQFQFTAWPDHGVPEHPTPFLAFLRRVKACNPP--DAGPMVVHCSAGVGRTGCFIVIDAMLERNKHEKTVDIYGHVTLMRAQRNYMVQTEDQYVFIHDALLEAVNCGTTEVPARNLYAYIQKLTQ 1504          

HSP 3 Score: 140.584 bits (353), Expect = 9.944e-33
Identity = 255/1118 (22.81%), Postives = 432/1118 (38.64%), Query Frame = 1
Query:  313 PKISLIIQSPNVLLFKSMILACSSTGHPVPSISWKINESPIEELKSPLKKLQNPPRIFSIKNYQNSVLVITQLIESDSNSVLICEAENNAGFD-SRQQQLKVISTETDIPSGFPVFQNNFFPIIKPYNSNVTLVCQAYGNPPPLIQWFKNYELINESFTKIKILNDGNLLLVQVTREDKGIYHCQAQNTNGLRLSDPSTLDITSYPISPNSLIIERFASDNVEISWRSGLNDVTEQENFILHYREVPENITEKQIMSKFVYLTISEKK----SIYKYNLKDLFPFTTYCIWMESENPLGVSPPTIALTVKTLPTSPQLSPRSITATSISNTAILVAWRPPERKFGKFKYYQIIYTNNDGFLPQHWRQFAVKDDNVMLTH-LIASELYHIRVKIVNEIGHGPLSKTISIKTIAGTLSQCPDFKITEIFQSHIKLQWGTPDPV-KLFKLIQYNLLCWDVRLKIVNATAKSSTLFPILNHNLSMNEMEYVLYLKNEKEIKCRLSAINSDGKGMPT-EIQASTV-NKGVNYQNLIHIDKIGSTYITFQWRPPSKFSFDYFLWIYQI--FDSEKLDRAVKLPKIKINISDSASAENGWFVYNYTNAFSSSRYILGLRYLCRDSTDILREYVHRSDLVSTMKSVPSDSPKDLVVKEIDSNSALVSWKPLDQVHSNGIITHYEVRYYAPKKEESTERFINVSE------TSAILSNLKYFHYVIYVRAFTKVGGGSWSNPKNYYRQNLEEFPIPTTIKGERKSETEINISWELPVLSEKNLAHAAIEGFIILYAPVESSPKWIKYTVQSKNLSAVIKGLEPDLRYQFQIAATNYAGFNGNFSEIVQEMPKNFPNLNLKTVPDLRCSVQSSNRLKVEWSSPSISTDLLKFEIRYSGNLSYITEIGLKKSEFIDMESKSVNFETLVNRYDVTLENLQSNALYKIAVRAIYQNKELYESHRETTCDTMPAVPNLVKPPIIVGLDEEKSKVIIKLHRCSQRNGKISYYFVIVAAFQGNKNQQ-ISFQEDTESYTFMEL--SVNTRSNNAKGEYIAIMKD-INDIFKVSGKDHSSVLLGDGTHDENHLSVNKKLEKNFNYRCFARVCLKYSNNSLCKSSPWSEPFRISDL 3603
            P I +  Q   V   ++  + C+++G+P P ISW  +  P+    +  +          IK  ++  L I Q  ESD      C A NN G   S    L V           P   N   P       +V + C A G+P P ++W     L  E  T    +  G  +L     +    Y C A +T G+ +   + + + + P +P   ++    + ++ ++W SG                 PE +T   I  K  Y     K+    +  +Y++  L P++ Y   + + N +G  PP+ ++  KT   +P  +PR +    +S T  ++ W  PE   G+   Y++ YT +       W +  V+  N +  H LI ++ Y+I+V     +G GPLS  + I    G  SQ  DFK     ++ + L W TP    +  ++  Y L    +  K  +   K  +  P   + L          LK       RL+A +  G G  T EI A T   +       +      ST I   WR P     +  +  Y +    +E  D A +  +I  NI   +S       Y   N    + Y    R      TD+         L+ T + VP + P+ L+V   +  +AL+ W P    H  G +  Y +R+   +K+      I   E      TS I    K   Y   + A  KVG G  +  +    +++     P  IK E  + + I +SW+  +L+E+N     I  + + Y  + S     +  + +   + V+ GL PD  Y  ++ A    G +G +S  VQ   +    +  K    +R +++SS  + + W  P        F I Y    S   +  L +     ++ ++     L NR + +   LQ                     HR     TM A   L   P ++G       V ++L    Q + +I  Y+V+V   +  +  + +   ++ +     EL   +N  S   + +  A  K  I   FK   K+ +   LGDG    +    NK+L+    Y  F    L+ S N +  +SP+S+    +D+
Sbjct:  118 PTIDMGPQLKVVERTRTATMLCAASGNPDPDISWFKDFLPVNTSNNNGR----------IKQLRSGALQIEQSEESDQGKYE-CVATNNDGTRYSAPANLYVRVRRVPPRFSIPPTDNEIMP-----GGSVNITCVAVGSPMPYVKWM----LGAEDLTPEDDMPIGRNVLELTDVQQSANYTCVAMSTLGV-IEAVAQITVKALPKAPGIPVVTERTATSITLTWDSG----------------NPEPVTYYIIQHKSKYSDDLYKEINGVATTRYSVGGLSPYSDYEFRVVAVNNIGRGPPSESIEAKTAEQAPSTAPRHVRGHMMSATTAVIQWDEPEEANGQIMGYRVYYTMDPTQHVNIWEKQIVRGSNFVTIHGLIPNKTYNIKVLAYTSVGDGPLSPDLQIIAKTGVPSQPTDFKGEAKSETSVLLSWNTPSQTGQENQVTGYEL----IYRKRDDKEEKQISFEPTTTYLLKD--------LKPFTTYTFRLAARSKHGVGAYTSEISAETPQTQPAGPPEEVKCSSPSSTKILVSWRAPPVELRNGIITQYTVSYAPTEGEDTAAR--QIS-NIPPESSQ------YLLENLEKWTEY----RVTVTAHTDVGAGPESLPHLIRTEEDVP-EKPR-LMVSTTNMGTALLQWHPPAVTH--GPLQGYRLRFG--RKDVDPLTVIEFQERDNHYTTSEI---HKGASYTFRLSARNKVGFGEETVKEITTNEDVPSG-YPQNIKAEGATTSTIQVSWQPVLLAERN---GKIVKYALQYKDINSPRSPSELFITAPESTVVLDGLRPDTTYDIKMCAFTSKG-SGPYSPSVQFRTQPVDQVFAKNF-HVRAAMKSS--VLLTWEIPDTYNPAQPFTILYDKGQSVEVDGRLTQKLITGLQPETQYSFLLTNRGN-SAGGLQ---------------------HR---VSTMTAPDVLRTKPYLIGKTNSDGMVTVELPTV-QTSERIRGYYVVVVPLKKQRTGKFLKPWDNPDEMNLEELLKEINRTSRGLRFQRHAEPKAYIAAYFKDLPKEFT---LGDGKIYGDF--ENKQLQNGQEYVFFVLAVLEMSENIMYATSPYSDSVISADI 1125          

HSP 4 Score: 97.0561 bits (240), Expect = 1.820e-19
Identity = 112/439 (25.51%), Postives = 163/439 (37.13%), Query Frame = 1
Query:  376 CSSTGHPVPSISWKINESPIEELKSPLKKLQNPP-RIFSIKNYQNSVLVITQLIESDSNSVLICEAENNAGFDSRQQQLKVISTETDIPSGFPVFQNNFFPIIKPYNSNVTLVCQAYGNPPPLIQWFKNYELINESFT--KIKILNDGNLLLVQVTREDKGIYHCQAQNTNGLRLSDPSTLDI------TSYPISPNSLIIERFASDNVE----------ISWRSGLNDVTEQENFILHYREVPENITEKQIMSKFVYLTISEKKSIYKYNLKDLFPFTTYCIWMESENPLGVSPPTIALTVKTLPTSPQLSPRSITATSISNTAILVAW---RPPERKF----GKFKYYQIIYTNNDGFLPQHWRQFAVKDDNVMLTHLIASELYHIRVKIVNEIGHGPLSKTISIKTIAGTLSQCPDFKITEIFQSHIK-LQWGTPD 1611
            C +TG P P I W              KK+ N    +    +   SVL I  L      ++  C A N  G  S   +L V+  E  +P GFP         +       T++C A GNP P I WFK++  +N S    +IK L  G L + Q    D+G Y C A N +G R S P+ L +        + I P    I    S N+           + W  G  D+T +++       +  N+ E         LT  ++ + Y             C+ M +   LGV      +TVK LP +P +       T  + T+I + W    P    +     K KY   +Y   +G          V      +  L     Y  RV  VN IG GP S++I  KT     S  P      +  +    +QW  P+
Sbjct:   37 CQATGDPRPKIVWNKKG----------KKVSNQRFEVIEFDDGSGSVLRIQPLRTPRDEAIYECVASNTVGEISASTRLTVLR-EDQLPPGFPTIDMGPQLKVVERTRTATMLCAASGNPDPDISWFKDFLPVNTSNNNGRIKQLRSGALQIEQSEESDQGKYECVATNNDGTRYSAPANLYVRVRRVPPRFSIPPTDNEIMPGGSVNITCVAVGSPMPYVKWMLGAEDLTPEDDM-----PIGRNVLE---------LTDVQQSANYT------------CVAMST---LGVIEAVAQITVKALPKAPGIP----VVTERTATSITLTWDSGNPEPVTYYIIQHKSKYSDDLYKEING----------VATTRYSVGGLSPYSDYEFRVVAVNNIGRGPPSESIEAKTAEQAPSTAPRHVRGHMMSATTAVIQWDEPE 421          
BLAST of Protein tyrosine phosphatase receptor type D vs. Ensembl Medaka
Match: ptprsa (receptor-type tyrosine-protein phosphatase S [Source:NCBI gene;Acc:101174175])

HSP 1 Score: 712.605 bits (1838), Expect = 0.000e+0
Identity = 330/612 (53.92%), Postives = 440/612 (71.90%), Query Frame = 1
Query: 3988 LSPVLVSDSIKLRIGSQKSENISDRPSISICNLYQYVTDLKANDCTLLQAEFETLNTNLDDRFTWQRSNIDSNKSKNRYANVVAYDHTSVLLTPVDDVIGSDYINANYIDGYQRQNAYIATQGPLPDTTDDFWRMVWEQRSNCIVMMTRLEERSGIKCHQYWPNRGFICYGQMIVSHIDTFVLAYYTIRLFEIRHSKYSEKREIQHFQFTAWPDHGVPKLSTPLLMFIRRVRSIGKIESCPKIVHCSAGVGRTGAFIVVDAQLERIKQEKNIDVFNYVSKIRCQRNYMVQTQAQYQFILETLLEAVEDGNTEVMACNFHAHVTKLSQIGISGSNQLSGFEMEFSKLNSLASNRGRHGVMLADFVKAAGNQAVNMTKNRVRNIIPYEWNRVVLNAIRGIEGSDYINASYIDGYRDRRAYIAAQSPIPSTVEDFWRMLWDQHCGVVIVLNQPHE---DKSHIYWPINKSIRYQFFVVDPVVEYNMPNYILREFKVTDARDGEFRALRQFQFTQWPNHGCPKESESILDFIRQVHKTKEQFGHMEPMVIHCNTGSGRTGVFIALSIVLDRLQQESVVDMYQTVKLLHKQRIGLVQTEEQYEFCYMAVLDYLSNYE 5814
            ++P   +D +++R  + ++  + + P I I  L ++   LKAND   L  E+E+++     +FTW+ SN++ NK KNRYANV+AYDH+ V+L P++ + GSDYINANYIDGY++QNAYIATQGPLP+T  DFWRMVWEQR+  +VMMT+LEE+S IKC QYWP+RG   YG   V+ +DT  LA + +R F +  +  SEKRE++ FQFTAWPDHGVP+  TP L F+RRV++    ++ P I HCSAGVGRTG FIV+DA LERIK EK +D++ +V+ +R QRNYMVQT+ QY FI + LLEAV  GNTEV A + ++++ KL+Q  +     ++G E+EF +L +  ++  R       F+ A  N   N  KNR+ NI+PYE  RV L  IRG+EGSDYINAS+IDGYR +RAYI+ Q P+  T EDFWRMLW+ +  +V++L +  E   +K H YWP  +S RYQ+FVVDP+ EYNMP YILREFKVTDARDG+ R +RQFQFT WP  G PK  E  +DFI QVHKTKEQFG   P+ +HC+ G GRTGVFI LSIVL+R++ E VVD++QTVK+L  QR  +VQTE++Y+FCY A L+YL +++
Sbjct: 1303 ITPHHPTDPVEVRRINFQTPGMLNHPPIPISELAEHTELLKANDNLKLSQEYESIDPG--QQFTWEHSNLEVNKPKNRYANVIAYDHSRVILAPIEGITGSDYINANYIDGYRKQNAYIATQGPLPETFGDFWRMVWEQRAATVVMMTKLEEKSRIKCDQYWPSRGTETYGMTQVTLLDTIELATFCVRTFSLHKNGSSEKREVRQFQFTAWPDHGVPEYPTPFLAFLRRVKTCNPPDAGPIIAHCSAGVGRTGCFIVIDAMLERIKHEKTVDIYGHVTLMRSQRNYMVQTEDQYSFIHDALLEAVACGNTEVAARSLYSYIQKLAQ--VESGEHVTGMELEFKRLANSKAHTSR-------FISA--NLPCNKFKNRLVNIMPYETTRVCLQPIRGLEGSDYINASFIDGYRQQRAYISTQGPLAETTEDFWRMLWENNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDEYQFCYHAALEYLGSFD 1901          

HSP 2 Score: 203.756 bits (517), Expect = 5.374e-52
Identity = 105/262 (40.08%), Postives = 150/262 (57.25%), Query Frame = 1
Query: 5092 NQAVNMTKNRVRNIIPYEWNRVVLNAIRGIEGSDYINASYIDGYRDRRAYIAAQSPIPSTVEDFWRMLWDQHCGVVIVLNQPHEDKSHI----YWPINKSIRYQFFVVDPVVEYNMPNYILREFKVTDARDGEFRALRQFQFTQWPNHGCPKESESILDFIRQVHKTKEQFGHMEPMVIHCNTGSGRTGVFIALSIVLDRLQQESVVDMYQTVKLLHKQRIGLVQTEEQYEFCYMAVLDYLSNYEKILEKSHLY*TYQDLSE 5865
            N  VN  KNR  N+I Y+ +RV+L  I GI GSDYINA+YIDGYR + AYIA Q P+P T  DFWRM+W+Q    V+++ +  E+KS I    YWP   +  Y    V  +    +  + +R F +      E R +RQFQFT WP+HG P+     L F+R+V           P++ HC+ G GRTG FI +  +L+R++ E  VD+Y  V L+  QR  +VQTE+QY F + A+L+ ++     +    LY   Q L++
Sbjct: 1369 NLEVNKPKNRYANVIAYDHSRVILAPIEGITGSDYINANYIDGYRKQNAYIATQGPLPETFGDFWRMVWEQRAATVVMMTK-LEEKSRIKCDQYWPSRGTETYGMTQVTLLDTIELATFCVRTFSLHKNGSSEKREVRQFQFTAWPDHGVPEYPTPFLAFLRRVKTCNPP--DAGPIIAHCSAGVGRTGCFIVIDAMLERIKHEKTVDIYGHVTLMRSQRNYMVQTEDQYSFIHDALLEAVACGNTEVAARSLYSYIQKLAQ 1627          

HSP 3 Score: 137.502 bits (345), Expect = 9.953e-32
Identity = 218/964 (22.61%), Postives = 375/964 (38.90%), Query Frame = 1
Query:  313 PKISLIIQSPNVLLFKSMILACSSTGHPVPSISWKINESPIEELKSPLKKLQNPPRIFSIKNYQNSVLVITQLIESDSNSVLICEAENNAGFD-SRQQQLKV--ISTETDIPSGF--PVFQNNFFPIIKPYNSNVTLVCQAYGNPPPLIQWFKNYELINESFTKIKILNDG-NLLLVQVTREDKGIYHCQAQNTNGLRLSDPSTLDITSYPISPNSLIIERFASDNVEISWRSGLNDVTEQENFILHYREVPENITEKQIMSKFVYLTISEKKSIYKYNLKDLFPFTTYCIWMESENPLGVSPPTIALTVKTLPTSPQLSPRSITATSISNTAILVAWRPPERKFGKFKYYQIIYTNNDGFLPQHWRQFAVKDDNV-MLTHLIASELYHIRVKIVNEIGHGPLSKTISIKTIAGTLSQCPDFKITEIFQSHIKLQWGTPDPVKLFKLIQYNLLCWDVRLKIVNATAKSSTLFPILNHNLSMNEMEYVLYLKNEKEIKCRLSAINSDGKGMPTE--IQASTVNKGVNYQNLIHIDKIGSTYITFQWRPPSKFS----FDYFLWIYQIFDSEKLDRAVKLPKIKINISDSASAE-----NGWFVYNYTNAFSSSRYILGLR-----YLCRDSTDILREYVHRSDLVSTMKSVPSDSPKDLVVKEIDSNSALVSWKPLDQVHSNGIITHYEVRYYAPKKEES-----TERFINVSETSAILSNLKY-FHYVIYVRAFTKVGGGSWSNPKNYYRQNLEEFPIPTTIKGERKSETEINISWELPVLSEKNLAHAAIEGF--------IILYAPVESSPKWIKYTVQSKNLSAVIKGLEPDLRYQFQIAATNYAGFNGNFSEIVQEM--PKNFPN--LNLKTVPDLRCSVQSSNRLKVEWSSPSISTDLLKFEIRYSGNLSYITEIGLKKSEFIDME-SKSVNFETLVNRYDVTLENLQSNALYKIAVRA 3078
            P I +  Q   V   ++  + C+++G+P P I+W  +  PI+   S  +          IK  ++  L I    E+D      C A N  G   S    L V  +     +P  F  P       P       +V + C A G+P P ++W  N    +E  T    +  G N+L +   RE    Y C A ++ G+ +   + + + S P  P + ++    + +V I+W SG  D      +I+ Y+        K   SK  Y T+ +  +  +Y++  L+P T Y I + + N +G  PP+  +  +T   +P   PR++    +    ++V W  PE   G+ K Y++ YT +      +W    V+D  +  +  L   E Y I+V     +G GP S  I +K + G   Q   F++  +  + I+L W   +P    + I+     +++R +  N   +    F          +   V  L+   E    L+AI+  G G  T   +Q +   K       I      ST +   WRPP   S       +  +YQ+    +       P  +  I  +           W  Y+ T    S+  ++GL       +CR   D                 VP   P+ + V  ++S +  V W+ L     NG I  Y+V Y   +  ES      +  +       ++  LK    Y I V A+T  G G+ S PK    +     P P  +   + S+T   + W+ P L+        ++G+        I   A +E +P+  +Y+V + +  A          Y F++AA +  GF     E V E+  P+N P     +K   ++ C       + + WS P ++                ITE  L   E    E  + +     ++ Y   L +L+ N+ Y++ +RA
Sbjct:  137 PNIDMGPQLKVVERTRTATMLCAASGNPDPEITWYKDFLPIDPSASNGR----------IKQLRSGALQIENSEETDQGKYE-CVASNVEGVRYSSPANLYVRELREVRRVPPRFSIPPTSQEIMP-----GGSVNITCVAVGSPMPYVKWMLN----SEDLTPEDEMPVGRNVLELSSVRESAN-YTCVAMSSLGI-IESVAQITVKSLPKPPGTPVVTETTATSVTITWDSGNPDPVSY--YIIQYKA-------KSPDSK--YETVDDITTT-RYSIGGLYPNTEYEIRVSAINTIGQGPPSEPVETRTGEQAPASPPRNVNGQILPQNTMMVTWEEPEEPNGQIKGYRVYYTMDASQPMSNWHIHNVQDSVITTIRSLTPLETYTIKVLAFTSVGDGPFSPPIKVKVVQGVPGQPSKFQVGAVSDTSIELIW---EPAHDKEAIRR----YELRYRESNHGNQMKKTF-------DPTKSYVVESLRPNTEYYFSLAAISDKGIGAFTNEILQKTLQAKPSAPPQEIECSSTSSTSLLVSWRPPPLKSQNGDLTGYKVLYQVVSPSEGAGGDPQPTEEPMIPPTEEQVLLQRLGKWTQYHIT---VSAATVVGLGPESEPIICRTDED-----------------VPGAPPRRVEVDVLNSTAIKVMWRSLTPGKQNGQIRGYQVHYVRVENGESRGLPLIKDVMLADAQEMVIGGLKPDTTYSITVAAYTTKGDGARSKPKLVVTKGA--VPGPPYLSVAQNSKTSAVVHWDPPDLTNG----MDLQGYRLQFGRKDITPLATLEFAPQERRYSVDNIHRGAT---------YLFKMAAKSRGGFG---EEAVAELSVPENTPGGYPQIKEGSNVTCC-----SVLLSWSPPVLAE-----------RNGVITEYTLVYKEAGTGEIPRELRLHPSLSSY--VLNSLKPNSAYEVKMRA 996          

HSP 4 Score: 106.301 bits (264), Expect = 2.930e-22
Identity = 202/907 (22.27%), Postives = 329/907 (36.27%), Query Frame = 1
Query:  370 LACSSTGHPVPSISW-----KINESPIEELKSPLKKLQNPPRIFSIKNYQNSVLVITQLIESDSNSVLICEAENNAGFDSRQQQLKVISTETDIPSGFPVFQNNFFPIIKPYNSNVTLVCQAYGNPPPLIQWFKNYELINESFT--KIKILNDGNLLLVQVTREDKGIYHCQAQNTNGLRLSDPSTLDITS----------YPISPNSLIIERFASDNVE----------ISWRSGLNDVTEQENFILHYREVPENITEKQIMSKFVYLTISEKKSIYKYNLKDLFPFTTYCIWMESENPLGVSPPTIALTVKTLPTSPQLSPRSITATSISNTAILVAWRPPERKFGKFKYYQIIYTNNDGFLPQHWRQFAVKDD----NVMLTHLIASELYHIRVKIVNEIGHGPLSKTISIKTIAGTLSQCPDFKITEIF-QSHIKLQWGTPDPVKLFKLIQYNLLCWDVRLKIVNATAKSSTLFPILNHNLSMNEMEYVLYLKNEKEIKCRLSAINSDGKGMPTEIQASTVNKGVNYQ-NLIHIDKIGSTYITFQWRPPSKFSFDYFLWIYQIFDSEKLDRAVKLPKIKINISDSASAENGWFVYNYTNAF------SSSRYILGLRYLCRDSTDILREYVHRSDLVSTMKSVPSDSPKDLVVKEIDSNSALVSWKPLDQVHSNGIITHYEVRYYAPKKEEST--------ERFINVSETSAILSNL-KYFHYVIYVRAFTKVGGGSWSNPKNYYRQNLEEFP--IPTTIKGERKSETEINISWELPVLSEKNLAHAAIEGFIILYAPVESSPK----WIKYTVQSKNLSAVIKGLEPDLRYQFQIAATNYAGFNGNFSEIVQEMPKNFPNLNLKTVPDLRCSVQSSNRLKVEWSSPSIST--DLLKFEIRYS 2922
              C +TG P P +SW     K+N   IE ++                    +VL I  L      ++  C AEN+ G  S   +L +I  E  +P GFP         +       T++C A GNP P I W+K++  I+ S +  +IK L  G L +      D+G Y C A N  G+R S P+ L +            + I P S  I    S N+           + W     D+T ++        V  N+           L +S  +    Y           C+ M S   LG+      +TVK+LP  P     +   T  + T++ + W           YY I Y       P    ++   DD       +  L  +  Y IRV  +N IG GP S+ +  +T     +  P     +I  Q+ + + W  P+        + N      R+      ++  + + I  HN+  + +  +  L   +    ++ A  S G G  +      V +GV  Q +   +  +  T I   W P                D E + R       ++   +S         ++ T ++       ++ Y   L  +           + +  L    ++ PS  P+++      S S LVSW+P      NG +T Y+V Y      E          E  I  +E   +L  L K+  Y I V A T VG G  S P     +  E+ P   P  ++ +  + T I + W      ++N     I G+ + Y  VE+        IK  + +     VI GL+PD  Y   +AA    G +G  S+    + K      +   P L  +  S     V W  P ++   DL  + +++ 
Sbjct:   54 FVCHATGDPKPKVSWSKKGKKVNSQRIETIE--------------FDEGAGAVLRIQPLRAPRDENIYECVAENSEGEISVNARLAIIR-EDLLPPGFPNIDMGPQLKVVERTRTATMLCAASGNPDPEITWYKDFLPIDPSASNGRIKQLRSGALQIENSEETDQGKYECVASNVEGVRYSSPANLYVRELREVRRVPPRFSIPPTSQEIMPGGSVNITCVAVGSPMPYVKWMLNSEDLTPEDEM-----PVGRNV-----------LELSSVRESANYT----------CVAMSS---LGIIESVAQITVKSLPKPPG----TPVVTETTATSVTITWD--SGNPDPVSYYIIQYKAKS---PDS--KYETVDDITTTRYSIGGLYPNTEYEIRVSAINTIGQGPPSEPVETRTGEQAPASPPRNVNGQILPQNTMMVTWEEPE--------EPNGQIKGYRVYYTMDASQPMSNWHI--HNVQDSVITTIRSLTPLETYTIKVLAFTSVGDGPFSPPIKVKVVQGVPGQPSKFQVGAVSDTSIELIWEP--------------AHDKEAIRR------YELRYRESNHGNQMKKTFDPTKSYVVESLRPNTEYYFSLAAISDKGIGAFTNEILQKTL----QAKPSAPPQEIECSSTSSTSLLVSWRPPPLKSQNGDLTGYKVLYQVVSPSEGAGGDPQPTEEPMIPPTEEQVLLQRLGKWTQYHITVSAATVVGLGPESEP--IICRTDEDVPGAPPRRVEVDVLNSTAIKVMWRSLTPGKQN---GQIRGYQVHYVRVENGESRGLPLIKDVMLADAQEMVIGGLKPDTTYSITVAAYTTKG-DGARSKPKLVVTKG----AVPGPPYLSVAQNSKTSAVVHWDPPDLTNGMDLQGYRLQFG 861          

HSP 5 Score: 83.1889 bits (204), Expect = 3.322e-15
Identity = 139/618 (22.49%), Postives = 239/618 (38.67%), Query Frame = 1
Query:  913 ITSYPISPNSLIIERFASDNVEISWRSGLNDVTEQENFILHYREVPENITEKQIMSKFVYLTISEKKSIYKYNLKDLFPFTTYCIWMESENPLGVSPPTIALTVKTLPTSPQLSPRSITATSISNTAILVAWRPPERKF--GKFKYYQIIY-----TNNDGFLPQHWRQFAVK--DDNVMLTHLIASELYHIRVKIVNEIGHGPLSKTISIKTIAGTLSQCPDFKITEIFQS-HIKLQWGTPDPVKLFKLIQYNLLCWDVRLKIVNATAKSSTLFPILNHNLSMNEMEYVLY-LKNEKEIKCRLSAINSDGKGMPTEIQASTVNKGVNYQNLIHIDKIGSTYITFQWRPPSKFSFDYFLWIYQIFDSEKLDRAVKLPKIKINISDSASAENGWFVYNYTNAFSSSRYILGLRYLCRDSTDILREYVHRSDLVSTMKSVPSDSPKDLVVKEIDSNSALVSWKPLDQVHSNGIITHYEVRYY-APKKEESTERFINVSETSAILSNLK-YFHYVIYVRAFTKVGGGSWSNPKNYYRQNLEEFPIPTTIKGERKSETEINISWELPVLSEKNLAHAAIEGFIILYAPVESSPKWIKYTVQSKNLSAVIKGLEPDLRYQFQI 2727
            +   P  P+   +   +  ++E+ W    +D      + L YRE       K+        T    KS   Y ++ L P T Y   + + +  G+   T  +  KTL   P   P+ I  +S S+T++LV+WRPP  K   G    Y+++Y     +   G  PQ   +  +   ++ V+L  L     YHI V     +G GP S+ I  +T        P     ++  S  IK+ W +  P K    I+        ++  V      S   P++   +  +  E V+  LK +      ++A  + G G  ++ +       V     + + +   T     W PP   +    L  Y++    +  R    P   +  +           Y+  N    + Y+  +    R       E V     +S  ++ P   P+      +   S L+SW P      NG+IT Y + Y  A   E   E  ++ S +S +L++LK    Y + +RA T VG G +S P  Y    +    +P     +  ++T + + W+    SE++     IE     YA         K  V ++ L A IKGL  +  Y+F++
Sbjct:  514 VQGVPGQPSKFQVGAVSDTSIELIWEPA-HDKEAIRRYELRYRESNHGNQMKK--------TFDPTKS---YVVESLRPNTEYYFSLAAISDKGIGAFTNEILQKTLQAKPSAPPQEIECSSTSSTSLLVSWRPPPLKSQNGDLTGYKVLYQVVSPSEGAGGDPQPTEEPMIPPTEEQVLLQRLGKWTQYHITVSAATVVGLGPESEPIICRTDEDVPGAPPRRVEVDVLNSTAIKVMWRSLTPGKQNGQIR------GYQVHYVRVENGESRGLPLIKDVMLADAQEMVIGGLKPDTTYSITVAAYTTKGDGARSKPKLVVTKGAVPGPPYLSVAQNSKTSAVVHWDPPD-LTNGMDLQGYRL----QFGRKDITPLATLEFAPQERR------YSVDNIHRGATYLFKMAAKSRGG--FGEEAVAE---LSVPENTPGGYPQIKEGSNVTCCSVLLSWSPPVLAERNGVITEYTLVYKEAGTGEIPRELRLHPSLSSYVLNSLKPNSAYEVKMRAHTSVGPGPYSPPIQYRTVAIHPADVPKNFTVKWATKTTVVLGWK---FSERSPYKCVIE-----YA-------HQKKDVDARELKAFIKGLRHNTTYEFKV 1082          
BLAST of Protein tyrosine phosphatase receptor type D vs. Ensembl Medaka
Match: ptprsa (receptor-type tyrosine-protein phosphatase S [Source:NCBI gene;Acc:101174175])

HSP 1 Score: 712.22 bits (1837), Expect = 0.000e+0
Identity = 330/612 (53.92%), Postives = 440/612 (71.90%), Query Frame = 1
Query: 3988 LSPVLVSDSIKLRIGSQKSENISDRPSISICNLYQYVTDLKANDCTLLQAEFETLNTNLDDRFTWQRSNIDSNKSKNRYANVVAYDHTSVLLTPVDDVIGSDYINANYIDGYQRQNAYIATQGPLPDTTDDFWRMVWEQRSNCIVMMTRLEERSGIKCHQYWPNRGFICYGQMIVSHIDTFVLAYYTIRLFEIRHSKYSEKREIQHFQFTAWPDHGVPKLSTPLLMFIRRVRSIGKIESCPKIVHCSAGVGRTGAFIVVDAQLERIKQEKNIDVFNYVSKIRCQRNYMVQTQAQYQFILETLLEAVEDGNTEVMACNFHAHVTKLSQIGISGSNQLSGFEMEFSKLNSLASNRGRHGVMLADFVKAAGNQAVNMTKNRVRNIIPYEWNRVVLNAIRGIEGSDYINASYIDGYRDRRAYIAAQSPIPSTVEDFWRMLWDQHCGVVIVLNQPHE---DKSHIYWPINKSIRYQFFVVDPVVEYNMPNYILREFKVTDARDGEFRALRQFQFTQWPNHGCPKESESILDFIRQVHKTKEQFGHMEPMVIHCNTGSGRTGVFIALSIVLDRLQQESVVDMYQTVKLLHKQRIGLVQTEEQYEFCYMAVLDYLSNYE 5814
            ++P   +D +++R  + ++  + + P I I  L ++   LKAND   L  E+E+++     +FTW+ SN++ NK KNRYANV+AYDH+ V+L P++ + GSDYINANYIDGY++QNAYIATQGPLP+T  DFWRMVWEQR+  +VMMT+LEE+S IKC QYWP+RG   YG   V+ +DT  LA + +R F +  +  SEKRE++ FQFTAWPDHGVP+  TP L F+RRV++    ++ P I HCSAGVGRTG FIV+DA LERIK EK +D++ +V+ +R QRNYMVQT+ QY FI + LLEAV  GNTEV A + ++++ KL+Q  +     ++G E+EF +L +  ++  R       F+ A  N   N  KNR+ NI+PYE  RV L  IRG+EGSDYINAS+IDGYR +RAYI+ Q P+  T EDFWRMLW+ +  +V++L +  E   +K H YWP  +S RYQ+FVVDP+ EYNMP YILREFKVTDARDG+ R +RQFQFT WP  G PK  E  +DFI QVHKTKEQFG   P+ +HC+ G GRTGVFI LSIVL+R++ E VVD++QTVK+L  QR  +VQTE++Y+FCY A L+YL +++
Sbjct: 1308 ITPHHPTDPVEVRRINFQTPGMLNHPPIPISELAEHTELLKANDNLKLSQEYESIDPG--QQFTWEHSNLEVNKPKNRYANVIAYDHSRVILAPIEGITGSDYINANYIDGYRKQNAYIATQGPLPETFGDFWRMVWEQRAATVVMMTKLEEKSRIKCDQYWPSRGTETYGMTQVTLLDTIELATFCVRTFSLHKNGSSEKREVRQFQFTAWPDHGVPEYPTPFLAFLRRVKTCNPPDAGPIIAHCSAGVGRTGCFIVIDAMLERIKHEKTVDIYGHVTLMRSQRNYMVQTEDQYSFIHDALLEAVACGNTEVAARSLYSYIQKLAQ--VESGEHVTGMELEFKRLANSKAHTSR-------FISA--NLPCNKFKNRLVNIMPYETTRVCLQPIRGLEGSDYINASFIDGYRQQRAYISTQGPLAETTEDFWRMLWENNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDEYQFCYHAALEYLGSFD 1906          

HSP 2 Score: 203.756 bits (517), Expect = 5.717e-52
Identity = 105/262 (40.08%), Postives = 150/262 (57.25%), Query Frame = 1
Query: 5092 NQAVNMTKNRVRNIIPYEWNRVVLNAIRGIEGSDYINASYIDGYRDRRAYIAAQSPIPSTVEDFWRMLWDQHCGVVIVLNQPHEDKSHI----YWPINKSIRYQFFVVDPVVEYNMPNYILREFKVTDARDGEFRALRQFQFTQWPNHGCPKESESILDFIRQVHKTKEQFGHMEPMVIHCNTGSGRTGVFIALSIVLDRLQQESVVDMYQTVKLLHKQRIGLVQTEEQYEFCYMAVLDYLSNYEKILEKSHLY*TYQDLSE 5865
            N  VN  KNR  N+I Y+ +RV+L  I GI GSDYINA+YIDGYR + AYIA Q P+P T  DFWRM+W+Q    V+++ +  E+KS I    YWP   +  Y    V  +    +  + +R F +      E R +RQFQFT WP+HG P+     L F+R+V           P++ HC+ G GRTG FI +  +L+R++ E  VD+Y  V L+  QR  +VQTE+QY F + A+L+ ++     +    LY   Q L++
Sbjct: 1374 NLEVNKPKNRYANVIAYDHSRVILAPIEGITGSDYINANYIDGYRKQNAYIATQGPLPETFGDFWRMVWEQRAATVVMMTK-LEEKSRIKCDQYWPSRGTETYGMTQVTLLDTIELATFCVRTFSLHKNGSSEKREVRQFQFTAWPDHGVPEYPTPFLAFLRRVKTCNPP--DAGPIIAHCSAGVGRTGCFIVIDAMLERIKHEKTVDIYGHVTLMRSQRNYMVQTEDQYSFIHDALLEAVACGNTEVAARSLYSYIQKLAQ 1632          

HSP 3 Score: 136.346 bits (342), Expect = 2.041e-31
Identity = 217/969 (22.39%), Postives = 373/969 (38.49%), Query Frame = 1
Query:  313 PKISLIIQSPNVLLFKSMILACSSTGHPVPSISWKINESPIEELKSPLKKLQNPPRIFSIKNYQNSVLVITQLIESDSNSVLICEAENNAGFD-SRQQQLKVISTETDIPSGFPVFQNNFFPIIKPYNSNVTLVCQAYGNPPPLIQWFKNYELINESFTKIKILNDG-NLLLVQVTREDKGIYHCQAQNTNGLRLSDPSTLDITSYPISPNSLIIERFASDNVEISWRSGLNDVTEQENFILHYREVPENITEKQIMSKFVYLTISEKKSIYKYNLKDLFPFTTYCIWMESENPLGVSPPTIALTVKTLPTSPQLSPRSITATSISNTAILVAWRPPERKFGKFKYYQIIYTNNDGFLPQHWRQFAVKDDNV-MLTHLIASELYHIRVKIVNEIGHGPLSKTISIKTIAGTLSQCPDFKITEIFQSHIKLQWGTPDPVKLFKLIQYNLLCWDVRLKIVNATAKSSTLFPILNHNLSMNEMEYVLYLKNEKEIKCRLSAINSDGKGMPTE--IQASTVNKGVNYQNLIHIDKIGSTYITFQWRPPSKFS----FDYFLWIYQIFDSEKLDRAVKLPKIKINISDSASAE-----NGWFVYNYTNAFSSSRYILGLR-----YLCRDSTDILREYVHRSDLVSTMKSVPSDSPKDLVVKEIDSNSALVSWKPLDQVHSNGIITHYEVRYYAPKKEESTERFI--------------NVSETSAILSNLKY-FHYVIYVRAFTKVGGGSWSNPKNYYRQNLEEFPIPTTIKGERKSETEINISWELPVLSEKNLAHAAIEGF--------IILYAPVESSPKWIKYTVQSKNLSAVIKGLEPDLRYQFQIAATNYAGFNGNFSEIVQEM--PKNFPN--LNLKTVPDLRCSVQSSNRLKVEWSSPSISTDLLKFEIRYSGNLSYITEIGLKKSEFIDME-SKSVNFETLVNRYDVTLENLQSNALYKIAVRA 3078
            P I +  Q   V   ++  + C+++G+P P I+W  +  PI+   S  +          IK  ++  L I    E+D      C A N  G   S    L V           P       P       +V + C A G+P P ++W  N    +E  T    +  G N+L +   RE    Y C A ++ G+ +   + + + S P  P + ++    + +V I+W SG  D      +I+ Y+        K   SK  Y T+ +  +  +Y++  L+P T Y I + + N +G  PP+  +  +T   +P   PR++    +    ++V W  PE   G+ K Y++ YT +      +W    V+D  +  +  L   E Y I+V     +G GP S  I +K + G   Q   F++  +  + I+L W   +P    + I+     +++R +  N   +    F          +   V  L+   E    L+AI+  G G  T   +Q +   K       I      ST +   WRPP   S       +  +YQ+    +       P  +  I  +           W  Y+ T    S+  ++GL       +CR   D                 VP   P+ + V  ++S +  V W+ L     NG I  Y+V Y   +  ES    +              + +E   ++  LK    Y I V A+T  G G+ S PK    +     P P  +   + S+T   + W+ P L+        ++G+        I   A +E +P+  +Y+V + +  A          Y F++AA +  GF     E V E+  P+N P     +K   ++ C       + + WS P ++                ITE  L   E    E  + +     ++ Y   L +L+ N+ Y++ +RA
Sbjct:  137 PNIDMGPQLKVVERTRTATMLCAASGNPDPEITWYKDFLPIDPSASNGR----------IKQLRSGALQIENSEETDQGKYE-CVASNVEGVRYSSPANLYVRVRRVPPRFSIPPTSQEIMP-----GGSVNITCVAVGSPMPYVKWMLN----SEDLTPEDEMPVGRNVLELSSVRESAN-YTCVAMSSLGI-IESVAQITVKSLPKPPGTPVVTETTATSVTITWDSGNPDPVSY--YIIQYKA-------KSPDSK--YETVDDITTT-RYSIGGLYPNTEYEIRVSAINTIGQGPPSEPVETRTGEQAPASPPRNVNGQILPQNTMMVTWEEPEEPNGQIKGYRVYYTMDASQPMSNWHIHNVQDSVITTIRSLTPLETYTIKVLAFTSVGDGPFSPPIKVKVVQGVPGQPSKFQVGAVSDTSIELIW---EPAHDKEAIRR----YELRYRESNHGNQMKKTF-------DPTKSYVVESLRPNTEYYFSLAAISDKGIGAFTNEILQKTLQAKPSAPPQEIECSSTSSTSLLVSWRPPPLKSQNGDLTGYKVLYQVVSPSEGAGGDPQPTEEPMIPPTEEQVLLQRLGKWTQYHIT---VSAATVVGLGPESEPIICRTDED-----------------VPGAPPRRVEVDVLNSTAIKVMWRSLTPGKQNGQIRGYQVHYVRVENGESRGLPLIKDVMLADAQWETDDTAEYEMVIGGLKPDTTYSITVAAYTTKGDGARSKPKLVVTKGA--VPGPPYLSVAQNSKTSAVVHWDPPDLTNG----MDLQGYRLQFGRKDITPLATLEFAPQERRYSVDNIHRGAT---------YLFKMAAKSRGGFG---EEAVAELSVPENTPGGYPQIKEGSNVTCC-----SVLLSWSPPVLAE-----------RNGVITEYTLVYKEAGTGEIPRELRLHPSLSSY--VLNSLKPNSAYEVKMRA 1001          

HSP 4 Score: 103.219 bits (256), Expect = 2.827e-21
Identity = 202/914 (22.10%), Postives = 329/914 (36.00%), Query Frame = 1
Query:  370 LACSSTGHPVPSISW-----KINESPIEELKSPLKKLQNPPRIFSIKNYQNSVLVITQLIESDSNSVLICEAENNAGFDSRQQQLKVISTETDIPSGFPVFQNNFFPIIKPYNSNVTLVCQAYGNPPPLIQWFKNYELINESFT--KIKILNDGNLLLVQVTREDKGIYHCQAQNTNGLRLSDPSTLDI------TSYPISPNSLIIERFASDNVE----------ISWRSGLNDVTEQENFILHYREVPENITEKQIMSKFVYLTISEKKSIYKYNLKDLFPFTTYCIWMESENPLGVSPPTIALTVKTLPTSPQLSPRSITATSISNTAILVAWRPPERKFGKFKYYQIIYTNNDGFLPQHWRQFAVKDD----NVMLTHLIASELYHIRVKIVNEIGHGPLSKTISIKTIAGTLSQCPDFKITEIF-QSHIKLQWGTPDPVKLFKLIQYNLLCWDVRLKIVNATAKSSTLFPILNHNLSMNEMEYVLYLKNEKEIKCRLSAINSDGKGMPTEIQASTVNKGVNYQ-NLIHIDKIGSTYITFQWRPPSKFSFDYFLWIYQIFDSEKLDRAVKLPKIKINISDSASAENGWFVYNYTNAF------SSSRYILGLRYLCRDSTDILREYVHRSDLVSTMKSVPSDSPKDLVVKEIDSNSALVSWKPLDQVHSNGIITHYEVRYYAPKKEEST--------ERFINVSETSAILSNL-KYFHYVIYVRAFTKVGGGSWSNPKNYYRQNLEEFP--IPTTIKGERKSETEINISWELPVLSEKNLAHAAIEGFIILYAPVE---------------SSPKWIKYTVQSKNLSAVIKGLEPDLRYQFQIAATNYAGFNGNFSEIVQEMPKNFPNLNLKTVPDLRCSVQSSNRLKVEWSSPSIST--DLLKFEIRYS 2922
              C +TG P P +SW     K+N   IE ++                    +VL I  L      ++  C AEN+ G  S   +L +I  E  +P GFP         +       T++C A GNP P I W+K++  I+ S +  +IK L  G L +      D+G Y C A N  G+R S P+ L +        + I P S  I    S N+           + W     D+T ++        V  N+           L +S  +    Y           C+ M S   LG+      +TVK+LP  P     +   T  + T++ + W           YY I Y       P    ++   DD       +  L  +  Y IRV  +N IG GP S+ +  +T     +  P     +I  Q+ + + W  P+        + N      R+      ++  + + I  HN+  + +  +  L   +    ++ A  S G G  +      V +GV  Q +   +  +  T I   W P                D E + R       ++   +S         ++ T ++       ++ Y   L  +           + +  L    ++ PS  P+++      S S LVSW+P      NG +T Y+V Y      E          E  I  +E   +L  L K+  Y I V A T VG G  S P     +  E+ P   P  ++ +  + T I + W      ++N     I G+ + Y  VE               +  +W   T  +     VI GL+PD  Y   +AA    G +G  S+    + K      +   P L  +  S     V W  P ++   DL  + +++ 
Sbjct:   54 FVCHATGDPKPKVSWSKKGKKVNSQRIETIE--------------FDEGAGAVLRIQPLRAPRDENIYECVAENSEGEISVNARLAIIR-EDLLPPGFPNIDMGPQLKVVERTRTATMLCAASGNPDPEITWYKDFLPIDPSASNGRIKQLRSGALQIENSEETDQGKYECVASNVEGVRYSSPANLYVRVRRVPPRFSIPPTSQEIMPGGSVNITCVAVGSPMPYVKWMLNSEDLTPEDEM-----PVGRNV-----------LELSSVRESANYT----------CVAMSS---LGIIESVAQITVKSLPKPPG----TPVVTETTATSVTITWD--SGNPDPVSYYIIQYKAKS---PDS--KYETVDDITTTRYSIGGLYPNTEYEIRVSAINTIGQGPPSEPVETRTGEQAPASPPRNVNGQILPQNTMMVTWEEPE--------EPNGQIKGYRVYYTMDASQPMSNWHI--HNVQDSVITTIRSLTPLETYTIKVLAFTSVGDGPFSPPIKVKVVQGVPGQPSKFQVGAVSDTSIELIWEP--------------AHDKEAIRR------YELRYRESNHGNQMKKTFDPTKSYVVESLRPNTEYYFSLAAISDKGIGAFTNEILQKTL----QAKPSAPPQEIECSSTSSTSLLVSWRPPPLKSQNGDLTGYKVLYQVVSPSEGAGGDPQPTEEPMIPPTEEQVLLQRLGKWTQYHITVSAATVVGLGPESEP--IICRTDEDVPGAPPRRVEVDVLNSTAIKVMWRSLTPGKQN---GQIRGYQVHYVRVENGESRGLPLIKDVMLADAQW--ETDDTAEYEMVIGGLKPDTTYSITVAAYTTKG-DGARSKPKLVVTKG----AVPGPPYLSVAQNSKTSAVVHWDPPDLTNGMDLQGYRLQFG 866          

HSP 5 Score: 77.0258 bits (188), Expect = 1.970e-13
Identity = 140/627 (22.33%), Postives = 240/627 (38.28%), Query Frame = 1
Query:  913 ITSYPISPNSLIIERFASDNVEISWRSGLNDVTEQENFILHYREVPENITEKQIMSKFVYLTISEKKSIYKYNLKDLFPFTTYCIWMESENPLGVSPPTIALTVKTLPTSPQLSPRSITATSISNTAILVAWRPPERKF--GKFKYYQIIY-----TNNDGFLPQHWRQFAVK--DDNVMLTHLIASELYHIRVKIVNEIGHGPLSKTISIKTIAGTLSQCPDFKITEIFQS-HIKLQWGTPDPVKLFKLIQYNLLCWDVRLKIVNATAKSSTLFPILNHNLSMN---------EMEYVLY-LKNEKEIKCRLSAINSDGKGMPTEIQASTVNKGVNYQNLIHIDKIGSTYITFQWRPPSKFSFDYFLWIYQIFDSEKLDRAVKLPKIKINISDSASAENGWFVYNYTNAFSSSRYILGLRYLCRDSTDILREYVHRSDLVSTMKSVPSDSPKDLVVKEIDSNSALVSWKPLDQVHSNGIITHYEVRYY-APKKEESTERFINVSETSAILSNLK-YFHYVIYVRAFTKVGGGSWSNPKNYYRQNLEEFPIPTTIKGERKSETEINISWELPVLSEKNLAHAAIEGFIILYAPVESSPKWIKYTVQSKNLSAVIKGLEPDLRYQFQI 2727
            +   P  P+   +   +  ++E+ W    +D      + L YRE       K+        T    KS   Y ++ L P T Y   + + +  G+   T  +  KTL   P   P+ I  +S S+T++LV+WRPP  K   G    Y+++Y     +   G  PQ   +  +   ++ V+L  L     YHI V     +G GP S+ I  +T        P     ++  S  IK+ W +  P K    I+        ++  V      S   P++   +  +         E E V+  LK +      ++A  + G G  ++ +       V     + + +   T     W PP   +    L  Y++    +  R    P   +  +           Y+  N    + Y+  +    R       E V     +S  ++ P   P+      +   S L+SW P      NG+IT Y + Y  A   E   E  ++ S +S +L++LK    Y + +RA T VG G +S P  Y    +    +P     +  ++T + + W+    SE++     IE     YA         K  V ++ L A IKGL  +  Y+F++
Sbjct:  510 VQGVPGQPSKFQVGAVSDTSIELIWEPA-HDKEAIRRYELRYRESNHGNQMKK--------TFDPTKS---YVVESLRPNTEYYFSLAAISDKGIGAFTNEILQKTLQAKPSAPPQEIECSSTSSTSLLVSWRPPPLKSQNGDLTGYKVLYQVVSPSEGAGGDPQPTEEPMIPPTEEQVLLQRLGKWTQYHITVSAATVVGLGPESEPIICRTDEDVPGAPPRRVEVDVLNSTAIKVMWRSLTPGKQNGQIR------GYQVHYVRVENGESRGLPLIKDVMLADAQWETDDTAEYEMVIGGLKPDTTYSITVAAYTTKGDGARSKPKLVVTKGAVPGPPYLSVAQNSKTSAVVHWDPPD-LTNGMDLQGYRL----QFGRKDITPLATLEFAPQERR------YSVDNIHRGATYLFKMAAKSRGG--FGEEAVAE---LSVPENTPGGYPQIKEGSNVTCCSVLLSWSPPVLAERNGVITEYTLVYKEAGTGEIPRELRLHPSLSSYVLNSLKPNSAYEVKMRAHTSVGPGPYSPPIQYRTVAIHPADVPKNFTVKWATKTTVVLGWK---FSERSPYKCVIE-----YA-------HQKKDVDARELKAFIKGLRHNTTYEFKV 1087          
BLAST of Protein tyrosine phosphatase receptor type D vs. Ensembl Medaka
Match: ptprsa (receptor-type tyrosine-protein phosphatase S [Source:NCBI gene;Acc:101174175])

HSP 1 Score: 712.22 bits (1837), Expect = 0.000e+0
Identity = 330/612 (53.92%), Postives = 440/612 (71.90%), Query Frame = 1
Query: 3988 LSPVLVSDSIKLRIGSQKSENISDRPSISICNLYQYVTDLKANDCTLLQAEFETLNTNLDDRFTWQRSNIDSNKSKNRYANVVAYDHTSVLLTPVDDVIGSDYINANYIDGYQRQNAYIATQGPLPDTTDDFWRMVWEQRSNCIVMMTRLEERSGIKCHQYWPNRGFICYGQMIVSHIDTFVLAYYTIRLFEIRHSKYSEKREIQHFQFTAWPDHGVPKLSTPLLMFIRRVRSIGKIESCPKIVHCSAGVGRTGAFIVVDAQLERIKQEKNIDVFNYVSKIRCQRNYMVQTQAQYQFILETLLEAVEDGNTEVMACNFHAHVTKLSQIGISGSNQLSGFEMEFSKLNSLASNRGRHGVMLADFVKAAGNQAVNMTKNRVRNIIPYEWNRVVLNAIRGIEGSDYINASYIDGYRDRRAYIAAQSPIPSTVEDFWRMLWDQHCGVVIVLNQPHE---DKSHIYWPINKSIRYQFFVVDPVVEYNMPNYILREFKVTDARDGEFRALRQFQFTQWPNHGCPKESESILDFIRQVHKTKEQFGHMEPMVIHCNTGSGRTGVFIALSIVLDRLQQESVVDMYQTVKLLHKQRIGLVQTEEQYEFCYMAVLDYLSNYE 5814
            ++P   +D +++R  + ++  + + P I I  L ++   LKAND   L  E+E+++     +FTW+ SN++ NK KNRYANV+AYDH+ V+L P++ + GSDYINANYIDGY++QNAYIATQGPLP+T  DFWRMVWEQR+  +VMMT+LEE+S IKC QYWP+RG   YG   V+ +DT  LA + +R F +  +  SEKRE++ FQFTAWPDHGVP+  TP L F+RRV++    ++ P I HCSAGVGRTG FIV+DA LERIK EK +D++ +V+ +R QRNYMVQT+ QY FI + LLEAV  GNTEV A + ++++ KL+Q  +     ++G E+EF +L +  ++  R       F+ A  N   N  KNR+ NI+PYE  RV L  IRG+EGSDYINAS+IDGYR +RAYI+ Q P+  T EDFWRMLW+ +  +V++L +  E   +K H YWP  +S RYQ+FVVDP+ EYNMP YILREFKVTDARDG+ R +RQFQFT WP  G PK  E  +DFI QVHKTKEQFG   P+ +HC+ G GRTGVFI LSIVL+R++ E VVD++QTVK+L  QR  +VQTE++Y+FCY A L+YL +++
Sbjct: 1312 ITPHHPTDPVEVRRINFQTPGMLNHPPIPISELAEHTELLKANDNLKLSQEYESIDPG--QQFTWEHSNLEVNKPKNRYANVIAYDHSRVILAPIEGITGSDYINANYIDGYRKQNAYIATQGPLPETFGDFWRMVWEQRAATVVMMTKLEEKSRIKCDQYWPSRGTETYGMTQVTLLDTIELATFCVRTFSLHKNGSSEKREVRQFQFTAWPDHGVPEYPTPFLAFLRRVKTCNPPDAGPIIAHCSAGVGRTGCFIVIDAMLERIKHEKTVDIYGHVTLMRSQRNYMVQTEDQYSFIHDALLEAVACGNTEVAARSLYSYIQKLAQ--VESGEHVTGMELEFKRLANSKAHTSR-------FISA--NLPCNKFKNRLVNIMPYETTRVCLQPIRGLEGSDYINASFIDGYRQQRAYISTQGPLAETTEDFWRMLWENNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDEYQFCYHAALEYLGSFD 1910          

HSP 2 Score: 203.756 bits (517), Expect = 6.026e-52
Identity = 105/262 (40.08%), Postives = 150/262 (57.25%), Query Frame = 1
Query: 5092 NQAVNMTKNRVRNIIPYEWNRVVLNAIRGIEGSDYINASYIDGYRDRRAYIAAQSPIPSTVEDFWRMLWDQHCGVVIVLNQPHEDKSHI----YWPINKSIRYQFFVVDPVVEYNMPNYILREFKVTDARDGEFRALRQFQFTQWPNHGCPKESESILDFIRQVHKTKEQFGHMEPMVIHCNTGSGRTGVFIALSIVLDRLQQESVVDMYQTVKLLHKQRIGLVQTEEQYEFCYMAVLDYLSNYEKILEKSHLY*TYQDLSE 5865
            N  VN  KNR  N+I Y+ +RV+L  I GI GSDYINA+YIDGYR + AYIA Q P+P T  DFWRM+W+Q    V+++ +  E+KS I    YWP   +  Y    V  +    +  + +R F +      E R +RQFQFT WP+HG P+     L F+R+V           P++ HC+ G GRTG FI +  +L+R++ E  VD+Y  V L+  QR  +VQTE+QY F + A+L+ ++     +    LY   Q L++
Sbjct: 1378 NLEVNKPKNRYANVIAYDHSRVILAPIEGITGSDYINANYIDGYRKQNAYIATQGPLPETFGDFWRMVWEQRAATVVMMTK-LEEKSRIKCDQYWPSRGTETYGMTQVTLLDTIELATFCVRTFSLHKNGSSEKREVRQFQFTAWPDHGVPEYPTPFLAFLRRVKTCNPP--DAGPIIAHCSAGVGRTGCFIVIDAMLERIKHEKTVDIYGHVTLMRSQRNYMVQTEDQYSFIHDALLEAVACGNTEVAARSLYSYIQKLAQ 1636          

HSP 3 Score: 135.961 bits (341), Expect = 3.140e-31
Identity = 219/973 (22.51%), Postives = 377/973 (38.75%), Query Frame = 1
Query:  313 PKISLIIQSPNVLLFKSMILACSSTGHPVPSISWKINESPIEELKSPLKKLQNPPRIFSIKNYQNSVLVITQLIESDSNSVLICEAENNAGFD-SRQQQLKV--ISTETDIPSGF--PVFQNNFFPIIKPYNSNVTLVCQAYGNPPPLIQWFKNYELINESFTKIKILNDG-NLLLVQVTREDKGIYHCQAQNTNGLRLSDPSTLDITSYPISPNSLIIERFASDNVEISWRSGLNDVTEQENFILHYREVPENITEKQIMSKFVYLTISEKKSIYKYNLKDLFPFTTYCIWMESENPLGVSPPTIALTVKTLPTSPQLSPRSITATSISNTAILVAWRPPERKFGKFKYYQIIYTNNDGFLPQHWRQFAVKDDNV-MLTHLIASELYHIRVKIVNEIGHGPLSKTISIKTIAGTLSQCPDFKITEIFQSHIKLQWGTPDPVKLFKLIQYNLLCWDVRLKIVNATAKSSTLFPILNHNLSMNEMEYVLYLKNEKEIKCRLSAINSDGKGMPTE--IQASTVNKGVNYQNLIHIDKIGSTYITFQWRPPSKFS----FDYFLWIYQIFDSEKLDRAVKLPKIKINISDSASAE-----NGWFVYNYTNAFSSSRYILGLR-----YLCRDSTDILREYVHRSDLVSTMKSVPSDSPKDLVVKEIDSNSALVSWKPLDQVHSNGIITHYEVRYYAPKKEESTERFI--------------NVSETSAILSNLKY-FHYVIYVRAFTKVGGGSWSNPKNYYRQNLEEFPIPTTIKGERKSETEINISWELPVLSEKNLAHAAIEGF--------IILYAPVESSPKWIKYTVQSKNLSAVIKGLEPDLRYQFQIAATNYAGFNGNFSEIVQEM--PKNFPN--LNLKTVPDLRCSVQSSNRLKVEWSSPSISTDLLKFEIRYSGNLSYITEIGLKKSEFIDME-SKSVNFETLVNRYDVTLENLQSNALYKIAVRA 3078
            P I +  Q   V   ++  + C+++G+P P I+W  +  PI+   S  +          IK  ++  L I    E+D      C A N  G   S    L V  +     +P  F  P       P       +V + C A G+P P ++W  N    +E  T    +  G N+L +   RE    Y C A ++ G+ +   + + + S P  P + ++    + +V I+W SG  D      +I+ Y+        K   SK  Y T+ +  +  +Y++  L+P T Y I + + N +G  PP+  +  +T   +P   PR++    +    ++V W  PE   G+ K Y++ YT +      +W    V+D  +  +  L   E Y I+V     +G GP S  I +K + G   Q   F++  +  + I+L W   +P    + I+     +++R +  N   +    F          +   V  L+   E    L+AI+  G G  T   +Q +   K       I      ST +   WRPP   S       +  +YQ+    +       P  +  I  +           W  Y+ T    S+  ++GL       +CR   D                 VP   P+ + V  ++S +  V W+ L     NG I  Y+V Y   +  ES    +              + +E   ++  LK    Y I V A+T  G G+ S PK    +     P P  +   + S+T   + W+ P L+        ++G+        I   A +E +P+  +Y+V + +  A          Y F++AA +  GF     E V E+  P+N P     +K   ++ C       + + WS P ++                ITE  L   E    E  + +     ++ Y   L +L+ N+ Y++ +RA
Sbjct:  137 PNIDMGPQLKVVERTRTATMLCAASGNPDPEITWYKDFLPIDPSASNGR----------IKQLRSGALQIENSEETDQGKYE-CVASNVEGVRYSSPANLYVRELREVRRVPPRFSIPPTSQEIMP-----GGSVNITCVAVGSPMPYVKWMLN----SEDLTPEDEMPVGRNVLELSSVRESAN-YTCVAMSSLGI-IESVAQITVKSLPKPPGTPVVTETTATSVTITWDSGNPDPVSY--YIIQYKA-------KSPDSK--YETVDDITTT-RYSIGGLYPNTEYEIRVSAINTIGQGPPSEPVETRTGEQAPASPPRNVNGQILPQNTMMVTWEEPEEPNGQIKGYRVYYTMDASQPMSNWHIHNVQDSVITTIRSLTPLETYTIKVLAFTSVGDGPFSPPIKVKVVQGVPGQPSKFQVGAVSDTSIELIW---EPAHDKEAIRR----YELRYRESNHGNQMKKTF-------DPTKSYVVESLRPNTEYYFSLAAISDKGIGAFTNEILQKTLQAKPSAPPQEIECSSTSSTSLLVSWRPPPLKSQNGDLTGYKVLYQVVSPSEGAGGDPQPTEEPMIPPTEEQVLLQRLGKWTQYHIT---VSAATVVGLGPESEPIICRTDED-----------------VPGAPPRRVEVDVLNSTAIKVMWRSLTPGKQNGQIRGYQVHYVRVENGESRGLPLIKDVMLADAQWETDDTAEYEMVIGGLKPDTTYSITVAAYTTKGDGARSKPKLVVTKGA--VPGPPYLSVAQNSKTSAVVHWDPPDLTNG----MDLQGYRLQFGRKDITPLATLEFAPQERRYSVDNIHRGAT---------YLFKMAAKSRGGFG---EEAVAELSVPENTPGGYPQIKEGSNVTCC-----SVLLSWSPPVLAE-----------RNGVITEYTLVYKEAGTGEIPRELRLHPSLSSY--VLNSLKPNSAYEVKMRA 1005          

HSP 4 Score: 101.679 bits (252), Expect = 7.837e-21
Identity = 202/918 (22.00%), Postives = 329/918 (35.84%), Query Frame = 1
Query:  370 LACSSTGHPVPSISW-----KINESPIEELKSPLKKLQNPPRIFSIKNYQNSVLVITQLIESDSNSVLICEAENNAGFDSRQQQLKVISTETDIPSGFPVFQNNFFPIIKPYNSNVTLVCQAYGNPPPLIQWFKNYELINESFT--KIKILNDGNLLLVQVTREDKGIYHCQAQNTNGLRLSDPSTLDITS----------YPISPNSLIIERFASDNVE----------ISWRSGLNDVTEQENFILHYREVPENITEKQIMSKFVYLTISEKKSIYKYNLKDLFPFTTYCIWMESENPLGVSPPTIALTVKTLPTSPQLSPRSITATSISNTAILVAWRPPERKFGKFKYYQIIYTNNDGFLPQHWRQFAVKDD----NVMLTHLIASELYHIRVKIVNEIGHGPLSKTISIKTIAGTLSQCPDFKITEIF-QSHIKLQWGTPDPVKLFKLIQYNLLCWDVRLKIVNATAKSSTLFPILNHNLSMNEMEYVLYLKNEKEIKCRLSAINSDGKGMPTEIQASTVNKGVNYQ-NLIHIDKIGSTYITFQWRPPSKFSFDYFLWIYQIFDSEKLDRAVKLPKIKINISDSASAENGWFVYNYTNAF------SSSRYILGLRYLCRDSTDILREYVHRSDLVSTMKSVPSDSPKDLVVKEIDSNSALVSWKPLDQVHSNGIITHYEVRYYAPKKEEST--------ERFINVSETSAILSNL-KYFHYVIYVRAFTKVGGGSWSNPKNYYRQNLEEFP--IPTTIKGERKSETEINISWELPVLSEKNLAHAAIEGFIILYAPVE---------------SSPKWIKYTVQSKNLSAVIKGLEPDLRYQFQIAATNYAGFNGNFSEIVQEMPKNFPNLNLKTVPDLRCSVQSSNRLKVEWSSPSIST--DLLKFEIRYS 2922
              C +TG P P +SW     K+N   IE ++                    +VL I  L      ++  C AEN+ G  S   +L +I  E  +P GFP         +       T++C A GNP P I W+K++  I+ S +  +IK L  G L +      D+G Y C A N  G+R S P+ L +            + I P S  I    S N+           + W     D+T ++        V  N+           L +S  +    Y           C+ M S   LG+      +TVK+LP  P     +   T  + T++ + W           YY I Y       P    ++   DD       +  L  +  Y IRV  +N IG GP S+ +  +T     +  P     +I  Q+ + + W  P+        + N      R+      ++  + + I  HN+  + +  +  L   +    ++ A  S G G  +      V +GV  Q +   +  +  T I   W P                D E + R       ++   +S         ++ T ++       ++ Y   L  +           + +  L    ++ PS  P+++      S S LVSW+P      NG +T Y+V Y      E          E  I  +E   +L  L K+  Y I V A T VG G  S P     +  E+ P   P  ++ +  + T I + W      ++N     I G+ + Y  VE               +  +W   T  +     VI GL+PD  Y   +AA    G +G  S+    + K      +   P L  +  S     V W  P ++   DL  + +++ 
Sbjct:   54 FVCHATGDPKPKVSWSKKGKKVNSQRIETIE--------------FDEGAGAVLRIQPLRAPRDENIYECVAENSEGEISVNARLAIIR-EDLLPPGFPNIDMGPQLKVVERTRTATMLCAASGNPDPEITWYKDFLPIDPSASNGRIKQLRSGALQIENSEETDQGKYECVASNVEGVRYSSPANLYVRELREVRRVPPRFSIPPTSQEIMPGGSVNITCVAVGSPMPYVKWMLNSEDLTPEDEM-----PVGRNV-----------LELSSVRESANYT----------CVAMSS---LGIIESVAQITVKSLPKPPG----TPVVTETTATSVTITWD--SGNPDPVSYYIIQYKAKS---PDS--KYETVDDITTTRYSIGGLYPNTEYEIRVSAINTIGQGPPSEPVETRTGEQAPASPPRNVNGQILPQNTMMVTWEEPE--------EPNGQIKGYRVYYTMDASQPMSNWHI--HNVQDSVITTIRSLTPLETYTIKVLAFTSVGDGPFSPPIKVKVVQGVPGQPSKFQVGAVSDTSIELIWEP--------------AHDKEAIRR------YELRYRESNHGNQMKKTFDPTKSYVVESLRPNTEYYFSLAAISDKGIGAFTNEILQKTL----QAKPSAPPQEIECSSTSSTSLLVSWRPPPLKSQNGDLTGYKVLYQVVSPSEGAGGDPQPTEEPMIPPTEEQVLLQRLGKWTQYHITVSAATVVGLGPESEP--IICRTDEDVPGAPPRRVEVDVLNSTAIKVMWRSLTPGKQN---GQIRGYQVHYVRVENGESRGLPLIKDVMLADAQW--ETDDTAEYEMVIGGLKPDTTYSITVAAYTTKG-DGARSKPKLVVTKG----AVPGPPYLSVAQNSKTSAVVHWDPPDLTNGMDLQGYRLQFG 870          

HSP 5 Score: 77.0258 bits (188), Expect = 2.022e-13
Identity = 140/627 (22.33%), Postives = 240/627 (38.28%), Query Frame = 1
Query:  913 ITSYPISPNSLIIERFASDNVEISWRSGLNDVTEQENFILHYREVPENITEKQIMSKFVYLTISEKKSIYKYNLKDLFPFTTYCIWMESENPLGVSPPTIALTVKTLPTSPQLSPRSITATSISNTAILVAWRPPERKF--GKFKYYQIIY-----TNNDGFLPQHWRQFAVK--DDNVMLTHLIASELYHIRVKIVNEIGHGPLSKTISIKTIAGTLSQCPDFKITEIFQS-HIKLQWGTPDPVKLFKLIQYNLLCWDVRLKIVNATAKSSTLFPILNHNLSMN---------EMEYVLY-LKNEKEIKCRLSAINSDGKGMPTEIQASTVNKGVNYQNLIHIDKIGSTYITFQWRPPSKFSFDYFLWIYQIFDSEKLDRAVKLPKIKINISDSASAENGWFVYNYTNAFSSSRYILGLRYLCRDSTDILREYVHRSDLVSTMKSVPSDSPKDLVVKEIDSNSALVSWKPLDQVHSNGIITHYEVRYY-APKKEESTERFINVSETSAILSNLK-YFHYVIYVRAFTKVGGGSWSNPKNYYRQNLEEFPIPTTIKGERKSETEINISWELPVLSEKNLAHAAIEGFIILYAPVESSPKWIKYTVQSKNLSAVIKGLEPDLRYQFQI 2727
            +   P  P+   +   +  ++E+ W    +D      + L YRE       K+        T    KS   Y ++ L P T Y   + + +  G+   T  +  KTL   P   P+ I  +S S+T++LV+WRPP  K   G    Y+++Y     +   G  PQ   +  +   ++ V+L  L     YHI V     +G GP S+ I  +T        P     ++  S  IK+ W +  P K    I+        ++  V      S   P++   +  +         E E V+  LK +      ++A  + G G  ++ +       V     + + +   T     W PP   +    L  Y++    +  R    P   +  +           Y+  N    + Y+  +    R       E V     +S  ++ P   P+      +   S L+SW P      NG+IT Y + Y  A   E   E  ++ S +S +L++LK    Y + +RA T VG G +S P  Y    +    +P     +  ++T + + W+    SE++     IE     YA         K  V ++ L A IKGL  +  Y+F++
Sbjct:  514 VQGVPGQPSKFQVGAVSDTSIELIWEPA-HDKEAIRRYELRYRESNHGNQMKK--------TFDPTKS---YVVESLRPNTEYYFSLAAISDKGIGAFTNEILQKTLQAKPSAPPQEIECSSTSSTSLLVSWRPPPLKSQNGDLTGYKVLYQVVSPSEGAGGDPQPTEEPMIPPTEEQVLLQRLGKWTQYHITVSAATVVGLGPESEPIICRTDEDVPGAPPRRVEVDVLNSTAIKVMWRSLTPGKQNGQIR------GYQVHYVRVENGESRGLPLIKDVMLADAQWETDDTAEYEMVIGGLKPDTTYSITVAAYTTKGDGARSKPKLVVTKGAVPGPPYLSVAQNSKTSAVVHWDPPD-LTNGMDLQGYRL----QFGRKDITPLATLEFAPQERR------YSVDNIHRGATYLFKMAAKSRGG--FGEEAVAE---LSVPENTPGGYPQIKEGSNVTCCSVLLSWSPPVLAERNGVITEYTLVYKEAGTGEIPRELRLHPSLSSYVLNSLKPNSAYEVKMRAHTSVGPGPYSPPIQYRTVAIHPADVPKNFTVKWATKTTVVLGWK---FSERSPYKCVIE-----YA-------HQKKDVDARELKAFIKGLRHNTTYEFKV 1091          
BLAST of Protein tyrosine phosphatase receptor type D vs. Planmine SMEST
Match: SMESG000053906.1 (SMESG000053906.1)

HSP 1 Score: 3762.62 bits (9756), Expect = 0.000e+0
Identity = 1845/1848 (99.84%), Postives = 1847/1848 (99.95%), Query Frame = 1
Query:  298 ENDEAPKISLIIQSPNVLLFKSMILACSSTGHPVPSISWKINESPIEELKSPLKKLQNPPRIFSIKNYQNSVLVITQLIESDSNSVLICEAENNAGFDSRQQQLKVISTETDIPSGFPVFQNNFFPIIKPYNSNVTLVCQAYGNPPPLIQWFKNYELINESFTKIKILNDGNLLLVQVTREDKGIYHCQAQNTNGLRLSDPSTLDITSYPISPNSLIIERFASDNVEISWRSGLNDVTEQENFILHYREVPENITEKQIMSKFVYLTISEKKSIYKYNLKDLFPFTTYCIWMESENPLGVSPPTIALTVKTLPTSPQLSPRSITATSISNTAILVAWRPPERKFGKFKYYQIIYTNNDGFLPQHWRQFAVKDDNVMLTHLIASELYHIRVKIVNEIGHGPLSKTISIKTIAGTLSQCPDFKITEIFQSHIKLQWGTPDPVKLFKLIQYNLLCWDVRLKIVNATAKSSTLFPILNHNLSMNEMEYVLYLKNEKEIKCRLSAINSDGKGMPTEIQASTVNKGVNYQNLIHIDKIGSTYITFQWRPPSKFSFDYFLWIYQIFDSEKLDRAVKLPKIKINISDSASAENGWFVYNYTNAFSSSRYILGLRYLCRDSTDILREYVHRSDLVSTMKSVPSDSPKDLVVKEIDSNSALVSWKPLDQVHSNGIITHYEVRYYAPKKEESTERFINVSETSAILSNLKYFHYVIYVRAFTKVGGGSWSNPKNYYRQNLEEFPIPTTIKGERKSETEINISWELPVLSEKNLAHAAIEGFIILYAPVESSPKWIKYTVQSKNLSAVIKGLEPDLRYQFQIAATNYAGFNGNFSEIVQEMPKNFPNLNLKTVPDLRCSVQSSNRLKVEWSSPSISTDLLKFEIRYSGNLSYITEIGLKKSEFIDMESKSVNFETLVNRYDVTLENLQSNALYKIAVRAIYQNKELYESHRETTCDTMPAVPNLVKPPIIVGLDEEKSKVIIKLHRCSQRNGKISYYFVIVAAFQGNKNQQISFQEDTESYTFMELSVNTRSNNAKGEYIAIMKDINDIFKVSGKDHSSVLLGDGTHDENHLSVNKKLEKNFNYRCFARVCLKYSNNSLCKSSPWSEPFRISDLILNRNVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXASIIIGCIVKRKKSKERFMHLGNHDDIRSSIGMKSSMLNGLMAADKIFVSAEVDEPFNSDKKYTSMSLKPDIKSIPDLVNADSVQMCQDGTKLSPVLVSDSIKLRIGSQKSENISDRPSISICNLYQYVTDLKANDCTLLQAEFETLNTNLDDRFTWQRSNIDSNKSKNRYANVVAYDHTSVLLTPVDDVIGSDYINANYIDGYQRQNAYIATQGPLPDTTDDFWRMVWEQRSNCIVMMTRLEERSGIKCHQYWPNRGFICYGQMIVSHIDTFVLAYYTIRLFEIRHSKYSEKREIQHFQFTAWPDHGVPKLSTPLLMFIRRVRSIGKIESCPKIVHCSAGVGRTGAFIVVDAQLERIKQEKNIDVFNYVSKIRCQRNYMVQTQAQYQFILETLLEAVEDGNTEVMACNFHAHVTKLSQIGISGSNQLSGFEMEFSKLNSLASNRGRHGVMLADFVKAAGNQAVNMTKNRVRNIIPYEWNRVVLNAIRGIEGSDYINASYIDGYRDRRAYIAAQSPIPSTVEDFWRMLWDQHCGVVIVLNQPHEDKSHIYWPINKSIRYQFFVVDPVVEYNMPNYILREFKVTDARDGEFRALRQFQFTQWPNHGCPKESESILDFIRQVHKTKEQFGHMEPMVIHCNTGSGRTGVFIALSIVLDRLQQESVVDMYQTVKLLHKQRIGLVQTEEQYEFCYMAVLDYLSNYEKILEKSHLY 5841
            ++ EAPKISLIIQSPNVLLFKSMILACSSTGHPVPSISWKINESPIEELKSPLKKLQNPPRIFSIKNYQNSVLVITQLIESDSNSVLICEAENNAGFDSRQQQLKVISTETDIPSGFPVFQNNFFPIIKPYNSNVTLVCQAYGNPPPLIQWFKNYELINESFTKIKILNDGNLLLVQVTREDKGIYHCQAQNTNGLRLSDPSTLDITSYPISPNSLIIERFASDNVEISWRSGLNDVTEQENFILHYREVPENITEKQIMSKFVYLTISEKKSIYKYNLKDLFPFTTYCIWMESENPLGVSPPTIALTVKTLPTSPQLSPRSITATSISNTAILVAWRPPERKFGKFKYYQIIYTNNDGFLPQHWRQFAVKDDNVMLTHLIASELYHIRVKIVNEIGHGPLSKTISIKTIAGTLSQCPDFKITEIFQSHIKLQWGTPDPVKLFKLIQYNLLCWDVRLKIVNATAKSSTLFPILNHNLSMNEMEYVLYLKNEKEIKCRLSAINSDGKGMPTEIQASTVNKGVNYQNLIHIDKIGSTYITFQWRPPSKFSFDYFLWIYQIFDSEKLDRAVKLPKIKINISDSASAENGWFVYNYTNAFSSSRYILGLRYLCRDSTDILREYVHRSDLVSTMKSVPSDSPKDLVVKEIDSNSALVSWKPLDQVHSNGIITHYEVRYYAPKKEESTERFINVSETSAILSNLKYFHYVIYVRAFTKVGGGSWSNPKNYYRQNLEEFPIPTTIKGERKSETEINISWELPVLSEKNLAHAAIEGFIILYAPVESSPKWIKYTVQSKNLSAVIKGLEPDLRYQFQIAATNYAGFNGNFSEIVQEMPKNFPNLNLKTVPDLRCSVQSSNRLKVEWSSPSISTDLLKFEIRYSGNLSYITEIGLKKSEFIDMESKSVNFETLVNRYDVTLENLQSNALYKIAVRAIYQNKELYESHRETTCDTMPAVPNLVKPPIIVGLDEEKSKVIIKLHRCSQRNGKISYYFVIVAAFQGNKNQQISFQEDTESYTFMELSVNTRSNNAKGEYIAIMKDINDIFKVSGKDHSSVLLGDGTHDENHLSVNKKLEKNFNYRCFARVCLKYSNNSLCKSSPWSEPFRISDLILNRNVSLSSSKSSKDSYSNSSIIIILLVCGVILAVASIIIGCIVKRKKSKERFMHLGNHDDIRSSIGMKSSMLNGLMAADKIFVSAEVDEPFNSDKKYTSMSLKPDIKSIPDLVNADSVQMCQDGTKLSPVLVSDSIKLRIGSQKSENISDRPSISICNLYQYVTDLKANDCTLLQAEFETLNTNLDDRFTWQRSNIDSNKSKNRYANVVAYDHTSVLLTPVDDVIGSDYINANYIDGYQRQNAYIATQGPLPDTTDDFWRMVWEQRSNCIVMMTRLEERSGIKCHQYWPNRGFICYGQMIVSHIDTFVLAYYTIRLFEIRHSKYSEKREIQHFQFTAWPDHGVPKLSTPLLMFIRRVRSIGKIESCPKIVHCSAGVGRTGAFIVVDAQLERIKQEKNIDVFNYVSKIRCQRNYMVQTQAQYQFILETLLEAVEDGNTEVMACNFHAHVTKLSQIGISGSNQLSGFEMEFSKLNSLASNRGRHGVMLADFVKAAGNQAVNMTKNRVRNIIPYEWNRVVLNAIRGIEGSDYINASYIDGYRDRRAYIAAQSPIPSTVEDFWRMLWDQHCGVVIVLNQPHEDKSHIYWPINKSIRYQFFVVDPVVEYNMPNYILREFKVTDARDGEFRALRQFQFTQWPNHGCPKESESILDFIRQVHKTKEQFGHMEPMVIHCNTGSGRTGVFIALSIVLDRLQQESVVDMYQTVKLLHKQRIGLVQTEEQYEFCYMAVLDYLSNYEKILEKSHLY
Sbjct:   36 KHKEAPKISLIIQSPNVLLFKSMILACSSTGHPVPSISWKINESPIEELKSPLKKLQNPPRIFSIKNYQNSVLVITQLIESDSNSVLICEAENNAGFDSRQQQLKVISTETDIPSGFPVFQNNFFPIIKPYNSNVTLVCQAYGNPPPLIQWFKNYELINESFTKIKILNDGNLLLVQVTREDKGIYHCQAQNTNGLRLSDPSTLDITSYPISPNSLIIERFASDNVEISWRSGLNDVTEQENFILHYREVPENITEKQIMSKFVYLTISEKKSIYKYNLKDLFPFTTYCIWMESENPLGVSPPTIALTVKTLPTSPQLSPRSITATSISNTAILVAWRPPERKFGKFKYYQIIYTNNDGFLPQHWRQFAVKDDNVMLTHLIASELYHIRVKIVNEIGHGPLSKTISIKTIAGTLSQCPDFKITEIFQSHIKLQWGTPDPVKLFKLIQYNLLCWDVRLKIVNATAKSSTLFPILNHNLSMNEMEYVLYLKNEKEIKCRLSAINSDGKGMPTEIQASTVNKGVNYQNLIHIDKIGSTYITFQWRPPSKFSFDYFLWIYQIFDSEKLDRAVKLPKIKINISDSASAENGWFVYNYTNAFSSSRYILGLRYLCRDSTDILREYVHRSDLVSTMKSVPSDSPKDLVVKEIDSNSALVSWKPLDQVHSNGIITHYEVRYYAPKKEESTERFINVSETSAILSNLKYFHYVIYVRAFTKVGGGSWSNPKNYYRQNLEEFPIPTTIKGERKSETEINISWELPVLSEKNLAHAAIEGFIILYAPVESSPKWIKYTVQSKNLSAVIKGLEPDLRYQFQIAATNYAGFNGNFSEIVQEMPKNFPNLNLKTVPDLRCSVQSSNRLKVEWSSPSISTDLLKFEIRYSGNLSYITEIGLKKSEFIDMESKSVNFETLVNRYDVTLENLQSNALYKIAVRAIYQNKELYESHRETTCDTMPAVPNLVKPPIIVGLDEEKSKVIIKLHRCSQRNGKISYYFVIVAAFQGNKNQQISFQEDTESYTFMELSVNTRSNNAKGEYIAIMKDINDIFKVSGKDHSSVLLGDGTHDENHLSVNKKLEKNFNYRCFARVCLKYSNNSLCKSSPWSEPFRISDLILNRNVSLSSSKSSKDSYSNSSIIIILLVCGVILAVASIIIGCIVKRKKSKERFMHLGNHDDIRSSIGMKSSMLNGLMAADKIFVSAEVDEPFNSDKKYTSMSLKPDIKSIPDLVNADSVQMCQDGTKLSPVLVSDSIKLRIGSQKSENISDRPSISICNLYQYVTDLKANDCTLLQAEFETLNTNLDDRFTWQRSNIDSNKSKNRYANVVAYDHTSVLLTPVDDVIGSDYINANYIDGYQRQNAYIATQGPLPDTTDDFWRMVWEQRSNCIVMMTRLEERSGIKCHQYWPNRGFICYGQMIVSHIDTFVLAYYTIRLFEIRHSKYSEKREIQHFQFTAWPDHGVPKLSTPLLMFIRRVRSIGKIESCPKIVHCSAGVGRTGAFIVVDAQLERIKQEKNIDVFNYVSKIRCQRNYMVQTQAQYQFILETLLEAVEDGNTEVMACNFHAHVTKLSQIGISGSNQLSGFEMEFSKLNSLASNRGRHGVMLADFVKAAGNQAVNMTKNRVRNIIPYEWNRVVLNAIRGIEGSDYINASYIDGYRDRRAYIAAQSPIPSTVEDFWRMLWDQHCGVVIVLNQPHEDKSHIYWPINKSIRYQFFVVDPVVEYNMPNYILREFKVTDARDGEFRALRQFQFTQWPNHGCPKESESILDFIRQVHKTKEQFGHMEPMVIHCNTGSGRTGVFIALSIVLDRLQQESVVDMYQTVKLLHKQRIGLVQTEEQYEFCYMAVLDYLSNYEKILEKSHLY 1883          
BLAST of Protein tyrosine phosphatase receptor type D vs. Planmine SMEST
Match: SMESG000053906.1 (SMESG000053906.1)

HSP 1 Score: 3759.92 bits (9749), Expect = 0.000e+0
Identity = 1845/1848 (99.84%), Postives = 1847/1848 (99.95%), Query Frame = 1
Query:  298 ENDEAPKISLIIQSPNVLLFKSMILACSSTGHPVPSISWKINESPIEELKSPLKKLQNPPRIFSIKNYQNSVLVITQLIESDSNSVLICEAENNAGFDSRQQQLKVISTETDIPSGFPVFQNNFFPIIKPYNSNVTLVCQAYGNPPPLIQWFKNYELINESFTKIKILNDGNLLLVQVTREDKGIYHCQAQNTNGLRLSDPSTLDITSYPISPNSLIIERFASDNVEISWRSGLNDVTEQENFILHYREVPENITEKQIMSKFVYLTISEKKSIYKYNLKDLFPFTTYCIWMESENPLGVSPPTIALTVKTLPTSPQLSPRSITATSISNTAILVAWRPPERKFGKFKYYQIIYTNNDGFLPQHWRQFAVKDDNVMLTHLIASELYHIRVKIVNEIGHGPLSKTISIKTIAGTLSQCPDFKITEIFQSHIKLQWGTPDPVKLFKLIQYNLLCWDVRLKIVNATAKSSTLFPILNHNLSMNEMEYVLYLKNEKEIKCRLSAINSDGKGMPTEIQASTVNKGVNYQNLIHIDKIGSTYITFQWRPPSKFSFDYFLWIYQIFDSEKLDRAVKLPKIKINISDSASAENGWFVYNYTNAFSSSRYILGLRYLCRDSTDILREYVHRSDLVSTMKSVPSDSPKDLVVKEIDSNSALVSWKPLDQVHSNGIITHYEVRYYAPKKEESTERFINVSETSAILSNLKYFHYVIYVRAFTKVGGGSWSNPKNYYRQNLEEFPIPTTIKGERKSETEINISWELPVLSEKNLAHAAIEGFIILYAPVESSPKWIKYTVQSKNLSAVIKGLEPDLRYQFQIAATNYAGFNGNFSEIVQEMPKNFPNLNLKTVPDLRCSVQSSNRLKVEWSSPSISTDLLKFEIRYSGNLSYITEIGLKKSEFIDMESKSVNFETLVNRYDVTLENLQSNALYKIAVRAIYQNKELYESHRETTCDTMPAVPNLVKPPIIVGLDEEKSKVIIKLHRCSQRNGKISYYFVIVAAFQGNKNQQISFQEDTESYTFMELSVNTRSNNAKGEYIAIMKDINDIFKVSGKDHSSVLLGDGTHDENHLSVNKKLEKNFNYRCFARVCLKYSNNSLCKSSPWSEPFRISDLILNRNVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXASIIIGCIVKRKKSKERFMHLGNHDDIRSSIGMKSSMLNGLMAADKIFVSAEVDEPFNSDKKYTSMSLKPDIKSIPDLVNADSVQMCQDGTKLSPVLVSDSIKLRIGSQKSENISDRPSISICNLYQYVTDLKANDCTLLQAEFETLNTNLDDRFTWQRSNIDSNKSKNRYANVVAYDHTSVLLTPVDDVIGSDYINANYIDGYQRQNAYIATQGPLPDTTDDFWRMVWEQRSNCIVMMTRLEERSGIKCHQYWPNRGFICYGQMIVSHIDTFVLAYYTIRLFEIRHSKYSEKREIQHFQFTAWPDHGVPKLSTPLLMFIRRVRSIGKIESCPKIVHCSAGVGRTGAFIVVDAQLERIKQEKNIDVFNYVSKIRCQRNYMVQTQAQYQFILETLLEAVEDGNTEVMACNFHAHVTKLSQIGISGSNQLSGFEMEFSKLNSLASNRGRHGVMLADFVKAAGNQAVNMTKNRVRNIIPYEWNRVVLNAIRGIEGSDYINASYIDGYRDRRAYIAAQSPIPSTVEDFWRMLWDQHCGVVIVLNQPHEDKSHIYWPINKSIRYQFFVVDPVVEYNMPNYILREFKVTDARDGEFRALRQFQFTQWPNHGCPKESESILDFIRQVHKTKEQFGHMEPMVIHCNTGSGRTGVFIALSIVLDRLQQESVVDMYQTVKLLHKQRIGLVQTEEQYEFCYMAVLDYLSNYEKILEKSHLY 5841
            ++ EAPKISLIIQSPNVLLFKSMILACSSTGHPVPSISWKINESPIEELKSPLKKLQNPPRIFSIKNYQNSVLVITQLIESDSNSVLICEAENNAGFDSRQQQLKVISTETDIPSGFPVFQNNFFPIIKPYNSNVTLVCQAYGNPPPLIQWFKNYELINESFTKIKILNDGNLLLVQVTREDKGIYHCQAQNTNGLRLSDPSTLDITSYPISPNSLIIERFASDNVEISWRSGLNDVTEQENFILHYREVPENITEKQIMSKFVYLTISEKKSIYKYNLKDLFPFTTYCIWMESENPLGVSPPTIALTVKTLPTSPQLSPRSITATSISNTAILVAWRPPERKFGKFKYYQIIYTNNDGFLPQHWRQFAVKDDNVMLTHLIASELYHIRVKIVNEIGHGPLSKTISIKTIAGTLSQCPDFKITEIFQSHIKLQWGTPDPVKLFKLIQYNLLCWDVRLKIVNATAKSSTLFPILNHNLSMNEMEYVLYLKNEKEIKCRLSAINSDGKGMPTEIQASTVNKGVNYQNLIHIDKIGSTYITFQWRPPSKFSFDYFLWIYQIFDSEKLDRAVKLPKIKINISDSASAENGWFVYNYTNAFSSSRYILGLRYLCRDSTDILREYVHRSDLVSTMKSVPSDSPKDLVVKEIDSNSALVSWKPLDQVHSNGIITHYEVRYYAPKKEESTERFINVSETSAILSNLKYFHYVIYVRAFTKVGGGSWSNPKNYYRQNLEEFPIPTTIKGERKSETEINISWELPVLSEKNLAHAAIEGFIILYAPVESSPKWIKYTVQSKNLSAVIKGLEPDLRYQFQIAATNYAGFNGNFSEIVQEMPKNFPNLNLKTVPDLRCSVQSSNRLKVEWSSPSISTDLLKFEIRYSGNLSYITEIGLKKSEFIDMESKSVNFETLVNRYDVTLENLQSNALYKIAVRAIYQNKELYESHRETTCDTMPAVPNLVKPPIIVGLDEEKSKVIIKLHRCSQRNGKISYYFVIVAAFQGNKNQQISFQEDTESYTFMELSVNTRSNNAKGEYIAIMKDINDIFKVSGKDHSSVLLGDGTHDENHLSVNKKLEKNFNYRCFARVCLKYSNNSLCKSSPWSEPFRISDLILNRNVSLSSSKSSKDSYSNSSIIIILLVCGVILAVASIIIGCIVKRKKSKERFMHLGNHDDIRSSIGMKSSMLNGLMAADKIFVSAEVDEPFNSDKKYTSMSLKPDIKSIPDLVNADSVQMCQDGTKLSPVLVSDSIKLRIGSQKSENISDRPSISICNLYQYVTDLKANDCTLLQAEFETLNTNLDDRFTWQRSNIDSNKSKNRYANVVAYDHTSVLLTPVDDVIGSDYINANYIDGYQRQNAYIATQGPLPDTTDDFWRMVWEQRSNCIVMMTRLEERSGIKCHQYWPNRGFICYGQMIVSHIDTFVLAYYTIRLFEIRHSKYSEKREIQHFQFTAWPDHGVPKLSTPLLMFIRRVRSIGKIESCPKIVHCSAGVGRTGAFIVVDAQLERIKQEKNIDVFNYVSKIRCQRNYMVQTQAQYQFILETLLEAVEDGNTEVMACNFHAHVTKLSQIGISGSNQLSGFEMEFSKLNSLASNRGRHGVMLADFVKAAGNQAVNMTKNRVRNIIPYEWNRVVLNAIRGIEGSDYINASYIDGYRDRRAYIAAQSPIPSTVEDFWRMLWDQHCGVVIVLNQPHEDKSHIYWPINKSIRYQFFVVDPVVEYNMPNYILREFKVTDARDGEFRALRQFQFTQWPNHGCPKESESILDFIRQVHKTKEQFGHMEPMVIHCNTGSGRTGVFIALSIVLDRLQQESVVDMYQTVKLLHKQRIGLVQTEEQYEFCYMAVLDYLSNYEKILEKSHLY
Sbjct:    4 KHKEAPKISLIIQSPNVLLFKSMILACSSTGHPVPSISWKINESPIEELKSPLKKLQNPPRIFSIKNYQNSVLVITQLIESDSNSVLICEAENNAGFDSRQQQLKVISTETDIPSGFPVFQNNFFPIIKPYNSNVTLVCQAYGNPPPLIQWFKNYELINESFTKIKILNDGNLLLVQVTREDKGIYHCQAQNTNGLRLSDPSTLDITSYPISPNSLIIERFASDNVEISWRSGLNDVTEQENFILHYREVPENITEKQIMSKFVYLTISEKKSIYKYNLKDLFPFTTYCIWMESENPLGVSPPTIALTVKTLPTSPQLSPRSITATSISNTAILVAWRPPERKFGKFKYYQIIYTNNDGFLPQHWRQFAVKDDNVMLTHLIASELYHIRVKIVNEIGHGPLSKTISIKTIAGTLSQCPDFKITEIFQSHIKLQWGTPDPVKLFKLIQYNLLCWDVRLKIVNATAKSSTLFPILNHNLSMNEMEYVLYLKNEKEIKCRLSAINSDGKGMPTEIQASTVNKGVNYQNLIHIDKIGSTYITFQWRPPSKFSFDYFLWIYQIFDSEKLDRAVKLPKIKINISDSASAENGWFVYNYTNAFSSSRYILGLRYLCRDSTDILREYVHRSDLVSTMKSVPSDSPKDLVVKEIDSNSALVSWKPLDQVHSNGIITHYEVRYYAPKKEESTERFINVSETSAILSNLKYFHYVIYVRAFTKVGGGSWSNPKNYYRQNLEEFPIPTTIKGERKSETEINISWELPVLSEKNLAHAAIEGFIILYAPVESSPKWIKYTVQSKNLSAVIKGLEPDLRYQFQIAATNYAGFNGNFSEIVQEMPKNFPNLNLKTVPDLRCSVQSSNRLKVEWSSPSISTDLLKFEIRYSGNLSYITEIGLKKSEFIDMESKSVNFETLVNRYDVTLENLQSNALYKIAVRAIYQNKELYESHRETTCDTMPAVPNLVKPPIIVGLDEEKSKVIIKLHRCSQRNGKISYYFVIVAAFQGNKNQQISFQEDTESYTFMELSVNTRSNNAKGEYIAIMKDINDIFKVSGKDHSSVLLGDGTHDENHLSVNKKLEKNFNYRCFARVCLKYSNNSLCKSSPWSEPFRISDLILNRNVSLSSSKSSKDSYSNSSIIIILLVCGVILAVASIIIGCIVKRKKSKERFMHLGNHDDIRSSIGMKSSMLNGLMAADKIFVSAEVDEPFNSDKKYTSMSLKPDIKSIPDLVNADSVQMCQDGTKLSPVLVSDSIKLRIGSQKSENISDRPSISICNLYQYVTDLKANDCTLLQAEFETLNTNLDDRFTWQRSNIDSNKSKNRYANVVAYDHTSVLLTPVDDVIGSDYINANYIDGYQRQNAYIATQGPLPDTTDDFWRMVWEQRSNCIVMMTRLEERSGIKCHQYWPNRGFICYGQMIVSHIDTFVLAYYTIRLFEIRHSKYSEKREIQHFQFTAWPDHGVPKLSTPLLMFIRRVRSIGKIESCPKIVHCSAGVGRTGAFIVVDAQLERIKQEKNIDVFNYVSKIRCQRNYMVQTQAQYQFILETLLEAVEDGNTEVMACNFHAHVTKLSQIGISGSNQLSGFEMEFSKLNSLASNRGRHGVMLADFVKAAGNQAVNMTKNRVRNIIPYEWNRVVLNAIRGIEGSDYINASYIDGYRDRRAYIAAQSPIPSTVEDFWRMLWDQHCGVVIVLNQPHEDKSHIYWPINKSIRYQFFVVDPVVEYNMPNYILREFKVTDARDGEFRALRQFQFTQWPNHGCPKESESILDFIRQVHKTKEQFGHMEPMVIHCNTGSGRTGVFIALSIVLDRLQQESVVDMYQTVKLLHKQRIGLVQTEEQYEFCYMAVLDYLSNYEKILEKSHLY 1851          
BLAST of Protein tyrosine phosphatase receptor type D vs. Planmine SMEST
Match: SMESG000053906.1 (SMESG000053906.1)

HSP 1 Score: 2467.57 bits (6394), Expect = 0.000e+0
Identity = 1218/1223 (99.59%), Postives = 1221/1223 (99.84%), Query Frame = 1
Query: 2173 VSTMKSVPSDSPKDLVVKEIDSNSALVSWKPLDQVHSNGIITHYEVRYYAPKKEESTERFINVSETSAILSNLKYFHYVIYVRAFTKVGGGSWSNPKNYYRQNLEEFPIPTTIKGERKSETEINISWELPVLSEKNLAHAAIEGFIILYAPVESSPKWIKYTVQSKNLSAVIKGLEPDLRYQFQIAATNYAGFNGNFSEIVQEMPKNFPNLNLKTVPDLRCSVQSSNRLKVEWSSPSISTDLLKFEIRYSGNLSYITEIGLKKSEFIDMESKSVNFETLVNRYDVTLENLQSNALYKIAVRAIYQNKELYESHRETTCDTMPAVPNLVKPPIIVGLDEEKSKVIIKLHRCSQRNGKISYYFVIVAAFQGNKNQQISFQEDTESYTFMELSVNTRSNNAKGEYIAIMKDINDIFKVSGKDHSSVLLGDGTHDENHLSVNKKLEKNFNYRCFARVCLKYSNNSLCKSSPWSEPFRISDLILNRNVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXASIIIGCIVKRKKSKERFMHLGNHDDIRSSIGMKSSMLNGLMAADKIFVSAEVDEPFNSDKKYTSMSLKPDIKSIPDLVNADSVQMCQDGTKLSPVLVSDSIKLRIGSQKSENISDRPSISICNLYQYVTDLKANDCTLLQAEFETLNTNLDDRFTWQRSNIDSNKSKNRYANVVAYDHTSVLLTPVDDVIGSDYINANYIDGYQRQNAYIATQGPLPDTTDDFWRMVWEQRSNCIVMMTRLEERSGIKCHQYWPNRGFICYGQMIVSHIDTFVLAYYTIRLFEIRHSKYSEKREIQHFQFTAWPDHGVPKLSTPLLMFIRRVRSIGKIESCPKIVHCSAGVGRTGAFIVVDAQLERIKQEKNIDVFNYVSKIRCQRNYMVQTQAQYQFILETLLEAVEDGNTEVMACNFHAHVTKLSQIGISGSNQLSGFEMEFSKLNSLASNRGRHGVMLADFVKAAGNQAVNMTKNRVRNIIPYEWNRVVLNAIRGIEGSDYINASYIDGYRDRRAYIAAQSPIPSTVEDFWRMLWDQHCGVVIVLNQPHEDKSHIYWPINKSIRYQFFVVDPVVEYNMPNYILREFKVTDARDGEFRALRQFQFTQWPNHGCPKESESILDFIRQVHKTKEQFGHMEPMVIHCNTGSGRTGVFIALSIVLDRLQQESVVDMYQTVKLLHKQRIGLVQTEEQYEFCYMAVLDYLSNYEKILEKSHLY 5841
            ++  +SVPSDSPKDLVVKEIDSNSALVSWKPLDQVHSNGIITHYEVRYYAPKKEESTERFINVSETSAILSNLKYFHYVIYVRAFTKVGGGSWSNPKNYYRQNLEEFPIPTTIKGERKSETEINISWELPVLSEKNLAHAAIEGFIILYAPVESSPKWIKYTVQSKNLSAVIKGLEPDLRYQFQIAATNYAGFNGNFSEIVQEMPKNFPNLNLKTVPDLRCSVQSSNRLKVEWSSPSISTDLLKFEIRYSGNLSYITEIGLKKSEFIDMESKSVNFETLVNRYDVTLENLQSNALYKIAVRAIYQNKELYESHRETTCDTMPAVPNLVKPPIIVGLDEEKSKVIIKLHRCSQRNGKISYYFVIVAAFQGNKNQQISFQEDTESYTFMELSVNTRSNNAKGEYIAIMKDINDIFKVSGKDHSSVLLGDGTHDENHLSVNKKLEKNFNYRCFARVCLKYSNNSLCKSSPWSEPFRISDLILNRNVSLSSSKSSKDSYSNSSIIIILLVCGVILAVASIIIGCIVKRKKSKERFMHLGNHDDIRSSIGMKSSMLNGLMAADKIFVSAEVDEPFNSDKKYTSMSLKPDIKSIPDLVNADSVQMCQDGTKLSPVLVSDSIKLRIGSQKSENISDRPSISICNLYQYVTDLKANDCTLLQAEFETLNTNLDDRFTWQRSNIDSNKSKNRYANVVAYDHTSVLLTPVDDVIGSDYINANYIDGYQRQNAYIATQGPLPDTTDDFWRMVWEQRSNCIVMMTRLEERSGIKCHQYWPNRGFICYGQMIVSHIDTFVLAYYTIRLFEIRHSKYSEKREIQHFQFTAWPDHGVPKLSTPLLMFIRRVRSIGKIESCPKIVHCSAGVGRTGAFIVVDAQLERIKQEKNIDVFNYVSKIRCQRNYMVQTQAQYQFILETLLEAVEDGNTEVMACNFHAHVTKLSQIGISGSNQLSGFEMEFSKLNSLASNRGRHGVMLADFVKAAGNQAVNMTKNRVRNIIPYEWNRVVLNAIRGIEGSDYINASYIDGYRDRRAYIAAQSPIPSTVEDFWRMLWDQHCGVVIVLNQPHEDKSHIYWPINKSIRYQFFVVDPVVEYNMPNYILREFKVTDARDGEFRALRQFQFTQWPNHGCPKESESILDFIRQVHKTKEQFGHMEPMVIHCNTGSGRTGVFIALSIVLDRLQQESVVDMYQTVKLLHKQRIGLVQTEEQYEFCYMAVLDYLSNYEKILEKSHLY
Sbjct:  134 ITLKESVPSDSPKDLVVKEIDSNSALVSWKPLDQVHSNGIITHYEVRYYAPKKEESTERFINVSETSAILSNLKYFHYVIYVRAFTKVGGGSWSNPKNYYRQNLEEFPIPTTIKGERKSETEINISWELPVLSEKNLAHAAIEGFIILYAPVESSPKWIKYTVQSKNLSAVIKGLEPDLRYQFQIAATNYAGFNGNFSEIVQEMPKNFPNLNLKTVPDLRCSVQSSNRLKVEWSSPSISTDLLKFEIRYSGNLSYITEIGLKKSEFIDMESKSVNFETLVNRYDVTLENLQSNALYKIAVRAIYQNKELYESHRETTCDTMPAVPNLVKPPIIVGLDEEKSKVIIKLHRCSQRNGKISYYFVIVAAFQGNKNQQISFQEDTESYTFMELSVNTRSNNAKGEYIAIMKDINDIFKVSGKDHSSVLLGDGTHDENHLSVNKKLEKNFNYRCFARVCLKYSNNSLCKSSPWSEPFRISDLILNRNVSLSSSKSSKDSYSNSSIIIILLVCGVILAVASIIIGCIVKRKKSKERFMHLGNHDDIRSSIGMKSSMLNGLMAADKIFVSAEVDEPFNSDKKYTSMSLKPDIKSIPDLVNADSVQMCQDGTKLSPVLVSDSIKLRIGSQKSENISDRPSISICNLYQYVTDLKANDCTLLQAEFETLNTNLDDRFTWQRSNIDSNKSKNRYANVVAYDHTSVLLTPVDDVIGSDYINANYIDGYQRQNAYIATQGPLPDTTDDFWRMVWEQRSNCIVMMTRLEERSGIKCHQYWPNRGFICYGQMIVSHIDTFVLAYYTIRLFEIRHSKYSEKREIQHFQFTAWPDHGVPKLSTPLLMFIRRVRSIGKIESCPKIVHCSAGVGRTGAFIVVDAQLERIKQEKNIDVFNYVSKIRCQRNYMVQTQAQYQFILETLLEAVEDGNTEVMACNFHAHVTKLSQIGISGSNQLSGFEMEFSKLNSLASNRGRHGVMLADFVKAAGNQAVNMTKNRVRNIIPYEWNRVVLNAIRGIEGSDYINASYIDGYRDRRAYIAAQSPIPSTVEDFWRMLWDQHCGVVIVLNQPHEDKSHIYWPINKSIRYQFFVVDPVVEYNMPNYILREFKVTDARDGEFRALRQFQFTQWPNHGCPKESESILDFIRQVHKTKEQFGHMEPMVIHCNTGSGRTGVFIALSIVLDRLQQESVVDMYQTVKLLHKQRIGLVQTEEQYEFCYMAVLDYLSNYEKILEKSHLY 1356          
BLAST of Protein tyrosine phosphatase receptor type D vs. Planmine SMEST
Match: SMESG000053906.1 (SMESG000053906.1)

HSP 1 Score: 1330.47 bits (3442), Expect = 0.000e+0
Identity = 649/649 (100.00%), Postives = 649/649 (100.00%), Query Frame = 1
Query:  244 MFWIITQLVLINSQITFTENDEAPKISLIIQSPNVLLFKSMILACSSTGHPVPSISWKINESPIEELKSPLKKLQNPPRIFSIKNYQNSVLVITQLIESDSNSVLICEAENNAGFDSRQQQLKVISTETDIPSGFPVFQNNFFPIIKPYNSNVTLVCQAYGNPPPLIQWFKNYELINESFTKIKILNDGNLLLVQVTREDKGIYHCQAQNTNGLRLSDPSTLDITSYPISPNSLIIERFASDNVEISWRSGLNDVTEQENFILHYREVPENITEKQIMSKFVYLTISEKKSIYKYNLKDLFPFTTYCIWMESENPLGVSPPTIALTVKTLPTSPQLSPRSITATSISNTAILVAWRPPERKFGKFKYYQIIYTNNDGFLPQHWRQFAVKDDNVMLTHLIASELYHIRVKIVNEIGHGPLSKTISIKTIAGTLSQCPDFKITEIFQSHIKLQWGTPDPVKLFKLIQYNLLCWDVRLKIVNATAKSSTLFPILNHNLSMNEMEYVLYLKNEKEIKCRLSAINSDGKGMPTEIQASTVNKGVNYQNLIHIDKIGSTYITFQWRPPSKFSFDYFLWIYQIFDSEKLDRAVKLPKIKINISDSASAENGWFVYNYTNAFSSSRYILGLRYLCRDSTDILREYVHRSDLVSTMKS 2190
            MFWIITQLVLINSQITFTENDEAPKISLIIQSPNVLLFKSMILACSSTGHPVPSISWKINESPIEELKSPLKKLQNPPRIFSIKNYQNSVLVITQLIESDSNSVLICEAENNAGFDSRQQQLKVISTETDIPSGFPVFQNNFFPIIKPYNSNVTLVCQAYGNPPPLIQWFKNYELINESFTKIKILNDGNLLLVQVTREDKGIYHCQAQNTNGLRLSDPSTLDITSYPISPNSLIIERFASDNVEISWRSGLNDVTEQENFILHYREVPENITEKQIMSKFVYLTISEKKSIYKYNLKDLFPFTTYCIWMESENPLGVSPPTIALTVKTLPTSPQLSPRSITATSISNTAILVAWRPPERKFGKFKYYQIIYTNNDGFLPQHWRQFAVKDDNVMLTHLIASELYHIRVKIVNEIGHGPLSKTISIKTIAGTLSQCPDFKITEIFQSHIKLQWGTPDPVKLFKLIQYNLLCWDVRLKIVNATAKSSTLFPILNHNLSMNEMEYVLYLKNEKEIKCRLSAINSDGKGMPTEIQASTVNKGVNYQNLIHIDKIGSTYITFQWRPPSKFSFDYFLWIYQIFDSEKLDRAVKLPKIKINISDSASAENGWFVYNYTNAFSSSRYILGLRYLCRDSTDILREYVHRSDLVSTMKS
Sbjct:    1 MFWIITQLVLINSQITFTENDEAPKISLIIQSPNVLLFKSMILACSSTGHPVPSISWKINESPIEELKSPLKKLQNPPRIFSIKNYQNSVLVITQLIESDSNSVLICEAENNAGFDSRQQQLKVISTETDIPSGFPVFQNNFFPIIKPYNSNVTLVCQAYGNPPPLIQWFKNYELINESFTKIKILNDGNLLLVQVTREDKGIYHCQAQNTNGLRLSDPSTLDITSYPISPNSLIIERFASDNVEISWRSGLNDVTEQENFILHYREVPENITEKQIMSKFVYLTISEKKSIYKYNLKDLFPFTTYCIWMESENPLGVSPPTIALTVKTLPTSPQLSPRSITATSISNTAILVAWRPPERKFGKFKYYQIIYTNNDGFLPQHWRQFAVKDDNVMLTHLIASELYHIRVKIVNEIGHGPLSKTISIKTIAGTLSQCPDFKITEIFQSHIKLQWGTPDPVKLFKLIQYNLLCWDVRLKIVNATAKSSTLFPILNHNLSMNEMEYVLYLKNEKEIKCRLSAINSDGKGMPTEIQASTVNKGVNYQNLIHIDKIGSTYITFQWRPPSKFSFDYFLWIYQIFDSEKLDRAVKLPKIKINISDSASAENGWFVYNYTNAFSSSRYILGLRYLCRDSTDILREYVHRSDLVSTMKS 649          
BLAST of Protein tyrosine phosphatase receptor type D vs. Planmine SMEST
Match: SMESG000041927.1 (SMESG000041927.1)

HSP 1 Score: 762.296 bits (1967), Expect = 0.000e+0
Identity = 599/1923 (31.15%), Postives = 937/1923 (48.73%), Query Frame = 1
Query:  370 LACSSTGHPVPSISWKINESPIEELKSPLKKLQNPPRIFSIKNYQNSVLVITQLIESDSNSVLICEAENNAGFDSRQQQLKVISTETDIPSGFPVFQNNFFPIIKPYNSNVTLVCQAYGNPPPLIQWFKNYE--LINESFT-KIKILNDGNLLLVQVTREDKGIYHCQAQNTN-----------------------GLRLSDPS-TLDITSYPISPNSLIIERFASDN----VEISWRSGLNDVTEQENFILHY-REVPENITEKQIMSKFVYLTISEKKSIYKYNLKDLFPFTTYCIWMESENPLGVSPPTIALTVKTLPTSPQLSPRSITATSISNTAILVAWRPPE--RKFGKFKY---YQIIYTNNDGFLPQHWRQFAVKDD--NVMLTHLIASELYHIRVKIVNEIGHGPLSKTISIKTIAGTLSQCPDFKITEIFQSHIKLQW----GTPDPVKLFKLIQYNLLCWDVRLKIVNATAKSSTL------FPILNHNLSMNEMEYVLY-LKNEKEIKCRLSAINSDGKGMPTEIQASTVNKG---------VNYQNLIHIDKIGSTYIT--FQWRPP--SKFSFDYFLWIYQIFDSEKLDRAVKLPKIKINISDSASAENGWFVYNYTNAFSSSRY--ILGLRYLCRDSTDILREYVHRSDLVSTMKSVPSDSPKDLVVKEIDSNSALVSWKPLDQVHSNGIITHYEVRYYAPKKEESTERFINVSETSAILSNLKY-FHYVIYVRAFTKVGGGSWSNPKNYYRQNLEEFPIPTTIKGERKSETEINISWELPVLSEKNLAHAAIEGFIILYAPVESSPKWIKY--TVQSKNLSAVIKG-LEPDLRYQFQIAATNYAGFNGNFSEIVQEMPKNFPNLNLKTVPDLRCSVQSSNRLKVEWSSPSISTDLLKFEIRYSGNLSYITEIGLKKSEFIDMESKSVNFETLVNRYDVTLENLQSNALYKIAVRAIYQN---KELYESHRETTCDTMPAVPNLVKPPIIVGLDEEKSKVIIKLHRCSQRNGKISYYFVIVAAFQGNKNQQISFQEDTESYTFMELSVNTRSNNAKGEYIAIMKDINDIFKVS-------GKDHSSVLLGDGTHDENHLSVNKKL-EKNFNYRCFARVCL-----KYSNNSL--CKSSPWSEPFRISDLILNRNVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXASIIIGCIVKRKKSKERFMHLGNHDDIRSSIGMKSSMLNGLMAADKIFVSAEVDEPFNSDKKYTSMSLKPDIKSIPDLVNADSVQMCQDGTKLSPVLVSDSIKLRIGSQKSENISDRPSISICNLYQYVTDLKANDCTLLQAEFETLNTNLDDRFTWQRSNIDSNKSKNRYANVVAYDHTSVLLTPVDDVIGSDYINANYIDGYQRQNAYIATQGPLPDTTDDFWRMVWEQRSNCIVMMTRLEERSGIKCHQYWPNRGFICYGQ--MIVSHIDTFVLAYYTIRLFEIRHSKYS------EKREIQHFQFTAWPDHGVPKLSTPLLMFIRRVRSIGKIESCPKIVHCSAGVGRTGAFIVVDAQLERIKQEKNIDVFNYVSKIRCQRNYMVQTQAQYQFILETLLEAVEDGNTEVMACNFHAHVTKLSQ----IGISGSNQLS-GFEMEFSKLNSLASNRGRHGVMLADFVKAAGNQAVNMTKNRVRNIIPYEWNRVVLNAIRGIEGSDYINASYIDGYRDRRAYIAAQSPIPSTVEDFWRMLWDQHCGVVIVLNQPHE---DKSHIYWPINKSIRYQFFVVDPVVEYNMPNYILREFKVTDARDGEF--RALRQFQFTQWPNHGCPKESESILDFIRQVHKTKEQFGHMEPMVIHCNTGSGRTGVFIALSIVLDRLQQESVVDMYQTVKLLHKQRIGLVQTEEQYEFCYMAVLDYLSNYEKIL 5823
            L C++ G+P P + W      + +   P+  L +          + S+L++T + E  S    IC A N+ G      Q++V      IP   PV              N+T  C   G     I W +N E  L  ESFT  I  L+  N +L    ++   I+     N N                        L  SDPS T+ I +  + P+S     +A+ +    + + W   +    +  ++ ++Y R +   I + Q            + +     + DLF   TY I + + N  G  P +    +   P  P   P +     I++T+I + W PP+   K     Y   Y++I   +   L     +  +  D  +  +T L  + LYHI +    E G G +S T++++T     +      +  +  + I ++W       + +  FK+         ++LK +     S+ +       P    N S +  EY++  L+  +  K  L ++ S G   P          G         +    L    + G T +     W PP  S  +   +   + +   + L  ++K   + + + +           NY   F    Y  +        ++ DI  E       VST +S P   P  + +  I S+S  +SW+P    + NGI+ +Y+V Y+    + +T R  +     A++  L+    Y   VRAFTKVG G WS+  N+    L   P P  I+  R +E +I ++WEL   S  N  +  + GF I Y  +++ PK I+   T+    ++ V  G ++ +  YQ  I +       G  S I        P +   +V  L+C  +  + ++++W  P    +L KF +  +G  SY  E G  +      + + V+F     ++ + L+++  N +Y I+V+ +Y+       Y + + T+C T+ A P  V  P I+ ++     + +++ R ++  G I  Y++I+   +    Q+ +F +    Y+F   S+ + S       I + +  NDIFK         G+D          ++ + L +   + +   +Y+ F R C+      ++N+    C  S WS  F   +     + +++     K +   +  II +++   ++A+ SI +GC +KR++ K  +               +  ++NG  +  +  +S  V  P      Y  +S    I     + + DS                 SIK    + K+  ++  P I   +L  Y+  LK ND      E+E+++      FTW +SN++ NK KNRYANV+AYDH+ V+L+ ++D+ GSDYINANY DGY++QNAYIATQGPLP+T + FWRMVWE R   IVMMT+LEER  +KC QYWP RG   Y +  + ++H++T  LAYYT+R F +     S      E R++ HFQFT WPDHGVP  + PLLMFI+RVRS    +S P +VHCSAGVGRTGA+IV+D+QL +I+ EK +DV+  VS++R QRNYMVQT+ QY FI + LLEA   GNTEV   + HAHVTKL Q    +G++ SNQ S G E+EF  L+ L S R R       F  A  N   N  KNR+ NI+PYE  RV L  IR  +GSDYINAS+IDGYR ++AYIA Q P+ +T+ DFWRMLW  +  +V++L+Q  E   +K   YWP  +S  +   +V+P+VEYNMP++ILREF+V  + D E   R +RQFQF  W   G P+  ES++DFI QVHKTKEQFG   P+ +HC+ G GRTGVF+ALSIVLDR++ E  +D++QTV+LL  QR  +VQTE+QY+FCY+  L+YLS++++ L
Sbjct:  248 LTCTAKGNPPPQLRW------LTQYHRPINDLTD----------KESILLLTDITEPAS---YICRANNSMGVIQHAVQVRV----KKIPK-IPV--------------NIT--CLNIGPTDAQISWEQNPESDLPAESFTLMIADLSIDNTVLG--LKQIPNIHPWPPDNKNITYNVTDLRPYTKYSVKVIAFSKTLGDSDPSKTIVIETKELPPSSPPQSVYATADTFTSITVKWAPPIEANGKITDYNVYYSRNLQHPINQWQ----------KSETTRQHVRITDLFTNNTYHIKVNAVNSAGPGPVSEPFPIIVRPGVPP-QPHNFRGAGITSTSINLIWSPPQLPSKLVLLDYVLKYKVISGKHIPTLTNKEEEIKILPDRTDYRMTELWPNTLYHISLAARTEHGVG-VSNTMNVRTENRVPNSPIGIDVRTLSPTSIAIRWRKGMDNEESISSFKIKV-------IKLKSIETVDNSNEMHVQIQSVPAKTKNQS-DIYEYIINDLETGQNYKIVLWSVGSSGLSAPFIFDIVKTRPGNIVPSPPLNIRLNQLRQKTESGLTLLLADIAWDPPINSHGTIKAYRIRHNLVGPQNLIESLKRRSLSVKVYEKNVTGT-----NYCTEFGELGYGKVYEFSVAAMNTADIGLEVKLN---VSTRESAPDSYPVSIDITGITSHSVNISWQPPLVENHNGILVNYQVAYFTYGLKNTTIRTTSTPNLYALIEGLQENMLYTFQVRAFTKVGQGPWSSDVNFRTVVLLPDP-PINIEASRINENQIKVTWEL---SHTN--NIKVVGFKIYYC-LQTIPKDIESCNTLDVGPVTMVTLGNVQYNSDYQVGIKSKGIDNRYGLISNIATAKISELPVIRDLSVSSLKCEGKVRS-MEIQWQKPKTHDNLSKFRVTINGYASYTKETGEVEKFKSSFKPREVDFVDKYIKFVLGLKDMSPNMVYDISVQTVYKRDGESSFYGAIQNTSCRTLMARPKFVSTPEIILVNRTSLSIYLRILRVTEHLGIIRTYYLIIE--ESIHTQKTNFSK----YSFE--SLQSASKPISDSPILVAEFSNDIFKKGSNISFWVGQDIWRSQYSKPIYNTDSLLMRPIMFDMKKSYKMFLRACIFTEITSFANDDFYPCTDSSWSRLFNFEE-----SPAINKLLPKKQTDVFTVSIIAIIIGLGVIALISIAVGCFMKRRRPKRYYN------------SPQELIMNGDPSLKQALISQAVSGP----PSYVPLSHSNGI-----VTDMDS-----------------SIK---SNFKNTIVNKHPPIPSGHLADYIAALKTNDNAKFTEEYESIDPG--HHFTWIQSNLEINKPKNRYANVIAYDHSRVVLSTLNDIPGSDYINANYCDGYRKQNAYIATQGPLPETFEAFWRMVWESRCALIVMMTKLEERLRVKCDQYWPTRGSEAYAESGLSINHLETVELAYYTMRKFSLTKKLSSDPNGSKETRDVFHFQFTGWPDHGVPDTALPLLMFIKRVRSCCPSDSGPIVVHCSAGVGRTGAYIVLDSQLSQIQHEKVVDVYGIVSRLRAQRNYMVQTEEQYVFIYDALLEASLCGNTEVSIRHLHAHVTKLKQPLPVLGVTPSNQYSTGMELEFKHLSEL-STRPRQ------FNTA--NLPENRLKNRLINILPYENRRVCLQPIRNQDGSDYINASFIDGYRSQKAYIATQGPLANTIVDFWRMLWQHNSSIVVMLSQLREMGREKCSQYWPTERSATFGQIIVEPMVEYNMPSFILREFRVRHS-DSETHNRTIRQFQFLDWAEQGVPRSGESLIDFIGQVHKTKEQFGQEGPITVHCSAGVGRTGVFLALSIVLDRMRSEGTIDLFQTVRLLRMQRPCMVQTEDQYQFCYLTALEYLSSFDQFL 2026          

HSP 2 Score: 126.331 bits (316), Expect = 1.732e-28
Identity = 203/849 (23.91%), Postives = 359/849 (42.29%), Query Frame = 1
Query:  697 NVTLVCQAYGNPPPLIQWFKNYEL-INESFTKIKILNDGNLLLVQVTREDKGIYHCQAQNTNGLRLSDPSTLDITSYPISPNSLIIERFASDNVEISWRSGLNDVTEQENFILHYREVPENITE---KQIMSKFVYLTISEKKSIYKYNLKDLFPFTTYCIWMES-ENPLGVSPPTIALTVKTLPTSPQLSPRSITATSISNTAILVAWRPPERKFGKFKYYQIIYTNNDGFLPQHWRQFAVKDDNVMLTHLIASELYHIRVKIVNEIGHGPLSKTISIKTIAGTLSQCPDFKITEIFQSHIKLQWGTPD-PVKLFKLIQYNLLCWDVRLKIVNATAKSSTLFPILNHNLSMNEMEYVLYLKNEKEIK-----------CRLSAINSDGKGMPTEIQASTVNKGVNYQNLIHIDKIGSTYITFQWRP--PSKFSFDYF-LWIYQIFDSEKLDRAVKLPKIKINISDSASAENGWFVYNY--TNAFSSSRYILGLRYLCRDSTDILREYVHRSDLVSTMKS--VPSDSPKDLVVKEIDSNS--------ALVSWKPLDQVHSNGIITHYEVRY--YAPKKE-ESTER---FINVSETSAILSN-------LKYFH-YVIYVRAFTKVGGGSWSNPKNYYRQNLEE-FPIPTTIKGERKSETEINISWELPVLSEKNLAHAAIEGFIILYAPVESSPKWIKYTVQSKNLSAVIKGLEPDLRYQFQIAATNYAGFNGNFSEIVQEMPKNFPNLNLKTV---PDLRCSVQSS----NRLKVEWS-SPSISTDLLKFEIRYSGNLSYITEIGLKKSEFIDMESKSVNFETLVNRYDVTLENLQSNALYKIAVRA 3078
             V L C A GNPPP ++W   Y   IN+   K  IL     LL  +T  +   Y C+A N+ G+ +     + +   P  P ++        + +ISW          E+F L   ++  + T    KQI +  ++    + K+I  YN+ DL P+T Y + + +    LG S P+  + ++T    P   P+S+ AT+ + T+I V W PP    GK   Y + Y+ N       W++      +V +T L  +  YHI+V  VN  G GP+S+   I    G   Q  +F+   I  + I L W  P  P KL       LL + ++ K++     S    P L      N+ E +  L +  + +             L+A    G G+   +   T N+  N    I +  +  T I  +WR    ++ S   F + + ++   E +D + ++  ++I  S  A  +N   +Y Y   +  +   Y + L  +   S+ +   ++   D+V T     VPS  P ++ + ++   +        A ++W P   ++S+G I  Y +R+    P+   ES +R    + V E +   +N       L Y   Y   V A      G         R++  + +P+   I G   +   +NISW+ P++   N      +     Y    ++ +    T  + NL A+I+GL+ ++ Y FQ+ A    G  G +S           ++N +TV   PD   ++++S    N++KV W  S + +  ++ F+I Y               + I  + +S N   +     VTL N+Q N+ Y++ +++
Sbjct:  245 GVNLTCTAKGNPPPQLRWLTQYHRPINDLTDKESIL-----LLTDIT--EPASYICRANNSMGV-IQHAVQVRVKKIPKIPVNITCLNIGPTDAQISWEQNPESDLPAESFTLMIADLSIDNTVLGLKQIPN--IHPWPPDNKNI-TYNVTDLRPYTKYSVKVIAFSKTLGDSDPSKTIVIETKELPPSSPPQSVYATADTFTSITVKWAPPIEANGKITDYNVYYSRNLQHPINQWQKSETTRQHVRITDLFTNNTYHIKVNAVNSAGPGPVSEPFPIIVRPGVPPQPHNFRGAGITSTSINLIWSPPQLPSKLV------LLDYVLKYKVI-----SGKHIPTLT-----NKEEEIKILPDRTDYRMTELWPNTLYHISLAARTEHGVGVSNTMNVRTENRVPNSPIGIDVRTLSPTSIAIRWRKGMDNEESISSFKIKVIKLKSIETVDNSNEM-HVQIQ-SVPAKTKNQSDIYEYIINDLETGQNYKIVLWSV--GSSGLSAPFIF--DIVKTRPGNIVPS-PPLNIRLNQLRQKTESGLTLLLADIAWDP--PINSHGTIKAYRIRHNLVGPQNLIESLKRRSLSVKVYEKNVTGTNYCTEFGELGYGKVYEFSVAAMNTADIGLEVKLNVSTRESAPDSYPVSIDITG--ITSHSVNISWQPPLVENHNGILVNYQVAYFTYGLKNTTIR----TTSTPNLYALIEGLQENMLYTFQVRAFTKVG-QGPWSS----------DVNFRTVVLLPDPPINIEASRINENQIKVTWELSHTNNIKVVGFKIYYC-------------LQTIPKDIESCNTLDVGPVTMVTLGNVQYNSDYQVGIKS 1027          

HSP 3 Score: 80.8777 bits (198), Expect = 1.241e-14
Identity = 233/1019 (22.87%), Postives = 395/1019 (38.76%), Query Frame = 1
Query:  244 MFW-IITQLVLINSQITFTENDEAPKISLIIQSPNVLLFKSMILACSSTGHPVPSISWKINESPIEELKSPLKKLQNPPRIFSIKNYQNSVLVITQLIESDSNSVLI-CEAENNAGFDSRQQQLKVISTETDIPSGFPVFQN--NFFPIIKPYNSNVTLVCQAYGNPPPLIQWFKNYELINESFTKIKILNDGNLLLVQVTREDKGIYHCQAQNTNGLRLSDPSTLDITSYPISPNSLIIERFASDNVEISWRSGLN-------DVTEQENFILHYREVPENITEKQIMSKFVYLTISEKKSIYKYNLKDLFPFTTYCIWMESENPLGVSPPTIALTVKTLPTSPQLSPRSITATSISNTAILVAW-RPPERKFGKFKYYQII----YTNNDGFLPQHWRQFAVKDDNVMLTHLIASELYHIR--VKIV---NEIGHGPLSKTISIKTIAGTLSQCPD--FKITEIFQSHIKLQWGTPDPVKLFKLIQYNLLCWDVRLKIVNATAKSSTLFPILNHNLSMNEMEYVLYLKNEKEIKCRLSAINSDGKGMPTEIQASTVNKGVNYQ-NLIHIDKIGSTYITFQWRP---PSKFSFDYFLWIYQIFDSEKLDRAV-KLPKIKINISDSASAENGWFVYNYTNAFSSSRYILGLRYLCRDSTDILREYVHRSDLVSTMKSVPSDSPKDLVVKEIDSNSALVSW-KPLDQVHSNGIITHYEVRYYAPKKEE----STERFINVSETSAILSNLK-YFHYVI--------YVRAFTKVGGGSWSNPKNY-----YRQNLEEFPIPTTIK-GERKSETE-------INISWELPVLSEKNLAHAAIEGFII---LYAP---VES------SPKWIKYTVQSKNLSAVIKGLEPDLRYQFQIAATNYA--GFNGNFSEIVQE-MPKNFP-NLNLKTVPDLRCSVQSSNRLKVEWSSPSISTD---LLKFEIRYSGNLSYITEIGLKKSEFIDMESKSVNFETLVNRYDVTLENLQSNALYKIAVRA 3078
            +FW  I  L+ +++ IT T    A KI +  QS  VLL ++ I  C   G+P   +S                 L N  + + I      +L I  +  +D   V I C   N +  + +   L V     D+P+GFP F++  +F+  +     N+ + C   G  P    WFK+   ++ S  +  +L  G++   ++ +ED GIY C+  N  G  LS    L+I + PI+P  +        +VE+    G+N       +   Q  ++  Y     ++T+K+  S  +   I+E             P +  C    + N +GV    + + VK +P  P     +IT  +I  T   ++W + PE       +  +I      N    L Q         DN  +T+ +     + +  VK++     +G    SKTI I+T     S  P   +   + F S I ++W  P      K+  YN+         +N   KS T       ++ + +    L+  N   IK  ++A+NS G G  +E     V  GV  Q +      I ST I   W P   PSK     ++  Y++   + +     K  +IKI + D          Y  T  + ++ Y + L              V  +  V T   VP +SP  + V+ +   S  + W K +D   S   I+ ++++    K  E    S E  + +    A   N    + Y+I        Y      VG    S P  +        N+   P P  I+  + + +TE        +I+W+ P+ S     H  I+ + I   L  P   +ES      S K  +  V   N       L     Y+F +AA N A  G     +   +E  P ++P ++++  +        +S+ + + W  P +      L+ +++ Y    +Y    GLK +        ++   +  N Y + +E LQ N LY   VRA
Sbjct:   16 LFWCFILNLLYLSTNITSTG---AAKIIVAPQSQTVLLGETAIFFCQIDGNPSFHLSL----------------LYNGMKKYVIPIPSGLMLRIPDVKLTDGKPVRIDCIVRNPSAEEKKTAYLNVTDPSKDLPNGFPRFKSIKDFY--VGDVGQNMKMNCDVEGGLPIKFNWFKDNAPLDLSEPRRTMLRSGSIFFDRLLKEDSGIYECRVINPVGSILSSKMKLEIRNTPITPQWI----HRPQDVEVRPGHGVNLTCTAKGNPPPQLRWLTQYHRPINDLTDKE--SILLLTDITE-------------PASYIC---RANNSMGVIQHAVQVRVKKIPKIPV----NITCLNIGPTDAQISWEQNPESDLPAESFTLMIADLSIDNTVLGLKQIPNIHPWPPDNKNITYNVTDLRPYTKYSVKVIAFSKTLGDSDPSKTIVIETKELPPSSPPQSVYATADTFTS-ITVKWAPPIEAN-GKITDYNVYYSRNLQHPINQWQKSET----TRQHVRITD----LFTNNTYHIK--VNAVNSAGPGPVSEPFPIIVRPGVPPQPHNFRGAGITSTSINLIWSPPQLPSKLVLLDYVLKYKVISGKHIPTLTNKEEEIKI-LPDRTD-------YRMTELWPNTLYHISLAARTEHGVG-----VSNTMNVRTENRVP-NSPIGIDVRTLSPTSIAIRWRKGMDNEES---ISSFKIKVIKLKSIETVDNSNEMHVQIQSVPAKTKNQSDIYEYIINDLETGQNYKIVLWSVGSSGLSAPFIFDIVKTRPGNIVPSP-PLNIRLNQLRQKTESGLTLLLADIAWDPPINS-----HGTIKAYRIRHNLVGPQNLIESLKRRSLSVKVYEKNVTGTNYCTEFGELGYGKVYEFSVAAMNTADIGLEVKLNVSTRESAPDSYPVSIDITGI--------TSHSVNISWQPPLVENHNGILVNYQVAY---FTY----GLKNT--------TIRTTSTPNLYAL-IEGLQENMLYTFQVRA 928          
The following BLAST results are available for this feature:
BLAST of Protein tyrosine phosphatase receptor type D vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PTPRS4.172e-5253.70protein tyrosine phosphatase receptor type S [Sour... [more]
PTPRS4.292e-5253.70protein tyrosine phosphatase receptor type S [Sour... [more]
PTPRS4.060e-5253.70protein tyrosine phosphatase receptor type S [Sour... [more]
PTPRS4.273e-5254.90protein tyrosine phosphatase receptor type S [Sour... [more]
PTPRS4.867e-5256.16protein tyrosine phosphatase receptor type S [Sour... [more]
back to top
BLAST of Protein tyrosine phosphatase receptor type D vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ptp-36.946e-4746.85Tyrosine-protein phosphatase Lar-like [Source:Uni... [more]
ptp-35.939e-4746.85Tyrosine-protein phosphatase Lar-like [Source:Uni... [more]
ptp-38.326e-4746.85Tyrosine-protein phosphatase Lar-like [Source:Uni... [more]
ptp-35.948e-4746.85Tyrosine-protein phosphatase Lar-like [Source:Uni... [more]
ptp-31.100e-18046.85Tyrosine-protein phosphatase Lar-like [Source:Uni... [more]
back to top
BLAST of Protein tyrosine phosphatase receptor type D vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Lar1.238e-4051.43gene:FBgn0000464 transcript:FBtr0112800[more]
Lar2.689e-3251.43gene:FBgn0000464 transcript:FBtr0331242[more]
Lar2.401e-3251.43gene:FBgn0000464 transcript:FBtr0331241[more]
Lar2.209e-4051.43gene:FBgn0000464 transcript:FBtr0081260[more]
Lar6.194e-3951.43gene:FBgn0000464 transcript:FBtr0331239[more]
back to top
BLAST of Protein tyrosine phosphatase receptor type D vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ptprfa1.585e-5154.62protein tyrosine phosphatase receptor type Fa [Sou... [more]
ptprfa1.664e-5154.62protein tyrosine phosphatase receptor type Fa [Sou... [more]
ptprfa1.664e-5154.62protein tyrosine phosphatase receptor type Fa [Sou... [more]
ptprfa1.373e-5154.62protein tyrosine phosphatase receptor type Fa [Sou... [more]
ptprfa1.373e-5154.62protein tyrosine phosphatase receptor type Fa [Sou... [more]
back to top
BLAST of Protein tyrosine phosphatase receptor type D vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
brdt2.768e-5153.99bromodomain, testis-specific [Source:Xenbase;Acc:X... [more]
brdt3.057e-5153.99bromodomain, testis-specific [Source:Xenbase;Acc:X... [more]
brdt3.194e-5153.99bromodomain, testis-specific [Source:Xenbase;Acc:X... [more]
brdt3.403e-5153.99bromodomain, testis-specific [Source:Xenbase;Acc:X... [more]
brdt3.506e-5153.99bromodomain, testis-specific [Source:Xenbase;Acc:X... [more]
back to top
BLAST of Protein tyrosine phosphatase receptor type D vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ptprs2.831e-5153.39protein tyrosine phosphatase, receptor type, S [So... [more]
Ptprs2.355e-5153.39protein tyrosine phosphatase, receptor type, S [So... [more]
Ptprf7.019e-3955.28protein tyrosine phosphatase, receptor type, F [So... [more]
Ptprs2.619e-5154.58protein tyrosine phosphatase, receptor type, S [So... [more]
Ptprd5.407e-5254.95protein tyrosine phosphatase, receptor type, D [So... [more]
back to top
BLAST of Protein tyrosine phosphatase receptor type D vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|B0V2N1|PTPRS_MOUSE1.980e-5053.39Receptor-type tyrosine-protein phosphatase S OS=Mu... [more]
sp|Q64605|PTPRS_RAT2.248e-5053.07Receptor-type tyrosine-protein phosphatase S OS=Ra... [more]
sp|A2A8L5|PTPRF_MOUSE4.910e-3855.28Receptor-type tyrosine-protein phosphatase F OS=Mu... [more]
sp|Q13332|PTPRS_HUMAN2.337e-5156.16Receptor-type tyrosine-protein phosphatase S OS=Ho... [more]
sp|Q64604|PTPRF_RAT1.670e-3755.61Receptor-type tyrosine-protein phosphatase F OS=Ra... [more]
back to top
BLAST of Protein tyrosine phosphatase receptor type D vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267H9B73.280e-1937.86Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267DSI90.000e+037.81Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267G0Z10.000e+042.64Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A3P8NJL35.462e-2854.95Protein tyrosine phosphatase receptor type Fa OS=A... [more]
A0A3P9B2Z88.387e-3154.95Protein tyrosine phosphatase receptor type Fa OS=M... [more]
back to top
BLAST of Protein tyrosine phosphatase receptor type D vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ptprfa2.020e-3654.62protein tyrosine phosphatase receptor type Fa [Sou... [more]
ptprfa3.346e-3455.33protein tyrosine phosphatase receptor type Fa [Sou... [more]
ptprfa2.202e-3655.33protein tyrosine phosphatase receptor type Fa [Sou... [more]
ptprfa2.912e-3655.33protein tyrosine phosphatase receptor type Fa [Sou... [more]
PTPRD1.966e-5255.78protein tyrosine phosphatase receptor type D [Sour... [more]
back to top
BLAST of Protein tyrosine phosphatase receptor type D vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ptpra1.408e-14340.71protein tyrosine phosphatase receptor type A [Sour... [more]
ptprsa1.890e-12847.22protein tyrosine phosphatase receptor type Sa [Sou... [more]
ca16b1.140e-11335.89carbonic anhydrase XVI b [Source:ZFIN;Acc:ZDB-GENE... [more]
ENSPMAT00000002738.19.374e-10835.47pep scaffold:Pmarinus_7.0:GL477626:22501:55781:-1 ... [more]
ptprk8.587e-10435.25protein tyrosine phosphatase receptor type K [Sour... [more]
back to top
BLAST of Protein tyrosine phosphatase receptor type D vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
PTP12.721e-2630.69Phosphotyrosine-specific protein phosphatase; deph... [more]
PTP28.620e-1726.38Nuclear phosphotyrosine-specific phosphatase invol... [more]
PTP33.518e-728.81Phosphotyrosine-specific protein phosphatase; invo... [more]
back to top
BLAST of Protein tyrosine phosphatase receptor type D vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO469613.107e-2846.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO438546.074e-16546.28Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO453822.209e-16044.39Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO481871.254e-14841.16Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO317362.709e-13539.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein tyrosine phosphatase receptor type D vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PTPRD4.069e-5354.95receptor-type tyrosine-protein phosphatase delta [... [more]
PTPRD3.662e-5354.95receptor-type tyrosine-protein phosphatase delta [... [more]
ptprsa5.374e-5253.92receptor-type tyrosine-protein phosphatase S [Sour... [more]
ptprsa5.717e-5253.92receptor-type tyrosine-protein phosphatase S [Sour... [more]
ptprsa6.026e-5253.92receptor-type tyrosine-protein phosphatase S [Sour... [more]
back to top
BLAST of Protein tyrosine phosphatase receptor type D vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000053906.10.000e+099.84SMESG000053906.1[more]
SMESG000053906.10.000e+099.84SMESG000053906.1[more]
SMESG000053906.10.000e+099.59SMESG000053906.1[more]
SMESG000053906.10.000e+0100.00SMESG000053906.1[more]
SMESG000041927.11.732e-2831.15SMESG000041927.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30028312 ID=SMED30028312|Name=Protein tyrosine phosphatase receptor type D|organism=Schmidtea mediterranea sexual|type=transcript|length=5953bp
TTTGGGCAAATAAACTCAGTAATCGGGAAATGGGAGATTAAACTTGATTC
TCTCTATCTCATAATGGATCAACTATTCCTCGATAGTATTCACCAATGGG
ATACAGCTTATCTATCATTGGATTGGTACAAATACACTTAGTTTTCATTA
AAAAAAGTAATCAATAAATATTATTTATATATATTTTTTTATAAAAATAA
TTTAGATTATTTCTCCATATTCGACTCTCCATAAAACCGGTAAATGTTTT
GGATCATTACTCAATTGGTTCTTATCAATTCCCAGATCACGTTCACTGAA
AACGACGAAGCACCCAAAATTAGTTTAATTATCCAATCACCAAACGTTCT
GTTATTCAAATCTATGATATTAGCCTGTTCTTCTACTGGTCACCCGGTAC
CGAGTATATCTTGGAAAATCAACGAATCTCCAATAGAAGAACTGAAATCT
CCATTGAAGAAGCTTCAAAATCCTCCAAGAATATTCAGTATAAAGAACTA
TCAAAATTCTGTGTTGGTCATCACTCAATTGATAGAGTCTGACAGCAATT
CGGTGCTAATTTGTGAAGCTGAGAACAATGCCGGATTCGATTCGAGACAG
CAACAGTTGAAGGTTATTTCTACTGAAACAGATATTCCATCGGGTTTTCC
AGTTTTTCAGAATAACTTTTTCCCAATCATCAAGCCTTACAATAGCAACG
TGACTCTAGTATGTCAAGCATATGGAAACCCTCCACCCTTGATTCAATGG
TTCAAGAACTATGAATTAATCAATGAAAGTTTCACAAAAATCAAAATTCT
TAATGACGGCAACCTGCTTCTCGTCCAAGTAACCAGGGAAGATAAAGGTA
TATATCACTGCCAAGCTCAAAACACAAATGGTCTACGGTTATCAGATCCT
TCTACACTGGACATTACAAGCTACCCTATATCTCCGAATTCGTTGATAAT
TGAAAGGTTTGCCAGTGATAACGTTGAAATATCATGGCGGTCAGGCCTTA
ATGATGTAACTGAACAGGAAAATTTCATACTACATTATAGAGAAGTTCCG
GAGAATATAACTGAAAAACAAATCATGTCGAAATTTGTCTATTTAACAAT
AAGTGAAAAGAAGTCTATATATAAATACAATTTAAAAGATTTGTTTCCTT
TCACCACTTACTGTATTTGGATGGAATCAGAAAATCCACTGGGAGTTTCT
CCACCGACAATTGCTTTAACCGTAAAAACATTGCCAACTTCCCCCCAATT
ATCTCCTAGGTCAATTACTGCAACCTCTATTTCCAATACTGCAATTTTGG
TGGCTTGGAGGCCACCGGAAAGAAAATTTGGAAAATTTAAGTACTATCAA
ATTATTTACACCAACAACGATGGGTTTCTGCCGCAACATTGGAGACAATT
TGCAGTGAAGGATGACAATGTCATGCTGACCCATTTAATCGCCTCAGAAC
TATATCATATTCGAGTGAAAATTGTGAATGAAATCGGTCACGGACCCTTG
TCAAAGACCATTTCTATTAAGACAATAGCTGGCACCCTATCCCAATGTCC
GGATTTCAAAATCACGGAAATATTTCAATCACATATCAAGTTGCAGTGGG
GCACCCCAGATCCAGTCAAACTTTTCAAGCTCATTCAATACAATTTGCTA
TGCTGGGATGTGCGCTTGAAGATCGTAAATGCAACGGCAAAATCCTCAAC
ATTATTCCCCATCCTCAATCACAATTTGTCCATGAATGAAATGGAGTATG
TTTTATATTTGAAAAATGAAAAAGAAATAAAATGCCGATTGTCTGCCATT
AATTCTGATGGAAAAGGAATGCCAACTGAAATTCAAGCCTCAACTGTTAA
TAAGGGAGTCAACTATCAAAACCTAATTCATATCGATAAAATTGGTTCAA
CCTATATCACTTTTCAATGGAGACCACCGTCAAAATTTTCATTTGACTAC
TTTCTATGGATCTATCAAATCTTTGATTCCGAGAAACTCGACAGAGCTGT
GAAACTGCCGAAAATCAAAATCAACATCTCCGATTCAGCCTCAGCTGAAA
ACGGATGGTTTGTTTACAATTATACAAATGCGTTCTCATCATCCAGATAT
ATTCTCGGACTTCGATATCTCTGTCGAGACTCGACTGATATTCTTCGAGA
ATATGTTCACAGATCCGATTTAGTTAGTACCATGAAAAGCGTTCCATCAG
ACAGTCCAAAGGATTTAGTAGTGAAAGAGATCGATTCTAATAGCGCTTTA
GTCTCATGGAAGCCCTTAGACCAAGTCCACAGCAATGGGATAATTACACA
TTATGAAGTAAGATATTATGCCCCTAAAAAGGAGGAAAGCACAGAAAGAT
TTATCAACGTGTCAGAAACTAGTGCCATCCTGTCAAATCTAAAATATTTT
CATTATGTCATCTATGTAAGAGCGTTTACGAAAGTAGGAGGTGGAAGTTG
GTCAAATCCTAAAAATTATTATCGTCAAAATTTGGAAGAATTTCCAATCC
CTACAACTATTAAAGGGGAAAGAAAATCCGAAACAGAAATTAACATATCA
TGGGAATTGCCAGTTTTGTCTGAAAAAAATCTGGCCCACGCAGCAATTGA
AGGATTTATCATTCTCTATGCTCCTGTTGAAAGTTCTCCAAAATGGATAA
AGTACACAGTGCAAAGTAAAAATCTTTCGGCGGTTATTAAAGGATTGGAG
CCGGATTTGCGGTATCAATTTCAAATAGCCGCCACAAATTATGCCGGATT
TAATGGAAATTTTTCAGAAATCGTTCAAGAAATGCCGAAAAACTTTCCGA
ATTTAAATTTGAAAACCGTTCCAGATTTACGGTGTTCCGTTCAGAGTAGT
AATAGACTCAAAGTCGAATGGTCCTCCCCTTCAATTTCGACTGATCTGTT
AAAATTTGAAATACGCTACTCTGGAAATCTCAGCTACATTACAGAGATAG
GTTTAAAGAAGTCAGAATTTATAGACATGGAATCGAAAAGTGTCAACTTT
GAAACGTTAGTTAACCGATACGATGTCACCCTTGAAAATTTGCAGTCCAA
TGCTTTGTACAAGATTGCCGTGCGTGCCATCTACCAGAACAAAGAGCTTT
ATGAATCTCACAGGGAGACCACCTGTGACACAATGCCAGCTGTGCCTAAT
TTGGTGAAACCTCCCATAATTGTAGGGTTAGATGAAGAAAAATCAAAAGT
CATAATCAAACTCCATCGATGTTCTCAGAGAAATGGGAAAATTTCCTATT
ATTTTGTCATTGTTGCGGCTTTTCAGGGGAATAAAAATCAACAAATTTCA
TTTCAAGAAGACACAGAGTCTTACACGTTCATGGAATTGAGCGTCAACAC
AAGATCCAATAATGCCAAAGGCGAATATATTGCAATTATGAAGGATATCA
ATGATATTTTCAAGGTCAGTGGTAAAGATCATTCTAGTGTCCTTCTGGGC
GATGGAACGCATGACGAGAATCATCTATCTGTCAATAAAAAATTGGAGAA
GAATTTCAACTACAGATGTTTTGCTAGGGTCTGCTTAAAGTATTCCAATA
ATTCCTTATGCAAATCCAGTCCGTGGTCAGAACCATTCAGGATTAGCGAT
TTAATTCTCAATCGCAATGTCTCCCTCAGCTCATCAAAGTCATCCAAAGA
CTCTTACAGCAATTCTTCAATAATCATCATTTTACTCGTTTGCGGAGTTA
TCTTGGCGGTCGCGTCAATCATCATTGGGTGCATTGTCAAACGAAAGAAG
TCAAAAGAACGCTTCATGCATCTCGGCAATCACGACGACATCCGATCCTC
AATCGGGATGAAATCTTCAATGCTCAATGGATTAATGGCGGCGGATAAAA
TTTTCGTTTCTGCTGAAGTTGATGAACCGTTTAATAGTGACAAAAAATAT
ACTTCAATGTCATTGAAACCCGACATTAAAAGCATACCAGATCTCGTCAA
TGCTGACTCAGTACAAATGTGCCAAGATGGAACCAAATTGTCTCCAGTTC
TCGTGAGCGATTCGATAAAACTGCGAATCGGGTCGCAGAAATCGGAAAAT
ATTTCAGACAGACCTTCGATATCAATTTGTAACTTGTATCAATATGTCAC
AGATTTGAAAGCTAACGATTGCACTCTTCTTCAAGCAGAATTCGAAACCC
TCAACACAAATCTAGACGATCGGTTTACATGGCAACGATCGAATATAGAT
TCAAACAAAAGCAAAAACCGCTATGCCAATGTTGTTGCGTACGATCATAC
TTCAGTTCTTTTGACTCCGGTTGATGATGTAATCGGTTCCGATTACATAA
ATGCAAACTACATAGATGGCTATCAGAGGCAGAACGCTTACATAGCAACA
CAAGGCCCACTACCCGATACTACAGACGACTTTTGGAGAATGGTTTGGGA
ACAAAGGTCAAATTGCATAGTTATGATGACCCGTTTAGAAGAAAGATCAG
GCATAAAATGTCACCAATACTGGCCAAATAGGGGTTTCATATGCTATGGG
CAAATGATTGTTTCCCACATTGACACATTTGTGTTGGCTTATTACACAAT
TCGGCTTTTTGAGATACGACATAGCAAATATTCTGAAAAACGTGAAATAC
AACACTTCCAATTTACTGCTTGGCCTGACCATGGAGTGCCAAAACTAAGC
ACTCCTTTGCTCATGTTTATACGAAGAGTTAGGTCAATAGGAAAGATAGA
ATCTTGTCCAAAGATTGTTCACTGCTCGGCTGGTGTTGGGAGAACTGGAG
CTTTCATTGTTGTCGATGCGCAGTTGGAAAGAATTAAACAAGAAAAGAAC
ATTGATGTATTCAATTACGTATCCAAAATCCGTTGCCAACGGAACTATAT
GGTTCAGACCCAAGCTCAGTATCAATTTATCTTAGAAACATTACTGGAAG
CTGTGGAAGACGGCAACACAGAAGTAATGGCCTGTAATTTTCATGCTCAT
GTCACAAAATTATCCCAAATTGGAATTTCTGGCTCGAATCAGTTGTCGGG
ATTCGAAATGGAGTTCAGTAAGCTAAACAGCTTAGCTTCCAACAGAGGTC
GGCACGGAGTGATGTTGGCTGATTTTGTGAAGGCGGCAGGCAATCAAGCG
GTAAACATGACAAAAAATCGAGTCAGGAACATAATTCCTTATGAATGGAA
CCGAGTTGTTTTGAATGCAATAAGAGGCATCGAAGGGTCTGATTATATCA
ACGCCAGTTATATCGATGGGTACCGAGATCGCCGAGCTTATATTGCAGCC
CAAAGTCCGATACCTTCAACTGTTGAAGATTTCTGGCGAATGCTATGGGA
TCAACATTGTGGAGTGGTTATTGTATTGAATCAGCCTCATGAAGATAAAT
CCCATATCTATTGGCCCATTAATAAGTCAATTCGTTATCAGTTTTTTGTT
GTTGACCCCGTCGTTGAGTATAATATGCCAAATTACATTTTACGGGAATT
TAAAGTCACTGACGCCAGAGATGGAGAATTCAGAGCCTTAAGACAATTTC
AATTCACCCAATGGCCAAATCATGGTTGCCCTAAAGAATCCGAGTCAATA
CTTGATTTTATAAGACAGGTTCATAAAACAAAAGAGCAATTTGGTCATAT
GGAACCAATGGTCATACATTGCAACACTGGTTCCGGCAGAACGGGCGTCT
TTATTGCGCTAAGTATTGTTCTGGATAGGTTACAGCAAGAGAGTGTAGTG
GACATGTATCAAACGGTGAAACTGCTACACAAACAACGTATAGGTCTAGT
TCAAACCGAGGAGCAATATGAGTTCTGTTATATGGCCGTTTTAGATTATT
TATCTAATTACGAAAAAATTTTGGAGAAATCTCATTTATATTAAACTTAT
CAAGATTTATCAGAAAGTTCAGTTTTAAACCGGTGAAGAAATTGTCATTA
AAATGTACATTTTGCTCTCATGTGATAAGTTGCTGACCTATACTCAAATT
TAG
back to top

protein sequence of SMED30028312-orf-1

>SMED30028312-orf-1 ID=SMED30028312-orf-1|Name=SMED30028312-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1867bp
MFWIITQLVLINSQITFTENDEAPKISLIIQSPNVLLFKSMILACSSTGH
PVPSISWKINESPIEELKSPLKKLQNPPRIFSIKNYQNSVLVITQLIESD
SNSVLICEAENNAGFDSRQQQLKVISTETDIPSGFPVFQNNFFPIIKPYN
SNVTLVCQAYGNPPPLIQWFKNYELINESFTKIKILNDGNLLLVQVTRED
KGIYHCQAQNTNGLRLSDPSTLDITSYPISPNSLIIERFASDNVEISWRS
GLNDVTEQENFILHYREVPENITEKQIMSKFVYLTISEKKSIYKYNLKDL
FPFTTYCIWMESENPLGVSPPTIALTVKTLPTSPQLSPRSITATSISNTA
ILVAWRPPERKFGKFKYYQIIYTNNDGFLPQHWRQFAVKDDNVMLTHLIA
SELYHIRVKIVNEIGHGPLSKTISIKTIAGTLSQCPDFKITEIFQSHIKL
QWGTPDPVKLFKLIQYNLLCWDVRLKIVNATAKSSTLFPILNHNLSMNEM
EYVLYLKNEKEIKCRLSAINSDGKGMPTEIQASTVNKGVNYQNLIHIDKI
GSTYITFQWRPPSKFSFDYFLWIYQIFDSEKLDRAVKLPKIKINISDSAS
AENGWFVYNYTNAFSSSRYILGLRYLCRDSTDILREYVHRSDLVSTMKSV
PSDSPKDLVVKEIDSNSALVSWKPLDQVHSNGIITHYEVRYYAPKKEEST
ERFINVSETSAILSNLKYFHYVIYVRAFTKVGGGSWSNPKNYYRQNLEEF
PIPTTIKGERKSETEINISWELPVLSEKNLAHAAIEGFIILYAPVESSPK
WIKYTVQSKNLSAVIKGLEPDLRYQFQIAATNYAGFNGNFSEIVQEMPKN
FPNLNLKTVPDLRCSVQSSNRLKVEWSSPSISTDLLKFEIRYSGNLSYIT
EIGLKKSEFIDMESKSVNFETLVNRYDVTLENLQSNALYKIAVRAIYQNK
ELYESHRETTCDTMPAVPNLVKPPIIVGLDEEKSKVIIKLHRCSQRNGKI
SYYFVIVAAFQGNKNQQISFQEDTESYTFMELSVNTRSNNAKGEYIAIMK
DINDIFKVSGKDHSSVLLGDGTHDENHLSVNKKLEKNFNYRCFARVCLKY
SNNSLCKSSPWSEPFRISDLILNRNVSLSSSKSSKDSYSNSSIIIILLVC
GVILAVASIIIGCIVKRKKSKERFMHLGNHDDIRSSIGMKSSMLNGLMAA
DKIFVSAEVDEPFNSDKKYTSMSLKPDIKSIPDLVNADSVQMCQDGTKLS
PVLVSDSIKLRIGSQKSENISDRPSISICNLYQYVTDLKANDCTLLQAEF
ETLNTNLDDRFTWQRSNIDSNKSKNRYANVVAYDHTSVLLTPVDDVIGSD
YINANYIDGYQRQNAYIATQGPLPDTTDDFWRMVWEQRSNCIVMMTRLEE
RSGIKCHQYWPNRGFICYGQMIVSHIDTFVLAYYTIRLFEIRHSKYSEKR
EIQHFQFTAWPDHGVPKLSTPLLMFIRRVRSIGKIESCPKIVHCSAGVGR
TGAFIVVDAQLERIKQEKNIDVFNYVSKIRCQRNYMVQTQAQYQFILETL
LEAVEDGNTEVMACNFHAHVTKLSQIGISGSNQLSGFEMEFSKLNSLASN
RGRHGVMLADFVKAAGNQAVNMTKNRVRNIIPYEWNRVVLNAIRGIEGSD
YINASYIDGYRDRRAYIAAQSPIPSTVEDFWRMLWDQHCGVVIVLNQPHE
DKSHIYWPINKSIRYQFFVVDPVVEYNMPNYILREFKVTDARDGEFRALR
QFQFTQWPNHGCPKESESILDFIRQVHKTKEQFGHMEPMVIHCNTGSGRT
GVFIALSIVLDRLQQESVVDMYQTVKLLHKQRIGLVQTEEQYEFCYMAVL
DYLSNYEKILEKSHLY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0002028dorsal-ventral muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR036179Ig-like_dom_sf
IPR036116FN3_sf
IPR000242PTPase_domain
IPR003961FN3_dom
IPR003595Tyr_Pase_cat
IPR003599Ig_sub
IPR003598Ig_sub2
IPR029021Prot-tyrosine_phosphatase-like
IPR013783Ig-like_fold
IPR013098Ig_I-set
IPR007110Ig-like_dom
IPR016130Tyr_Pase_AS
IPR000387TYR_PHOSPHATASE_dom
Vocabulary: molecular function
TermDefinition
GO:0004725protein tyrosine phosphatase activity
GO:0005515protein binding
GO:0016791phosphatase activity
GO:0004721phosphoprotein phosphatase activity
GO:0008201heparin binding
GO:0016787hydrolase activity
GO:0035374chondroitin sulfate binding
GO:0043395heparan sulfate proteoglycan binding
Vocabulary: biological process
TermDefinition
GO:0006470protein dephosphorylation
GO:0016311dephosphorylation
GO:0007155cell adhesion
GO:0010977negative regulation of neuron projection development
GO:0021510spinal cord development
GO:0021549cerebellum development
GO:0021766hippocampus development
GO:0021987cerebral cortex development
GO:0022038corpus callosum development
GO:0030517negative regulation of axon extension
GO:0032687negative regulation of interferon-alpha production
GO:0032688negative regulation of interferon-beta production
GO:0034164negative regulation of toll-like receptor 9 signaling pathway
GO:0035335peptidyl-tyrosine dephosphorylation
GO:0048671negative regulation of collateral sprouting
GO:0048681negative regulation of axon regeneration
GO:0061000negative regulation of dendritic spine development
GO:0090557establishment of endothelial intestinal barrier
Vocabulary: cellular component
TermDefinition
GO:0005886plasma membrane
GO:0016020membrane
GO:0016021integral component of membrane
GO:0030285integral component of synaptic vesicle membrane
GO:0030424axon
GO:0070062extracellular exosome
GO:0099061integral component of postsynaptic density membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000242PTP type protein phosphatasePRINTSPR00700PRTYPHPHTASEcoord: 1350..1357
score: 79.71
coord: 1520..1535
score: 34.41
coord: 1366..1386
score: 69.22
coord: 1450..1467
score: 54.05
coord: 1489..1507
score: 67.55
coord: 1536..1546
score: 60.05
IPR000242PTP type protein phosphataseSMARTSM00194PTPc_3coord: 1586..1854
e-value: 8.1E-101
score: 350.9
coord: 1295..1555
e-value: 2.5E-111
score: 385.8
IPR000242PTP type protein phosphatasePFAMPF00102Y_phosphatasecoord: 1321..1552
e-value: 5.0E-77
score: 258.6
coord: 1621..1850
e-value: 2.8E-72
score: 243.1
IPR000242PTP type protein phosphatasePROSITEPS50055TYR_PHOSPHATASE_PTPcoord: 1296..1553
score: 56.637
IPR000242PTP type protein phosphatasePROSITEPS50055TYR_PHOSPHATASE_PTPcoord: 1587..1852
score: 53.199
IPR003961Fibronectin type IIISMARTSM00060FN3_2coord: 335..417
e-value: 1.1E-5
score: 34.9
coord: 652..734
e-value: 7.6E-8
score: 42.1
coord: 856..952
e-value: 0.014
score: 24.5
coord: 228..319
e-value: 0.0014
score: 27.9
coord: 750..837
e-value: 1.4E-4
score: 31.2
coord: 432..525
e-value: 34.0
score: 6.9
IPR003961Fibronectin type IIIPFAMPF00041fn3coord: 337..420
e-value: 1.2E-11
score: 44.8
coord: 753..841
e-value: 1.4E-7
score: 31.8
coord: 653..737
e-value: 1.8E-12
score: 47.4
IPR003961Fibronectin type IIIPROSITEPS50853FN3coord: 230..332
score: 14.911
IPR003961Fibronectin type IIIPROSITEPS50853FN3coord: 858..966
score: 9.113
IPR003961Fibronectin type IIIPROSITEPS50853FN3coord: 752..851
score: 16.781
IPR003961Fibronectin type IIIPROSITEPS50853FN3coord: 654..749
score: 16.426
IPR003961Fibronectin type IIIPROSITEPS50853FN3coord: 337..430
score: 16.048
IPR003961Fibronectin type IIICDDcd00063FN3coord: 228..329
e-value: 1.15104E-7
score: 49.4171
IPR003961Fibronectin type IIICDDcd00063FN3coord: 753..845
e-value: 4.51732E-10
score: 55.9655
IPR003961Fibronectin type IIICDDcd00063FN3coord: 859..951
e-value: 0.00177601
score: 37.4759
IPR003961Fibronectin type IIICDDcd00063FN3coord: 653..741
e-value: 3.68179E-14
score: 67.9067
IPR003961Fibronectin type IIICDDcd00063FN3coord: 338..427
e-value: 1.81943E-13
score: 65.5955
IPR003598Immunoglobulin subtype 2SMARTSM00408igc2_5coord: 36..114
e-value: 2.0
score: 4.3
coord: 148..213
e-value: 2.0E-12
score: 57.3
IPR003595Protein-tyrosine phosphatase, catalyticSMARTSM00404ptp_7coord: 1748..1851
e-value: 4.0E-38
score: 142.6
coord: 1451..1552
e-value: 2.6E-35
score: 133.3
IPR003599Immunoglobulin subtypeSMARTSM00409IG_3ccoord: 142..225
e-value: 2.4E-5
score: 33.8
coord: 32..125
e-value: 30.0
score: 7.3
IPR013098Immunoglobulin I-setPFAMPF07679I-setcoord: 25..124
e-value: 8.9E-6
score: 25.7
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 129..227
e-value: 1.3E-17
score: 65.6
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 24..128
e-value: 1.7E-10
score: 42.9
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 228..328
e-value: 1.0E-6
score: 31.0
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 329..431
e-value: 4.7E-19
score: 70.6
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 855..970
e-value: 4.8E-7
score: 31.9
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 746..851
e-value: 2.5E-14
score: 55.1
coord: 641..745
e-value: 1.4E-20
score: 75.4
IPR007110Immunoglobulin-like domainPFAMPF13895Ig_2coord: 149..222
e-value: 9.6E-13
score: 48.3
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 24..123
score: 9.845
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 136..217
score: 11.188
IPR029021Protein-tyrosine phosphatase-likeGENE3DG3DSA:3.90.190.10coord: 1564..1865
e-value: 1.0E-96
score: 325.8
IPR029021Protein-tyrosine phosphatase-likeGENE3DG3DSA:3.90.190.10coord: 1269..1563
e-value: 7.9E-106
score: 355.7
IPR029021Protein-tyrosine phosphatase-likeSUPERFAMILYSSF52799(Phosphotyrosine protein) phosphatases IIcoord: 1274..1553
IPR029021Protein-tyrosine phosphatase-likeSUPERFAMILYSSF52799(Phosphotyrosine protein) phosphatases IIcoord: 1550..1858
NoneNo IPR availablePANTHERPTHR19134:SF203RECEPTOR-TYPE TYROSINE-PROTEIN PHOSPHATASE Fcoord: 1237..1852
NoneNo IPR availablePANTHERPTHR19134:SF203RECEPTOR-TYPE TYROSINE-PROTEIN PHOSPHATASE Fcoord: 153..563
NoneNo IPR availablePANTHERPTHR19134PROTEIN-TYROSINE PHOSPHATASEcoord: 153..563
coord: 646..1039
NoneNo IPR availablePANTHERPTHR19134PROTEIN-TYROSINE PHOSPHATASEcoord: 1237..1852
NoneNo IPR availablePANTHERPTHR19134:SF203RECEPTOR-TYPE TYROSINE-PROTEIN PHOSPHATASE Fcoord: 646..1039
NoneNo IPR availableCDDcd00096Igcoord: 43..117
e-value: 2.20921E-7
score: 47.622
NoneNo IPR availableCDDcd00096Igcoord: 153..213
e-value: 5.51484E-14
score: 66.4968
NoneNo IPR availableCDDcd14554R-PTP-LAR-2coord: 1617..1850
e-value: 1.6565E-120
score: 377.635
NoneNo IPR availableCDDcd14553R-PTPc-LAR-1coord: 1319..1554
e-value: 1.65301E-136
score: 422.19
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..18
score: 0.481
NoneNo IPR availableTMHMMTMhelixcoord: 1143..1165
NoneNo IPR availableTMHMMTMhelixcoord: 1414..1436
IPR016130Protein-tyrosine phosphatase, active sitePROSITEPS00383TYR_PHOSPHATASE_1coord: 1791..1801
IPR016130Protein-tyrosine phosphatase, active sitePROSITEPS00383TYR_PHOSPHATASE_1coord: 1492..1502
IPR000387Tyrosine specific protein phosphatases domainPROSITEPS50056TYR_PHOSPHATASE_2coord: 1767..1843
score: 20.316
IPR000387Tyrosine specific protein phosphatases domainPROSITEPS50056TYR_PHOSPHATASE_2coord: 1473..1544
score: 18.958
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 144..230
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 23..125
IPR036116Fibronectin type III superfamilySUPERFAMILYSSF49265Fibronectin type IIIcoord: 860..1036
IPR036116Fibronectin type III superfamilySUPERFAMILYSSF49265Fibronectin type IIIcoord: 436..576
IPR036116Fibronectin type III superfamilySUPERFAMILYSSF49265Fibronectin type IIIcoord: 653..845
IPR036116Fibronectin type III superfamilySUPERFAMILYSSF49265Fibronectin type IIIcoord: 228..428