Spectrin beta chain

Overview
NameSpectrin beta chain
Smed IDSMED30028311
Length (bp)7439
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Spectrin beta chain (SMED30028311) t-SNE clustered cells

Violin plots show distribution of expression levels for Spectrin beta chain (SMED30028311) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Spectrin beta chain (SMED30028311) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Spectrin beta chain (SMED30028311) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30028311

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 17

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30028311SMESG000066485.1 dd_Smed_v4_12996_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30028311SMESG000066485.1 dd_Smed_v4_12996_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30028311SMESG000066485.1 dd_Smed_v4_12996_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30028311SMESG000066485.1 dd_Smed_v4_12996_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30028311SMESG000066485.1 dd_Smed_v4_7344_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30028311SMESG000066485.1 dd_Smed_v4_7344_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30028311SMESG000066485.1 dd_Smed_v4_7344_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30028311SMESG000066485.1 dd_Smed_v4_7344_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30028311SMESG000066485.1 dd_Smed_v4_7344_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30028311SMESG000066485.1 dd_Smed_v4_7344_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30028311SMESG000066485.1 dd_Smed_v4_7344_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30028311SMESG000066485.1 SMESG000066474.1 Contig19719uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30028311SMESG000066485.1 SMESG000066474.1 Contig19719newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30028311SMESG000066485.1 Contig48501uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30028311SMESG000066485.1 Contig48501newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30028311SMESG000066485.1 dd_Smed_v6_7344_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Category 2 cellSMED30028311SMESG000066485.1 dd_Smed_v4_12996_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Spectrin beta chain vs. Ensembl Human
Match: SPTBN1 (spectrin beta, non-erythrocytic 1 [Source:HGNC Symbol;Acc:HGNC:11275])

HSP 1 Score: 1840.08 bits (4765), Expect = 0.000e+0
Identity = 1008/2311 (43.62%), Postives = 1527/2311 (66.08%), Query Frame = 1
Query:  154 KLYERFRIKALAGEREKVQKKTFTKWINSHLNKLKQSIDDLYNXXXXXXXXXXXXXXXXXXXXPYPTKGKMRIHCLENVDKSLNFLIEQRVHLENMGAHDIVDGNARLTLGLIWTIILRFQIQDIVVEEDDTSEKRQAKDALLLWCQMKTAGYPNTNVRNFSTCWRDGLAFNAIIHRHRPDLLEYSALSRSNPNENLEQAIRIAEEKLGIPRLLDPEDVSVENPDEKSIMTYVVTFYHFFSKMKADSVHSKRVGKILSQSMETEEMMVHYDKLTSNLLEWINQTIELLNDRTFANSLSGVQQQLAAFNTYRVTEKPPKFQEKGNLEMLLFSIQSQMRANNQMPYLPIEGKLISDINNAWNKLDKAEHARELALRDELIRQEKLEQLALRFDRKAGMREAWLTENQRLITQDNFGQDLSAVEAAGKKHEAIKTDILAYEERVNSVTLVTSELENECYHDVERVLCRRDNVIRLWEKLLDMLAVRKLRLDACYKVQKLFQDIKHLLDLINDLKARLKTEDIGRHLMGVEDLIHKHSLLEIDIRMVGTKIEGIMSDAQPFINSEFGLGSGDFQPADPNEVILRTVNLKEEYDNLLELSRNRKDNLSASKVMWEFLWGVADEEQWMKEKIQLMLNPDLGHDLSSVHRLISKHKVIEEDVRNHSNYLQNVIQGGQQLILDKNPGAEKVADXXXXXXXXXXXXXXXXXXRRSKLEQSLAYFHCLADCGEVEIWIIEQVKLVKIDETSINEESIITDIHKHEQLSKSIEDYESNINSLDEQVKKLSEGDLELVTIEEKVSNIKSQYAILIELTNQKQNKLTDTLSLFRVLRKADTVKTWIDEKEKLLMSLIPTDELEELEVFRHRFDGFEKEMNIQADQVEFVNTLAEKLSDMDHPQIADVVNKRFELNKLWNSLADLVEARREQLQTSYEFNQYLLECKQTGEWIREKSRLVESTDELGDDLAGIMQLQRRMGGMQRDMDAIRAKLEHLDEEMDTLIAKRPNXXXXXXXXXXXXXXFWAELGDMLADRDDRLSESSELQRFLQDLDHIHIWLSKMQTTVASEDLPKDLADAEKSLVQHEQLKEEIDSYQDEFIRLLDYGRRITEDKTDAQYMFLSQRLNALEEGWQELCQMWENRXXXXXXXXXXXVFLRDAIQSEVLLAQEENFLSKEDIPISIENSQNLLRKHEGFLTTLQANHDHTIAVIEFGRNLVERGHFCSDKINLRVKSILXXXXXXXXXXXXAYEKLKDQVLYQELSQDIDDLSKWIQEKMIIATDESFREEKNIARRYNRHRAFDEEIQANKDRLCQAIDYAMQIVEERPQLADMIYPQIDSLNQQWEELEQTTFLKGEKMIEANREAIFEEGTMDVMTWLXXXXXXXXXXXXXXXXXXXXXXKLKKVEEADNEMEIKRKQIQDLKMHAAKLKEEQPEKAFGIEQKHLILEHRFTQLQMPXXXXXXXXXXXXXXXXFLRNLDDQKAWVDDKLLLAESTNFGNNLLTVQQLLRRHRYLATEVNNHKPQLEYLKEEGAVLIEEVSPMQREKFVAGLQELESLWNRLEHSIDLRQQRLKESEATQTFLFDAEEAESWLWEQELFLLSEERGIRDQEAAINVIKKHDARQKTIEDYGEEITKLGTRSRLLIEKDHPQADRIALAQSHVDKVYAGLRDLCLEKKQRLSEIQKLNHLYREIVDLENWIYERTLVASSHDLGVDFEHCCLLRERFDEFFHETHLLGKDRVKAANDLCASLISQCHADSAEIAQWHDRINDSWAELQELMQTRIQLLRTAWEFYKYLSSCQDVLDRICEKIASIPTDVSKDSQSVAIQQRKHATFLSDAQALEGQVQWVVDEANHLLPSYAGQKEWHICERRDDVLATWNQLNMQAERRRHQLEDAADLQRFFSMVRELLQWMDLVALQINEKTRPKDVSGVELLINDHRSIKAEIAAREESMSICVNLGRTLLHRGRVGVDEVRAALINLITRKYSLEDMWEERWDYLQLILEVYQFARDASVAEAWILAQEPYLANKTLGETLDETLSLLKKHINFEKTVMSQEERFEALEKLTTMEIR--------------------AKEITKESILLK--DKHKQERI-ENAIKIFQPPP-------SPELVHESPKVSISEEDEE-----GKSHQHKISVISKEAAEM-CQSSETKT-DIRGILIRKHEWEYKNRKALNRSWHEFLVVLSIEKNKLLVYKDEKHYNEKPQDTYHKDSGLDLNDLVAAPASDYLKRPFVFRIKITSTGAEYLFQAKDEEDMLRWVNSINENSQKDLKSETTAPGKSSTLPACTSDPHVPST 6975
            +L+ER RIKALA ERE VQKKTFTKW+NSHL ++   I DLY DL+DG+ML+ LLE+LSGE+LP PTKG+MRIHCLENVDK+L FL EQRVHLENMG+HDIVDGN RLTLGLIWTIILRFQIQDI VE +D  EK+ AKDALLLWCQMKTAGYPN N+ NF+T WRDG+AFNA+IH+HRPDL+++  L +SN + NL+ A  +AE+ LG+ +LLDPED+SV++PDEKSI+TYVVT+YH+FSKMKA +V  KR+GK+L  ++ETE+M+  Y+ L S+LLEWI QTI +LN+R FANSL GVQQQL AFNTYR  EKPPKF EKGNLE+LLF+IQS+MRANNQ  Y+P EGKLISDIN AW +L+KAEH RELALR+ELIRQEKLEQLA RFDRKA MRE WL+ENQRL++QDNFG DL AVEAA KKHEAI+TDI AYEERV +V  V  ELE E YHD++R+  R+DNVIRLWE LL++L  R+ RL+    +QK+FQ++ +++D ++++K  + ++D G+HL+GVEDL+ KH+L+E DI +   ++ G+ + AQ F       G G ++P DP  +  R  +++  Y  L +L+  R+  L  S+ +W+F W +A+EE W++EK +++ + D G DL+SV RL+SKH+  E+++   S + +  I+ G+ +I +++ G+EK+ + +  +   W  L +L+  R+ +LE++       AD  +++ W+++ +K+V   +   +E S  + + KH+ +++ I +Y   +++L EQ   L +   E   +  ++S I+ +Y  + ELT  ++  L DTL+L+++  +AD  + WIDEKE+ L ++   ++LE+LEV +HRF+  E EMN QA +V  VN +A +L    HP   ++  ++ +LN  W+   +LV+ +++ L ++     Y LEC +T  WIREK++++EST +LG+DLAG+M LQR++ GM+RD+ AI AKL  L +E + L ++ P+  + I      + D W E+   L +R+  L E+S+LQ+FL+DLD    WLS+ QT +ASED+P  L +AEK L QHE +K EID+Y++++ ++ D G  +T+ +TDAQYMFL QRL AL+ GW EL +MWENRQ LLSQS + Q FLRD  Q+E  L  +E  L+  ++P ++E ++  ++K E F+TT+ AN +   AV+E GR LV  G+  SD+I  +V SI +R   N+  ++E   +LKD    Q+  QD  +LS WI EKM+ A D S+ E +N+  ++ +H+AF  E+ +NK+ L +     MQ++ E+P+   ++  ++  L++ WE LE TT  K +++ +AN+  +F +   D+  WL  +   I   +   +  +   + LKK +  +N+ME+++K+I++L+  A  L +E  +    ++ K L ++ +F +L  P+  +K  L+  K I QF R+++D+  WV +++ LA ST+ G+NL TVQ L+++++ L  E+  H+P+++ + E    ++ + S +  E     L +L+ LW  L    + R +RL+E+   Q + FDA EAE+W+ EQEL+++SEE+  +D+++A++++KKH   ++ +EDY E + +L   SR L+   HP+++RI++ QS VDK+YAGL+DL  E++ +L E  +L  L RE+ DLE WI ER +VA SH+LG D+EH  +L+ERF EF  +T  +G++RV   N L   LI+  H+D+A IA+W D +N++WA+L EL+ TR Q+L  ++E +K+    +++  RI +K   +P ++ +D  +V   QR H TF  D QAL  QV+ + ++A  L  +YAG K   I +R ++VL  W  L    E RR +L D  D  RFFSMVR+L+ WM+ V  QI  + +P+DVS VELL+N+H+ IKAEI AR +S + C+ LG++LL R     +E++  L+ L  ++  + D WE+RW++L+LILEV+QF+RDASVAEAW+L QEPYL+++ +G+++DE   L+K+H  FEK+  + +ERF ALE+LTT+E+                     + ++++E+   +  D  K E++ +N +   Q  P       + E+V+ + +   S ++           + K ++ ++ AA +  ++ ET +  + G L RKHEWE  N+KA +RSWH    V  I   ++  YKD K         YH +  + L + V   A DY K+  VF++++   G EYLFQAKD+E+M  W+ +I+     D K E +A  +S+  PA +    +P++
Sbjct:   38 RLFERSRIKALADEREAVQKKTFTKWVNSHLARVSCRITDLYTDLRDGRMLIKLLEVLSGERLPKPTKGRMRIHCLENVDKALQFLKEQRVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKEKKSAKDALLLWCQMKTAGYPNVNIHNFTTSWRDGMAFNALIHKHRPDLIDFDKLKKSNAHYNLQNAFNLAEQHLGLTKLLDPEDISVDHPDEKSIITYVVTYYHYFSKMKALAVEGKRIGKVLDNAIETEKMIEKYESLASDLLEWIEQTIIILNNRKFANSLVGVQQQLQAFNTYRTVEKPPKFTEKGNLEVLLFTIQSKMRANNQKVYMPREGKLISDINKAWERLEKAEHERELALRNELIRQEKLEQLARRFDRKAAMRETWLSENQRLVSQDNFGFDLPAVEAATKKHEAIETDIAAYEERVQAVVAVARELEAENYHDIKRITARKDNVIRLWEYLLELLRARRQRLEMNLGLQKIFQEMLYIMDWMDEMKVLVLSQDYGKHLLGVEDLLQKHTLVEADIGIQAERVRGVNASAQKFATD----GEG-YKPCDPQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEKILSSDDYGKDLTSVMRLLSKHRAFEDEMSGRSGHFEQAIKEGEDMIAEEHFGSEKIRERIIYIREQWANLEQLSAIRKKRLEEASLLHQFQADADDIDAWMLDILKIVSSSDVGHDEYSTQSLVKKHKDVAEEIANYRPTLDTLHEQASALPQEHAESPDVRGRLSGIEERYKEVAELTRLRKQALQDTLALYKMFSEADACELWIDEKEQWLNNMQIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLMHSGHPSEKEIKAQQDKLNTRWSQFRELVDRKKDALLSALSIQNYHLECNETKSWIREKTKVIESTQDLGNDLAGVMALQRKLTGMERDLVAIEAKLSDLQKEAEKLESEHPDQAQAILSRLAEISDVWEEMKTTLKNREASLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLTEAEKLLTQHENIKNEIDNYEEDYQKMRDMGEMVTQGQTDAQYMFLRQRLQALDTGWNELHKMWENRQNLLSQSHAYQQFLRDTKQAEAFLNNQEYVLAHTEMPTTLEGAEAAIKKQEDFMTTMDANEEKINAVVETGRRLVSDGNINSDRIQEKVDSIDDRHRKNRETASELLMRLKDNRDLQKFLQDCQELSLWINEKMLTAQDMSYDEARNLHSKWLKHQAFMAELASNKEWLDKIEKEGMQLISEKPETEAVVKEKLTGLHKMWEVLESTTQTKAQRLFDANKAELFTQSCADLDKWLHGLESQIQSDDYGKDLTSVNIL-LKKQQMLENQMEVRKKEIEELQSQAQALSQE-GKSTDEVDSKRLTVQTKFMELLEPLNERKHNLLASKEIHQFNRDVEDEILWVGERMPLATSTDHGHNLQTVQLLIKKNQTLQKEIQGHQPRIDDIFERSQNIVTDSSSLSAEAIRQRLADLKQLWGLLIEETEKRHRRLEEAHRAQQYYFDAAEAEAWMSEQELYMMSEEKA-KDEQSAVSMLKKHQILEQAVEDYAETVHQLSKTSRALVADSHPESERISMRQSKVDKLYAGLKDLAEERRGKLDERHRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFREFARDTGNIGQERVDTVNHLADELINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQILAASYELHKFYHDAKEIFGRIQDKHKKLPEELGRDQNTVETLQRMHTTFEHDIQALGTQVRQLQEDAARLQAAYAGDKADDIQKRENEVLEAWKSLLDACESRRVRLVDTGDKFRFFSMVRDLMLWMEDVIRQIEAQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTTCIELGKSLLARKHYASEEIKEKLLQLTEKRKEMIDKWEDRWEWLRLILEVHQFSRDASVAEAWLLGQEPYLSSREIGQSVDEVEKLIKRHEAFEKSAATWDERFSALERLTTLELLEVRRQQEEEERKRRPPSPEPSTKVSEEAESQQQWDTSKGEQVSQNGLPAEQGSPRMAETVDTSEMVNGATEQRTSSKESSPIPSPTSDRKAKTALPAQSAATLPARTQETPSAQMEGFLNRKHEWEAHNKKASSRSWHNVYCV--INNQEMGFYKDAK--TAASGIPYHSEVPVSLKEAVCEVALDYKKKKHVFKLRLND-GNEYLFQAKDDEEMNTWIQAISSAISSD-KHEVSASTQST--PASSRAQTLPTS 2332          
BLAST of Spectrin beta chain vs. Ensembl Human
Match: SPTBN1 (spectrin beta, non-erythrocytic 1 [Source:HGNC Symbol;Acc:HGNC:11275])

HSP 1 Score: 1835.46 bits (4753), Expect = 0.000e+0
Identity = 1008/2313 (43.58%), Postives = 1527/2313 (66.02%), Query Frame = 1
Query:  154 KLYERFRIKALAGEREKVQKKTFTKWINSHLNKLKQSIDDLYNXXXXXXXXXXXXXXXXXXXXPYPTKGKMRIHCLENVDKSLNFLIEQRVHLENMGAHDIVDGNARLTLGLIWTIILRFQIQDIVVEEDDTSEKRQAKDALLLWCQMKTAGYPNTNVRNFSTCWRDGLAFNAIIHRHRPDLLEYSALSRSNPNENLEQAIRIAEEKLGIPRLLDPEDVSVENPDEKSIMTYVVTFYHFFSKMKADSVHSKRVGKILSQSMETEEMMVHYDKLTSNLLEWINQTIELLNDRTFANSLSGVQQQLAAFNTYRVTEKPPKFQEKGNLEMLLFSIQSQMRANNQMPYLPIEGKLISDINNAWNKLDKAEHARELALRDELIRQEKLEQLALRFDRKAGMREAWLTENQRLITQDNFGQDLSAVEAAGKKHEAIKTDILAYEERVNSVTLVTSELENECYHDVERVLCRRDNVIRLWEKLLDMLAVRKLRLDACYKVQKLFQDIKHLLDLINDLKARLKTEDIGRHLMGVEDLIHKHSLLEIDIRMVGTKIEGIMSDAQPFINSEFGLGSGDFQPADPNEVILRTVNLKEEYDNLLELSRNRKDNLSASKVMWEFLWGVADEEQWMKEKIQLMLNPDLGHDLSSVHRLISKHKVIEEDVRNHSNYLQNVIQGGQQLILDKNPGAEKVADXXXXXXXXXXXXXXXXXXRRSKLEQSLAYFHCLADCGEVEIWIIEQVKLVKIDETSINEESIITDIHKHEQLSKSIEDYESNINSLDEQVKKLSEGDLELVTIEEKVSNIKSQYAILIELTNQKQNKLTDTLSLFRVLRKADTVKTWIDEKEKLLMSLIPTDELEELEVFRHRFDGFEKEMNIQADQVEFVNTLAEKLSDMDHPQIADVVNKRFELNKLWNSLADLVEARREQLQTSYEFNQYLLECKQTGEWIREKSRLVESTDELGDDLAGIMQLQRRMGGMQRDMDAIRAKLEHLDEEMDTLIAKRPNXXXXXXXXXXXXXXFWAELGDMLADRDDRLSESSELQRFLQDLDHIHIWLSKMQTTVASEDLPKDLADAEKSLVQHEQLKEEIDSYQDEFIRLLDYGRRITEDKTDAQYMFLSQRLNALEEGWQELCQMWENRXXXXXXXXXXXVFLRDAIQSEVLLAQEENFLSKEDIPISIENSQNLLRKHEGFLTTLQANHDHTIAVIEFGRNLVERGHFCSDKINLRVKSILXXXXXXXXXXXXAYEKLKDQVLYQELSQDIDDLSKWIQEKMIIATDESFREEKNIARRYNRHRAFDEEIQANKDRLCQAIDYAMQIVEERPQLADMIYPQIDSLNQQWEELEQTTFLKGEKMIEANREAIFEEGTMDVMTWLXXXXXXXXXXXXXXXXXXXXXXKLKKVEEA--DNEMEIKRKQIQDLKMHAAKLKEEQPEKAFGIEQKHLILEHRFTQLQMPXXXXXXXXXXXXXXXXFLRNLDDQKAWVDDKLLLAESTNFGNNLLTVQQLLRRHRYLATEVNNHKPQLEYLKEEGAVLIEEVSPMQREKFVAGLQELESLWNRLEHSIDLRQQRLKESEATQTFLFDAEEAESWLWEQELFLLSEERGIRDQEAAINVIKKHDARQKTIEDYGEEITKLGTRSRLLIEKDHPQADRIALAQSHVDKVYAGLRDLCLEKKQRLSEIQKLNHLYREIVDLENWIYERTLVASSHDLGVDFEHCCLLRERFDEFFHETHLLGKDRVKAANDLCASLISQCHADSAEIAQWHDRINDSWAELQELMQTRIQLLRTAWEFYKYLSSCQDVLDRICEKIASIPTDVSKDSQSVAIQQRKHATFLSDAQALEGQVQWVVDEANHLLPSYAGQKEWHICERRDDVLATWNQLNMQAERRRHQLEDAADLQRFFSMVRELLQWMDLVALQINEKTRPKDVSGVELLINDHRSIKAEIAAREESMSICVNLGRTLLHRGRVGVDEVRAALINLITRKYSLEDMWEERWDYLQLILEVYQFARDASVAEAWILAQEPYLANKTLGETLDETLSLLKKHINFEKTVMSQEERFEALEKLTTMEIR--------------------AKEITKESILLK--DKHKQERI-ENAIKIFQPPP-------SPELVHESPKVSISEEDEE-----GKSHQHKISVISKEAAEM-CQSSETKT-DIRGILIRKHEWEYKNRKALNRSWHEFLVVLSIEKNKLLVYKDEKHYNEKPQDTYHKDSGLDLNDLVAAPASDYLKRPFVFRIKITSTGAEYLFQAKDEEDMLRWVNSINENSQKDLKSETTAPGKSSTLPACTSDPHVPST 6975
            +L+ER RIKALA ERE VQKKTFTKW+NSHL ++   I DLY DL+DG+ML+ LLE+LSGE+LP PTKG+MRIHCLENVDK+L FL EQRVHLENMG+HDIVDGN RLTLGLIWTIILRFQIQDI VE +D  EK+ AKDALLLWCQMKTAGYPN N+ NF+T WRDG+AFNA+IH+HRPDL+++  L +SN + NL+ A  +AE+ LG+ +LLDPED+SV++PDEKSI+TYVVT+YH+FSKMKA +V  KR+GK+L  ++ETE+M+  Y+ L S+LLEWI QTI +LN+R FANSL GVQQQL AFNTYR  EKPPKF EKGNLE+LLF+IQS+MRANNQ  Y+P EGKLISDIN AW +L+KAEH RELALR+ELIRQEKLEQLA RFDRKA MRE WL+ENQRL++QDNFG DL AVEAA KKHEAI+TDI AYEERV +V  V  ELE E YHD++R+  R+DNVIRLWE LL++L  R+ RL+    +QK+FQ++ +++D ++++K  + ++D G+HL+GVEDL+ KH+L+E DI +   ++ G+ + AQ F       G G ++P DP  +  R  +++  Y  L +L+  R+  L  S+ +W+F W +A+EE W++EK +++ + D G DL+SV RL+SKH+  E+++   S + +  I+ G+ +I +++ G+EK+ + +  +   W  L +L+  R+ +LE++       AD  +++ W+++ +K+V   +   +E S  + + KH+ +++ I +Y   +++L EQ   L +   E   +  ++S I+ +Y  + ELT  ++  L DTL+L+++  +AD  + WIDEKE+ L ++   ++LE+LEV +HRF+  E EMN QA +V  VN +A +L    HP   ++  ++ +LN  W+   +LV+ +++ L ++     Y LEC +T  WIREK++++EST +LG+DLAG+M LQR++ GM+RD+ AI AKL  L +E + L ++ P+  + I      + D W E+   L +R+  L E+S+LQ+FL+DLD    WLS+ QT +ASED+P  L +AEK L QHE +K EID+Y++++ ++ D G  +T+ +TDAQYMFL QRL AL+ GW EL +MWENRQ LLSQS + Q FLRD  Q+E  L  +E  L+  ++P ++E ++  ++K E F+TT+ AN +   AV+E GR LV  G+  SD+I  +V SI +R   N+  ++E   +LKD    Q+  QD  +LS WI EKM+ A D S+ E +N+  ++ +H+AF  E+ +NK+ L +     MQ++ E+P+   ++  ++  L++ WE LE TT  K +++ +AN+  +F +   D+  WL  +   I   +   +  +   + LKK +    +N+ME+++K+I++L+  A  L +E  +    ++ K L ++ +F +L  P+  +K  L+  K I QF R+++D+  WV +++ LA ST+ G+NL TVQ L+++++ L  E+  H+P+++ + E    ++ + S +  E     L +L+ LW  L    + R +RL+E+   Q + FDA EAE+W+ EQEL+++SEE+  +D+++A++++KKH   ++ +EDY E + +L   SR L+   HP+++RI++ QS VDK+YAGL+DL  E++ +L E  +L  L RE+ DLE WI ER +VA SH+LG D+EH  +L+ERF EF  +T  +G++RV   N L   LI+  H+D+A IA+W D +N++WA+L EL+ TR Q+L  ++E +K+    +++  RI +K   +P ++ +D  +V   QR H TF  D QAL  QV+ + ++A  L  +YAG K   I +R ++VL  W  L    E RR +L D  D  RFFSMVR+L+ WM+ V  QI  + +P+DVS VELL+N+H+ IKAEI AR +S + C+ LG++LL R     +E++  L+ L  ++  + D WE+RW++L+LILEV+QF+RDASVAEAW+L QEPYL+++ +G+++DE   L+K+H  FEK+  + +ERF ALE+LTT+E+                     + ++++E+   +  D  K E++ +N +   Q  P       + E+V+ + +   S ++           + K ++ ++ AA +  ++ ET +  + G L RKHEWE  N+KA +RSWH    V  I   ++  YKD K         YH +  + L + V   A DY K+  VF++++   G EYLFQAKD+E+M  W+ +I+     D K E +A  +S+  PA +    +P++
Sbjct:   38 RLFERSRIKALADEREAVQKKTFTKWVNSHLARVSCRITDLYTDLRDGRMLIKLLEVLSGERLPKPTKGRMRIHCLENVDKALQFLKEQRVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKEKKSAKDALLLWCQMKTAGYPNVNIHNFTTSWRDGMAFNALIHKHRPDLIDFDKLKKSNAHYNLQNAFNLAEQHLGLTKLLDPEDISVDHPDEKSIITYVVTYYHYFSKMKALAVEGKRIGKVLDNAIETEKMIEKYESLASDLLEWIEQTIIILNNRKFANSLVGVQQQLQAFNTYRTVEKPPKFTEKGNLEVLLFTIQSKMRANNQKVYMPREGKLISDINKAWERLEKAEHERELALRNELIRQEKLEQLARRFDRKAAMRETWLSENQRLVSQDNFGFDLPAVEAATKKHEAIETDIAAYEERVQAVVAVARELEAENYHDIKRITARKDNVIRLWEYLLELLRARRQRLEMNLGLQKIFQEMLYIMDWMDEMKVLVLSQDYGKHLLGVEDLLQKHTLVEADIGIQAERVRGVNASAQKFATD----GEG-YKPCDPQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEKILSSDDYGKDLTSVMRLLSKHRAFEDEMSGRSGHFEQAIKEGEDMIAEEHFGSEKIRERIIYIREQWANLEQLSAIRKKRLEEASLLHQFQADADDIDAWMLDILKIVSSSDVGHDEYSTQSLVKKHKDVAEEIANYRPTLDTLHEQASALPQEHAESPDVRGRLSGIEERYKEVAELTRLRKQALQDTLALYKMFSEADACELWIDEKEQWLNNMQIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLMHSGHPSEKEIKAQQDKLNTRWSQFRELVDRKKDALLSALSIQNYHLECNETKSWIREKTKVIESTQDLGNDLAGVMALQRKLTGMERDLVAIEAKLSDLQKEAEKLESEHPDQAQAILSRLAEISDVWEEMKTTLKNREASLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLTEAEKLLTQHENIKNEIDNYEEDYQKMRDMGEMVTQGQTDAQYMFLRQRLQALDTGWNELHKMWENRQNLLSQSHAYQQFLRDTKQAEAFLNNQEYVLAHTEMPTTLEGAEAAIKKQEDFMTTMDANEEKINAVVETGRRLVSDGNINSDRIQEKVDSIDDRHRKNRETASELLMRLKDNRDLQKFLQDCQELSLWINEKMLTAQDMSYDEARNLHSKWLKHQAFMAELASNKEWLDKIEKEGMQLISEKPETEAVVKEKLTGLHKMWEVLESTTQTKAQRLFDANKAELFTQSCADLDKWLHGLESQIQSDDYGKDLTSVNIL-LKKQQATMLENQMEVRKKEIEELQSQAQALSQE-GKSTDEVDSKRLTVQTKFMELLEPLNERKHNLLASKEIHQFNRDVEDEILWVGERMPLATSTDHGHNLQTVQLLIKKNQTLQKEIQGHQPRIDDIFERSQNIVTDSSSLSAEAIRQRLADLKQLWGLLIEETEKRHRRLEEAHRAQQYYFDAAEAEAWMSEQELYMMSEEKA-KDEQSAVSMLKKHQILEQAVEDYAETVHQLSKTSRALVADSHPESERISMRQSKVDKLYAGLKDLAEERRGKLDERHRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHFTMLQERFREFARDTGNIGQERVDTVNHLADELINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQILAASYELHKFYHDAKEIFGRIQDKHKKLPEELGRDQNTVETLQRMHTTFEHDIQALGTQVRQLQEDAARLQAAYAGDKADDIQKRENEVLEAWKSLLDACESRRVRLVDTGDKFRFFSMVRDLMLWMEDVIRQIEAQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTTCIELGKSLLARKHYASEEIKEKLLQLTEKRKEMIDKWEDRWEWLRLILEVHQFSRDASVAEAWLLGQEPYLSSREIGQSVDEVEKLIKRHEAFEKSAATWDERFSALERLTTLELLEVRRQQEEEERKRRPPSPEPSTKVSEEAESQQQWDTSKGEQVSQNGLPAEQGSPRMAETVDTSEMVNGATEQRTSSKESSPIPSPTSDRKAKTALPAQSAATLPARTQETPSAQMEGFLNRKHEWEAHNKKASSRSWHNVYCV--INNQEMGFYKDAK--TAASGIPYHSEVPVSLKEAVCEVALDYKKKKHVFKLRLND-GNEYLFQAKDDEEMNTWIQAISSAISSD-KHEVSASTQST--PASSRAQTLPTS 2334          
BLAST of Spectrin beta chain vs. Ensembl Human
Match: SPTBN1 (spectrin beta, non-erythrocytic 1 [Source:HGNC Symbol;Acc:HGNC:11275])

HSP 1 Score: 1764.59 bits (4569), Expect = 0.000e+0
Identity = 929/2040 (45.54%), Postives = 1391/2040 (68.19%), Query Frame = 1
Query:  172 RIKALAGEREKVQKKTFTKWINSHLNKLKQSIDDLYNXXXXXXXXXXXXXXXXXXXXPYPTKGKMRIHCLENVDKSLNFLIEQRVHLENMGAHDIVDGNARLTLGLIWTIILRFQIQDIVVEEDDTSEKRQAKDALLLWCQMKTAGYPNTNVRNFSTCWRDGLAFNAIIHRHRPDLLEYSALSRSNPNENLEQAIRIAEEKLGIPRLLDPEDVSVENPDEKSIMTYVVTFYHFFSKMKADSVHSKRVGKILSQSMETEEMMVHYDKLTSNLLEWINQTIELLNDRTFANSLSGVQQQLAAFNTYRVTEKPPKFQEKGNLEMLLFSIQSQMRANNQMPYLPIEGKLISDINNAWNKLDKAEHARELALRDELIRQEKLEQLALRFDRKAGMREAWLTENQRLITQDNFGQDLSAVEAAGKKHEAIKTDILAYEERVNSVTLVTSELENECYHDVERVLCRRDNVIRLWEKLLDMLAVRKLRLDACYKVQKLFQDIKHLLDLINDLKARLKTEDIGRHLMGVEDLIHKHSLLEIDIRMVGTKIEGIMSDAQPFINSEFGLGSGDFQPADPNEVILRTVNLKEEYDNLLELSRNRKDNLSASKVMWEFLWGVADEEQWMKEKIQLMLNPDLGHDLSSVHRLISKHKVIEEDVRNHSNYLQNVIQGGQQLILDKNPGAEKVADXXXXXXXXXXXXXXXXXXRRSKLEQSLAYFHCLADCGEVEIWIIEQVKLVKIDETSINEESIITDIHKHEQLSKSIEDYESNINSLDEQVKKLSEGDLELVTIEEKVSNIKSQYAILIELTNQKQNKLTDTLSLFRVLRKADTVKTWIDEKEKLLMSLIPTDELEELEVFRHRFDGFEKEMNIQADQVEFVNTLAEKLSDMDHPQIADVVNKRFELNKLWNSLADLVEARREQLQTSYEFNQYLLECKQTGEWIREKSRLVESTDELGDDLAGIMQLQRRMGGMQRDMDAIRAKLEHLDEEMDTLIAKRPNXXXXXXXXXXXXXXFWAELGDMLADRDDRLSESSELQRFLQDLDHIHIWLSKMQTTVASEDLPKDLADAEKSLVQHEQLKEEIDSYQDEFIRLLDYGRRITEDKTDAQYMFLSQRLNALEEGWQELCQMWENRXXXXXXXXXXXVFLRDAIQSEVLLAQEENFLSKEDIPISIENSQNLLRKHEGFLTTLQANHDHTIAVIEFGRNLVERGHFCSDKINLRVKSILXXXXXXXXXXXXAYEKLKDQVLYQELSQDIDDLSKWIQEKMIIATDESFREEKNIARRYNRHRAFDEEIQANKDRLCQAIDYAMQIVEERPQLADMIYPQIDSLNQQWEELEQTTFLKGEKMIEANREAIFEEGTMDVMTWLXXXXXXXXXXXXXXXXXXXXXXKLKKVEEADNEMEIKRKQIQDLKMHAAKLKEEQPEKAFGIEQKHLILEHRFTQLQMPXXXXXXXXXXXXXXXXFLRNLDDQKAWVDDKLLLAESTNFGNNLLTVQQLLRRHRYLATEVNNHKPQLEYLKEEGAVLIEEVSPMQREKFVAGLQELESLWNRLEHSIDLRQQRLKESEATQTFLFDAEEAESWLWEQELFLLSEERGIRDQEAAINVIKKHDARQKTIEDYGEEITKLGTRSRLLIEKDHPQADRIALAQSHVDKVYAGLRDLCLEKKQRLSEIQKLNHLYREIVDLENWIYERTLVASSHDLGVDFEHCCLLRERFDEFFHETHLLGKDRVKAANDLCASLISQCHADSAEIAQWHDRINDSWAELQELMQTRIQLLRTAWEFYKYLSSCQDVLDRICEKIASIPTDVSKDSQSVAIQQRKHATFLSDAQALEGQVQWVVDEANHLLPSYAGQKEWHICERRDDVLATWNQLNMQAERRRHQLEDAADLQRFFSMVRELLQWMDLVALQINEKTRPKDVSGVELLINDHRSIKAEIAAREESMSICVNLGRTLLHRGRVGVDEVRAALINLITRKYSLEDMWEERWDYLQLILEVYQFARDASVAEAWILAQEPYLANKTLGETLDETLSLLKKHINFEKTVMSQEERFEA 6291
            R K L  ERE VQKKTFTKW+NSHL ++   I DLY DL+DG+ML+ LLE+LSGE+LP PTKG+MRIHCLENVDK+L FL EQRVHLENMG+HDIVDGN RLTLGLIWTIILRFQIQDI VE +D  EK+ AKDALLLWCQMKTAGYPN N+ NF+T WRDG+AFNA+IH+HRPDL+++  L +SN + NL+ A  +AE+ LG+ +LLDPED+SV++PDEKSI+TYVVT+YH+FSKMKA +V  KR+GK+L  ++ETE+M+  Y+ L S+LLEWI QTI +LN+R FANSL GVQQQL AFNTYR  EKPPKF EKGNLE+LLF+IQS+MRANNQ  Y+P EGKLISDIN AW +L+KAEH RELALR+ELIRQEKLEQLA RFDRKA MRE WL+ENQRL++QDNFG DL AVEAA KKHEAI+TDI AYEERV +V  V  ELE E YHD++R+  R+DNVIRLWE LL++L  R+ RL+    +QK+FQ++ +++D ++++K  + ++D G+HL+GVEDL+ KH+L+E DI +   ++ G+ + AQ F       G G ++P DP  +  R  +++  Y  L +L+  R+  L  S+ +W+F W +A+EE W++EK +++ + D G DL+SV RL+SKH+  E+++   S + +  I+ G+ +I +++ G+EK+ + +  +   W  L +L+  R+ +LE++       AD  +++ W+++ +K+V   +   +E S  + + KH+ +++ I +Y   +++L EQ   L +   E   +  ++S I+ +Y  + ELT  ++  L DTL+L+++  +AD  + WIDEKE+ L ++   ++LE+LEV +HRF+  E EMN QA +V  VN +A +L    HP   ++  ++ +LN  W+   +LV+ +++ L ++     Y LEC +T  WIREK++++EST +LG+DLAG+M LQR++ GM+RD+ AI AKL  L +E + L ++ P+  + I      + D W E+   L +R+  L E+S+LQ+FL+DLD    WLS+ QT +ASED+P  L +AEK L QHE +K EID+Y++++ ++ D G  +T+ +TDAQYMFL QRL AL+ GW EL +MWENRQ LLSQS + Q FLRD  Q+E  L  +E  L+  ++P ++E ++  ++K E F+TT+ AN +   AV+E GR LV  G+  SD+I  +V SI +R   N+  ++E   +LKD    Q+  QD  +LS WI EKM+ A D S+ E +N+  ++ +H+AF  E+ +NK+ L +     MQ++ E+P+   ++  ++  L++ WE LE TT  K +++ +AN+  +F +   D+  WL  +   I   +   +  +   + LKK +  +N+ME+++K+I++L+  A  L +E  +    ++ K L ++ +F +L  P+  +K  L+  K I QF R+++D+  WV +++ LA ST+ G+NL TVQ L+++++ L  E+  H+P+++ + E    ++ + S +  E     L +L+ LW  L    + R +RL+E+   Q + FDA EAE+W+ EQEL+++SEE+  +D+++A++++KKH   ++ +EDY E + +L   SR L+   HP+++RI++ QS VDK+YAGL+DL  E++ +L E  +L  L RE+ DLE WI ER +VA SH+LG D+EH  +L+ERF EF  +T  +G++RV   N L   LI+  H+D+A IA+W D +N++WA+L EL+ TR Q+L  ++E +K+    +++  RI +K   +P ++ +D  +V   QR H TF  D QAL  QV+ + ++A  L  +YAG K   I +R ++VL  W  L    E RR +L D  D  RFFSMVR+L+ WM+ V  QI  + +P+DVS VELL+N+H+ IKAEI AR +S + C+ LG++LL R     +E++  L+ L  ++  + D WE+RW++L+LILEV+QF+RDASVAEAW+L QEPYL+++ +G+++DE   L+K+H  FEK+  + +ERF A
Sbjct:   31 RFKQLQDEREAVQKKTFTKWVNSHLARVSCRITDLYTDLRDGRMLIKLLEVLSGERLPKPTKGRMRIHCLENVDKALQFLKEQRVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKEKKSAKDALLLWCQMKTAGYPNVNIHNFTTSWRDGMAFNALIHKHRPDLIDFDKLKKSNAHYNLQNAFNLAEQHLGLTKLLDPEDISVDHPDEKSIITYVVTYYHYFSKMKALAVEGKRIGKVLDNAIETEKMIEKYESLASDLLEWIEQTIIILNNRKFANSLVGVQQQLQAFNTYRTVEKPPKFTEKGNLEVLLFTIQSKMRANNQKVYMPREGKLISDINKAWERLEKAEHERELALRNELIRQEKLEQLARRFDRKAAMRETWLSENQRLVSQDNFGFDLPAVEAATKKHEAIETDIAAYEERVQAVVAVARELEAENYHDIKRITARKDNVIRLWEYLLELLRARRQRLEMNLGLQKIFQEMLYIMDWMDEMKVLVLSQDYGKHLLGVEDLLQKHTLVEADIGIQAERVRGVNASAQKFATD----GEG-YKPCDPQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEKILSSDDYGKDLTSVMRLLSKHRAFEDEMSGRSGHFEQAIKEGEDMIAEEHFGSEKIRERIIYIREQWANLEQLSAIRKKRLEEASLLHQFQADADDIDAWMLDILKIVSSSDVGHDEYSTQSLVKKHKDVAEEIANYRPTLDTLHEQASALPQEHAESPDVRGRLSGIEERYKEVAELTRLRKQALQDTLALYKMFSEADACELWIDEKEQWLNNMQIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLMHSGHPSEKEIKAQQDKLNTRWSQFRELVDRKKDALLSALSIQNYHLECNETKSWIREKTKVIESTQDLGNDLAGVMALQRKLTGMERDLVAIEAKLSDLQKEAEKLESEHPDQAQAILSRLAEISDVWEEMKTTLKNREASLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLTEAEKLLTQHENIKNEIDNYEEDYQKMRDMGEMVTQGQTDAQYMFLRQRLQALDTGWNELHKMWENRQNLLSQSHAYQQFLRDTKQAEAFLNNQEYVLAHTEMPTTLEGAEAAIKKQEDFMTTMDANEEKINAVVETGRRLVSDGNINSDRIQEKVDSIDDRHRKNRETASELLMRLKDNRDLQKFLQDCQELSLWINEKMLTAQDMSYDEARNLHSKWLKHQAFMAELASNKEWLDKIEKEGMQLISEKPETEAVVKEKLTGLHKMWEVLESTTQTKAQRLFDANKAELFTQSCADLDKWLHGLESQIQSDDYGKDLTSVNIL-LKKQQMLENQMEVRKKEIEELQSQAQALSQE-GKSTDEVDSKRLTVQTKFMELLEPLNERKHNLLASKEIHQFNRDVEDEILWVGERMPLATSTDHGHNLQTVQLLIKKNQTLQKEIQGHQPRIDDIFERSQNIVTDSSSLSAEAIRQRLADLKQLWGLLIEETEKRHRRLEEAHRAQQYYFDAAEAEAWMSEQELYMMSEEKA-KDEQSAVSMLKKHQILEQAVEDYAETVHQLSKTSRALVADSHPESERISMRQSKVDKLYAGLKDLAEERRGKLDERHRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFREFARDTGNIGQERVDTVNHLADELINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQILAASYELHKFYHDAKEIFGRIQDKHKKLPEELGRDQNTVETLQRMHTTFEHDIQALGTQVRQLQEDAARLQAAYAGDKADDIQKRENEVLEAWKSLLDACESRRVRLVDTGDKFRFFSMVRDLMLWMEDVIRQIEAQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTTCIELGKSLLARKHYASEEIKEKLLQLTEKRKEMIDKWEDRWEWLRLILEVHQFSRDASVAEAWLLGQEPYLSSREIGQSVDEVEKLIKRHEAFEKSAATWDERFSA 2062          
BLAST of Spectrin beta chain vs. Ensembl Human
Match: SPTB (spectrin beta, erythrocytic [Source:HGNC Symbol;Acc:HGNC:11274])

HSP 1 Score: 1609.73 bits (4167), Expect = 0.000e+0
Identity = 934/2298 (40.64%), Postives = 1403/2298 (61.05%), Query Frame = 1
Query:  154 KLYERFRIKALAGEREKVQKKTFTKWINSHLNKLKQSIDDLYNXXXXXXXXXXXXXXXXXXXXPYPTKGKMRIHCLENVDKSLNFLIEQRVHLENMGAHDIVDGNARLTLGLIWTIILRFQIQDIVVEEDDTSEKRQAKDALLLWCQMKTAGYPNTNVRNFSTCWRDGLAFNAIIHRHRPDLLEYSALSRSNPNENLEQAIRIAEEKLGIPRLLDPEDVSVENPDEKSIMTYVVTFYHFFSKMKADSVHSKRVGKILSQSMETEEMMVHYDKLTSNLLEWINQTIELLNDRTFANSLSGVQQQLAAFNTYRVTEKPPKFQEKGNLEMLLFSIQSQMRANNQMPYLPIEGKLISDINNAWNKLDKAEHARELALRDELIRQEKLEQLALRFDRKAGMREAWLTENQRLITQDNFGQDLSAVEAAGKKHEAIKTDILAYEERVNSVTLVTSELENECYHDVERVLCRRDNVIRLWEKLLDMLAVRKLRLDACYKVQKLFQDIKHLLDLINDLKARLKTEDIGRHLMGVEDLIHKHSLLEIDIRMVGTKIEGIMSDAQPFINSEFGLGSGDFQPADPNEVILRTVNLKEEYDNLLELSRNRKDNLSASKVMWEFLWGVADEEQWMKEKIQLMLNPDLGHDLSSVHRLISKHKVIEEDVRNHSNYLQNVIQGGQQLILDKNPGAEKVADXXXXXXXXXXXXXXXXXXRRSKLEQSLAYFHCLADCGEVEIWIIEQVKLVKIDETSINEESIITDIHKHEQLSKSIEDYESNINSLDEQVKKLSEGDLELVTIEEKVSNIKSQYAILIELTNQKQNKLTDTLSLFRVLRKADTVKTWIDEKEKLLMSLIPTDELEELEVFRHRFDGFEKEMNIQADQVEFVNTLAEKLSDMDHPQIADVVNKRFELNKLWNSLADLVEARREQLQTSYEFNQYLLECKQTGEWIREKSRLVESTDELGDDLAGIMQLQRRMGGMQRDMDAIRAKLEHLDEEMDTLIAKRPNXXXXXXXXXXXXXXFWAELGDMLADRDDRLSESSELQRFLQDLDHIHIWLSKMQTTVASEDLPKDLADAEKSLVQHEQLKEEIDSYQDEFIRLLDYGRRITEDKTDAQYMFLSQRLNALEEGWQELCQMWENRXXXXXXXXXXXVFLRDAIQSEVLLAQEENFLSKEDIPISIENSQNLLRKHEGFLTTLQANHDHTIAVIEFGRNLVERGHFCSDKINLRVKSILXXXXXXXXXXXXAYEKLKDQVLYQELSQDIDDLSKWIQEKMIIATDESFREEKNIARRYNRHRAFDEEIQANKDRLCQAIDYAMQIVEERPQLADMIYPQIDSLNQQWEELEQTTFLKGEKMIEANREAIFEEGTMDVMTWLXXXXXXXXXXXXXX--XXXXXXXXKLKKVEEADNEMEIKRKQIQDLKMHAAKLKEEQPEKAFGIEQKHLILEHRFTQLQMPXXXXXXXXXXXXXXXXFLRNLDDQKAWVDDKLLLAESTNFGNNLLTVQQLLRRHRYLATEVNNHKPQLEYLKEEGAVLIEEVSPMQREKFVAGLQELESLWNRLEHSIDLRQQRLKESEATQTFLFDAEEAESWLWEQELFLLSEERGIRDQEAAINVIKKHDARQKTIEDYGEEITKLGTRSRLLIEKDHPQADRIALAQSHVDKVYAGLRDLCLEKKQRLSEIQKLNHLYREIVDLENWIYERTLVASSHDLGVDFEHCCLLRERFDEFFHETHLLGKDRVKAANDLCASLISQCHADSAEIAQWHDRINDSWAELQELMQTRIQLLRTAWEFYKYLSSCQDVLDRICEKIASIPTDVSKDSQSVAIQQRKHATFLSDAQALEGQVQWVVDEANHLLPSYAGQKEWHICERRDDVLATWNQLNMQAERRRHQLEDAADLQRFFSMVRELLQWMDLVALQINEKTRPKDVSGVELLINDHRSIKAEIAAREESMSICVNLGRTLLHRGRVGVDEVRAALINLITRKYSLEDMWEERWDYLQLILEVYQFARDASVAEAWILAQEPYLANKTLGETLDETLSLLKKHINFEKTVMSQEERFEALEKLTTMEI-------RAKEITKESILLKDKHKQERIENAIKIFQPPPSPE--------------LVHESPKVSISEEDEEGKSHQHKISVISKEAAEMCQSSETK-----TDIRGILIRKHEWEYKNRKALNRSWHEFLVVLSIEKNKLLVYKDEKHYNEKPQDTYHKDSGLDLNDLVAAPASDYLKRPFVFRIKITSTGAEYLFQAKDEEDMLRWV----NSINENSQKDLKSETTAPGKSSTLPACT 6951
            +L+ER RIKALA ERE VQKKTFTKW+NSHL ++   I DLY DL+DG+ML+ LLE+LSGE LP PTKGKMRIHCLENVDK+L FL EQRVHLENMG+HDIVDGN RL LGLIWTIILRFQIQDIVV+  +  E R AKDALLLWCQMKTAGYP+ NV NF++ W+DGLAFNA+IH+HRPDL+++  L  SN   NLE A  +AE +LGI  LLDPEDV  ENPDEKSI+TYVV FYH+FSKMK  +V  KRVGK++  ++ETE+M+  Y  L S+LL WI QTI +LN R FANSL+GVQQQL AF+TYR  EKPPKFQEKGNLE+LLF+IQS+MRANNQ  Y P +GKL+SDIN AW  L++AE+ RELALR+ELIRQEKLEQLA RFDRKA MRE WL+ENQRL+ QDNFG DL+AVEAA KKHEAI+TD  AYEERV ++  +  ELE E YHD +R+  R+DN++RLW  L ++L  R+ RL+    +QKLFQD+ H +D ++++KA L + + G+HL+ VEDL+ KH L+E DI + G K++ I +    F       G G +QP DP  +  R  +L++ ++ L  ++  RK  L  SK +W+F W + + E W+KEK Q+  + D G DL+SV  L  KHK  E+++R    +L+ + Q    ++  K  G  ++   +KE+   W++L +L    +  L+ +  +F    D  +++ W+ +  +L+  ++   +E +      KH+   + +E+    +  L++Q +   E   +   +  ++  ++  Y  ++   + +Q +L + L L+ V  + D  + W+ EKEK L  +   D LE+LEV +HRFD  ++EM     Q++ VN  A  L +  HP+  +V   +  LN  W +   LV  RRE + ++   + Y ++C++T +WI +K+++VEST +LG DLAGI+ +QR++ G++RD+ AI+A+++ L+ E   L+   P  +E I + +  LE+ W  L   L  ++D L E S+LQ FLQDLD    WLS  Q  VASED+P+ L +AE+ L QH  +K+EID +QD + R+ + G ++ + +TD +Y+ L QRL  L+ GW  L +MWE+R   L+Q L  Q F +DA Q+E +L+ +E  L+  + P S+E ++  +RK E FL +++ N D  ++ ++ G  LV  G+  SDKI  +V+ I +R   N  ++ EA   L+D +  Q   Q+  +L+ WI +K++ + D S+ E +N+  ++ +H+AF  E+ +++  L        Q+++E+PQ   ++  ++++L++ W+EL+ TT  K + +  A    +  +   D+  W+  + + +   +      ++  +  KLK+VE   +++ ++++++ +L      + EE  +    IE+       RF  L  P+  +K QL   +   Q  R+L+D+  WV+++L LA+S ++G NL TVQ  +++++ L  E+  H P++E + + G  L+E  + +  +     L  L+S W+RL  +   R QRL+++   Q +  DA+EAE+W+ EQEL+++S+E   +D+E AI ++K+H  +Q+ +EDYG  I +L +R++ L+   HP+ ++I   Q  VDK YAGL+D+  E+K++L  +  L  L RE  DLE WI E+ LVASS ++G DF+H  LLR++F +F  ET  +G++RV   N     LI   H+++A IA+W D +N+ WA+L EL+ TR+QLL  +++ ++Y  +  ++L  I EK   +P DV  D+ +     R H  F  +   L  QVQ   D A  L  +YAG+K   I  +  +V A W  L      RR QL D AD  RFFSM R+LL WM+ +  QI  + RP+DVS VELL+  H+ I AEI  R ++ S C+ LG +LL R     +E+R  L  +++R+  + + WE RW+ L+++LEV QF+RDASVAEAW++AQEPYLA+   G T+D    L+K+H  FEK+  S  ERF ALEK TT+E+       R  E T       +   +  + +     +  P  E                H+  + S  +E    +     +     E  E       +       + G L RKH+ E  N+KA NRSW+    VL    ++L  YKD K  N      YH +  L L   +   A++Y K+  VF++++ S G+E+LF  KDEE+ML W+     +INE+    +K+++  P  S + P  +
Sbjct:   38 RLFERSRIKALADEREVVQKKTFTKWVNSHLARVSCRITDLYKDLRDGRMLIKLLEVLSGEMLPKPTKGKMRIHCLENVDKALQFLKEQRVHLENMGSHDIVDGNHRLVLGLIWTIILRFQIQDIVVQTQEGRETRSAKDALLLWCQMKTAGYPHVNVTNFTSSWKDGLAFNALIHKHRPDLIDFDKLKDSNARHNLEHAFNVAERQLGIIPLLDPEDVFTENPDEKSIITYVVAFYHYFSKMKVLAVEGKRVGKVIDHAIETEKMIEKYSGLASDLLTWIEQTITVLNSRKFANSLTGVQQQLQAFSTYRTVEKPPKFQEKGNLEVLLFTIQSRMRANNQKVYTPHDGKLVSDINRAWESLEEAEYRRELALRNELIRQEKLEQLARRFDRKAAMRETWLSENQRLVAQDNFGYDLAAVEAAKKKHEAIETDTAAYEERVRALEDLAQELEKENYHDQKRITARKDNILRLWSYLQELLQSRRQRLETTLALQKLFQDMLHSIDWMDEIKAHLLSAEFGKHLLEVEDLLQKHKLMEADIAIQGDKVKAITAATLKFTE-----GKG-YQPCDPQVIQDRISHLEQCFEELSNMAAGRKAQLEQSKRLWKFFWEMDEAESWIKEKEQIYSSLDYGKDLTSVLILQRKHKAFEDELRGLDAHLEQIFQEAHGMVARKQFGHPQIEARIKEVSAQWDQLKDLAAFCKKNLQDAENFFQFQGDADDLKAWLQDAHRLLSGEDVGQDEGATRALGKKHKDFLEELEESRGVMEHLEQQAQGFPEEFRDSPDVTHRLQALRELYQQVVAQADLRQQRLQEALDLYTVFGETDACELWMGEKEKWLAEMEMPDTLEDLEVVQHRFDILDQEMKTLMTQIDGVNLAANSLVESGHPRSREVKQYQDHLNTRWQAFQTLVSERREAVDSALRVHNYCVDCEETSKWITDKTKVVESTKDLGRDLAGIIAIQRKLSGLERDVAAIQARVDALERESQQLMDSHPEQKEDIGQRQKHLEELWQGLQQSLQGQEDLLGEVSQLQAFLQDLDDFQAWLSITQKAVASEDMPESLPEAEQLLQQHAGIKDEIDGHQDSYQRVKESGEKVIQGQTDPEYLLLGQRLEGLDTGWNALGRMWESRSHTLAQCLGFQEFQKDAKQAEAILSNQEYTLAHLEPPDSLEAAEAGIRKFEDFLGSMENNRDKVLSPVDSGNKLVAEGNLYSDKIKEKVQLIEDRHRKNNEKAQEASVLLRDNLELQNFLQNCQELTLWINDKLLTSQDVSYDEARNLHNKWLKHQAFVAELASHEGWLENIDAEGKQLMDEKPQFTALVSQKLEALHRLWDELQATTKEKTQHLSAARSSDLRLQTHADLNKWISAMEDQLRSDDPGKDLTSVNRMLAKLKRVE---DQVNVRKEELGELFAQVPSMGEEGGDADLSIEK-------RFLDLLEPLGRRKKQLESSRAKLQISRDLEDETLWVEERLPLAQSADYGTNLQTVQLFMKKNQTLQNEILGHTPRVEDVLQRGQQLVE-AAEIDCQDLEERLGHLQSSWDRLREAAAGRLQRLRDANEAQQYYLDADEAEAWIGEQELYVISDEIP-KDEEGAIVMLKRHLRQQRAVEDYGRNIKQLASRAQGLLSAGHPEGEQIIRLQGQVDKHYAGLKDVAEERKRKLENMYHLFQLKRETDDLEQWISEKELVASSPEMGQDFDHVTLLRDKFRDFARETGAIGQERVDNVNAFIERLIDAGHSEAATIAEWKDGLNEMWADLLELIDTRMQLLAASYDLHRYFYTGAEILGLIDEKHRELPEDVGLDASTAESFHRVHTAFERELHLLGVQVQQFQDVATRLQTAYAGEKAEAIQNKEQEVSAAWQALLDACAGRRTQLVDTADKFRFFSMARDLLSWMESIIRQIETQERPRDVSSVELLMKYHQGINAEIETRSKNFSACLELGESLLQRQHQASEEIREKLQQVMSRRKEMNEKWEARWERLRMLLEVCQFSRDASVAEAWLIAQEPYLASGDFGHTVDSVEKLIKRHEAFEKSTASWAERFAALEKPTTLELKERQIAERPAEETGPQEEEGETAGEAPVSHHAATERTSPGEEEGTWPQNLQQPPPPGQHKDGQKSTGDERPTTEPLFKVLDTPLSEGDEPATLPAPRDHGQSVQMEGYLGRKHDLEGPNKKASNRSWNNLYCVL--RNSELTFYKDAK--NLALGMPYHGEEPLALRHAICEIAANYKKKKHVFKLRL-SNGSEWLFHGKDEEEMLSWLQGVSTAINESQSIRVKAQSL-PLPSLSGPDAS 2311          
BLAST of Spectrin beta chain vs. Ensembl Human
Match: SPTB (spectrin beta, erythrocytic [Source:HGNC Symbol;Acc:HGNC:11274])

HSP 1 Score: 1609.73 bits (4167), Expect = 0.000e+0
Identity = 934/2298 (40.64%), Postives = 1403/2298 (61.05%), Query Frame = 1
Query:  154 KLYERFRIKALAGEREKVQKKTFTKWINSHLNKLKQSIDDLYNXXXXXXXXXXXXXXXXXXXXPYPTKGKMRIHCLENVDKSLNFLIEQRVHLENMGAHDIVDGNARLTLGLIWTIILRFQIQDIVVEEDDTSEKRQAKDALLLWCQMKTAGYPNTNVRNFSTCWRDGLAFNAIIHRHRPDLLEYSALSRSNPNENLEQAIRIAEEKLGIPRLLDPEDVSVENPDEKSIMTYVVTFYHFFSKMKADSVHSKRVGKILSQSMETEEMMVHYDKLTSNLLEWINQTIELLNDRTFANSLSGVQQQLAAFNTYRVTEKPPKFQEKGNLEMLLFSIQSQMRANNQMPYLPIEGKLISDINNAWNKLDKAEHARELALRDELIRQEKLEQLALRFDRKAGMREAWLTENQRLITQDNFGQDLSAVEAAGKKHEAIKTDILAYEERVNSVTLVTSELENECYHDVERVLCRRDNVIRLWEKLLDMLAVRKLRLDACYKVQKLFQDIKHLLDLINDLKARLKTEDIGRHLMGVEDLIHKHSLLEIDIRMVGTKIEGIMSDAQPFINSEFGLGSGDFQPADPNEVILRTVNLKEEYDNLLELSRNRKDNLSASKVMWEFLWGVADEEQWMKEKIQLMLNPDLGHDLSSVHRLISKHKVIEEDVRNHSNYLQNVIQGGQQLILDKNPGAEKVADXXXXXXXXXXXXXXXXXXRRSKLEQSLAYFHCLADCGEVEIWIIEQVKLVKIDETSINEESIITDIHKHEQLSKSIEDYESNINSLDEQVKKLSEGDLELVTIEEKVSNIKSQYAILIELTNQKQNKLTDTLSLFRVLRKADTVKTWIDEKEKLLMSLIPTDELEELEVFRHRFDGFEKEMNIQADQVEFVNTLAEKLSDMDHPQIADVVNKRFELNKLWNSLADLVEARREQLQTSYEFNQYLLECKQTGEWIREKSRLVESTDELGDDLAGIMQLQRRMGGMQRDMDAIRAKLEHLDEEMDTLIAKRPNXXXXXXXXXXXXXXFWAELGDMLADRDDRLSESSELQRFLQDLDHIHIWLSKMQTTVASEDLPKDLADAEKSLVQHEQLKEEIDSYQDEFIRLLDYGRRITEDKTDAQYMFLSQRLNALEEGWQELCQMWENRXXXXXXXXXXXVFLRDAIQSEVLLAQEENFLSKEDIPISIENSQNLLRKHEGFLTTLQANHDHTIAVIEFGRNLVERGHFCSDKINLRVKSILXXXXXXXXXXXXAYEKLKDQVLYQELSQDIDDLSKWIQEKMIIATDESFREEKNIARRYNRHRAFDEEIQANKDRLCQAIDYAMQIVEERPQLADMIYPQIDSLNQQWEELEQTTFLKGEKMIEANREAIFEEGTMDVMTWLXXXXXXXXXXXXXX--XXXXXXXXKLKKVEEADNEMEIKRKQIQDLKMHAAKLKEEQPEKAFGIEQKHLILEHRFTQLQMPXXXXXXXXXXXXXXXXFLRNLDDQKAWVDDKLLLAESTNFGNNLLTVQQLLRRHRYLATEVNNHKPQLEYLKEEGAVLIEEVSPMQREKFVAGLQELESLWNRLEHSIDLRQQRLKESEATQTFLFDAEEAESWLWEQELFLLSEERGIRDQEAAINVIKKHDARQKTIEDYGEEITKLGTRSRLLIEKDHPQADRIALAQSHVDKVYAGLRDLCLEKKQRLSEIQKLNHLYREIVDLENWIYERTLVASSHDLGVDFEHCCLLRERFDEFFHETHLLGKDRVKAANDLCASLISQCHADSAEIAQWHDRINDSWAELQELMQTRIQLLRTAWEFYKYLSSCQDVLDRICEKIASIPTDVSKDSQSVAIQQRKHATFLSDAQALEGQVQWVVDEANHLLPSYAGQKEWHICERRDDVLATWNQLNMQAERRRHQLEDAADLQRFFSMVRELLQWMDLVALQINEKTRPKDVSGVELLINDHRSIKAEIAAREESMSICVNLGRTLLHRGRVGVDEVRAALINLITRKYSLEDMWEERWDYLQLILEVYQFARDASVAEAWILAQEPYLANKTLGETLDETLSLLKKHINFEKTVMSQEERFEALEKLTTMEI-------RAKEITKESILLKDKHKQERIENAIKIFQPPPSPE--------------LVHESPKVSISEEDEEGKSHQHKISVISKEAAEMCQSSETK-----TDIRGILIRKHEWEYKNRKALNRSWHEFLVVLSIEKNKLLVYKDEKHYNEKPQDTYHKDSGLDLNDLVAAPASDYLKRPFVFRIKITSTGAEYLFQAKDEEDMLRWV----NSINENSQKDLKSETTAPGKSSTLPACT 6951
            +L+ER RIKALA ERE VQKKTFTKW+NSHL ++   I DLY DL+DG+ML+ LLE+LSGE LP PTKGKMRIHCLENVDK+L FL EQRVHLENMG+HDIVDGN RL LGLIWTIILRFQIQDIVV+  +  E R AKDALLLWCQMKTAGYP+ NV NF++ W+DGLAFNA+IH+HRPDL+++  L  SN   NLE A  +AE +LGI  LLDPEDV  ENPDEKSI+TYVV FYH+FSKMK  +V  KRVGK++  ++ETE+M+  Y  L S+LL WI QTI +LN R FANSL+GVQQQL AF+TYR  EKPPKFQEKGNLE+LLF+IQS+MRANNQ  Y P +GKL+SDIN AW  L++AE+ RELALR+ELIRQEKLEQLA RFDRKA MRE WL+ENQRL+ QDNFG DL+AVEAA KKHEAI+TD  AYEERV ++  +  ELE E YHD +R+  R+DN++RLW  L ++L  R+ RL+    +QKLFQD+ H +D ++++KA L + + G+HL+ VEDL+ KH L+E DI + G K++ I +    F       G G +QP DP  +  R  +L++ ++ L  ++  RK  L  SK +W+F W + + E W+KEK Q+  + D G DL+SV  L  KHK  E+++R    +L+ + Q    ++  K  G  ++   +KE+   W++L +L    +  L+ +  +F    D  +++ W+ +  +L+  ++   +E +      KH+   + +E+    +  L++Q +   E   +   +  ++  ++  Y  ++   + +Q +L + L L+ V  + D  + W+ EKEK L  +   D LE+LEV +HRFD  ++EM     Q++ VN  A  L +  HP+  +V   +  LN  W +   LV  RRE + ++   + Y ++C++T +WI +K+++VEST +LG DLAGI+ +QR++ G++RD+ AI+A+++ L+ E   L+   P  +E I + +  LE+ W  L   L  ++D L E S+LQ FLQDLD    WLS  Q  VASED+P+ L +AE+ L QH  +K+EID +QD + R+ + G ++ + +TD +Y+ L QRL  L+ GW  L +MWE+R   L+Q L  Q F +DA Q+E +L+ +E  L+  + P S+E ++  +RK E FL +++ N D  ++ ++ G  LV  G+  SDKI  +V+ I +R   N  ++ EA   L+D +  Q   Q+  +L+ WI +K++ + D S+ E +N+  ++ +H+AF  E+ +++  L        Q+++E+PQ   ++  ++++L++ W+EL+ TT  K + +  A    +  +   D+  W+  + + +   +      ++  +  KLK+VE   +++ ++++++ +L      + EE  +    IE+       RF  L  P+  +K QL   +   Q  R+L+D+  WV+++L LA+S ++G NL TVQ  +++++ L  E+  H P++E + + G  L+E  + +  +     L  L+S W+RL  +   R QRL+++   Q +  DA+EAE+W+ EQEL+++S+E   +D+E AI ++K+H  +Q+ +EDYG  I +L +R++ L+   HP+ ++I   Q  VDK YAGL+D+  E+K++L  +  L  L RE  DLE WI E+ LVASS ++G DF+H  LLR++F +F  ET  +G++RV   N     LI   H+++A IA+W D +N+ WA+L EL+ TR+QLL  +++ ++Y  +  ++L  I EK   +P DV  D+ +     R H  F  +   L  QVQ   D A  L  +YAG+K   I  +  +V A W  L      RR QL D AD  RFFSM R+LL WM+ +  QI  + RP+DVS VELL+  H+ I AEI  R ++ S C+ LG +LL R     +E+R  L  +++R+  + + WE RW+ L+++LEV QF+RDASVAEAW++AQEPYLA+   G T+D    L+K+H  FEK+  S  ERF ALEK TT+E+       R  E T       +   +  + +     +  P  E                H+  + S  +E    +     +     E  E       +       + G L RKH+ E  N+KA NRSW+    VL    ++L  YKD K  N      YH +  L L   +   A++Y K+  VF++++ S G+E+LF  KDEE+ML W+     +INE+    +K+++  P  S + P  +
Sbjct:   38 RLFERSRIKALADEREVVQKKTFTKWVNSHLARVSCRITDLYKDLRDGRMLIKLLEVLSGEMLPKPTKGKMRIHCLENVDKALQFLKEQRVHLENMGSHDIVDGNHRLVLGLIWTIILRFQIQDIVVQTQEGRETRSAKDALLLWCQMKTAGYPHVNVTNFTSSWKDGLAFNALIHKHRPDLIDFDKLKDSNARHNLEHAFNVAERQLGIIPLLDPEDVFTENPDEKSIITYVVAFYHYFSKMKVLAVEGKRVGKVIDHAIETEKMIEKYSGLASDLLTWIEQTITVLNSRKFANSLTGVQQQLQAFSTYRTVEKPPKFQEKGNLEVLLFTIQSRMRANNQKVYTPHDGKLVSDINRAWESLEEAEYRRELALRNELIRQEKLEQLARRFDRKAAMRETWLSENQRLVAQDNFGYDLAAVEAAKKKHEAIETDTAAYEERVRALEDLAQELEKENYHDQKRITARKDNILRLWSYLQELLQSRRQRLETTLALQKLFQDMLHSIDWMDEIKAHLLSAEFGKHLLEVEDLLQKHKLMEADIAIQGDKVKAITAATLKFTE-----GKG-YQPCDPQVIQDRISHLEQCFEELSNMAAGRKAQLEQSKRLWKFFWEMDEAESWIKEKEQIYSSLDYGKDLTSVLILQRKHKAFEDELRGLDAHLEQIFQEAHGMVARKQFGHPQIEARIKEVSAQWDQLKDLAAFCKKNLQDAENFFQFQGDADDLKAWLQDAHRLLSGEDVGQDEGATRALGKKHKDFLEELEESRGVMEHLEQQAQGFPEEFRDSPDVTHRLQALRELYQQVVAQADLRQQRLQEALDLYTVFGETDACELWMGEKEKWLAEMEMPDTLEDLEVVQHRFDILDQEMKTLMTQIDGVNLAANSLVESGHPRSREVKQYQDHLNTRWQAFQTLVSERREAVDSALRVHNYCVDCEETSKWITDKTKVVESTKDLGRDLAGIIAIQRKLSGLERDVAAIQARVDALERESQQLMDSHPEQKEDIGQRQKHLEELWQGLQQSLQGQEDLLGEVSQLQAFLQDLDDFQAWLSITQKAVASEDMPESLPEAEQLLQQHAGIKDEIDGHQDSYQRVKESGEKVIQGQTDPEYLLLGQRLEGLDTGWNALGRMWESRSHTLAQCLGFQEFQKDAKQAEAILSNQEYTLAHLEPPDSLEAAEAGIRKFEDFLGSMENNRDKVLSPVDSGNKLVAEGNLYSDKIKEKVQLIEDRHRKNNEKAQEASVLLRDNLELQNFLQNCQELTLWINDKLLTSQDVSYDEARNLHNKWLKHQAFVAELASHEGWLENIDAEGKQLMDEKPQFTALVSQKLEALHRLWDELQATTKEKTQHLSAARSSDLRLQTHADLNKWISAMEDQLRSDDPGKDLTSVNRMLAKLKRVE---DQVNVRKEELGELFAQVPSMGEEGGDADLSIEK-------RFLDLLEPLGRRKKQLESSRAKLQISRDLEDETLWVEERLPLAQSADYGTNLQTVQLFMKKNQTLQNEILGHTPRVEDVLQRGQQLVE-AAEIDCQDLEERLGHLQSSWDRLREAAAGRLQRLRDANEAQQYYLDADEAEAWIGEQELYVISDEIP-KDEEGAIVMLKRHLRQQRAVEDYGRNIKQLASRAQGLLSAGHPEGEQIIRLQGQVDKHYAGLKDVAEERKRKLENMYHLFQLKRETDDLEQWISEKELVASSPEMGQDFDHVTLLRDKFRDFARETGAIGQERVDNVNAFIERLIDAGHSEAATIAEWKDGLNEMWADLLELIDTRMQLLAASYDLHRYFYTGAEILGLIDEKHRELPEDVGLDASTAESFHRVHTAFERELHLLGVQVQQFQDVATRLQTAYAGEKAEAIQNKEQEVSAAWQALLDACAGRRTQLVDTADKFRFFSMARDLLSWMESIIRQIETQERPRDVSSVELLMKYHQGINAEIETRSKNFSACLELGESLLQRQHQASEEIREKLQQVMSRRKEMNEKWEARWERLRMLLEVCQFSRDASVAEAWLIAQEPYLASGDFGHTVDSVEKLIKRHEAFEKSTASWAERFAALEKPTTLELKERQIAERPAEETGPQEEEGETAGEAPVSHHAATERTSPGEEEGTWPQNLQQPPPPGQHKDGQKSTGDERPTTEPLFKVLDTPLSEGDEPATLPAPRDHGQSVQMEGYLGRKHDLEGPNKKASNRSWNNLYCVL--RNSELTFYKDAK--NLALGMPYHGEEPLALRHAICEIAANYKKKKHVFKLRL-SNGSEWLFHGKDEEEMLSWLQGVSTAINESQSIRVKAQSL-PLPSLSGPDAS 2311          
BLAST of Spectrin beta chain vs. Ensembl Celegans
Match: unc-70 (Spectrin beta chain [Source:UniProtKB/TrEMBL;Acc:E0AHA7])

HSP 1 Score: 1803.49 bits (4670), Expect = 0.000e+0
Identity = 1001/2276 (43.98%), Postives = 1488/2276 (65.38%), Query Frame = 1
Query:  154 KLYERFRIKALAGEREKVQKKTFTKWINSHLNKLKQSIDDLYNXXXXXXXXXXXXXXXXXXXXPYPTKGKMRIHCLENVDKSLNFLIEQRVHLENMGAHDIVDGNARLTLGLIWTIILRFQIQDIVVEEDDTSEKRQAKDALLLWCQMKTAGYPNTNVRNFSTCWRDGLAFNAIIHRHRPDLLEYSALSRSNPNENLEQAIRIAEEKLGIPRLLDPEDVSVENPDEKSIMTYVVTFYHFFSKMKADSVHSKRVGKILSQSMETEEMMVHYDKLTSNLLEWINQTIELLNDRTFANSLSGVQQQLAAFNTYRVTEKPPKFQEKGNLEMLLFSIQSQMRANNQMPYLPIEGKLISDINNAWNKLDKAEHARELALRDELIRQEKLEQLALRFDRKAGMREAWLTENQRLITQDNFGQDLSAVEAAGKKHEAIKTDILAYEERVNSVTLVTSELENECYHDVERVLCRRDNVIRLWEKLLDMLAVRKLRLDACYKVQKLFQDIKHLLDLINDLKARLKTEDIGRHLMGVEDLIHKHSLLEIDIRMVGTKIEGIMSDAQPFINSEFGLGSGDFQPADPNEVILRTVNLKEEYDNLLELSRNRKDNLSASKVMWEFLWGVADEEQWMKEKIQLMLNPDLGHDLSSVHRLISKHKVIEEDVRNHSNYLQNVIQGGQQLILDKNPGAEKVADXXXXXXXXXXXXXXXXXXRRSKLEQSLAYFHCLADCGEVEIWIIEQVKLVKIDETSINEESIITDIHKHEQLSKSIEDYESNINSLDEQVKKLSEGDLELVTIEEKVSNIKSQYAILIELTNQKQNKLTDTLSLFRVLRKADTVKTWIDEKEKLLMSLIPTDELEELEVFRHRFDGFEKEMNIQADQVEFVNTLAEKLSDMDHPQIADVVNKRFELNKLWNSLADLVEARREQLQTSYEFNQYLLECKQTGEWIREKSRLVESTDELGDDLAGIMQLQRRMGGMQRDMDAIRAKLEHLDEEMDTLIAKRPNXXXXXXXXXXXXXXFWAELGDMLADRDDRLSESSELQRFLQDLDHIHIWLSKMQTTVASEDLPKDLADAEKSLVQHEQLKEEIDSYQDEFIRLLDYGRRITEDKTDAQYMFLSQRLNALEEGWQELCQMWENRXXXXXXXXXXXVFLRDAIQSEVLLAQEENFLSKEDIPISIENSQNLLRKHEGFLTTLQANHDHTIAVIEFGRNLVERGHFCSDKINLRVKSILXXXXXXXXXXXXAYEKLKDQVLYQELSQDIDDLSKWIQEKMIIATDESFREEKNIARRYNRHRAFDEEIQANKDRLCQAIDYAMQIVEERPQLADMIYPQIDSLNQQWEELEQTTFLKGEKMIEANREAIFEEGTMDVMTWLXXXXXXXXXXXXXXXXXXXXXXKLKKVEEADNEMEIKRKQIQDLKMHAAKLKEEQPEKAFGIEQKHLILEHRFTQLQMPXXXXXXXXXXXXXXXXFLRNLDDQKAWVDDKLLLAESTNFGNNLLTVQQLLRRHRYLATEVNNHKPQLEYLKEEGAVLIEEVSPMQREKFVAGLQELESLWNRLEHSIDLRQQRLKESEATQTFLFDAEEAESWLWEQELFLLSEERGIRDQEAAINVIKKHDARQKTIEDYGEEITKLGTRSRLLIEKDHPQADRIALAQSHVDKVYAGLRDLCLEKKQRLSEIQKLNHLYREIVDLENWIYERTLVASSHDLGVDFEHCCLLRERFDEFFHETHLLGKDRVKAANDLCASLISQCHADSAEIAQWHDRINDSWAELQELMQTRIQLLRTAWEFYKYLSSCQDVLDRICEKIASIPTDVSKDSQSVAIQQRKHATFLSDAQALEGQVQWVVDEANHLLPSYAGQKEWHICERRDDVLATWNQLNMQAERRRHQLEDAADLQRFFSMVRELLQWMDLVALQINEKTRPKDVSGVELLINDHRSIKAEIAAREESMSICVNLGRTLLHRGRVGVDEVRAALINLITRKYSLEDMWEERWDYLQLILEVYQFARDASVAEAWILAQEPYLANKTLGETLDETLSLLKKHINFEKTVMSQEERFEALEKLTTMEIRAKEITKESILLKDKHKQERIENAIKIFQPP--PSPELVHESPKVSISEEDEEGK-------SHQHKISVISKEAAEMCQSSETKTDIRGILIRKHEWEYKNRKALNRSWHEFLVVLSIEKNKLLVYKDEKHYNEKPQDTYHKDSGLDLNDLVAAPASDYLKRPFVFRIKITSTGAEYLFQAKDEEDMLRWVNSINENSQKDLKSETTAPGKSSTLPACTS 6954
            +L+ER RIKALA ERE VQKKTFTKW+NSHL ++   + DLY D++DGKMLL LL +LSGE+LP PT GKMRIHCLENV+K L FL  Q VHLEN+G+HDIVDGN+RLTLGLIWTIILRFQIQDI  E+ D  E R AK+ALLLWCQMKTAGYPN NV+NFST WRDGLAFNA+IH+HRPDL++Y  L +SN   NL+ A   AE +LG+ + LD EDV+V+ PDEKSI+TYVVT+YH+F+K+K D++  KR+GK++++ ME ++M+  Y+ L+S+LLEWIN  I+LLN+R F N+L GVQ+QL  FN YR  EKPPKF EKG LE+LLF++QS MRANNQ P++P EGKLI+DIN AW  L+KAEH REL L++ELIRQEKLEQLA RF+RKA MRE WLTENQRL++QDNFG DLS+VEAA KKHEAI+TDI AYEERV +V  V  ELE E YHD  ++  R++NV++LW  L  +L  R++RL+    +QK+F D+   LDL++D+K+RL +ED+G HLM VEDL+ KH+LLE DI ++G ++   ++ AQ F N +   GSG ++P +P  +  R+  L++ Y  LL+L+  RK  L  +K + +F W VA+ E  +KE+ Q++ + D G D+ +V  L++KHK  E ++R+   YL  +   G++L  +  PG++ +   L E+    N+L EL+ +R+ +L   + Y+    D  +V+ ++ + ++++  ++   +E ++   + KH+ +   +++++ +I  L  + + L +   E   I +++     Q A L  L+  ++ +L D LSL+++   AD+V++WIDEK KLL +L+P  ++EE+E+ +HRFD  E++M  Q  +V  VN LA +L +++HP   D+++++ +LN  W  L D+V+ +R +L+ ++    + ++C++T  WI +K+R++E +D L +DL+G+M+LQRR+  M+RD+ AI+AKL+ L +E D +  +RP + + IRE+   +   W  L   + + + +L E+ +LQRFL+DLDH   WL+  Q  VASE+ P+ LA+AE+ L QH  ++EEID Y +++ ++   G R+T+D+TD QYMFL QRL  L+EGW+EL +MW+NRQ LLSQ L+LQ+FLRDA Q+EV+L+Q+EN+L+K+DIP S+E ++N L++H+ F+TT+ AN +   AV  FG  L + GH+ +DKI+ + ++I ERR +N+ ++ E  +KLKD +  Q+   D D+L +WI+EKMI A DE++R+ K I  ++ RH+AF  E+ ANK+RL Q    A+ + +++P+    I PQI+ L  QW+ELE+TT  KG+K+ +ANR+ ++ +   D+  W  T  E+ +  E++   LT VNV ++K    + EM  K + I  L     +L+E  P++   I+   L ++ +  +LQ P+ +++  L ++K   QF R++DD+K W+ ++L+LA++ N G +L    +L +  + L+ E++NH+P +  +   G  LI+E        F   +QEL S W  L+ ++  R+  L ESE    FL+D  EAE+W+ EQEL+++ +ERG +D+ +  N IKKH+  Q  I+ + + I  L T++   +E+  P  ++I + Q+ ++K+YAGL+DL  E+++RL E  +L  L+REI DL  WI ++ +VA S + G D+EH  +L+ERF +F  +T  +G +RV  AND C +LI   H D+  IA W D +N++W  L ELM TR Q+L  +   +K+   C+D L RI EK  ++P D+ +DS SV    RKH  +L D  A+  QV  +  +A  L   YAG K   I  R  +V+  W  L    + R  +L D +DL +F +MVR+LL WMD V  ++N + RPKDVSGVELL+N+H+S+KAEI AREE+ + C++LGR LL+R      E+   LI L T +  +   WE+RW+YLQLILEVYQFARDA+VAE+W+ AQEPYL +K  G  L+ET+ L+KKH  FEK+  +QEERF ALEKLTT E+              K  Q R E   K   P    SP     + + S   +D+E +       S +  ++   K  ++  + ++      G LIRKH +E  +RKA NRSW +   VL   +N+L  YKD KH +E    + H +  + L       ASDY K+  V  +++   GAEYLFQ   EEDM RW+  +   +    +++     +S TLPA  S
Sbjct:   24 RLFERSRIKALADERELVQKKTFTKWVNSHLVRVSCKVQDLYMDMRDGKMLLRLLAVLSGERLPKPTPGKMRIHCLENVEKGLQFLRNQHVHLENLGSHDIVDGNSRLTLGLIWTIILRFQIQDITFEDADNHETRSAKEALLLWCQMKTAGYPNVNVKNFSTSWRDGLAFNALIHKHRPDLVDYDNLQKSNALYNLQSAFDTAENQLGLAKFLDAEDVNVDQPDEKSIITYVVTYYHYFNKLKQDNIQGKRIGKVINELMENDKMINRYETLSSDLLEWINAKIQLLNERHFENNLEGVQRQLTEFNDYRTQEKPPKFDEKGELEVLLFTLQSAMRANNQRPFVPREGKLIADINRAWQSLEKAEHERELVLKEELIRQEKLEQLAARFNRKAEMRETWLTENQRLVSQDNFGNDLSSVEAATKKHEAIETDIFAYEERVQAVVAVAGELEAENYHDQAKINERKENVLQLWNYLFQLLLARRVRLELSMAIQKIFHDMLLTLDLMDDIKSRLLSEDLGAHLMDVEDLLQKHALLESDINIIGERVNNSIAQAQRFRNPDGPDGSG-YKPVEPGTIDERSDVLQKRYKELLDLAAERKRRLEDNKRLCQFWWDVAELEHGIKEQEQVLSSTDTGRDIVTVSHLLAKHKNAENNLRDLEKYLDRLDVSGKELQDESIPGSDNIPPRLAEIRDYINKLKELSASRKERLAGGVEYYQFFTDADDVDRYLYDTLRVMSSEDVGKDEGTVQLLLKKHDDVHDELQNFDQHIKVLHAKAESLPQEAREHPDIRQRLDTTLKQKAELENLSQLRKQRLIDALSLYKLYSDADSVESWIDEKGKLLATLVPGRDIEEVEIMKHRFDTLEQDMKNQEAKVTNVNDLARQLLNVEHPNSDDILHRQNKLNARWAQLRDMVDQKRNELERAHRLETFRIDCQETVTWIEDKTRVLEDSDALTNDLSGVMKLQRRLSMMERDLGAIQAKLDSLHKEADDIERERPQEAQAIREDIKRIHQVWDILNKKVREHEAKLDEAGDLQRFLRDLDHFQAWLTATQRQVASEEEPQSLAEAEQLLNQHAAIREEIDGYAEDYKKMRAMGDRVTQDQTDPQYMFLRQRLAGLQEGWEELQRMWDNRQHLLSQGLNLQMFLRDAKQAEVMLSQQENYLAKDDIPQSLEQAENQLKRHQDFITTMDANDEKIRAVGMFGDQLCQDGHYAADKIHKKARNIDERRGANREKAQEVLKKLKDALSLQQFLSDCDELREWIEEKMIRAQDETYRDAKTITSKFVRHQAFQSELAANKERLDQLKHAAINLGDDKPEYHGTIDPQIEELATQWDELEKTTEEKGQKLFDANRQQLYVQSIADMKEW-ATQLENEMTREDQPGDLTTVNVAMQKQHLIETEMIKKAQHIDQLMEMEPQLEELHPDELENIKAHRLAVQEQLQRLQAPLDDRRKALERKKAAFQFGRDVDDEKLWISERLVLAKAQNLGESLPDCHRLQKNLQLLSNEIDNHEPWINQICNNGQELIDE-GHANGPAFEKKIQELRSAWQELKEAVKDRKGDLGESEKAHQFLYDCGEAEAWMSEQELYMMQDERG-KDEFSTKNQIKKHERLQSDIDKFADTIRALATKAHKFVEEKSPLTEQIQVRQAQIEKLYAGLQDLSKERRKRLEETLELYALHREIDDLLQWIADKEVVAGSQENGQDYEHVQMLQERFQQFARDTENIGSERVANANDGCDTLIGHGHTDAPTIALWKDSLNEAWENLLELMDTRAQILEASRLLHKFYHDCRDCLSRIMEKTHAMPDDLGRDSSSVGALSRKHQNYLKDIAAIGEQVAQIERDAAELRDGYAGDKALDIGSRESEVVKAWRHLRGLCDARTSRLMDTSDLFKFMNMVRDLLLWMDEVKREMNSQERPKDVSGVELLMNNHQSLKAEIDAREENFNACISLGRDLLNRKHYASSEIEKKLIKLTTERAEMMRRWEDRWEYLQLILEVYQFARDAAVAESWLFAQEPYLISKEYGRNLEETIKLIKKHEAFEKSAFAQEERFLALEKLTTFEL--------------KETQHREEETAKRRGPAHIGSPSRSTPAAETSFGAQDDEKRLAHSESSSWRKSLARAPKFDSKDPKGAKQGEAFEGTLIRKHTYESLDRKAANRSWEKLYAVL--RQNELSFYKDPKHRDE----SVHGEPPMALPGCSVNVASDYQKKKNVLSLRL-PIGAEYLFQCGSEEDMQRWLTELQVATG---QAQLEEASRSQTLPAEGS 2271          
BLAST of Spectrin beta chain vs. Ensembl Celegans
Match: unc-70 (Spectrin beta chain [Source:UniProtKB/TrEMBL;Acc:E0AHA7])

HSP 1 Score: 1798.87 bits (4658), Expect = 0.000e+0
Identity = 1002/2269 (44.16%), Postives = 1480/2269 (65.23%), Query Frame = 1
Query:  154 KLYERFRIKALAGEREKVQKKTFTKWINSHLNKLKQSIDDLYNXXXXXXXXXXXXXXXXXXXXPYPTKGKMRIHCLENVDKSLNFLIEQRVHLENMGAHDIVDGNARLTLGLIWTIILRFQIQDIVVEEDDTSEKRQAKDALLLWCQMKTAGYPNTNVRNFSTCWRDGLAFNAIIHRHRPDLLEYSALSRSNPNENLEQAIRIAEEKLGIPRLLDPEDVSVENPDEKSIMTYVVTFYHFFSKMKADSVHSKRVGKILSQSMETEEMMVHYDKLTSNLLEWINQTIELLNDRTFANSLSGVQQQLAAFNTYRVTEKPPKFQEKGNLEMLLFSIQSQMRANNQMPYLPIEGKLISDINNAWNKLDKAEHARELALRDELIRQEKLEQLALRFDRKAGMREAWLTENQRLITQDNFGQDLSAVEAAGKKHEAIKTDILAYEERVNSVTLVTSELENECYHDVERVLCRRDNVIRLWEKLLDMLAVRKLRLDACYKVQKLFQDIKHLLDLINDLKARLKTEDIGRHLMGVEDLIHKHSLLEIDIRMVGTKIEGIMSDAQPFINSEFGLGSGDFQPADPNEVILRTVNLKEEYDNLLELSRNRKDNLSASKVMWEFLWGVADEEQWMKEKIQLMLNPDLGHDLSSVHRLISKHKVIEEDVRNHSNYLQNVIQGGQQLILDKNPGAEKVADXXXXXXXXXXXXXXXXXXRRSKLEQSLAYFHCLADCGEVEIWIIEQVKLVKIDETSINEESIITDIHKHEQLSKSIEDYESNINSLDEQVKKLSEGDLELVTIEEKVSNIKSQYAILIELTNQKQNKLTDTLSLFRVLRKADTVKTWIDEKEKLLMSLIPTDELEELEVFRHRFDGFEKEMNIQADQVEFVNTLAEKLSDMDHPQIADVVNKRFELNKLWNSLADLVEARREQLQTSYEFNQYLLECKQTGEWIREKSRLVESTDELGDDLAGIMQLQRRMGGMQRDMDAIRAKLEHLDEEMDTLIAKRPNXXXXXXXXXXXXXXFWAELGDMLADRDDRLSESSELQRFLQDLDHIHIWLSKMQTTVASEDLPKDLADAEKSLVQHEQLKEEIDSYQDEFIRLLDYGRRITEDKTDAQYMFLSQRLNALEEGWQELCQMWENRXXXXXXXXXXXVFLRDAIQSEVLLAQEENFLSKEDIPISIENSQNLLRKHEGFLTTLQANHDHTIAVIEFGRNLVERGHFCSDKINLRVKSILXXXXXXXXXXXXAYEKLKDQVLYQELSQDIDDLSKWIQEKMIIATDESFREEKNIARRYNRHRAFDEEIQANKDRLCQAIDYAMQIVEERPQLADMIYPQIDSLNQQWEELEQTTFLKGEKMIEANREAIFEEGTMDVMTWLXXXXXXXXXXXXXXXXXXXXXXKLKKVEEADNEMEIKRKQIQDLKMHAAKLKEEQPEKAFGIEQKHLILEHRFTQLQMPXXXXXXXXXXXXXXXXFLRNLDDQKAWVDDKLLLAESTNFGNNLLTVQQLLRRHRYLATEVNNHKPQLEYLKEEGAVLIEEVSPMQREKFVAGLQELESLWNRLEHSIDLRQQRLKESEATQTFLFDAEEAESWLWEQELFLLSEERGIRDQEAAINVIKKHDARQKTIEDYGEEITKLGTRSRLLIEKDHPQADRIALAQSHVDKVYAGLRDLCLEKKQRLSEIQKLNHLYREIVDLENWIYERTLVASSHDLGVDFEHCCLLRERFDEFFHETHLLGKDRVKAANDLCASLISQCHADSAEIAQWHDRINDSWAELQELMQTRIQLLRTAWEFYKYLSSCQDVLDRICEKIASIPTDVSKDSQSVAIQQRKHATFLSDAQALEGQVQWVVDEANHLLPSYAGQKEWHICERRDDVLATWNQLNMQAERRRHQLEDAADLQRFFSMVRELLQWMDLVALQINEKTRPKDVSGVELLINDHRSIKAEIAAREESMSICVNLGRTLLHRGRVGVDEVRAALINLITRKYSLEDMWEERWDYLQLILEVYQFARDASVAEAWILAQEPYLANKTLGETLDETLSLLKKHINFEKTVMSQEERFEALEKLTTMEIRAKEITKESILLKDKHKQERIENAIKIFQPP--PSPELVHESPKVSISEEDEEGKSHQHKISVISKEAAEMCQSSETKTDIRGILIRKHEWEYKNRKALNRSWHEFLVVLSIEKNKLLVYKDEKHYNEKPQDTYHKDSGLDLNDLVAAPASDYLKRPFVFRIKITSTGAEYLFQAKDEEDMLRWVNSINENSQKDLKSETTAPGKSSTLPACTS 6954
            +L+ER RIKALA ERE VQKKTFTKW+NSHL ++   + DLY D++DGKMLL LL +LSGE+LP PT GKMRIHCLENV+K L FL  Q VHLEN+G+HDIVDGN+RLTLGLIWTIILRFQIQDI  E+ D  E R AK+ALLLWCQMKTAGYPN NV+NFST WRDGLAFNA+IH+HRPDL++Y  L +SN   NL+ A   AE +LG+ + LD EDV+V+ PDEKSI+TYVVT+YH+F+K+K D++  KR+GK++++ ME ++M+  Y+ L+S+LLEWIN  I+LLN+R F N+L GVQ+QL  FN YR  EKPPKF EKG LE+LLF++QS MRANNQ P++P EGKLI+DIN AW  L+KAEH REL L++ELIRQEKLEQLA RF+RKA MRE WLTENQRL++QDNFG DLS+VEAA KKHEAI+TDI AYEERV +V  V  ELE E YHD  ++  R++NV++LW  L  +L  R++RL+    +QK+F D+   LDL++D+K+RL +ED+G HLM VEDL+ KH+LLE DI ++G ++   ++ AQ F N +   GSG ++P +P  +  R+  L++ Y  LL+L+  RK  L  +K + +F W VA+ E  +KE+ Q++ + D G D+ +V  L++KHK  E ++R+   YL  +   G++L  +  PG++ +   L E+    N+L EL+ +R+ +L   + Y+    D  +V+ ++ + ++++  ++   +E ++   + KH+ +   +++++ +I  L  + + L +   E   I +++     Q A L  L+  ++ +L D LSL+++   AD+V++WIDEK KLL +L+P  ++EE+E+ +HRFD  E++M  Q  +V  VN LA +L +++HP   D+++++ +LN  W  L D+V+ +R +L+ ++    + ++C++T  WI +K+R++E +D L +DL+G+M+LQRR+  M+RD+ AI+AKL+ L +E D +  +RP + + IRE+   +   W  L   + + + +L E+ +LQRFL+DLDH   WL+  Q  VASE+ P+ LA+AE+ L QH  ++EEID Y +++ ++   G R+T+D+TD QYMFL QRL  L+EGW+EL +MW+NRQ LLSQ L+LQ+FLRDA Q+EV+L+Q+EN+L+K+DIP S+E ++N L++H+ F+TT+ AN +   AV  FG  L + GH+ +DKI+ + ++I ERR +N+ ++ E  +KLKD +  Q+   D D+L +WI+EKMI A DE++R+ K I  ++ RH+AF  E+ ANK+RL Q    A+ + +++P+    I PQI+ L  QW+ELE+TT  KG+K+ +ANR+ ++ +   D+  W  T  E+ +  E++   LT VNV ++K    + EM  K + I  L     +L+E  P++   I+   L ++ +  +LQ P+ +++  L ++K   QF R++DD+K W+ ++L+LA++ N G +L    +L +  + L+ E++NH+P +  +   G  LI+E        F   +QEL S W  L+ ++  R+  L ESE    FL+D  EAE+W+ EQEL+++ +ERG +D+ +  N IKKH+  Q  I+ + + I  L T++   +E+  P  ++I + Q+ ++K+YAGL+DL  E+++RL E  +L  L+REI DL  WI ++ +VA S + G D+EH  +L+ERF +F  +T  +G +RV  AND C +LI   H D+  IA W D +N++W  L ELM TR Q+L  +   +K+   C+D L RI EK  ++P D+ +DS SV    RKH  +L D  A+  QV  +  +A  L   YAG K   I  R  +V+  W  L    + R  +L D +DL +F +MVR+LL WMD V  ++N + RPKDVSGVELL+N+H+S+KAEI AREE+ + C++LGR LL+R      E+   LI L T +  +   WE+RW+YLQLILEVYQFARDA+VAE+W+ AQEPYL +K  G  L+ET+ L+KKH  FEK+  +QEERF ALEKLTT E+              K  Q R E   K   P    SP     + + S   +D+  K           EA E            G LIRKH +E  +RKA NRSW +   VL   +N+L  YKD KH +E    + H +  + L       ASDY K+  V  +++   GAEYLFQ   EEDM RW+  +   +    +++     +S TLPA  S
Sbjct:   24 RLFERSRIKALADERELVQKKTFTKWVNSHLVRVSCKVQDLYMDMRDGKMLLRLLAVLSGERLPKPTPGKMRIHCLENVEKGLQFLRNQHVHLENLGSHDIVDGNSRLTLGLIWTIILRFQIQDITFEDADNHETRSAKEALLLWCQMKTAGYPNVNVKNFSTSWRDGLAFNALIHKHRPDLVDYDNLQKSNALYNLQSAFDTAENQLGLAKFLDAEDVNVDQPDEKSIITYVVTYYHYFNKLKQDNIQGKRIGKVINELMENDKMINRYETLSSDLLEWINAKIQLLNERHFENNLEGVQRQLTEFNDYRTQEKPPKFDEKGELEVLLFTLQSAMRANNQRPFVPREGKLIADINRAWQSLEKAEHERELVLKEELIRQEKLEQLAARFNRKAEMRETWLTENQRLVSQDNFGNDLSSVEAATKKHEAIETDIFAYEERVQAVVAVAGELEAENYHDQAKINERKENVLQLWNYLFQLLLARRVRLELSMAIQKIFHDMLLTLDLMDDIKSRLLSEDLGAHLMDVEDLLQKHALLESDINIIGERVNNSIAQAQRFRNPDGPDGSG-YKPVEPGTIDERSDVLQKRYKELLDLAAERKRRLEDNKRLCQFWWDVAELEHGIKEQEQVLSSTDTGRDIVTVSHLLAKHKNAENNLRDLEKYLDRLDVSGKELQDESIPGSDNIPPRLAEIRDYINKLKELSASRKERLAGGVEYYQFFTDADDVDRYLYDTLRVMSSEDVGKDEGTVQLLLKKHDDVHDELQNFDQHIKVLHAKAESLPQEAREHPDIRQRLDTTLKQKAELENLSQLRKQRLIDALSLYKLYSDADSVESWIDEKGKLLATLVPGRDIEEVEIMKHRFDTLEQDMKNQEAKVTNVNDLARQLLNVEHPNSDDILHRQNKLNARWAQLRDMVDQKRNELERAHRLETFRIDCQETVTWIEDKTRVLEDSDALTNDLSGVMKLQRRLSMMERDLGAIQAKLDSLHKEADDIERERPQEAQAIREDIKRIHQVWDILNKKVREHEAKLDEAGDLQRFLRDLDHFQAWLTATQRQVASEEEPQSLAEAEQLLNQHAAIREEIDGYAEDYKKMRAMGDRVTQDQTDPQYMFLRQRLAGLQEGWEELQRMWDNRQHLLSQGLNLQMFLRDAKQAEVMLSQQENYLAKDDIPQSLEQAENQLKRHQDFITTMDANDEKIRAVGMFGDQLCQDGHYAADKIHKKARNIDERRGANREKAQEVLKKLKDALSLQQFLSDCDELREWIEEKMIRAQDETYRDAKTITSKFVRHQAFQSELAANKERLDQLKHAAINLGDDKPEYHGTIDPQIEELATQWDELEKTTEEKGQKLFDANRQQLYVQSIADMKEW-ATQLENEMTREDQPGDLTTVNVAMQKQHLIETEMIKKAQHIDQLMEMEPQLEELHPDELENIKAHRLAVQEQLQRLQAPLDDRRKALERKKAAFQFGRDVDDEKLWISERLVLAKAQNLGESLPDCHRLQKNLQLLSNEIDNHEPWINQICNNGQELIDE-GHANGPAFEKKIQELRSAWQELKEAVKDRKGDLGESEKAHQFLYDCGEAEAWMSEQELYMMQDERG-KDEFSTKNQIKKHERLQSDIDKFADTIRALATKAHKFVEEKSPLTEQIQVRQAQIEKLYAGLQDLSKERRKRLEETLELYALHREIDDLLQWIADKEVVAGSQENGQDYEHVQMLQERFQQFARDTENIGSERVANANDGCDTLIGHGHTDAPTIALWKDSLNEAWENLLELMDTRAQILEASRLLHKFYHDCRDCLSRIMEKTHAMPDDLGRDSSSVGALSRKHQNYLKDIAAIGEQVAQIERDAAELRDGYAGDKALDIGSRESEVVKAWRHLRGLCDARTSRLMDTSDLFKFMNMVRDLLLWMDEVKREMNSQERPKDVSGVELLMNNHQSLKAEIDAREENFNACISLGRDLLNRKHYASSEIEKKLIKLTTERAEMMRRWEDRWEYLQLILEVYQFARDAAVAESWLFAQEPYLISKEYGRNLEETIKLIKKHEAFEKSAFAQEERFLALEKLTTFEL--------------KETQHREEETAKRRGPAHIGSPSRSTPAAETSFGAQDDGAK---------QGEAFE------------GTLIRKHTYESLDRKAANRSWEKLYAVLR--QNELSFYKDPKHRDE----SVHGEPPMALPGCSVNVASDYQKKKNVLSLRL-PIGAEYLFQCGSEEDMQRWLTELQVATG---QAQLEEASRSQTLPAEGS 2243          
BLAST of Spectrin beta chain vs. Ensembl Celegans
Match: unc-70 (Spectrin beta chain [Source:UniProtKB/TrEMBL;Acc:E0AHA7])

HSP 1 Score: 1798.48 bits (4657), Expect = 0.000e+0
Identity = 1007/2293 (43.92%), Postives = 1489/2293 (64.94%), Query Frame = 1
Query:  154 KLYERFRIKALAGEREKVQKKTFTKWINSHLNKLKQSIDDLYNXXXXXXXXXXXXXXXXXXXXPYPTKGKMRIHCLENVDKSLNFLIEQRVHLENMGAHDIVDGNARLTLGLIWTIILRFQIQDIVVEEDDTSEKRQAKDALLLWCQMKTAGYPNTNVRNFSTCWRDGLAFNAIIHRHRPDLLEYSALSRSNPNENLEQAIRIAEEKLGIPRLLDPEDVSVENPDEKSIMTYVVTFYHFFSKMKADSVHSKRVGKILSQSMETEEMMVHYDKLTSNLLEWINQTIELLNDRTFANSLSGVQQQLAAFNTYRVTEKPPKFQEKGNLEMLLFSIQSQMRANNQMPYLPIEGKLISDINNAWNKLDKAEHARELALRDELIRQEKLEQLALRFDRKAGMREAWLTENQRLITQDNFGQDLSAVEAAGKKHEAIKTDILAYEERVNSVTLVTSELENECYHDVERVLCRRDNVIRLWEKLLDMLAVRKLRLDACYKVQKLFQDIKHLLDLINDLKARLKTEDIGRHLMGVEDLIHKHSLLEIDIRMVGTKIEGIMSDAQPFINSEFGLGSGDFQPADPNEVILRTVNLKEEYDNLLELSRNRKDNLSASKVMWEFLWGVADEEQWMKEKIQLMLNPDLGHDLSSVHRLISKHKVIEEDVRNHSNYLQNVIQGGQQLILDKNPGAEKVADXXXXXXXXXXXXXXXXXXRRSKLEQSLAYFHCLADCGEVEIWIIEQVKLVKIDETSINEESIITDIHKHEQLSKSIEDYESNINSLDEQVKKLSEGDLELVTIEEKVSNIKSQYAILIELTNQKQNKLTDTLSLFRVLRKADTVKTWIDEKEKLLMSLIPTDELEELEVFRHRFDGFEKEMNIQADQVEFVNTLAEKLSDMDHPQIADVVNKRFELNKLWNSLADLVEARREQLQTSYEFNQYLLECKQTGEWIREKSRLVESTDELGDDLAGIMQLQRRMGGMQRDMDAIRAKLEHLDEEMDTLIAKRPNXXXXXXXXXXXXXXFWAELGDMLADRDDRLSESSELQRFLQDLDHIHIWLSKMQTTVASEDLPKDLADAEKSLVQHEQLKEEIDSYQDEFIRLLDYGRRITEDKTDAQYMFLSQRLNALEEGWQELCQMWENRXXXXXXXXXXXVFLRDAIQSEVLLAQEENFLSKEDIPISIENSQNLLRKHEGFLTTLQANHDHTIAVIEFGRNLVERGHFCSDKINLRVKSILXXXXXXXXXXXXAYEKLKDQVLYQELSQDIDDLSKWIQEKMIIATDESFREEKNIARRYNRHRAFDEEIQANKDRLCQAIDYAMQIVEERPQLADMIYPQIDSLNQQWEELEQTTFLKGEKMIEANREAIFEEGTMDVMTWLXXXXXXXXXXXXXXXXXXXXXXKLKKVEEADNEMEIKRKQIQDLKMHAAKLKEEQPEKAFGIEQKHLILEHRFTQLQMPXXXXXXXXXXXXXXXXFLRNLDDQKAWVDDKLLLAESTNFGNNLLTVQQLLRRHRYLATEVNNHKPQLEYLKEEGAVLIEEVSPMQREKFVAGLQELESLWNRLEHSIDLRQQRLKESEATQTFLFDAEEAESWLWEQELFLLSEERGIRDQEAAINVIKKHDARQKTIEDYGEEITKLGTRSRLLIEKDHPQADRIALAQSHVDKVYAGLRDLCLEKKQRLSEIQKLNHLYREIVDLENWIYERTLVASSHDLGVDFEHCCLLRERFDEFFHETHLLGKDRVKAANDLCASLISQCHADSAEIAQWHDRINDSWAELQELMQTRIQLLRTAWEFYKYLSSCQDVLDRICEKIASIPTDVSKDSQSVAIQQRKHATFLSDAQALEGQVQWVVDEANHLLPSYAGQKEWHICERRDDVLATWNQLNMQAERRRHQLEDAADLQRFFSMVRELLQWMDLVALQINEKTRPKDVSGVELLINDHRSIKAEIAAREESMSICVNLGRTLLHRGRVGVDEVRAALINLITRKYSLEDMWEERWDYLQLILEVYQFARDASVAEAWILAQEPYLANKTLGETLDETLSLLKKHINFEKTVMSQEERFEALEKLTTMEIRAKEITKESILLKDKHKQERIENAIKIFQPP--PSPELVHESPKVSISEEDEEGK-SHQ----HKISVISKEAAEMCQSSETKTDIR-------------------GILIRKHEWEYKNRKALNRSWHEFLVVLSIEKNKLLVYKDEKHYNEKPQDTYHKDSGLDLNDLVAAPASDYLKRPFVFRIKITSTGAEYLFQAKDEEDMLRWVNSINENSQKDLKSETTAPGKSSTLPACTS 6954
            +L+ER RIKALA ERE VQKKTFTKW+NSHL ++   + DLY D++DGKMLL LL +LSGE+LP PT GKMRIHCLENV+K L FL  Q VHLEN+G+HDIVDGN+RLTLGLIWTIILRFQIQDI  E+ D  E R AK+ALLLWCQMKTAGYPN NV+NFST WRDGLAFNA+IH+HRPDL++Y  L +SN   NL+ A   AE +LG+ + LD EDV+V+ PDEKSI+TYVVT+YH+F+K+K D++  KR+GK++++ ME ++M+  Y+ L+S+LLEWIN  I+LLN+R F N+L GVQ+QL  FN YR  EKPPKF EKG LE+LLF++QS MRANNQ P++P EGKLI+DIN AW  L+KAEH REL L++ELIRQEKLEQLA RF+RKA MRE WLTENQRL++QDNFG DLS+VEAA KKHEAI+TDI AYEERV +V  V  ELE E YHD  ++  R++NV++LW  L  +L  R++RL+    +QK+F D+   LDL++D+K+RL +ED+G HLM VEDL+ KH+LLE DI ++G ++   ++ AQ F N +   GSG ++P +P  +  R+  L++ Y  LL+L+  RK  L  +K + +F W VA+ E  +KE+ Q++ + D G D+ +V  L++KHK  E ++R+   YL  +   G++L  +  PG++ +   L E+    N+L EL+ +R+ +L   + Y+    D  +V+ ++ + ++++  ++   +E ++   + KH+ +   +++++ +I  L  + + L +   E   I +++     Q A L  L+  ++ +L D LSL+++   AD+V++WIDEK KLL +L+P  ++EE+E+ +HRFD  E++M  Q  +V  VN LA +L +++HP   D+++++ +LN  W  L D+V+ +R +L+ ++    + ++C++T  WI +K+R++E +D L +DL+G+M+LQRR+  M+RD+ AI+AKL+ L +E D +  +RP + + IRE+   +   W  L   + + + +L E+ +LQRFL+DLDH   WL+  Q  VASE+ P+ LA+AE+ L QH  ++EEID Y +++ ++   G R+T+D+TD QYMFL QRL  L+EGW+EL +MW+NRQ LLSQ L+LQ+FLRDA Q+EV+L+Q+EN+L+K+DIP S+E ++N L++H+ F+TT+ AN +   AV  FG  L + GH+ +DKI+ + ++I ERR +N+ ++ E  +KLKD +  Q+   D D+L +WI+EKMI A DE++R+ K I  ++ RH+AF  E+ ANK+RL Q    A+ + +++P+    I PQI+ L  QW+ELE+TT  KG+K+ +ANR+ ++ +   D+  W  T  E+ +  E++   LT VNV ++K    + EM  K + I  L     +L+E  P++   I+   L ++ +  +LQ P+ +++  L ++K   QF R++DD+K W+ ++L+LA++ N G +L    +L +  + L+ E++NH+P +  +   G  LI+E        F   +QEL S W  L+ ++  R+  L ESE    FL+D  EAE+W+ EQEL+++ +ERG +D+ +  N IKKH+  Q  I+ + + I  L T++   +E+  P  ++I + Q+ ++K+YAGL+DL  E+++RL E  +L  L+REI DL  WI ++ +VA S + G D+EH  +L+ERF +F  +T  +G +RV  AND C +LI   H D+  IA W D +N++W  L ELM TR Q+L  +   +K+   C+D L RI EK  ++P D+ +DS SV    RKH  +L D  A+  QV  +  +A  L   YAG K   I  R  +V+  W  L    + R  +L D +DL +F +MVR+LL WMD V  ++N + RPKDVSGVELL+N+H+S+KAEI AREE+ + C++LGR LL+R      E+   LI L T +  +   WE+RW+YLQLILEVYQFARDA+VAE+W+ AQEPYL +K  G  L+ET+ L+KKH  FEK+  +QEERF ALEKLTT E+              K  Q R E   K   P    SP     + + S   +D++   +H     H+ S   K  A    SS  K+  R                   G LIRKH +E  +RKA NRSW +   VL   +N+L  YKD KH +E    + H +  + L       ASDY K+  V  +++   GAEYLFQ   EEDM RW+  +   +    +++     +S TLPA  S
Sbjct:   24 RLFERSRIKALADERELVQKKTFTKWVNSHLVRVSCKVQDLYMDMRDGKMLLRLLAVLSGERLPKPTPGKMRIHCLENVEKGLQFLRNQHVHLENLGSHDIVDGNSRLTLGLIWTIILRFQIQDITFEDADNHETRSAKEALLLWCQMKTAGYPNVNVKNFSTSWRDGLAFNALIHKHRPDLVDYDNLQKSNALYNLQSAFDTAENQLGLAKFLDAEDVNVDQPDEKSIITYVVTYYHYFNKLKQDNIQGKRIGKVINELMENDKMINRYETLSSDLLEWINAKIQLLNERHFENNLEGVQRQLTEFNDYRTQEKPPKFDEKGELEVLLFTLQSAMRANNQRPFVPREGKLIADINRAWQSLEKAEHERELVLKEELIRQEKLEQLAARFNRKAEMRETWLTENQRLVSQDNFGNDLSSVEAATKKHEAIETDIFAYEERVQAVVAVAGELEAENYHDQAKINERKENVLQLWNYLFQLLLARRVRLELSMAIQKIFHDMLLTLDLMDDIKSRLLSEDLGAHLMDVEDLLQKHALLESDINIIGERVNNSIAQAQRFRNPDGPDGSG-YKPVEPGTIDERSDVLQKRYKELLDLAAERKRRLEDNKRLCQFWWDVAELEHGIKEQEQVLSSTDTGRDIVTVSHLLAKHKNAENNLRDLEKYLDRLDVSGKELQDESIPGSDNIPPRLAEIRDYINKLKELSASRKERLAGGVEYYQFFTDADDVDRYLYDTLRVMSSEDVGKDEGTVQLLLKKHDDVHDELQNFDQHIKVLHAKAESLPQEAREHPDIRQRLDTTLKQKAELENLSQLRKQRLIDALSLYKLYSDADSVESWIDEKGKLLATLVPGRDIEEVEIMKHRFDTLEQDMKNQEAKVTNVNDLARQLLNVEHPNSDDILHRQNKLNARWAQLRDMVDQKRNELERAHRLETFRIDCQETVTWIEDKTRVLEDSDALTNDLSGVMKLQRRLSMMERDLGAIQAKLDSLHKEADDIERERPQEAQAIREDIKRIHQVWDILNKKVREHEAKLDEAGDLQRFLRDLDHFQAWLTATQRQVASEEEPQSLAEAEQLLNQHAAIREEIDGYAEDYKKMRAMGDRVTQDQTDPQYMFLRQRLAGLQEGWEELQRMWDNRQHLLSQGLNLQMFLRDAKQAEVMLSQQENYLAKDDIPQSLEQAENQLKRHQDFITTMDANDEKIRAVGMFGDQLCQDGHYAADKIHKKARNIDERRGANREKAQEVLKKLKDALSLQQFLSDCDELREWIEEKMIRAQDETYRDAKTITSKFVRHQAFQSELAANKERLDQLKHAAINLGDDKPEYHGTIDPQIEELATQWDELEKTTEEKGQKLFDANRQQLYVQSIADMKEW-ATQLENEMTREDQPGDLTTVNVAMQKQHLIETEMIKKAQHIDQLMEMEPQLEELHPDELENIKAHRLAVQEQLQRLQAPLDDRRKALERKKAAFQFGRDVDDEKLWISERLVLAKAQNLGESLPDCHRLQKNLQLLSNEIDNHEPWINQICNNGQELIDE-GHANGPAFEKKIQELRSAWQELKEAVKDRKGDLGESEKAHQFLYDCGEAEAWMSEQELYMMQDERG-KDEFSTKNQIKKHERLQSDIDKFADTIRALATKAHKFVEEKSPLTEQIQVRQAQIEKLYAGLQDLSKERRKRLEETLELYALHREIDDLLQWIADKEVVAGSQENGQDYEHVQMLQERFQQFARDTENIGSERVANANDGCDTLIGHGHTDAPTIALWKDSLNEAWENLLELMDTRAQILEASRLLHKFYHDCRDCLSRIMEKTHAMPDDLGRDSSSVGALSRKHQNYLKDIAAIGEQVAQIERDAAELRDGYAGDKALDIGSRESEVVKAWRHLRGLCDARTSRLMDTSDLFKFMNMVRDLLLWMDEVKREMNSQERPKDVSGVELLMNNHQSLKAEIDAREENFNACISLGRDLLNRKHYASSEIEKKLIKLTTERAEMMRRWEDRWEYLQLILEVYQFARDAAVAESWLFAQEPYLISKEYGRNLEETIKLIKKHEAFEKSAFAQEERFLALEKLTTFEL--------------KETQHREEETAKRRGPAHIGSPSRSTPAAETSFGAQDDDADITHSSLEGHRKSSHEKRLAHSESSSWRKSLARAPKFDSKDPKGAKQGEAFEGTLIRKHTYESLDRKAANRSWEKLYAVL--RQNELSFYKDPKHRDE----SVHGEPPMALPGCSVNVASDYQKKKNVLSLRL-PIGAEYLFQCGSEEDMQRWLTELQVATG---QAQLEEASRSQTLPAEGS 2288          
BLAST of Spectrin beta chain vs. Ensembl Celegans
Match: unc-70 (Spectrin beta chain [Source:UniProtKB/TrEMBL;Acc:E0AHA7])

HSP 1 Score: 1786.93 bits (4627), Expect = 0.000e+0
Identity = 995/2264 (43.95%), Postives = 1472/2264 (65.02%), Query Frame = 1
Query:  169 FRIKALAGEREKVQKKTFTKWINSHLNKLKQSIDDLYNXXXXXXXXXXXXXXXXXXXXPYPTKGKMRIHCLENVDKSLNFLIEQRVHLENMGAHDIVDGNARLTLGLIWTIILRFQIQDIVVEEDDTSEKRQAKDALLLWCQMKTAGYPNTNVRNFSTCWRDGLAFNAIIHRHRPDLLEYSALSRSNPNENLEQAIRIAEEKLGIPRLLDPEDVSVENPDEKSIMTYVVTFYHFFSKMKADSVHSKRVGKILSQSMETEEMMVHYDKLTSNLLEWINQTIELLNDRTFANSLSGVQQQLAAFNTYRVTEKPPKFQEKGNLEMLLFSIQSQMRANNQMPYLPIEGKLISDINNAWNKLDKAEHARELALRDELIRQEKLEQLALRFDRKAGMREAWLTENQRLITQDNFGQDLSAVEAAGKKHEAIKTDILAYEERVNSVTLVTSELENECYHDVERVLCRRDNVIRLWEKLLDMLAVRKLRLDACYKVQKLFQDIKHLLDLINDLKARLKTEDIGRHLMGVEDLIHKHSLLEIDIRMVGTKIEGIMSDAQPFINSEFGLGSGDFQPADPNEVILRTVNLKEEYDNLLELSRNRKDNLSASKVMWEFLWGVADEEQWMKEKIQLMLNPDLGHDLSSVHRLISKHKVIEEDVRNHSNYLQNVIQGGQQLILDKNPGAEKVADXXXXXXXXXXXXXXXXXXRRSKLEQSLAYFHCLADCGEVEIWIIEQVKLVKIDETSINEESIITDIHKHEQLSKSIEDYESNINSLDEQVKKLSEGDLELVTIEEKVSNIKSQYAILIELTNQKQNKLTDTLSLFRVLRKADTVKTWIDEKEKLLMSLIPTDELEELEVFRHRFDGFEKEMNIQADQVEFVNTLAEKLSDMDHPQIADVVNKRFELNKLWNSLADLVEARREQLQTSYEFNQYLLECKQTGEWIREKSRLVESTDELGDDLAGIMQLQRRMGGMQRDMDAIRAKLEHLDEEMDTLIAKRPNXXXXXXXXXXXXXXFWAELGDMLADRDDRLSESSELQRFLQDLDHIHIWLSKMQTTVASEDLPKDLADAEKSLVQHEQLKEEIDSYQDEFIRLLDYGRRITEDKTDAQYMFLSQRLNALEEGWQELCQMWENRXXXXXXXXXXXVFLRDAIQSEVLLAQEENFLSKEDIPISIENSQNLLRKHEGFLTTLQANHDHTIAVIEFGRNLVERGHFCSDKINLRVKSILXXXXXXXXXXXXAYEKLKDQVLYQELSQDIDDLSKWIQEKMIIATDESFREEKNIARRYNRHRAFDEEIQANKDRLCQAIDYAMQIVEERPQLADMIYPQIDSLNQQWEELEQTTFLKGEKMIEANREAIFEEGTMDVMTWLXXXXXXXXXXXXXXXXXXXXXXKLKKVEEADNEMEIKRKQIQDLKMHAAKLKEEQPEKAFGIEQKHLILEHRFTQLQMPXXXXXXXXXXXXXXXXFLRNLDDQKAWVDDKLLLAESTNFGNNLLTVQQLLRRHRYLATEVNNHKPQLEYLKEEGAVLIEEVSPMQREKFVAGLQELESLWNRLEHSIDLRQQRLKESEATQTFLFDAEEAESWLWEQELFLLSEERGIRDQEAAINVIKKHDARQKTIEDYGEEITKLGTRSRLLIEKDHPQADRIALAQSHVDKVYAGLRDLCLEKKQRLSEIQKLNHLYREIVDLENWIYERTLVASSHDLGVDFEHCCLLRERFDEFFHETHLLGKDRVKAANDLCASLISQCHADSAEIAQWHDRINDSWAELQELMQTRIQLLRTAWEFYKYLSSCQDVLDRICEKIASIPTDVSKDSQSVAIQQRKHATFLSDAQALEGQVQWVVDEANHLLPSYAGQKEWHICERRDDVLATWNQLNMQAERRRHQLEDAADLQRFFSMVRELLQWMDLVALQINEKTRPKDVSGVELLINDHRSIKAEIAAREESMSICVNLGRTLLHRGRVGVDEVRAALINLITRKYSLEDMWEERWDYLQLILEVYQFARDASVAEAWILAQEPYLANKTLGETLDETLSLLKKHINFEKTVMSQEERFEALEKLTTMEIRAKEITKESILLKDKHKQERIENAIKIFQPP--PSPELVHESPKVSISEEDEEGKSHQHKISVISKEAAEMCQSSETKTDIRGILIRKHEWEYKNRKALNRSWHEFLVVLSIEKNKLLVYKDEKHYNEKPQDTYHKDSGLDLNDLVAAPASDYLKRPFVFRIKITSTGAEYLFQAKDEEDMLRWVNSINENSQKDLKSETTAPGKSSTLPACTS 6954
             R + L  ERE VQKKTFTKW+NSHL ++   + DLY D++DGKMLL LL +LSGE+LP PT GKMRIHCLENV+K L FL  Q VHLEN+G+HDIVDGN+RLTLGLIWTIILRFQIQDI  E+ D  E R AK+ALLLWCQMKTAGYPN NV+NFST WRDGLAFNA+IH+HRPDL++Y  L +SN   NL+ A   AE +LG+ + LD EDV+V+ PDEKSI+TYVVT+YH+F+K+K D++  KR+GK++++ ME ++M+  Y+ L+S+LLEWIN  I+LLN+R F N+L GVQ+QL  FN YR  EKPPKF EKG LE+LLF++QS MRANNQ P++P EGKLI+DIN AW  L+KAEH REL L++ELIRQEKLEQLA RF+RKA MRE WLTENQRL++QDNFG DLS+VEAA KKHEAI+TDI AYEERV +V  V  ELE E YHD  ++  R++NV++LW  L  +L  R++RL+    +QK+F D+   LDL++D+K+RL +ED+G HLM VEDL+ KH+LLE DI ++G ++   ++ AQ F N +   GSG ++P +P  +  R+  L++ Y  LL+L+  RK  L  +K + +F W VA+ E  +KE+ Q++ + D G D+ +V  L++KHK  E ++R+   YL  +   G++L  +  PG++ +   L E+    N+L EL+ +R+ +L   + Y+    D  +V+ ++ + ++++  ++   +E ++   + KH+ +   +++++ +I  L  + + L +   E   I +++     Q A L  L+  ++ +L D LSL+++   AD+V++WIDEK KLL +L+P  ++EE+E+ +HRFD  E++M  Q  +V  VN LA +L +++HP   D+++++ +LN  W  L D+V+ +R +L+ ++    + ++C++T  WI +K+R++E +D L +DL+G+M+LQRR+  M+RD+ AI+AKL+ L +E D +  +RP + + IRE+   +   W  L   + + + +L E+ +LQRFL+DLDH   WL+  Q  VASE+ P+ LA+AE+ L QH  ++EEID Y +++ ++   G R+T+D+TD QYMFL QRL  L+EGW+EL +MW+NRQ LLSQ L+LQ+FLRDA Q+EV+L+Q+EN+L+K+DIP S+E ++N L++H+ F+TT+ AN +   AV  FG  L + GH+ +DKI+ + ++I ERR +N+ ++ E  +KLKD +  Q+   D D+L +WI+EKMI A DE++R+ K I  ++ RH+AF  E+ ANK+RL Q    A+ + +++P+    I PQI+ L  QW+ELE+TT  KG+K+ +ANR+ ++ +   D+  W  T  E+ +  E++   LT VNV ++K    + EM  K + I  L     +L+E  P++   I+   L ++ +  +LQ P+ +++  L ++K   QF R++DD+K W+ ++L+LA++ N G +L    +L +  + L+ E++NH+P +  +   G  LI+E        F   +QEL S W  L+ ++  R+  L ESE    FL+D  EAE+W+ EQEL+++ +ERG +D+ +  N IKKH+  Q  I+ + + I  L T++   +E+  P  ++I + Q+ ++K+YAGL+DL  E+++RL E  +L  L+REI DL  WI ++ +VA S + G D+EH  +L+ERF +F  +T  +G +RV  AND C +LI   H D+  IA W D +N++W  L ELM TR Q+L  +   +K+   C+D L RI EK  ++P D+ +DS SV    RKH  +L D  A+  QV  +  +A  L   YAG K   I  R  +V+  W  L    + R  +L D +DL +F +MVR+LL WMD V  ++N + RPKDVSGVELL+N+H+S+KAEI AREE+ + C++LGR LL+R      E+   LI L T +  +   WE+RW+YLQLILEVYQFARDA+VAE+W+ AQEPYL +K  G  L+ET+ L+KKH  FEK+  +QEERF ALEKLTT E+              K  Q R E   K   P    SP     + + S   +D+  K           EA E            G LIRKH +E  +RKA NRSW +   VL   +N+L  YKD KH +E    + H +  + L       ASDY K+  V  +++   GAEYLFQ   EEDM RW+  +   +    +++     +S TLPA  S
Sbjct:   98 LRFRGLRDERELVQKKTFTKWVNSHLVRVSCKVQDLYMDMRDGKMLLRLLAVLSGERLPKPTPGKMRIHCLENVEKGLQFLRNQHVHLENLGSHDIVDGNSRLTLGLIWTIILRFQIQDITFEDADNHETRSAKEALLLWCQMKTAGYPNVNVKNFSTSWRDGLAFNALIHKHRPDLVDYDNLQKSNALYNLQSAFDTAENQLGLAKFLDAEDVNVDQPDEKSIITYVVTYYHYFNKLKQDNIQGKRIGKVINELMENDKMINRYETLSSDLLEWINAKIQLLNERHFENNLEGVQRQLTEFNDYRTQEKPPKFDEKGELEVLLFTLQSAMRANNQRPFVPREGKLIADINRAWQSLEKAEHERELVLKEELIRQEKLEQLAARFNRKAEMRETWLTENQRLVSQDNFGNDLSSVEAATKKHEAIETDIFAYEERVQAVVAVAGELEAENYHDQAKINERKENVLQLWNYLFQLLLARRVRLELSMAIQKIFHDMLLTLDLMDDIKSRLLSEDLGAHLMDVEDLLQKHALLESDINIIGERVNNSIAQAQRFRNPDGPDGSG-YKPVEPGTIDERSDVLQKRYKELLDLAAERKRRLEDNKRLCQFWWDVAELEHGIKEQEQVLSSTDTGRDIVTVSHLLAKHKNAENNLRDLEKYLDRLDVSGKELQDESIPGSDNIPPRLAEIRDYINKLKELSASRKERLAGGVEYYQFFTDADDVDRYLYDTLRVMSSEDVGKDEGTVQLLLKKHDDVHDELQNFDQHIKVLHAKAESLPQEAREHPDIRQRLDTTLKQKAELENLSQLRKQRLIDALSLYKLYSDADSVESWIDEKGKLLATLVPGRDIEEVEIMKHRFDTLEQDMKNQEAKVTNVNDLARQLLNVEHPNSDDILHRQNKLNARWAQLRDMVDQKRNELERAHRLETFRIDCQETVTWIEDKTRVLEDSDALTNDLSGVMKLQRRLSMMERDLGAIQAKLDSLHKEADDIERERPQEAQAIREDIKRIHQVWDILNKKVREHEAKLDEAGDLQRFLRDLDHFQAWLTATQRQVASEEEPQSLAEAEQLLNQHAAIREEIDGYAEDYKKMRAMGDRVTQDQTDPQYMFLRQRLAGLQEGWEELQRMWDNRQHLLSQGLNLQMFLRDAKQAEVMLSQQENYLAKDDIPQSLEQAENQLKRHQDFITTMDANDEKIRAVGMFGDQLCQDGHYAADKIHKKARNIDERRGANREKAQEVLKKLKDALSLQQFLSDCDELREWIEEKMIRAQDETYRDAKTITSKFVRHQAFQSELAANKERLDQLKHAAINLGDDKPEYHGTIDPQIEELATQWDELEKTTEEKGQKLFDANRQQLYVQSIADMKEW-ATQLENEMTREDQPGDLTTVNVAMQKQHLIETEMIKKAQHIDQLMEMEPQLEELHPDELENIKAHRLAVQEQLQRLQAPLDDRRKALERKKAAFQFGRDVDDEKLWISERLVLAKAQNLGESLPDCHRLQKNLQLLSNEIDNHEPWINQICNNGQELIDE-GHANGPAFEKKIQELRSAWQELKEAVKDRKGDLGESEKAHQFLYDCGEAEAWMSEQELYMMQDERG-KDEFSTKNQIKKHERLQSDIDKFADTIRALATKAHKFVEEKSPLTEQIQVRQAQIEKLYAGLQDLSKERRKRLEETLELYALHREIDDLLQWIADKEVVAGSQENGQDYEHVQMLQERFQQFARDTENIGSERVANANDGCDTLIGHGHTDAPTIALWKDSLNEAWENLLELMDTRAQILEASRLLHKFYHDCRDCLSRIMEKTHAMPDDLGRDSSSVGALSRKHQNYLKDIAAIGEQVAQIERDAAELRDGYAGDKALDIGSRESEVVKAWRHLRGLCDARTSRLMDTSDLFKFMNMVRDLLLWMDEVKREMNSQERPKDVSGVELLMNNHQSLKAEIDAREENFNACISLGRDLLNRKHYASSEIEKKLIKLTTERAEMMRRWEDRWEYLQLILEVYQFARDAAVAESWLFAQEPYLISKEYGRNLEETIKLIKKHEAFEKSAFAQEERFLALEKLTTFEL--------------KETQHREEETAKRRGPAHIGSPSRSTPAAETSFGAQDDGAK---------QGEAFE------------GTLIRKHTYESLDRKAANRSWEKLYAVL--RQNELSFYKDPKHRDE----SVHGEPPMALPGCSVNVASDYQKKKNVLSLRL-PIGAEYLFQCGSEEDMQRWLTELQVATG---QAQLEEASRSQTLPAEGS 2312          
BLAST of Spectrin beta chain vs. Ensembl Celegans
Match: sma-1 (SMAll [Source:UniProtKB/TrEMBL;Acc:G5EFW3])

HSP 1 Score: 531.946 bits (1369), Expect = 2.922e-152
Identity = 318/795 (40.00%), Postives = 486/795 (61.13%), Query Frame = 1
Query:  160 YERFRIKALAGEREKVQKKTFTKWINSHLNKLKQSIDDLYNXXXXXXXXXXXXXXXXXXXXPYPTKGKMRIHCLENVDKSLNFLIEQRVHLENMGAHDIVDGNARLTLGLIWTIILRFQIQDIVVE-EDDTSEKRQAKDALLLWCQMKTAGYPNTNVRNFSTCWRDGLAFNAIIHRHRPDLLEYSALSRSNPNE---NLEQAIRIAEEKLGIPRLLDPEDVSVENPDEKSIMTYVVTFYHFFSKMKADSVHSKRVGKILSQSMETEEMMVHYDKLTSNLLEWINQTIELLNDRTFANSLSGVQQQLAAFNTYRVTEKPPKFQEKGNLEMLLFSIQSQMRANNQMPYLPIEGKLISDINNAWNKLDKAEHARELALRDELIRQEKLEQLALRFDRKAGMREAWLTENQRLITQDNFGQDLSAVEAAGKKHEAIKTDILAYEERVNSVTLVTSELENECYHDVERVLCRRDNVIRLWEKLLDMLAVRKLRLDACYKVQKLFQDIKHLLDLINDLKARLKTEDIGRHLMGVEDLIHKHSLLEIDIRMVGTKIEGIMSDAQPFINSEFGLGSGDFQPADPNEVILRTVN-LKEEYDNLLELSRNRKDNLSASKVMWEFLWGVADEEQWMKEKIQLMLNPDLGHDLSSVHRLISKHKVIEEDVRNHSNYLQNVIQGGQQLILDKNPGAEKVADXXXXXXXXXXXXXXXXXXRRSKLEQSLAYFHCLADCGEVEIWIIEQVKLVKIDETSINEESIITDIHKHEQLSKSIEDYESNINSLDEQVKKLSEGDLELVTIEEKV 2529
            +ER RI+ L  ER  +QKKTFTKW NS LN+    I DL+ D+ DG ML+ LLEI+SG++L  P +G+MR+  +EN++K L+FL ++++ LEN+GA DI+D N RL LGLIWTIILRFQI  IV+E E++  E++ AKDALLLWCQ KTAGYPN  + NF+T WR+GLAFNA+IH HRPDL++++ L   NPNE   NL  A  +AE+KL I RLLD EDV V  PDEKSI+TYV  +YH F+K K +   ++R+  I+ + M +E M   Y+ + S LL WI  TI+ L  R F NSL+G++++ A FN +R +EKPPK++EKG LE L F+IQ++ +A ++  Y P +G  + DI +AW +LD AE+ R++A+  EL RQEKLEQLA RF +KA +R++WL   Q ++ +   G+  S VE   KK +AI TDILA E+R   +T + +EL  E YH+ ++V      +I  W +LL +L  RK  L +   +  L +DI  L + +  L+  ++  D+G+HL+GVEDL+ KH LL+  I   G+ +  +   A  +I              +  +V+ R ++ +  +Y+ L+EL R+R+  L  ++ +++F+    +E  W+ EK +L        D+S+V +    +K +E +++ H    + +I GG++L+ +     E +   L ++   W  L    +   + L ++        D  E E WI E++ LVK D+   +E +  + + +H +L + I  Y+S+I+ L+E   +L+       T  + V
Sbjct:   37 FERSRIRTLQDERVHIQKKTFTKWCNSFLNRASLEIVDLFEDVGDGIMLMKLLEIISGDKLGKPNRGRMRVQKVENLNKVLDFLKKKKIQLENIGAEDILDRNERLILGLIWTIILRFQIDTIVIEDEEERGERKHAKDALLLWCQRKTAGYPNVRIENFTTSWRNGLAFNALIHSHRPDLVDFNRL---NPNEHVDNLNHAFDVAEKKLEIARLLDAEDVDVTRPDEKSIITYVSLYYHHFAKQKTEMTGARRIANIVGKLMVSETMEDDYEHIASELLNWIRVTIKTLESRRFPNSLNGMREEHAKFNQFRTSEKPPKYKEKGELEALFFTIQTKRKAMSRKQYQPPQGLFMHDIESAWAQLDYAENERQVAIIAELQRQEKLEQLAQRFHKKAKLRDSWLRSVQVVLEEMEHGRSASQVEKTLKKQQAISTDILAREDRFKMLTAMCNELCTEKYHESDKVRGMEREIIDRWTQLLTLLEQRKRALMSLNDLMSLLRDIDTLSNELYSLEPAVRNRDVGKHLIGVEDLLGKHDLLDAQINAHGSLLSKLSQSANNYIR----------HKEEQFDVLQRKLDEVTAQYNTLVELCRSRRLGLERARSLFQFVQDHEEEMAWLAEKEKLCTTALNSGDISAVPQTTLLYKNVEMEMQTHWARSKGMIAGGERLVQN-GQSKEDIQRRLTQMNHRWERLRVAVDALGNWLSEARHAQQYFQDANEAESWIREKMPLVKSDDLGRDEGAAESLLQRHARLEEEIRAYKSDISRLEEMQSQLANSAFHTATTSQSV 817          

HSP 2 Score: 317.005 bits (811), Expect = 3.851e-86
Identity = 367/1628 (22.54%), Postives = 717/1628 (44.04%), Query Frame = 1
Query: 2263 RRSKLEQSLAYFHCLADCGEVEIWIIEQVKLVK----IDETSINEESIITDIHKHEQLSKSIEDYESNINSL---DEQVKKLSEGDLELVTIEEKVSNIKSQYAILIELTNQKQNKLTDTLSLFRVLRKADTVKTWIDEKEKLLMSLIPTDELEELEVFRHRFDGFEKEMNIQADQVEFVNTLAEKLSDMDHPQIADVVNKRFELNKLWNSLADLVEARREQLQTSYEFNQYLLECKQTGEWIREKSRLVESTDELGDDLAGIMQLQRRMGGMQRDMDAIRAKLEHLDEEMDTLIAKRPNXXXXXXXXXXXXXXFWAELGDMLADRDDRLSESSELQRFLQDLDHIHIWLSKMQTTVASEDLPKDLADAEKSLVQHEQLKEEIDSYQDEFIRLLDYGRRITEDKTD--AQYMFLSQRLNALEEGWQELCQMWENRXXXXXXXXXXXVFLRDAIQSEVLLAQEENFLSKEDIPISIENSQNLLRKHEGFLTTLQANHDHTIAVIEFGRNLVERGHFCSDKINLRVKSILXXXXXXXXXXXXAYEKLKDQVLYQELSQDIDDLSKWIQEKMIIATDESFREEKNIARRYNRHRAFDEEIQANKDRLCQAIDYAMQIVEERPQLADMIYPQIDSLNQQWEELEQTTFLKGEKMIEANREAIFEEGTMDVMTWLXXXXXXXXXXXXXXXXXXXXXXKLKKVEEADNEMEIKRKQIQDLKMHAAKLKEEQPEKAFGIEQKHLILEHRFTQLQMPXXXXXXXXXXXXXXXXFLRNLDDQKAWVDDKLLLAESTNFGNNLLTVQQLLRRHRYLATEVNNHKPQLEYLKEEGAVLIEEVSPMQREKFVAG------LQELESLWNRLEHSIDLRQQRLKESEATQTFLFDAEEAESWLWEQELFLLSEERGIRDQEAAINVIKKHDARQKTIEDYGEEITKLGTRSRLLIEKDHPQADRIALAQSHVDKVYAGLRDLCLEKKQRLSEIQKLNHLYREIVDLENWIYERTLVASSHDLGVDFEHCCLLRERFDEFFHETHLLGKDRVKAANDLCASLISQCHADSAEIAQWHDRINDSWAELQELMQTRIQLLRTAWEFYKYLSSCQDVL----DRICEKIASIPTDVSK-DSQSVAIQQRKHATFLSDAQALEGQVQWVVDEANHLLPSYAGQKEWHICERRDDVLATWNQLNMQAERRRHQLEDAADLQRFFSMVRELLQWMDLVALQINEKTRPKDVSGVELLINDHRSIKAEIAAREESMSICVNLGRTLLHRGRVGVDEVRAALINLITRKYS-LEDMWEERWDYLQLILEVYQFARDASVAEAWILAQEPYLANK-TLGETLDETLSLLKKHINFEKTVMSQEERFEALEKLTTME-----IRAKEITKESILLKDKHKQERIE--------------------NAIKIFQPPPSPE--LVHESP------KVSISEEDEEGKSHQHKISVISKEAAEMCQSSE-TKT-----------------------DIRGILIRKHEWEYKNRKALNRSWHEFLVVLSIEKNKLLVYKDEKHYNEKPQDTYHKDSGLDLNDLVAAPA-----------SDYLKRPFVFRIKITSTGAEYLFQAKDEEDMLRWVNSI 6876
            R + L+ + A     +D  ++E WI E+   V+    +   SI+ +  +  +  H+ L   +   +  ++ +     Q+K L         I  +   +  ++  L      +   L +   L R  +  + V  WI+EKE L+ +     ++E   +   R DG   +  +    ++ +N L EKL          V  ++  LN+ W  L   +   R +L  + E + +  + + T E I EK   ++S D+ G D A +  L R+   ++RDM AI  KL   D++   ++ KRP   E + +    LE+ W +L      R+++L+ S +L ++L D+  +  W ++++  + S   PKD   A K L QH + K EID   +E   L + G+ + +++ +  A+     +R+   E    +L Q WE+ +G L + L   ++  +A+Q E  L+ +E  +++ ++  + +  + L++ H  F  T++   +   A+ +    LV  G+     I  R + +  R     +   +    L+D   Y E  +   +L  WI  K+ +A DESF +  N+  +  +H AFD E+  N+ RL        Q+V +   +++ +  Q+  L   W+EL   + LK +++ EA      +    D+  WL+ +   +   +   + L+   + +KK++    E+  +   + ++   A +L+ +    A    ++   +E R++ L  P++ ++  L+  +   Q+++  ++   W+ D+++LA S   G++L +   L ++H  L  E++  +  +   ++ G  +I       R++  A       L  L S    L+ S  LR+  L+E+     +  +  EAE WL EQ    +S+E G RDQ  A + +++     K +E +  EI +L  R+  L+ ++H  A  IA  Q  ++ ++  L   C  ++ ++ +  K +   R+  DL +W+ E+   AS+ D G D E C  + E+F+    E    G +RV A       L+   H   A I      +   W  + E+   R Q L  A + +++      +L    D+    +A    D+S+ D  SV  Q ++H  F+   +A+E QV  +  EA  L  S+   +  H+  RR D+      +   A++   +L     LQ +F   RE++QWM  +   +  +  P+DV+  E L+  H     E+  R+  +      GR ++    V   E++   ++++ + ++ L ++W++R +  +  ++V ++ ++A   ++W+  +   L +   + ++++   + L+   +F  T+ +Q E+ + +++LT +E     +R+KEI +  I   D+ +++ I+                      I + +P PS E    H  P      +   + +   G      I   S   A +    E TKT                       D++G   RK   +   ++A  RSW  +  +L      L  +KDE+ +               L ++ AAP             +Y KR   FR+ +   G+E++F   DE  ML WV  I
Sbjct: 2188 RHAMLKDAFALASFDSDVAQIEAWIDEKTNGVRKAQDLSSESISIDEKMKRLQTHQALEAEVTANKPVVDQILQRGNQLKNLHRNP----KIANRCDELSYKWNQLSGACADQSLALEEARDLLRFKQLVENVLAWINEKEVLVSTADMGKDMEHCRLLLERLDGTRSDSIVDEQTLDEINRLGEKLVKQGRSSRDQVQKEQQHLNEKWRLLLGQLAHYRTELLAAMEVHTFNRDVEDTDERIHEKVAAMKS-DDYGKDFASVELLVRKQSALERDMSAIHQKLIAHDKDAQKILEKRPPLRETVLDSLKKLEESWEQLSKAAELRNEKLNRSFKLYKYLDDVKKVEQWANQVRNKMTSHQTPKDSNGARKILEQHHERKAEIDGRSEELRLLHEEGQALNQEQPEHKAEVQRAHKRVQNSE---HQLRQTWESEKGTLQKLLEWMLWCDEAVQCEQWLSDKETQVARGELGDTTDAVEMLIKGHSAFEETVRKQSEKIDALTKNADALVSGGNNYRADIVTRSEEVTARHALLLKSMEKRGHMLEDSKKYHEFIRQCGELIIWITAKLQLAYDESFLDHTNLRSKLQKHMAFDSELVENEKRLSTVERQGEQLVTDNHFMSEQVKAQLVELRSGWDELRTKSALKTQRLREAFELHSLQRKVEDIEKWLDKVEGELSSDDHGRDILSTELL-IKKLDTLQTEIAGRSDAVVEMMKKARELRVQGSAAADDCLKQAEQVEARYSGLDEPVQIRRENLVDAQAFFQWVKAAEEDLEWLSDRMMLASSGESGDSLQSALSLQKKHATLEKELDTRQSAMNDTEQRGKDMI-------RQRHFASTHIQKILDRLSSAMLTLKESCGLRRDLLQEAIDAHEYYTEETEAEQWLREQMPLAMSQEMG-RDQAGAESHLRRLTVLDKEVELFKNEIDRLKKRADGLLAREHHDAMSIAAKQRKLEALFGDLCRECARRRTQIVDASKYHKFVRQADDLSDWLREKERSASAEDYGQDLEDCQQIIEQFESTVRELAAAG-ERVAAVQRAQEDLLRSGHPYGASITAKGADVQRLWTHVNEVANERKQALNGARQVHRFDQEADQILNWLQDKEATGVAMEQEDLSRADLASVKAQLQRHDEFMHGMKAVEKQVAELCHEAERLWNSFPDTRH-HLEVRRLDMEEQLKDILEAAKKHLEKLRHMQSLQSYFQEYREMMQWMKNMQSTMTSEQLPRDVASCESLVRRHDEYNLEMQGRKPFVDDFARQGRRMIQSSHVLSQEIQEK-VDILEKSWAMLCEIWKDRAELYEENMDVQKWKQNAEQLDSWLEERAGLLGDDWRMVDSVEMAETHLRDFDDFLVTLEAQSEKCDMVKRLTLVEQNFSRLRSKEIDRARIAEDDQKRRDTIKIVEKGNILANRRQERERRKTQEISLLRPSPSGEEFSTHTMPRKERKDRAKTTADLAPGAIQIGDILASSSTVAPLQSGVEMTKTPSFNTRRTQSIRKGSRWEDMGAIDMKGFFDRKQCQQSGGKRATIRSWKNYYGILC--GQLLCFFKDEQQF---------------LENVAAAPPVYIYGAQCEQYPEYAKRKNSFRL-LLQDGSEFIFSCPDERQMLEWVAKI 3777          

HSP 3 Score: 262.692 bits (670), Expect = 1.267e-69
Identity = 293/1282 (22.85%), Postives = 579/1282 (45.16%), Query Frame = 1
Query: 2512 TIEEKVSNIKSQYAILIELTNQKQNKLTDTLSLFRVLRKADTVKTWIDEKEKLLMSLIPTDELEELEVFRHRFDGFEKEMNIQAD-QVEFVNTLAEKLSDMDHPQIADVVNKRFELNKLWNSLADLVEARREQLQTSYEFNQYLLECKQTGEWIREKSRLVESTDELGDDLAGIMQLQRRMGGMQRDMDAIRAKLEHLDEEMDTLIAKRPNXXXXXXXXXXXXXXFWAELGDMLADRDDRLSESSELQRFLQDLDHIHIWLSKMQTTVASEDLPKDLADAEKSLVQHEQLKEEIDSYQDEFIRLLDYGRRITEDKTDAQYMFLSQRLNALEEGWQELCQMWENRXXXXXXXXXXXVFLRDAIQSEVLLAQEENFLSKEDIPISIENSQNLLRKHEGFLTTLQANHDHTIAVIEFGRNLVERGHFCSDKINLRVKSILXXXXXXXXXXXXAYEKLKDQVLYQELSQDIDDLSKWIQEK--MIIATDESFREEKNIARRYNRHRAFDEEIQANKDRLCQAIDYAMQIVEERPQLADMIYPQIDSLNQQWEELEQTTFLKGEKMIEANREAIFEEGTMDVMTWLXXXXXXXXXXXXXXXXXXXXXXKLKKVEEADNEMEIKRKQIQDLKMHAAKLKEEQPEKAFGIEQKHLILEHRFTQLQMPXXXXXXXXXXXXXXXXFLRNLDDQKAWVDDKLLLAESTNFGNNLLTVQQLLRRHRYLATEVNNHKPQLEYLKEEGAVLIEEVSPMQREKFVAGLQELESLWNRLEHSIDLRQQRLKESEATQTFLFDAEEAESWLWEQELFLLSEERGIRDQEAAINVIKKHDARQKTIEDYGEEITKLGTRSRLLIEKDHPQADRIALAQSHVDKVYAGLRDLCLEKKQRLSEIQKLNHLYREIVDLENWIYERTLVASSHDLGVDFEHCCLLRERFDEFFHETHLLGKDRVKAANDLCASLISQCHADSAEIAQWHDRINDSWAELQELMQTRIQLLRTAWEFYKYLSSCQDVLDRICEKIASIPTDVSKDSQSVAIQQRKHATFLSDAQALEGQVQWVVDEANHLLPSYAGQKEWHICERRDDVLATWNQLNMQAERRRHQLEDAADLQRFFSMVRELLQWMDLVALQINEKTRPKDVSGVELLINDHRSIKAEIAAREESMSICVNLGRTLLHRGRVGVDEVRAALINLITRKYSLEDMWEERWDYLQLILEVYQFARDASVAEAWILAQEPYLANKTLGETLDETLSLLKKHINFEKTVMSQEERFEALEKLTTMEIRAKEITKESI 6348
             + ++   I + Y  L  L + ++  L+D + L R  R+ D  + W  E E   +SL      E +  FR +FD  E +M      Q++ +N +A  L    H Q   +  ++ ++N +W++L  L + R  +L+ +     +   C+   EW+  K    E  D   +D+  +  L+R       D+  +  K+  L++    +    P +   I  +   L    A+L     ++     ++   + F   L  +  W+ K +  +  +  P D+A+AE+ L +H +L E+I   + E     + GRR+ E   + +   + ++L  L      L  ++  R  +L Q L LQ+F R++ + +      E FL  +++  S+E+ +NLL++H      L A      A      ++++  H  S  I  R + +L RRE+ +R + +  ++L+  + YQE+ ++ D++  W+ EK  ++++ D+S      I  R  +H AF+ EI AN+ R+ Q       +V ++   +  +   +  +N QW +L++  + KG ++ +A  +   +    D    L+ +  ++   ++ ++  +  ++ L+K    + EM +   ++ D++    K+  +    A  I      L  R+  ++ P + +K  L + +   Q + ++D +  W+ +K  +A S + G  L     ++++   L  EVN H  Q++ +  +   LI+        +  A   ELE+ W+ L+  + LR+  +      Q +LFDA E ESW+ E+   L SE+ G  D++AA  ++ KH A  + +  Y + + KL  +   L+E + P  +R    Q  + + +  L  L  +++  L +   L    RE  DL   I E   VA S +   D+EH   L+ +FDEF  +    G +R  +      +++ +    + ++ +  + +  +W  L E ++ R   L  A E +++     +    + +K+A++P D+ +D + V    + H     +    + ++  +V+EA  L  +Y G     I  R+  +   W +L    + R+  L  A DL  F   VR+LL W DL    I       D+   E L  +H  +  E+ ARE   +  VN G  ++       +E++     L +    L   W  R  +L   ++ + F R+A    A I ++   L +  +G ++ +  S  K+   FEK + + +ER   L+      ++A+ +  ++I
Sbjct:  905 VVADRQHKISNDYRELKRLADVRRRLLSDNIKLLRFYRECDEFERWAKEIE---VSLADEPSPEHVAAFRRKFDKLEADMKTNGGTQLKHINDIANDLISEGHGQSRKIEVRQHKINAMWDNLERLRKQRGVRLEATERVADFDTTCESAREWMLSK---FEQLDRNPNDVKSLQNLER-------DLKPLEDKIAALEKLAAAVKKDHPEEAAAIERKIAELRALHADLLRRAQEKMLLAEQTQGKEMFESALRDMIGWIEKTRKVMMEDVHPVDVAEAEELLKKHYELGEQIKDKKYEVEYCQELGRRLLE--RNPRMSKVEEQLQNLVSEMASLRDLYRRRDTILKQQLDLQLFNRESERIDAATKGHEAFLEFDNLGDSVESVENLLKRHRDLEAKLDAQEARLEAFSRTADDMIKAQHADSAYIEQRRRDVLARREAVRRAAAQRKKQLEASLEYQEMRREADEVVGWMYEKAKLVMSGDDSALAPSAIPHRLLKHEAFEAEIIANEPRIQQINSEGDGLVSKKHYESPNVEKIVRQVNAQWGDLKKQVWNKGLRLRQAADQKGLDRILEDAHAKLDEMQTALNSKDQGLDLRSVKDL-LQKHAVLEQEMGLYGNKLSDIENRGKKMAVDGHYDADRIHSTVGQLLQRYAAMKGPAQRRKGDLDESRLWHQLVFDVDCELQWIAEKKPIASSQDCGRTLTEALNMVKKQEQLEAEVNQHGGQIDKVLLQAGELIKRHHSAS-SQIKAKSSELETAWSELKKLLRLRRAVVDWGVKEQQYLFDAAEVESWMNEKRNALASEDYG-NDEDAARKLLSKHRALCEDMTTYRQWLEKLEVKCVELVESNRPHVERFQKRQDELVREFDALSKLAEDRRNALEDAVCLYEYMRESADLGQSIEENLRVAMSEEFAEDYEHLKELQSKFDEFKQKVKN-GSERFTSCETAANAILRRNPPFARDVVKKQEALRTAWNTLCEYIEARDSKLAVAEELHRFHRDVDEFEQWMADKMANMPRDLGRDVKHVHSLWQHHEALDKEIHNSQPRLAKLVEEAERLKKTYPGGNAEQIGGRQQTLEQEWEELKNATDDRKDMLRAAFDLHTFNGKVRDLLAWTDLTISDIQSDLHINDLQQAEWLQTEHSRLSHEMDAREPEFARLVNDGEKMITAQHYASEEIKNKTHLLKSALERLRSEWALRNGFLSQAVQWHAFQREAKQIIASIGSKRTTLRSLAVGGSVADVESQTKRLDTFEKALSTLDERTATLDHTANELMKARHMESKNI 2167          

HSP 4 Score: 148.673 bits (374), Expect = 4.742e-35
Identity = 174/815 (21.35%), Postives = 383/815 (46.99%), Query Frame = 1
Query: 1321 FDRKAGMREAWLTENQRLITQDNFGQDLSAVEAAGKKHEAIKTDILAYEERVNSVTLVTSELENECYHDVERVLCRRDNVIRLWEKLLDMLAVRKLRLDACYKVQKLFQDIKHLLDLINDLKARLKTEDIGRHLMGVEDLIHKHSLLEIDIRMVGTKIEGIMSDAQPFINSEFGLGSGDFQPADPNEVILRTVNLKEEYDNLLELSRNRKDNLSASKVMWEFLWGVADEEQWMKEKIQLMLNPDLGHDLSSVHRLISKHKVIEEDVRNHSNYLQNVIQGGQQLILDKNPGAEKVADXXXXXXXXXXXXXXXXXXRRSKLEQSLAYFHCLADCGEVEIWIIEQVKLVKIDETSINEESIITDIHKHEQLSKSIEDYESNINSLDEQVKKLSEGDL-----ELVTIEEKVSNIKSQYAILIELTNQKQNKLTDTLSLFRVLRKADTVKTWIDEKEKLLMSLIPTDELEELEVFRHRFDGFEKEMNIQADQVEFVNTLAEKLSDMDHPQIADVVNKRFELNKLWNSLADLVEARREQLQTSYEFNQYLLECKQTGEWIREKSRL---VESTDELGDDLAGI-MQLQRR---MGGMQRDMDAIRAKLEHLDEEMDTLIAKRPNXXXXXXXXXXXXXXFWAELGDMLADRDDRLSESSELQRFLQDLDHIHIWLSKMQTTVASEDLPKDLADAEKSLVQHEQLKEEIDS---YQDEFIRLLDYGRRITEDKTDAQYMFLSQRLNALEEGWQELCQMWENRXXXXXXXXXXXVFLRDAIQSEVLLAQEENFLSKE-DIPISIENSQNLLRKHEGFLTTLQA 3717
            F R+ G    W+T   +L   ++F  D + + +  +KH A  ++++  E+R+++V     +L  + +   E+V  +   +   W++L    A++  RL   +++  L + ++ +   ++ ++  L ++D GR ++  E LI K   L+ +I      +  +M  A+         GS     A  ++ + +   ++  Y  L E  + R++NL  ++  ++++    ++ +W+ +++ L  + + G  L S   L  KH  +E+++    + + +  Q G+ +I  ++  +  +   L  L      L E    RR  L++++       +  E E W+ EQ+ L    E   ++    + + +   L K +E +++ I+ L    KK ++G L     + ++I  K   +++ +  L     +++ ++ D     + +R+AD +  W+ EKE+   +     +LE+ +    +F+   +E+    ++V  V    E L    HP  A +  K  ++ +LW  + ++   R++ L  + + +++  E  Q   W+++K      +E  D    DLA +  QLQR    M GM+    A+  ++  L  E + L    P+    +   R+ +E+   ++ +      ++L     LQ + Q+   +  W+  MQ+T+ SE LP+D+A  E  + +H++   E+     + D+F R    GRR+ +  +      + ++++ LE+ W  LC++W++R  L  +++ +Q + ++A Q +  L +    L  +  +  S+E ++  LR  + FL TL+A
Sbjct: 2733 FIRQCGELIIWITAKLQLAYDESF-LDHTNLRSKLQKHMAFDSELVENEKRLSTVERQGEQLVTDNHFMSEQVKAQLVELRSGWDELRTKSALKTQRLREAFELHSLQRKVEDIEKWLDKVEGELSSDDHGRDILSTELLIKKLDTLQTEIAGRSDAVVEMMKKARELRVQ----GS-----AAADDCLKQAEQVEARYSGLDEPVQIRRENLVDAQAFFQWVKAAEEDLEWLSDRMMLASSGESGDSLQSALSLQKKHATLEKELDTRQSAMNDTEQRGKDMIRQRHFASTHIQKILDRLSSAMLTLKESCGLRRDLLQEAIDAHEYYTEETEAEQWLREQMPLAMSQEMGRDQAGAESHLRRLTVLDKEVELFKNEIDRL----KKRADGLLAREHHDAMSIAAKQRKLEALFGDLCRECARRRTQIVDASKYHKFVRQADDLSDWLREKERSASAEDYGQDLEDCQQIIEQFESTVRELAAAGERVAAVQRAQEDLLRSGHPYGASITAKGADVQRLWTHVNEVANERKQALNGARQVHRFDQEADQILNWLQDKEATGVAMEQEDLSRADLASVKAQLQRHDEFMHGMK----AVEKQVAELCHEAERLWNSFPDTRHHLEVRRLDMEEQLKDILEAAKKHLEKLRHMQSLQSYFQEYREMMQWMKNMQSTMTSEQLPRDVASCESLVRRHDEYNLEMQGRKPFVDDFAR---QGRRMIQ-SSHVLSQEIQEKVDILEKSWAMLCEIWKDRAELYEENMDVQKWKQNAEQLDSWLEERAGLLGDDWRMVDSVEMAETHLRDFDDFLVTLEA 3525          

HSP 5 Score: 107.842 bits (268), Expect = 1.023e-22
Identity = 144/637 (22.61%), Postives = 272/637 (42.70%), Query Frame = 1
Query: 4429 IEQKHLILEHRFTQLQMPXXXXXXXXXXXXXXXXFLRNLDDQKAWVDDKLLLAESTNFGNNLLTVQQLLRRHRYLATEVNNHKPQLEYLKEEGAVLIEEVSPMQREKFVAGLQELESL-WNRLEHSIDLRQQRLKESEATQTFLFDAEEAESWLWEQELFLLSEERGIRDQEAAINVIKKHDARQKTIEDYGEEITKLGTRSRLLIEKDHPQADRIALAQSHVDKVYAGLRDLCLEKKQRLSEIQKLNHLYREIVDLENWIYERTLVASSHDLGVDFEHCCLLRERFDEFFHETHLLGKDRVKAANDLCASLISQCHADSAEIAQWHDRINDSWAELQELMQTRIQLLRTAWEFYKYLSSCQDVLDRICEKIASI---PTDVSKDSQSVAIQQRKHATFLSDAQALEGQVQWVVDEANHLLPSYAGQKEWHICERRDDVLATWNQLNMQAERRRHQLEDAADLQRFFSMVRELLQWMDLVALQINEKTRPKDVSGVELLINDHRSIKAEIAAREESMSICVNLGRTLLHRGRVGVDEVRAALINLITRKYSLEDMWEERWDYLQLILEVYQFARDASVAEAWILAQEPYLANKTLGETLDETLSLLKKHINFEKTVMSQEERFEALEKLTTMEIRAK 6327
            I+++   + HR+ +L++ +      L + +  QQ+ ++ ++ ++W+ +K+ L +S + G +    + LL+RH  L  E+  +K  +  L+E  + L    S          +QE E +   ++E S +     ++ S+     L +    E W            R ++       V   +    K +      +T+   ++   +E +  ++  +A  Q  +   Y  L+ L   +++ LS+  KL   YRE  + E W  E  +  +        EH    R +FD+   +    G  ++K  ND+   LIS+ H  S +I     +IN  W  L+ L + R   L        + ++C+   + +  K   +   P DV    +S+   +R          ALE     V  + +H  P  A   E  I E R    A    L  +A+ +    E     + F S +R+++ W++     + E   P DV+  E L+  H  +  +I  ++  +  C  LGR LL R    + +V   L NL++   SL D++  R   L+  L++  F R++   +A     E +L    LG++++   +LLK+H + E  + +QE R EA  +     I+A+
Sbjct:  708 IQRRLTQMNHRWERLRVAVDALGNWLSEARHAQQYFQDANEAESWIREKMPLVKSDDLGRDEGAAESLLQRHARLEEEIRAYKSDISRLEEMQSQLAN--SAFHTATTSQSVQETEEVNVPQVEMSYNYEGNGMRVSKGEVLALLEKSTPEWW------------RALKRDGTEGYVPANY---CKIVPGETVTVTQTTQKTTTTLEGNETKSSVVADRQHKISNDYRELKRLADVRRRLLSDNIKLLRFYRECDEFERWAKEIEVSLADEP---SPEHVAAFRRKFDKLEADMKTNGGTQLKHINDIANDLISEGHGQSRKIEVRQHKINAMWDNLERLRKQRGVRLEATERVADFDTTCESAREWMLSKFEQLDRNPNDV----KSLQNLERDLKPLEDKIAALEKLAAAV--KKDH--PEEAAAIERKIAELR----ALHADLLRRAQEKMLLAEQTQGKEMFESALRDMIGWIEKTRKVMMEDVHPVDVAEAEELLKKHYELGEQIKDKKYEVEYCQELGRRLLERN-PRMSKVEEQLQNLVSEMASLRDLYRRRDTILKQQLDLQLFNRESERIDAATKGHEAFLEFDNLGDSVESVENLLKRHRDLEAKLDAQEARLEAFSRTADDMIKAQ 1311          

HSP 6 Score: 82.4185 bits (202), Expect = 4.778e-15
Identity = 113/588 (19.22%), Postives = 254/588 (43.20%), Query Frame = 1
Query: 1189 PIEGKLISDINNAWNKLDKAEHARELALRDELIRQEKLEQLALRFDRKAGMREAWLTENQRLITQDNFGQDLSAVEAAGKKHEAIKTDILAYEERVNSVTLVTSELENECYHDVERVLCRRDNVIRLWEKLLDMLAVRKLRLDACYKVQKLFQDIKHLLDLINDLKARLKTEDIGRHLMGVEDLIHKHSLLEIDIRMVGTKIEGIMSDAQPFINSEFGLGSGDFQPADPNEVILRTVNLKEEYDNLLELSRNRKDNLSASKVMWEFLWGVADEEQWMKEKIQLMLNPDLGHDLSSVHRLISKHKVIEEDVRNHSNYLQNVIQGGQQLILDKNPGAEKVADXXXXXXXXXXXXXXXXXXRRSKLEQSLAYFHCLADCGEVEIWIIEQVKLVKIDETSINEESIITDIHKHEQLSKSIEDYESNINSLDEQVKKLSEGDLELVT-IEEKVSNIKSQYAILIELTNQKQNKLTDTLSLFRVLRKADTVKTWIDEKEKLLMSLIPTD---ELEELEVFRHRFDGFEKEMNIQADQVEFVNTLAEKLSDMDHPQIADVVNKRFE-LNKLWNSLADLVEARREQLQTSYEFNQY 2937
            P   K++  +N  W  L K    + L LR      +  +Q  L  DR      A L E Q  +   + G DL +V+   +KH  ++ ++  Y  +++ +     ++  + ++D +R+      +++ +  +      RK  LD      +L  D+   L  I + K    ++D GR L    +++ K   LE ++   G +I+ ++  A   I       S         ++  ++  L+  +  L +L R R+  +       ++L+  A+ E WM EK   + + D G+D  +  +L+SKH+ + ED+  +  +L+ +     +L+    P  E+      EL   ++ L +L E+RR+ LE ++  +  + +  ++   I E +++   +E + + E +     K ++  + +++      S +     +   +      + +K   +++ +  L E    + +KL     L R  R  D  + W+ +K    M+ +P D   +++ +       +  +KE++    ++  +   AE+L        A+ +  R + L + W  L +  + R++ L+ +++ + +
Sbjct: 1423 PNVEKIVRQVNAQWGDLKKQVWNKGLRLR------QAADQKGL--DRILEDAHAKLDEMQTALNSKDQGLDLRSVKDLLQKHAVLEQEMGLYGNKLSDIENRGKKMAVDGHYDADRIHSTVGQLLQRYAAMKGPAQRRKGDLDESRLWHQLVFDVDCELQWIAEKKPIASSQDCGRTLTEALNMVKKQEQLEAEVNQHGGQIDKVLLQAGELIKRHHSASS---------QIKAKSSELETAWSELKKLLRLRRAVVDWGVKEQQYLFDAAEVESWMNEKRNALASEDYGNDEDAARKLLSKHRALCEDMTTYRQWLEKLEVKCVELVESNRPHVERFQKRQDELVREFDALSKLAEDRRNALEDAVCLYEYMRESADLGQSIEENLRVAMSEEFAEDYEHLKELQSKFDEFKQKVKNGSERFTSCETAANAILRRNPPFARDVVKKQEALRTAWNTLCEYIEARDSKLAVAEELHRFHRDVDEFEQWMADK----MANMPRDLGRDVKHVHSLWQHHEALDKEIHNSQPRLAKLVEEAERLKKTYPGGNAEQIGGRQQTLEQEWEELKNATDDRKDMLRAAFDLHTF 1989          

HSP 7 Score: 77.411 bits (189), Expect = 1.980e-13
Identity = 124/647 (19.17%), Postives = 281/647 (43.43%), Query Frame = 1
Query: 1159 MRANNQMPYL---PIEGKLISDINNAWNKLDKAEHARELALRD--ELIRQEKLEQLALRFDRKAGMREAWLTENQRLITQDNFGQDLSAVEAAGKKHEAIKTDILAYEERVNSVTLVTSELENECYHDVERVLCRRDNVIRLWEKLLDMLAVRKLRLDACYKVQKLFQDIKHLLDLINDLKARLKTEDIGRHLMGVEDLIHKHSLLEIDIRMVGTKIEGIMSDAQPFINSEFGLGSGDFQPADPNEVILRTVNLKEEYDNLLELSRNRKDNLSASKVMWEFLWGVADEEQWMKEKIQLMLNPDLGHDLSSVHRLISKHKVIEEDVRNHSNYLQNVIQGGQQLILDKNPGAEKVADXXXXXXXXXXXXXXXXXXRRSKLEQSLAYFHCLADCGEVEIWIIEQVKLVKIDETSINEESIITDIHKHEQLSKSIEDYESNINSLDEQVKKLSEGD----LELVTIEEKVSNIKSQYAILIELTNQKQNKLTDTLSLFRVLRKADTVKTWIDEKEKLLMSLIPTDELEELEVFRHRFDGFEKEMNIQADQVEFVNTLAEKLSDMDHPQIADVVNKRFELNKLWNSLADLVEARREQLQTSYEFNQYLLECKQTGEWIREKSRLVESTDELGDDLAGIMQLQRRMGGMQRDM 3072
            ++  NQ+  L   P       +++  WN+L  A   + LAL +  +L+R ++L +  L          AW+ E + L++  + G+D+       ++ +  ++D +  E+ ++ +  +  +L  +     ++V   + ++   W  LL  LA  +  L A  +V    +D++   + I++  A +K++D G+    VE L+ K S LE D+  +  K+     DAQ  +           +P     V+     L+E ++ L + +  R + L+ S  ++++L  V   EQW  +    M +     D +   +++ +H   + ++   S  L+ + + GQ L  ++     +V    K ++   ++L +  E+ +  L++ L +     +  + E W+ ++   V   E     +++   I  H    +++      I++L +    L  G      ++VT  E+V+   +++A+L++   ++ + L D+      +R+   +  WI  K +L       D    L     +   F+ E+     ++  V    E+L   +H     V  +  EL   W+ L      + ++L+ ++E +    + +   +W+ +K     S+D+ G D+     L +++  +Q ++
Sbjct: 2260 LQRGNQLKNLHRNPKIANRCDELSYKWNQLSGACADQSLALEEARDLLRFKQLVENVL----------AWINEKEVLVSTADMGKDMEHCRLLLERLDGTRSDSIVDEQTLDEINRLGEKLVKQGRSSRDQVQKEQQHLNEKWRLLLGQLAHYRTELLAAMEVHTFNRDVEDTDERIHEKVAAMKSDDYGKDFASVELLVRKQSALERDMSAIHQKLIAHDKDAQKILEK---------RPPLRETVLDSLKKLEESWEQLSKAAELRNEKLNRSFKLYKYLDDVKKVEQWANQVRNKMTSHQTPKDSNGARKILEQHHERKAEIDGRSEELRLLHEEGQALNQEQPEHKAEVQRAHKRVQNSEHQLRQTWESEKGTLQKLLEWMLWCDEAVQCEQWLSDKETQVARGELGDTTDAVEMLIKGHSAFEETVRKQSEKIDALTKNADALVSGGNNYRADIVTRSEEVT---ARHALLLKSMEKRGHMLEDSKKYHEFIRQCGELIIWITAKLQLAYDESFLDHT-NLRSKLQKHMAFDSELVENEKRLSTVERQGEQLVTDNHFMSEQVKAQLVELRSGWDELRTKSALKTQRLREAFELHSLQRKVEDIEKWL-DKVEGELSSDDHGRDILSTELLIKKLDTLQTEI 2882          

HSP 8 Score: 65.4698 bits (158), Expect = 6.426e-10
Identity = 59/289 (20.42%), Postives = 134/289 (46.37%), Query Frame = 1
Query: 1318 RFDRKAGMREAWLTENQRLITQDNFGQDLSAVEAAGKKHEAIKTDILAYEERVNSVTLVTSELENECYHDVERVLCRRDNVIRLWEKLLDMLAVRKLRLDACYKVQKLFQDIKHLLDLINDLKAR---LKTEDIGR-HLMGVEDLIHKHSLLEIDIRMVGTKIEGIMSDAQPFINSEFGLGSGDFQPADPNEVILRTVNLKEEYDNLLELSRNRKDNLSASKVMWEFLWGVADEEQWMKEKIQLMLNPDLGHDLSSVHRLISKHKVIEEDVRNHSNYLQNVIQGGQQLI 2172
            +F R+A     WL E +R  + +++GQDL   +   ++ E+   ++ A  ERV +V     +L    +     +  +  +V RLW  + ++   RK  L+   +V +  Q+   +L+ + D +A    ++ ED+ R  L  V+  + +H      ++ V  ++  +  +A+   NS F        P   + + +R ++++E+  ++LE ++   + L   + +  +     +  QWMK     M +  L  D++S   L+ +H     +++    ++ +  + G+++I
Sbjct: 3155 KFVRQADDLSDWLREKERSASAEDYGQDLEDCQQIIEQFESTVRELAAAGERVAAVQRAQEDLLRSGHPYGASITAKGADVQRLWTHVNEVANERKQALNGARQVHRFDQEADQILNWLQDKEATGVAMEQEDLSRADLASVKAQLQRHDEFMHGMKAVEKQVAELCHEAERLWNS-F--------PDTRHHLEVRRLDMEEQLKDILEAAKKHLEKLRHMQSLQSYFQEYREMMQWMKNMQSTMTSEQLPRDVASCESLVRRHDEYNLEMQGRKPFVDDFARQGRRMI 3434          
BLAST of Spectrin beta chain vs. Ensembl Fly
Match: beta-Spec (gene:FBgn0250788 transcript:FBtr0334404)

HSP 1 Score: 1912.89 bits (4954), Expect = 0.000e+0
Identity = 1023/2276 (44.95%), Postives = 1541/2276 (67.71%), Query Frame = 1
Query:  154 KLYERFRIKALAGEREKVQKKTFTKWINSHLNKLKQSIDDLYNXXXXXXXXXXXXXXXXXXXXPYPTKGKMRIHCLENVDKSLNFLIEQRVHLENMGAHDIVDGNARLTLGLIWTIILRFQIQDIVVEEDDTSEKRQAKDALLLWCQMKTAGYPNTNVRNFSTCWRDGLAFNAIIHRHRPDLLEYSALSRSNPNENLEQAIRIAEEKLGIPRLLDPEDVSVENPDEKSIMTYVVTFYHFFSKMKADSVHSKRVGKILSQSMETEEMMVHYDKLTSNLLEWINQTIELLNDRTFANSLSGVQQQLAAFNTYRVTEKPPKFQEKGNLEMLLFSIQSQMRANNQMPYLPIEGKLISDINNAWNKLDKAEHARELALRDELIRQEKLEQLALRFDRKAGMREAWLTENQRLITQDNFGQDLSAVEAAGKKHEAIKTDILAYEERVNSVTLVTSELENECYHDVERVLCRRDNVIRLWEKLLDMLAVRKLRLDACYKVQKLFQDIKHLLDLINDLKARLKTEDIGRHLMGVEDLIHKHSLLEIDIRMVGTKIEGIMSDAQPFINSEFGLGSGDFQPADPNEVILRTVNLKEEYDNLLELSRNRKDNLSASKVMWEFLWGVADEEQWMKEKIQLMLNPDLGHDLSSVHRLISKHKVIEEDVRNHSNYLQNVIQGGQQLILDKNPGAEKVADXXXXXXXXXXXXXXXXXXRRSKLEQSLAYFHCLADCGEVEIWIIEQVKLVKIDETSINEESIITDIHKHEQLSKSIEDYESNINSLDEQVKKLSEGDLELVTIEEKVSNIKSQYAILIELTNQKQNKLTDTLSLFRVLRKADTVKTWIDEKEKLLMSLIPTDELEELEVFRHRFDGFEKEMNIQADQVEFVNTLAEKLSDMDHPQIADVVNKRFELNKLWNSLADLVEARREQLQTSYEFNQYLLECKQTGEWIREKSRLVESTDELGDDLAGIMQLQRRMGGMQRDMDAIRAKLEHLDEEMDTLIAKRPNXXXXXXXXXXXXXXFWAELGDMLADRDDRLSESSELQRFLQDLDHIHIWLSKMQTTVASEDLPKDLADAEKSLVQHEQLKEEIDSYQDEFIRLLDYGRRITEDKT---DAQYMFLSQRLNALEEGWQELCQMWENRXXXXXXXXXXXVFLRDAIQSEVLLAQEENFLSKEDIPISIENSQNLLRKHEGFLTTLQANHDHTIAVIEFGRNLVERGHFCSDKINLRVKSILXXXXXXXXXXXXAYEKLKDQVLYQELSQDIDDLSKWIQEKMIIATDESFREEKNIARRYNRHRAFDEEIQANKDRLCQAIDYAMQIVEERPQLADMIYPQIDSLNQQWEELEQTTFLKGEKMIEANREAIFEEGTMDVMTWLXXXXXXXXXXXXXXXXXXXXXXKLKKVEEADNEMEIKRKQIQDLKMHAAKLKEEQPEKAFG--IEQKHLILEHRFTQLQMPXXXXXXXXXXXXXXXXFLRNLDDQKAWVDDKLLLAESTNFGNNLLTVQQLLRRHRYLATEVNNHKPQLEYLKEEGAVLIEEVSPMQREKFVAGLQELESLWNRLEHSIDLRQQRLKESEATQTFLFDAEEAESWLWEQELFLLSEERGIRDQEAAINVIKKHDARQKTIEDYGEEITKLGTRSRLLIEKDHPQADRIALAQSHVDKVYAGLRDLCLEKKQRLSEIQKLNHLYREIVDLENWIYERTLVASSHDLGVDFEHCCLLRERFDEFFHETHLLGKDRVKAANDLCASLISQCHADSAEIAQWHDRINDSWAELQELMQTRIQLLRTAWEFYKYLSSCQDVLDRICEKIASIPTDVSKDSQSVAIQQRKHATFLSDAQALEGQVQWVVDEANHLLPSYAGQKEWHICERRDDVLATWNQLNMQAERRRHQLEDAADLQRFFSMVRELLQWMDLVALQINEKTRPKDVSGVELLINDHRSIKAEIAAREESMSICVNLGRTLLHRGRVGVDEVRAALINLITRKYSLEDMWEERWDYLQLILEVYQFARDASVAEAWILAQEPYLANKTLGETLDETLSLLKKHINFEKTVMSQEERFEALEKLTTMEIRAKEITKESILLKDKHKQERIENAIKIFQPPPSPELVHESPK-----VSISEEDEEGKSHQHKISVISKEAAEMCQSSETKTDIRGILIRKHEWEYKNRKALNRSWHEFLVVLSIEKNKLLVYKDEKHYNEKPQDTYHKDSGLDLNDLVAAPASDYLKRPFVFRIKITSTGAEYLFQAKDEEDMLRWVNSINENSQKDLKSETTAPGKSSTLPACT 6951
            +L+ER RIKALA ERE VQKKTFTKW+NSHL ++   I DLY D++DGK L+ LLE+LSGE+LP PTKGKMRIHCLENVDK+L FL EQRVHLEN+G+HDIVDGNA L LGLIWTIILRFQIQDI +EE D  E + AKDALLLWCQMKTAGY N NVRNF+T WRDGLAFNAIIH+HRPDL+++  LS++N   NL  A  +AE+KLG+ +LLD EDV VE+PDEKSI+TYVVT+YH+FSK+K ++V  KR+GK++  +ME ++M+  Y+  TS+LL+WI  TI+ L +R F NSL+GVQ QLA F+ YR  EKPPKF EKGNLE+LLF++QS+MRANNQ PY P EGK+ISDIN AW +L+KAEH RELALR+ELIRQEKLEQLA RFDRKA MRE WL+ENQRL++QDNFG DL+AVEAA KKHEAI+TDI AYEERV +V  V  ELE+E YHDV+R+L R+DNV+RLW  LL++L  R++RL+   ++Q+ FQ++ ++LD + ++K  L T+D G+HLMGVEDL+ KHSL+E DI ++G +++ ++ ++Q F++ +       ++P DP  ++ R   L++ Y  L+ L+  R+  L  S+ +W+F W  ADEE W+KEK Q++   ++GHDL++V+ ++SKHK +E ++ +H   LQNV + G +LI + + GA+++ D LKE+   W+ L++LT+ RR +LE ++ YF   AD  +V+ W+++ +++V  ++   +E ++ + + KH+ ++  +++Y   I++L +Q + L   + E   +++++  I ++Y  L EL   ++ +L D LSL++++ +AD V+ WI EK K+L ++ P  ++E++E+ +HRF+GF+KEMN  A +V  VN LA +L  ++HP   +++ ++  LN+ W++L +  EA+ + L++++    + +EC++T  WI +K R++  TD L  DL G+M LQRR+ GM RD+ AI+AKL  L+ E +++  + P + ++IRE    +E  W +L  ML +RD +L E+ +L RFL+DLDH   WL+K QT VASED P  L +AEK L QH+ ++EEID+Y +++  +++YG R+T + +   D QYMFL +RLNAL++GW+EL QMWENRQ LLSQSL  Q+F RDA Q+EVLL+Q+E+FLSK+D P+++E ++N L++HE FLTT++AN D    +++    LVE+ HF +DKI  R ++I  RR+ N++R+ + +EKLK+QV   E  QD+++L++W+QEK   + DES+R  K I  ++ RH+AF+ EI ANK+RL +A   A ++ +E+P+  D+I P++  L +Q+++LE  T  KG  + +ANRE + ++   D+ +++  + + I+  +   +  +   + ++K +    +M +K +Q++++      L++  PE+     + +K  +LE RF +++ P+  ++  L ++K   QF R+++D+K W+D+KL +A S ++GN+L  V  L ++++ LATE++NH+P++  +   G  LI+E      +KF A + +L   W  L+ +I+ R++ L ESE  Q + FDA+EAESW+ EQEL+++ E+RG +D+ +A N++KKH+  ++++EDY   I +LG  +R     D    D +A+ QS +DK+YAGL+DL  E++ RL+E  +L  L RE+ DLE WI +R +VA S +LG DF+H  LL ERF+EF  +T  +G +RV   N +  +LI   H+DSA IA+W D +N+SW +L EL++TR Q+L  + E +K+   C+DVL RI EK   +  ++ +D+ SV+  QRKH  FL D   L  QVQ + +E+  L  +YAG K   I  R  +VL  W+ L    + R+ +L D  DL RFF+MVR L+ WM+ +  Q+N   +P+DVSGVELL+N+H+S+KAEI  RE++   C++LG+ LL R      +++  L+ L   + +L   WEERW+ LQLILEVYQFARDA+VAEAW++AQEPYL +  LG T+DE  +L+KKH  FEK+  +QEERF ALE+LTT E+  KE+ +   L ++  +Q   E          + +   E+ +     V  S +D   K    +   + +   E   +        G + RKHEW+   +KA NRSW +  V ++ +  ++  YKD+K Y   P+ T+  +   DL +     ASDY K+  V R+K+ + GA +L QA D+ +M +WV S+   S     S   A  +S TLPA +
Sbjct:   34 RLFERSRIKALAEERESVQKKTFTKWVNSHLCRVNCRIADLYVDMRDGKHLIKLLEVLSGERLPKPTKGKMRIHCLENVDKALQFLREQRVHLENIGSHDIVDGNASLNLGLIWTIILRFQIQDITIEEVDNKETKSAKDALLLWCQMKTAGYHNVNVRNFTTSWRDGLAFNAIIHKHRPDLVQFEKLSKTNAIHNLNNAFDVAEDKLGLAKLLDAEDVFVEHPDEKSIITYVVTYYHYFSKLKQETVQGKRIGKVVGIAMENDKMVHDYENFTSDLLKWIETTIQSLGEREFENSLAGVQGQLAQFSNYRTIEKPPKFVEKGNLEVLLFTLQSKMRANNQKPYTPKEGKMISDINKAWERLEKAEHERELALREELIRQEKLEQLAARFDRKASMRETWLSENQRLVSQDNFGFDLAAVEAAAKKHEAIETDIFAYEERVQAVVAVCDELESERYHDVKRILLRKDNVMRLWTYLLELLRARRMRLEISLQLQQNFQEMLYILDNMEEIKQLLMTDDYGKHLMGVEDLLQKHSLVEADINILGERVKVVVQNSQKFLSDD----PESYKPCDPEIIVSRVQQLEDAYAELVRLAVERRSRLEESRKLWQFYWDTADEENWIKEKEQIVSTDEVGHDLTTVNLMLSKHKALESEITSHDPQLQNVAKVGSELITEGHFGADRIKDRLKEILNKWDHLLDLTKYRRQRLENAVEYFQLFADADDVDNWMLDTLRIVSSEDVGRDEANVQSLLKKHKDVADELKNYAEVIDALHKQAESLKLNEAEKANVDKRLEAIDNRYKELTELAKLRKQRLLDALSLYKLMSEADGVEQWIKEKTKMLDTMTPGKDIEDVEIMKHRFEGFDKEMNANASRVAVVNQLARQLLHVEHPNSDEILERQNHLNQEWSTLREKAEAKMDDLKSAHGVQTFYIECRETISWIEDKKRILTETDSLEMDLTGVMTLQRRLSGMDRDLAAIQAKLSSLEREANSIEDEHPEEAKIIRERIAQIELIWEQLTQMLKERDSKLEEAGDLHRFLRDLDHFQTWLTKTQTDVASEDTPTSLPEAEKLLNQHQSIREEIDNYTEDYKNMMEYGERLTSEGSTSDDPQYMFLRERLNALKDGWEELHQMWENRQVLLSQSLDQQLFNRDARQTEVLLSQQEHFLSKDDTPVNLEQAENQLKRHEAFLTTMEANDDKINTLLQVADTLVEKDHFDADKIGKRAENITGRRDDNRQRALDQHEKLKNQVKLHEFLQDLEELAEWVQEKYATSQDESYRSAKTIHSKWTRHQAFEAEIAANKERLFEAEKSAQELSKEKPEFKDVIEPKLKELAKQFDDLEVHTKEKGAMLFDANREVLVQQTCDDIDSYITDLEKQIVSGDTANDLTSVNIL-MQKQQVIQTQMAVKARQVEEIDKQTEYLQKTVPEEKIEPIVVKKTAVLE-RFEKIKAPLLERQKALEKKKEAFQFCRDVEDEKLWIDEKLPVANSPDYGNSLFNVHVLKKKNQSLATEIDNHEPRINAICNNGRKLIDE-GHEDAKKFEALISDLTQKWQELKDAIENRRKHLLESEKVQQYFFDAQEAESWMSEQELYMMVEDRG-KDEISAQNLMKKHENLEQSVEDYANTIRQLGEVARQFSGDDISSGDAVAVKQSQLDKLYAGLKDLAGERRARLNEALQLFMLSREVDDLEQWITDREVVAGSQELGQDFDHVTLLSERFNEFARDTEAVGGERVAKVNGIADNLIQAGHSDSATIAEWKDNLNESWQDLLELIETRTQMLAASRELHKFFHDCKDVLGRILEKQHGVSDELGRDAGSVSTLQRKHYNFLQDLITLYSQVQQIQEESAKLQDAYAGDKAKEITNREQEVLHAWDNLQAMCDARKQKLADTGDLFRFFNMVRILMIWMEDLVRQMNTSEKPRDVSGVELLMNNHQSLKAEIDTREDNFGACISLGKELLTRNHYASADIKDRLMTLSNSRNALLRRWEERWENLQLILEVYQFARDAAVAEAWLIAQEPYLLSSELGHTIDEVENLIKKHEAFEKSAAAQEERFSALERLTTFEL--KEMKRRQELAEEAERQRIKEEQEAKAASEAAEQAKREAERRDDVDVGASHDDSAAKDTAVEFERVVEIQTERGGTPGAGEGHEGYVTRKHEWDSTTKKASNRSWDK--VYMAAKAGRISFYKDQKGYKSNPELTFRGEPSYDLQNAAIEIASDYTKKKHVLRVKL-ANGALFLLQAHDDTEMSQWVTSLKAQSD----STAVAASRSQTLPATS 2292          
BLAST of Spectrin beta chain vs. Ensembl Fly
Match: beta-Spec (gene:FBgn0250788 transcript:FBtr0074454)

HSP 1 Score: 1908.65 bits (4943), Expect = 0.000e+0
Identity = 1023/2271 (45.05%), Postives = 1541/2271 (67.86%), Query Frame = 1
Query:  154 KLYERFRIKALAGEREKVQKKTFTKWINSHLNKLKQSIDDLYNXXXXXXXXXXXXXXXXXXXXPYPTKGKMRIHCLENVDKSLNFLIEQRVHLENMGAHDIVDGNARLTLGLIWTIILRFQIQDIVVEEDDTSEKRQAKDALLLWCQMKTAGYPNTNVRNFSTCWRDGLAFNAIIHRHRPDLLEYSALSRSNPNENLEQAIRIAEEKLGIPRLLDPEDVSVENPDEKSIMTYVVTFYHFFSKMKADSVHSKRVGKILSQSMETEEMMVHYDKLTSNLLEWINQTIELLNDRTFANSLSGVQQQLAAFNTYRVTEKPPKFQEKGNLEMLLFSIQSQMRANNQMPYLPIEGKLISDINNAWNKLDKAEHARELALRDELIRQEKLEQLALRFDRKAGMREAWLTENQRLITQDNFGQDLSAVEAAGKKHEAIKTDILAYEERVNSVTLVTSELENECYHDVERVLCRRDNVIRLWEKLLDMLAVRKLRLDACYKVQKLFQDIKHLLDLINDLKARLKTEDIGRHLMGVEDLIHKHSLLEIDIRMVGTKIEGIMSDAQPFINSEFGLGSGDFQPADPNEVILRTVNLKEEYDNLLELSRNRKDNLSASKVMWEFLWGVADEEQWMKEKIQLMLNPDLGHDLSSVHRLISKHKVIEEDVRNHSNYLQNVIQGGQQLILDKNPGAEKVADXXXXXXXXXXXXXXXXXXRRSKLEQSLAYFHCLADCGEVEIWIIEQVKLVKIDETSINEESIITDIHKHEQLSKSIEDYESNINSLDEQVKKLSEGDLELVTIEEKVSNIKSQYAILIELTNQKQNKLTDTLSLFRVLRKADTVKTWIDEKEKLLMSLIPTDELEELEVFRHRFDGFEKEMNIQADQVEFVNTLAEKLSDMDHPQIADVVNKRFELNKLWNSLADLVEARREQLQTSYEFNQYLLECKQTGEWIREKSRLVESTDELGDDLAGIMQLQRRMGGMQRDMDAIRAKLEHLDEEMDTLIAKRPNXXXXXXXXXXXXXXFWAELGDMLADRDDRLSESSELQRFLQDLDHIHIWLSKMQTTVASEDLPKDLADAEKSLVQHEQLKEEIDSYQDEFIRLLDYGRRITEDKT---DAQYMFLSQRLNALEEGWQELCQMWENRXXXXXXXXXXXVFLRDAIQSEVLLAQEENFLSKEDIPISIENSQNLLRKHEGFLTTLQANHDHTIAVIEFGRNLVERGHFCSDKINLRVKSILXXXXXXXXXXXXAYEKLKDQVLYQELSQDIDDLSKWIQEKMIIATDESFREEKNIARRYNRHRAFDEEIQANKDRLCQAIDYAMQIVEERPQLADMIYPQIDSLNQQWEELEQTTFLKGEKMIEANREAIFEEGTMDVMTWLXXXXXXXXXXXXXXXXXXXXXXKLKKVEEADNEMEIKRKQIQDLKMHAAKLKEEQPEKAFG--IEQKHLILEHRFTQLQMPXXXXXXXXXXXXXXXXFLRNLDDQKAWVDDKLLLAESTNFGNNLLTVQQLLRRHRYLATEVNNHKPQLEYLKEEGAVLIEEVSPMQREKFVAGLQELESLWNRLEHSIDLRQQRLKESEATQTFLFDAEEAESWLWEQELFLLSEERGIRDQEAAINVIKKHDARQKTIEDYGEEITKLGTRSRLLIEKDHPQADRIALAQSHVDKVYAGLRDLCLEKKQRLSEIQKLNHLYREIVDLENWIYERTLVASSHDLGVDFEHCCLLRERFDEFFHETHLLGKDRVKAANDLCASLISQCHADSAEIAQWHDRINDSWAELQELMQTRIQLLRTAWEFYKYLSSCQDVLDRICEKIASIPTDVSKDSQSVAIQQRKHATFLSDAQALEGQVQWVVDEANHLLPSYAGQKEWHICERRDDVLATWNQLNMQAERRRHQLEDAADLQRFFSMVRELLQWMDLVALQINEKTRPKDVSGVELLINDHRSIKAEIAAREESMSICVNLGRTLLHRGRVGVDEVRAALINLITRKYSLEDMWEERWDYLQLILEVYQFARDASVAEAWILAQEPYLANKTLGETLDETLSLLKKHINFEKTVMSQEERFEALEKLTTMEIRAKEITKESILLKDKHKQERIENAIKIFQPPPSPELVHESPKVSISEEDEEGKSHQHKISVISKEAAEMCQSSETKTDIRGILIRKHEWEYKNRKALNRSWHEFLVVLSIEKNKLLVYKDEKHYNEKPQDTYHKDSGLDLNDLVAAPASDYLKRPFVFRIKITSTGAEYLFQAKDEEDMLRWVNSINENSQKDLKSETTAPGKSSTLPACT 6951
            +L+ER RIKALA ERE VQKKTFTKW+NSHL ++   I DLY D++DGK L+ LLE+LSGE+LP PTKGKMRIHCLENVDK+L FL EQRVHLEN+G+HDIVDGNA L LGLIWTIILRFQIQDI +EE D  E + AKDALLLWCQMKTAGY N NVRNF+T WRDGLAFNAIIH+HRPDL+++  LS++N   NL  A  +AE+KLG+ +LLD EDV VE+PDEKSI+TYVVT+YH+FSK+K ++V  KR+GK++  +ME ++M+  Y+  TS+LL+WI  TI+ L +R F NSL+GVQ QLA F+ YR  EKPPKF EKGNLE+LLF++QS+MRANNQ PY P EGK+ISDIN AW +L+KAEH RELALR+ELIRQEKLEQLA RFDRKA MRE WL+ENQRL++QDNFG DL+AVEAA KKHEAI+TDI AYEERV +V  V  ELE+E YHDV+R+L R+DNV+RLW  LL++L  R++RL+   ++Q+ FQ++ ++LD + ++K  L T+D G+HLMGVEDL+ KHSL+E DI ++G +++ ++ ++Q F++ +       ++P DP  ++ R   L++ Y  L+ L+  R+  L  S+ +W+F W  ADEE W+KEK Q++   ++GHDL++V+ ++SKHK +E ++ +H   LQNV + G +LI + + GA+++ D LKE+   W+ L++LT+ RR +LE ++ YF   AD  +V+ W+++ +++V  ++   +E ++ + + KH+ ++  +++Y   I++L +Q + L   + E   +++++  I ++Y  L EL   ++ +L D LSL++++ +AD V+ WI EK K+L ++ P  ++E++E+ +HRF+GF+KEMN  A +V  VN LA +L  ++HP   +++ ++  LN+ W++L +  EA+ + L++++    + +EC++T  WI +K R++  TD L  DL G+M LQRR+ GM RD+ AI+AKL  L+ E +++  + P + ++IRE    +E  W +L  ML +RD +L E+ +L RFL+DLDH   WL+K QT VASED P  L +AEK L QH+ ++EEID+Y +++  +++YG R+T + +   D QYMFL +RLNAL++GW+EL QMWENRQ LLSQSL  Q+F RDA Q+EVLL+Q+E+FLSK+D P+++E ++N L++HE FLTT++AN D    +++    LVE+ HF +DKI  R ++I  RR+ N++R+ + +EKLK+QV   E  QD+++L++W+QEK   + DES+R  K I  ++ RH+AF+ EI ANK+RL +A   A ++ +E+P+  D+I P++  L +Q+++LE  T  KG  + +ANRE + ++   D+ +++  + + I+  +   +  +   + ++K +    +M +K +Q++++      L++  PE+     + +K  +LE RF +++ P+  ++  L ++K   QF R+++D+K W+D+KL +A S ++GN+L  V  L ++++ LATE++NH+P++  +   G  LI+E      +KF A + +L   W  L+ +I+ R++ L ESE  Q + FDA+EAESW+ EQEL+++ E+RG +D+ +A N++KKH+  ++++EDY   I +LG  +R     D    D +A+ QS +DK+YAGL+DL  E++ RL+E  +L  L RE+ DLE WI +R +VA S +LG DF+H  LL ERF+EF  +T  +G +RV   N +  +LI   H+DSA IA+W D +N+SW +L EL++TR Q+L  + E +K+   C+DVL RI EK   +  ++ +D+ SV+  QRKH  FL D   L  QVQ + +E+  L  +YAG K   I  R  +VL  W+ L    + R+ +L D  DL RFF+MVR L+ WM+ +  Q+N   +P+DVSGVELL+N+H+S+KAEI  RE++   C++LG+ LL R      +++  L+ L   + +L   WEERW+ LQLILEVYQFARDA+VAEAW++AQEPYL +  LG T+DE  +L+KKH  FEK+  +QEERF ALE+LTT E+  KE+ +   L ++  +Q   E          + +   E+ +    ++ + G SH       +  A E  +         G + RKHEW+   +KA NRSW +  V ++ +  ++  YKD+K Y   P+ T+  +   DL +     ASDY K+  V R+K+ + GA +L QA D+ +M +WV S+   S     S   A  +S TLPA +
Sbjct:   34 RLFERSRIKALAEERESVQKKTFTKWVNSHLCRVNCRIADLYVDMRDGKHLIKLLEVLSGERLPKPTKGKMRIHCLENVDKALQFLREQRVHLENIGSHDIVDGNASLNLGLIWTIILRFQIQDITIEEVDNKETKSAKDALLLWCQMKTAGYHNVNVRNFTTSWRDGLAFNAIIHKHRPDLVQFEKLSKTNAIHNLNNAFDVAEDKLGLAKLLDAEDVFVEHPDEKSIITYVVTYYHYFSKLKQETVQGKRIGKVVGIAMENDKMVHDYENFTSDLLKWIETTIQSLGEREFENSLAGVQGQLAQFSNYRTIEKPPKFVEKGNLEVLLFTLQSKMRANNQKPYTPKEGKMISDINKAWERLEKAEHERELALREELIRQEKLEQLAARFDRKASMRETWLSENQRLVSQDNFGFDLAAVEAAAKKHEAIETDIFAYEERVQAVVAVCDELESERYHDVKRILLRKDNVMRLWTYLLELLRARRMRLEISLQLQQNFQEMLYILDNMEEIKQLLMTDDYGKHLMGVEDLLQKHSLVEADINILGERVKVVVQNSQKFLSDD----PESYKPCDPEIIVSRVQQLEDAYAELVRLAVERRSRLEESRKLWQFYWDTADEENWIKEKEQIVSTDEVGHDLTTVNLMLSKHKALESEITSHDPQLQNVAKVGSELITEGHFGADRIKDRLKEILNKWDHLLDLTKYRRQRLENAVEYFQLFADADDVDNWMLDTLRIVSSEDVGRDEANVQSLLKKHKDVADELKNYAEVIDALHKQAESLKLNEAEKANVDKRLEAIDNRYKELTELAKLRKQRLLDALSLYKLMSEADGVEQWIKEKTKMLDTMTPGKDIEDVEIMKHRFEGFDKEMNANASRVAVVNQLARQLLHVEHPNSDEILERQNHLNQEWSTLREKAEAKMDDLKSAHGVQTFYIECRETISWIEDKKRILTETDSLEMDLTGVMTLQRRLSGMDRDLAAIQAKLSSLEREANSIEDEHPEEAKIIRERIAQIELIWEQLTQMLKERDSKLEEAGDLHRFLRDLDHFQTWLTKTQTDVASEDTPTSLPEAEKLLNQHQSIREEIDNYTEDYKNMMEYGERLTSEGSTSDDPQYMFLRERLNALKDGWEELHQMWENRQVLLSQSLDQQLFNRDARQTEVLLSQQEHFLSKDDTPVNLEQAENQLKRHEAFLTTMEANDDKINTLLQVADTLVEKDHFDADKIGKRAENITGRRDDNRQRALDQHEKLKNQVKLHEFLQDLEELAEWVQEKYATSQDESYRSAKTIHSKWTRHQAFEAEIAANKERLFEAEKSAQELSKEKPEFKDVIEPKLKELAKQFDDLEVHTKEKGAMLFDANREVLVQQTCDDIDSYITDLEKQIVSGDTANDLTSVNIL-MQKQQVIQTQMAVKARQVEEIDKQTEYLQKTVPEEKIEPIVVKKTAVLE-RFEKIKAPLLERQKALEKKKEAFQFCRDVEDEKLWIDEKLPVANSPDYGNSLFNVHVLKKKNQSLATEIDNHEPRINAICNNGRKLIDE-GHEDAKKFEALISDLTQKWQELKDAIENRRKHLLESEKVQQYFFDAQEAESWMSEQELYMMVEDRG-KDEISAQNLMKKHENLEQSVEDYANTIRQLGEVARQFSGDDISSGDAVAVKQSQLDKLYAGLKDLAGERRARLNEALQLFMLSREVDDLEQWITDREVVAGSQELGQDFDHVTLLSERFNEFARDTEAVGGERVAKVNGIADNLIQAGHSDSATIAEWKDNLNESWQDLLELIETRTQMLAASRELHKFFHDCKDVLGRILEKQHGVSDELGRDAGSVSTLQRKHYNFLQDLITLYSQVQQIQEESAKLQDAYAGDKAKEITNREQEVLHAWDNLQAMCDARKQKLADTGDLFRFFNMVRILMIWMEDLVRQMNTSEKPRDVSGVELLMNNHQSLKAEIDTREDNFGACISLGKELLTRNHYASADIKDRLMTLSNSRNALLRRWEERWENLQLILEVYQFARDAAVAEAWLIAQEPYLLSSELGHTIDEVENLIKKHEAFEKSAAAQEERFSALERLTTFEL--KEMKRRQELAEEAERQRIKEEQEAKAASEAAEQAKREAER---RDDVDVGASHDDSERGGTPGAGEGHE---------GYVTRKHEWDSTTKKASNRSWDK--VYMAAKAGRISFYKDQKGYKSNPELTFRGEPSYDLQNAAIEIASDYTKKKHVLRVKL-ANGALFLLQAHDDTEMSQWVTSLKAQSD----STAVAASRSQTLPATS 2275          
BLAST of Spectrin beta chain vs. Ensembl Fly
Match: beta-Spec (gene:FBgn0250788 transcript:FBtr0334405)

HSP 1 Score: 1842.4 bits (4771), Expect = 0.000e+0
Identity = 964/2061 (46.77%), Postives = 1444/2061 (70.06%), Query Frame = 1
Query:  154 KLYERFRIKALAGEREKVQKKTFTKWINSHLNKLKQSIDDLYNXXXXXXXXXXXXXXXXXXXXPYPTKGKMRIHCLENVDKSLNFLIEQRVHLENMGAHDIVDGNARLTLGLIWTIILRFQIQDIVVEEDDTSEKRQAKDALLLWCQMKTAGYPNTNVRNFSTCWRDGLAFNAIIHRHRPDLLEYSALSRSNPNENLEQAIRIAEEKLGIPRLLDPEDVSVENPDEKSIMTYVVTFYHFFSKMKADSVHSKRVGKILSQSMETEEMMVHYDKLTSNLLEWINQTIELLNDRTFANSLSGVQQQLAAFNTYRVTEKPPKFQEKGNLEMLLFSIQSQMRANNQMPYLPIEGKLISDINNAWNKLDKAEHARELALRDELIRQEKLEQLALRFDRKAGMREAWLTENQRLITQDNFGQDLSAVEAAGKKHEAIKTDILAYEERVNSVTLVTSELENECYHDVERVLCRRDNVIRLWEKLLDMLAVRKLRLDACYKVQKLFQDIKHLLDLINDLKARLKTEDIGRHLMGVEDLIHKHSLLEIDIRMVGTKIEGIMSDAQPFINSEFGLGSGDFQPADPNEVILRTVNLKEEYDNLLELSRNRKDNLSASKVMWEFLWGVADEEQWMKEKIQLMLNPDLGHDLSSVHRLISKHKVIEEDVRNHSNYLQNVIQGGQQLILDKNPGAEKVADXXXXXXXXXXXXXXXXXXRRSKLEQSLAYFHCLADCGEVEIWIIEQVKLVKIDETSINEESIITDIHKHEQLSKSIEDYESNINSLDEQVKKLSEGDLELVTIEEKVSNIKSQYAILIELTNQKQNKLTDTLSLFRVLRKADTVKTWIDEKEKLLMSLIPTDELEELEVFRHRFDGFEKEMNIQADQVEFVNTLAEKLSDMDHPQIADVVNKRFELNKLWNSLADLVEARREQLQTSYEFNQYLLECKQTGEWIREKSRLVESTDELGDDLAGIMQLQRRMGGMQRDMDAIRAKLEHLDEEMDTLIAKRPNXXXXXXXXXXXXXXFWAELGDMLADRDDRLSESSELQRFLQDLDHIHIWLSKMQTTVASEDLPKDLADAEKSLVQHEQLKEEIDSYQDEFIRLLDYGRRITEDKT---DAQYMFLSQRLNALEEGWQELCQMWENRXXXXXXXXXXXVFLRDAIQSEVLLAQEENFLSKEDIPISIENSQNLLRKHEGFLTTLQANHDHTIAVIEFGRNLVERGHFCSDKINLRVKSILXXXXXXXXXXXXAYEKLKDQVLYQELSQDIDDLSKWIQEKMIIATDESFREEKNIARRYNRHRAFDEEIQANKDRLCQAIDYAMQIVEERPQLADMIYPQIDSLNQQWEELEQTTFLKGEKMIEANREAIFEEGTMDVMTWLXXXXXXXXXXXXXXXXXXXXXXKLKKVEEADNEMEIKRKQIQDLKMHAAKLKEEQPEKAFG--IEQKHLILEHRFTQLQMPXXXXXXXXXXXXXXXXFLRNLDDQKAWVDDKLLLAESTNFGNNLLTVQQLLRRHRYLATEVNNHKPQLEYLKEEGAVLIEEVSPMQREKFVAGLQELESLWNRLEHSIDLRQQRLKESEATQTFLFDAEEAESWLWEQELFLLSEERGIRDQEAAINVIKKHDARQKTIEDYGEEITKLGTRSRLLIEKDHPQADRIALAQSHVDKVYAGLRDLCLEKKQRLSEIQKLNHLYREIVDLENWIYERTLVASSHDLGVDFEHCCLLRERFDEFFHETHLLGKDRVKAANDLCASLISQCHADSAEIAQWHDRINDSWAELQELMQTRIQLLRTAWEFYKYLSSCQDVLDRICEKIASIPTDVSKDSQSVAIQQRKHATFLSDAQALEGQVQWVVDEANHLLPSYAGQKEWHICERRDDVLATWNQLNMQAERRRHQLEDAADLQRFFSMVRELLQWMDLVALQINEKTRPKDVSGVELLINDHRSIKAEIAAREESMSICVNLGRTLLHRGRVGVDEVRAALINLITRKYSLEDMWEERWDYLQLILEVYQFARDASVAEAWILAQEPYLANKTLGETLDETLSLLKKHINFEKTVMSQEERFEALEKLTTMEIR 6321
            +L+ER RIKALA ERE VQKKTFTKW+NSHL ++   I DLY D++DGK L+ LLE+LSGE+LP PTKGKMRIHCLENVDK+L FL EQRVHLEN+G+HDIVDGNA L LGLIWTIILRFQIQDI +EE D  E + AKDALLLWCQMKTAGY N NVRNF+T WRDGLAFNAIIH+HRPDL+++  LS++N   NL  A  +AE+KLG+ +LLD EDV VE+PDEKSI+TYVVT+YH+FSK+K ++V  KR+GK++  +ME ++M+  Y+  TS+LL+WI  TI+ L +R F NSL+GVQ QLA F+ YR  EKPPKF EKGNLE+LLF++QS+MRANNQ PY P EGK+ISDIN AW +L+KAEH RELALR+ELIRQEKLEQLA RFDRKA MRE WL+ENQRL++QDNFG DL+AVEAA KKHEAI+TDI AYEERV +V  V  ELE+E YHDV+R+L R+DNV+RLW  LL++L  R++RL+   ++Q+ FQ++ ++LD + ++K  L T+D G+HLMGVEDL+ KHSL+E DI ++G +++ ++ ++Q F++ +       ++P DP  ++ R   L++ Y  L+ L+  R+  L  S+ +W+F W  ADEE W+KEK Q++   ++GHDL++V+ ++SKHK +E ++ +H   LQNV + G +LI + + GA+++ D LKE+   W+ L++LT+ RR +LE ++ YF   AD  +V+ W+++ +++V  ++   +E ++ + + KH+ ++  +++Y   I++L +Q + L   + E   +++++  I ++Y  L EL   ++ +L D LSL++++ +AD V+ WI EK K+L ++ P  ++E++E+ +HRF+GF+KEMN  A +V  VN LA +L  ++HP   +++ ++  LN+ W++L +  EA+ + L++++    + +EC++T  WI +K R++  TD L  DL G+M LQRR+ GM RD+ AI+AKL  L+ E +++  + P + ++IRE    +E  W +L  ML +RD +L E+ +L RFL+DLDH   WL+K QT VASED P  L +AEK L QH+ ++EEID+Y +++  +++YG R+T + +   D QYMFL +RLNAL++GW+EL QMWENRQ LLSQSL  Q+F RDA Q+EVLL+Q+E+FLSK+D P+++E ++N L++HE FLTT++AN D    +++    LVE+ HF +DKI  R ++I  RR+ N++R+ + +EKLK+QV   E  QD+++L++W+QEK   + DES+R  K I  ++ RH+AF+ EI ANK+RL +A   A ++ +E+P+  D+I P++  L +Q+++LE  T  KG  + +ANRE + ++   D+ +++  + + I+  +   +  +   + ++K +    +M +K +Q++++      L++  PE+     + +K  +LE RF +++ P+  ++  L ++K   QF R+++D+K W+D+KL +A S ++GN+L  V  L ++++ LATE++NH+P++  +   G  LI+E      +KF A + +L   W  L+ +I+ R++ L ESE  Q + FDA+EAESW+ EQEL+++ E+RG +D+ +A N++KKH+  ++++EDY   I +LG  +R     D    D +A+ QS +DK+YAGL+DL  E++ RL+E  +L  L RE+ DLE WI +R +VA S +LG DF+H  LL ERF+EF  +T  +G +RV   N +  +LI   H+DSA IA+W D +N+SW +L EL++TR Q+L  + E +K+   C+DVL RI EK   +  ++ +D+ SV+  QRKH  FL D   L  QVQ + +E+  L  +YAG K   I  R  +VL  W+ L    + R+ +L D  DL RFF+MVR L+ WM+ +  Q+N   +P+DVSGVELL+N+H+S+KAEI  RE++   C++LG+ LL R      +++  L+ L   + +L   WEERW+ LQLILEVYQFARDA+VAEAW++AQEPYL +  LG T+DE  +L+KKH  FEK+  +QEERF ALE+LTT E++
Sbjct:   34 RLFERSRIKALAEERESVQKKTFTKWVNSHLCRVNCRIADLYVDMRDGKHLIKLLEVLSGERLPKPTKGKMRIHCLENVDKALQFLREQRVHLENIGSHDIVDGNASLNLGLIWTIILRFQIQDITIEEVDNKETKSAKDALLLWCQMKTAGYHNVNVRNFTTSWRDGLAFNAIIHKHRPDLVQFEKLSKTNAIHNLNNAFDVAEDKLGLAKLLDAEDVFVEHPDEKSIITYVVTYYHYFSKLKQETVQGKRIGKVVGIAMENDKMVHDYENFTSDLLKWIETTIQSLGEREFENSLAGVQGQLAQFSNYRTIEKPPKFVEKGNLEVLLFTLQSKMRANNQKPYTPKEGKMISDINKAWERLEKAEHERELALREELIRQEKLEQLAARFDRKASMRETWLSENQRLVSQDNFGFDLAAVEAAAKKHEAIETDIFAYEERVQAVVAVCDELESERYHDVKRILLRKDNVMRLWTYLLELLRARRMRLEISLQLQQNFQEMLYILDNMEEIKQLLMTDDYGKHLMGVEDLLQKHSLVEADINILGERVKVVVQNSQKFLSDD----PESYKPCDPEIIVSRVQQLEDAYAELVRLAVERRSRLEESRKLWQFYWDTADEENWIKEKEQIVSTDEVGHDLTTVNLMLSKHKALESEITSHDPQLQNVAKVGSELITEGHFGADRIKDRLKEILNKWDHLLDLTKYRRQRLENAVEYFQLFADADDVDNWMLDTLRIVSSEDVGRDEANVQSLLKKHKDVADELKNYAEVIDALHKQAESLKLNEAEKANVDKRLEAIDNRYKELTELAKLRKQRLLDALSLYKLMSEADGVEQWIKEKTKMLDTMTPGKDIEDVEIMKHRFEGFDKEMNANASRVAVVNQLARQLLHVEHPNSDEILERQNHLNQEWSTLREKAEAKMDDLKSAHGVQTFYIECRETISWIEDKKRILTETDSLEMDLTGVMTLQRRLSGMDRDLAAIQAKLSSLEREANSIEDEHPEEAKIIRERIAQIELIWEQLTQMLKERDSKLEEAGDLHRFLRDLDHFQTWLTKTQTDVASEDTPTSLPEAEKLLNQHQSIREEIDNYTEDYKNMMEYGERLTSEGSTSDDPQYMFLRERLNALKDGWEELHQMWENRQVLLSQSLDQQLFNRDARQTEVLLSQQEHFLSKDDTPVNLEQAENQLKRHEAFLTTMEANDDKINTLLQVADTLVEKDHFDADKIGKRAENITGRRDDNRQRALDQHEKLKNQVKLHEFLQDLEELAEWVQEKYATSQDESYRSAKTIHSKWTRHQAFEAEIAANKERLFEAEKSAQELSKEKPEFKDVIEPKLKELAKQFDDLEVHTKEKGAMLFDANREVLVQQTCDDIDSYITDLEKQIVSGDTANDLTSVNIL-MQKQQVIQTQMAVKARQVEEIDKQTEYLQKTVPEEKIEPIVVKKTAVLE-RFEKIKAPLLERQKALEKKKEAFQFCRDVEDEKLWIDEKLPVANSPDYGNSLFNVHVLKKKNQSLATEIDNHEPRINAICNNGRKLIDE-GHEDAKKFEALISDLTQKWQELKDAIENRRKHLLESEKVQQYFFDAQEAESWMSEQELYMMVEDRG-KDEISAQNLMKKHENLEQSVEDYANTIRQLGEVARQFSGDDISSGDAVAVKQSQLDKLYAGLKDLAGERRARLNEALQLFMLSREVDDLEQWITDREVVAGSQELGQDFDHVTLLSERFNEFARDTEAVGGERVAKVNGIADNLIQAGHSDSATIAEWKDNLNESWQDLLELIETRTQMLAASRELHKFFHDCKDVLGRILEKQHGVSDELGRDAGSVSTLQRKHYNFLQDLITLYSQVQQIQEESAKLQDAYAGDKAKEITNREQEVLHAWDNLQAMCDARKQKLADTGDLFRFFNMVRILMIWMEDLVRQMNTSEKPRDVSGVELLMNNHQSLKAEIDTREDNFGACISLGKELLTRNHYASADIKDRLMTLSNSRNALLRRWEERWENLQLILEVYQFARDAAVAEAWLIAQEPYLLSSELGHTIDEVENLIKKHEAFEKSAAAQEERFSALERLTTFELK 2086          

HSP 2 Score: 58.5362 bits (140), Expect = 1.034e-7
Identity = 76/301 (25.25%), Postives = 130/301 (43.19%), Query Frame = 1
Query: 5569 DSQSVAIQQRKHATFLSDAQALEGQVQWVVDEANHLLPS-YAGQKEWHICERRDDVLATWNQLNMQAERRRHQLEDAADLQRFFSMVRELLQWMDLVALQINEKTRPKDVSGVELLINDHRSIKAEIAAREESMSICVNLGRTLLHRGRVGVDEVRAALINLITRKYSLEDMWEE-------RWDYLQLILEVYQFARDASVAEAWILAQEPYLANKTLGETLDETLSLLKKHINFEKTVMSQEERFEALEKLTTMEI------------RAKEITK--ESILLKDKHKQERIENAIKIFQ 6405
            D  +V    +KH    +D  A E +VQ VV   + L    Y   K   I  R+D+V+  W  L      RR +LE +  LQ+ F  +  +L  M+ +   +      K + GVE L+  H  ++A+I    E + + V   +  L             +I  ++R   LED + E       R   L+   +++QF  D +  E WI  +E  ++   +G  L     +L KH   E  + S + + + + K+ +  I            R KEI    + +L   K++++R+ENA++ FQ
Sbjct:  449 DLAAVEAAAKKHEAIETDIFAYEERVQAVVAVCDELESERYHDVK--RILLRKDNVMRLWTYLLELLRARRMRLEISLQLQQNFQEMLYILDNMEEIKQLLMTDDYGKHLMGVEDLLQKHSLVEADINILGERVKVVVQNSQKFLSDDPESYKPCDPEII--VSRVQQLEDAYAELVRLAVERRSRLEESRKLWQFYWDTADEENWIKEKEQIVSTDEVGHDLTTVNLMLSKHKALESEITSHDPQLQNVAKVGSELITEGHFGADRIKDRLKEILNKWDHLLDLTKYRRQRLENAVEYFQ 745          
BLAST of Spectrin beta chain vs. Ensembl Fly
Match: kst (gene:FBgn0004167 transcript:FBtr0303857)

HSP 1 Score: 549.666 bits (1415), Expect = 1.059e-157
Identity = 332/801 (41.45%), Postives = 478/801 (59.68%), Query Frame = 1
Query:  160 YERFRIKALAGEREKVQKKTFTKWINSHLNKLKQSIDDLYNXXXXXXXXXXXXXXXXXXXXPYPTKGKMRIHCLENVDKSLNFLIEQRVHLENMGAHDIVDGNARLTLGLIWTIILRFQIQDI---VVEEDDTSEKRQAKDALLLWCQMKTAGYPNTNVRNFSTCWRDGLAFNAIIHRHRPDLLEYSALSRS-NPN-ENLEQAIRIAEEKLGIPRLLDPEDVSVENPDEKSIMTYVVTFYHFFSKMKADSVHSKRVGKILSQSMETEEMMVHYDKLTSNLLEWINQTIELLNDRTFANSLSGVQQQLAAFNTYRVTEKPPKFQEKGNLEMLLFSIQSQMRANNQMPYLPIEGKLISDINNAWNKLDKAEHARELALRDELIRQEKLEQLALRFDRKAGMREAWLTENQRLITQDNFGQDLSAVEAAGKKHEAIKTDILAYEERVNSVTLVTSELENECYHDVERVLCRRDNVIRLWEKLLDMLAVRKLRLDACYKVQKLFQDIKHLLDLINDLKARLKTEDIGRHLMGVEDLIHKHSLLEIDIRMVGTKIEGIMSDAQPFINSEFGLGSGDFQPADPNEVILRTVNLKEEYDNLLELSRNRKDNLSASKVMWEFLWGVADEEQWMKEKIQLMLNPDLGHDLSSVHRLISKHKVIEEDVRNHSNYLQNVIQGGQQLILDKNPGAEKVADXXXXXXXXXXXXXXXXXXRRSKLEQSLAYFHCLADCGEVEIWIIEQVKLVKIDETSINEESIITDIHKHEQLSKSIEDYESNINSLDEQVKKLSEGD---LELVTIEEKVSNI 2538
            +E  RIK L  ER  +QKKTFTKW+NS L K K  ++DL+ DL DG  LL LLEI+S E+L  P  G+MR+H +ENV+KSL FL   +V LE++GA DIVDGN RL LGLIWTIILRFQIQ+I   V EE+++SEKR AKDALLLWCQ KT GYP  N+ +F+  WR GL FNA+IH HRPDL EYS +  S N N +NL  A   A  +LGIP LLD ED+    PDEKSI+TYV ++YH F++MK +    KR+  I+ Q M+ +   + Y+ LT+NLL WI Q    L  R   NSL G+Q++L AF  YR  EKPPK++E+  +E L F+I + ++A NQ PY P +G+L++DI  AW  L+ AEH RE+ALRDEL+RQEKLEQL  +F++K+ +RE +L E  ++++   +   L  V+A  KKHEAI  DILA  ER N +T +  EL+ E YH  ERV  R   V+  W +LL++L  ++L L     +  L ++I    + + +L+ +  +ED+G HL+GVE+L+  HSL E+ +   G  ++     A P+ +SE           D   +  R  +L+E Y  LL  S  R+  L  ++    F+    +EE W+ +K ++        DL +V  L  KHK +E+++++       +   G++LI +++P + ++   +  L   W  L  L E RR +LE +   +    D  E E W+ E++ LV   +   +E S    + +H  L   +  Y  +I +L++Q  KL +     LEL   E ++  +
Sbjct:   10 FENERIKTLQEERLHIQKKTFTKWMNSFLIKAKMEVEDLFTDLADGIKLLKLLEIISSEKLGKPNSGRMRVHKIENVNKSLAFL-HTKVRLESIGAEDIVDGNPRLILGLIWTIILRFQIQEIEIDVDEENESSEKRSAKDALLLWCQRKTHGYPGVNITDFTNSWRSGLGFNALIHSHRPDLFEYSTIVNSKNSNLDNLNHAFDTAANELGIPSLLDAEDIDSARPDEKSILTYVASYYHTFARMKNEQKSGKRIANIVGQLMDADRKKMQYEGLTTNLLSWIRQKTLELEQRDLPNSLEGIQRELLAFKEYRTIEKPPKYKERSEIEALYFTINTLLKALNQPPYNPQDGQLVNDIEKAWQILEYAEHHREVALRDELLRQEKLEQLNYKFEKKSVLREGYLKEMIQVLSDPRY---LRQVDATLKKHEAISADILARVERFNDLTAMAEELDRENYHGKERVRRREQEVMAKWRQLLELLENQRLNLSQMSNLMNLLREIASTTEAVRELQQQFASEDVGPHLLGVEELLQAHSLQELQVNTYGETLKRFNRQALPYKSSEH---------KDAALLAQRLADLEEAYSELLRRSAARRARLEEARNFHHFMEDYDNEESWLVDKQRICKTGITAKDLRAVLSLQQKHKALEDEIKSRKPKSGQMSTAGKRLIGEQHPRSSEIQSRIDSLAEHWQALEALVELRRRQLEDAAEAYQFYTDANEAESWLNEKIALVNSRDYGNDEPSAQALLQRHRDLQGELNAYSGDILNLNQQADKLIKAGICTLELSAAEPELPEV 797          

HSP 2 Score: 419.853 bits (1078), Expect = 2.121e-117
Identity = 415/1654 (25.09%), Postives = 767/1654 (46.37%), Query Frame = 1
Query: 1390 FGQDLSAVEAAGKKHEAIKTDILAYEERVNSVTLVTSELENECYHDVERVLCRRDNVIRLWEKLLDMLAVRKLRLDACYKVQKLFQDIKHLLDLINDLKARLKTEDIGRHLMGVEDLIHKHSLL--EIDIRMVGTKIEGIMSDAQPFINSEFGLGSGDFQPADPNEVILRTVNLKEEYDNLLELSRNRKDNLSASKV-MWEFLWGVADEEQWMKEKIQLMLNPDLGHDLSSVHRLISKHKVIEEDVRNHSNYLQNVIQGGQQLILDKNPGAEKVADXXXXXXXXXXXXXXXXXXRRSKLEQSLAYFHCLADCGEVEIWIIEQVKLVKIDETS----INEESIITDIHKHEQLSKSIEDYESNINSL-DEQVKKLSEGDLELVTIEEKVSNIKSQYAILIELTNQKQNKLTDTLSLFRVLRKADTVKTWIDEKEKLLMSLIPTDELEELEVFRHRFDGFEKEMNIQADQVEFVNTLAEKLSDMDH-PQIADVVNKRF-ELNKLWNSLADLVEARREQLQTSYEFNQYLLECKQTGEWIREKSRLVESTDELGDDLAGIMQLQRRMGGMQRDMDAIRAKLEHLDEEMDTLIAKRPNXXXXXXXXXXXX-XXFWAELGDMLADRDDRLSESSELQRFLQDLDHIHIWLSKMQTTVASEDLPKDLADAEKSLVQHEQLKEEIDSYQDEFIRLLDYGRRITEDKTDAQYMFLSQRLNALEEGWQELCQMWENRXXXXXXXXXXXVFLRDAIQSEVLLAQEENFLSKEDIPISIENSQNLLRKHEGFLTTLQANHDHTIAVIEFGRNLVERGHFCSDKINLRVKSILXXXXXXXXXXXXAYEKLKDQVLYQELSQDIDDLSKWIQEKMIIATDESFREEKNIARRYNRHRAFDEEIQANKDRLCQAIDYAMQIVEERPQLADMIYPQIDSLNQQWEELEQTTFLKGEKMIEANREAIFEEGTMDVMTWLXXXXXXXXXXXXXXXXXXXXXXKLKKVEEADNEMEIKRKQIQDLKMHAAKLKEEQPEKAFGIEQKHLILEHRFTQLQMPXXXXXXXXXXXXXXXXFLRNLDDQKAWVDDKLLLAESTNFGNNLLTVQQLLRRHRYLATEVNNHKPQLEYLKEEGAVLIEEVSPMQREKFVAGLQELESLWNRLEHSIDLRQQRLKESEATQTFLFDAEEAESWLWEQELFLLSEERGIRDQEAAINVIKKHDARQKTIEDYGEEITKLGTRSRLLIEKDHPQADRIALAQSHVDKVYAGLRDLCLEKKQRLSEIQKLNHLYREIVDLENWIYERTLVASSHDLGVDFEHCCLLRERFDEFFHETHLLGKDRVKAANDLCASLISQCHADSAEIAQWHDRINDSWAELQELMQTRIQLLRTAWEFYKYLSSCQDVLDRICEKIAS-IPTDVSKDSQSVAIQQRKHATFLSDAQALEGQVQWVVDEANHLLPSYAGQKEWHICERRDDVLATWNQLNMQAERRRHQLEDAADLQRFFSMVRELLQWMDLVALQINEKTRPKDVSGVELLINDHRSIKAEIAAREESMSICVNLGRTLLHRGRVGVDEVRAALINLITRKYSLEDMWEERWDYLQLILEVYQFARDASVAEAWILAQEPYLANKTLGETLDETLSLLKKHINFEKTVMSQEERFEALEKLTTME 6315
             G+DL++  A  +KHE  + D++A E ++  +   +  L+ +   +   +  ++D V+  W  L +    R  RL A   +Q    D++ ++   ++L+A L+ E+      G   L  +H  +  EI+ R    +    +SD+         + +G +  AD  E     ++ +++    L  + N+K  +   K+ ++ FL      +     +   + + D G  +  V   I KH   E  ++     +  + + G++LI  ++  +  +   L+ +     ++ +L   RR KLE +L Y   + DC E + WI E+ K ++ D  S     N +  I  + KH+     +   +  I  + D  V  LS+       I+  +  +   +  L+    Q+   L +         + D ++ WI +KE ++ +     +LE       + D  + +M +   +V+ +N LA+KL +    P     V+KR  + N  W  L   + A R  L  + E + +  +   T + I EKS  + STD  G DLA +  L RR   ++RDM A++ K++  +   + LI K P       E ++      W  L  +   R   L+E+    +F+ D+  + +W++ M   + +   P  + D E  L  H++ K EI+  Q+ F  L   G ++++     Q   + + L  LEE  Q L + W  R   L+++  LQ+F     Q E+ LA +E FL+ +D+  S    + LL+KH+ F   L A+H  T+   +F  +++E     +D I  ++  IL R++     S E  ++L      QE  + + ++ +W+ +K+ +A DE++RE  N+  +  +H AFD E+ +N  R+   I    +++       D I  Q+  L   W +L+  +  K +K+ +A     F     +   W++ +   +   +   +     N+ LKK E  + ++    +    LK    +  + +      I ++  +   R+  L  P+  ++  L     +QQFLR+ +D+  W+ +K L+A S + G +LL+VQ L ++H  L  E+ + +P ++ L + G  +I + +    E+     + L+    +L     +R+ RL ++  +Q F  +A EA++W+ E+   L S + G RD+ +     KK +  Q+ +  +   I K+   +  LIE++H  +  IA   + V + Y  L  L  E++ RL E +KL    RE  +L  W+ ++  V +S D G D EH   L   F+ F    +   + RV+A  +    LI + +   + I    D     W EL++L+  R   L  A + + Y     + +  I EK AS I  D  +D +S+    RKH  F S+   ++GQV  V+ EA  L   Y   KE HI  +RD+ +  W  L  +   R+++L  A  LQ +F   R+L+ W++ +  +I        V+G ELL+   +    EI  R+E+ +     G+ L+        EV   +  L  R   L+    +R +  +L L+   F +DA + E WI ++EP L +  LG+++ +   LL++H +FEKTV +QEE+F+A++++T +E
Sbjct: 1952 LGRDLNSALALLRKHEGFENDLVALEAQLQVLVEDSVRLQAKYPSNASAIAQQQDKVVAAWNDLKERSTARGDRLAASSDLQTFLTDVRDIVSWSSNLRAALQAEEHVSDAAGATALKIQHDAIYGEIEAREDKFRYLNELSDSM--------VQTGHYAAADVEEKCAAMLDERQK----LHAAWNKKKIMLEQKIDLFCFLRDAKQIDNLSSSQQAALSSSDFGQTVEDVQNKIRKHDEFERLIQTQEEKVSLLQEHGRKLIEQRHYDSANIQTILQGVLARRQKVKDLCAVRRYKLEDALLYAKFVRDCAEAKYWINEKQKKLEADAASYAEVTNLDEKIKKLQKHQAFQAEVAANQGRIQEIQDTGVILLSKQHESSPEIKRAIEIVLEAWQGLLAELEQRGRGLEEAQDSLEFNSQLDKIEAWIRDKEMMVQASDTGRDLEHCNALMRKLDDVDSDMRVDDQRVKHINQLADKLINQAQVPADTQSVDKRRKDFNYNWRQLQGALNAYRALLGGANEIHVFNRDVDDTADRIAEKSLAMSSTD-TGRDLAAVEALIRREEALERDMSAVKQKIDQHETAAEFLIKKYPERGAQHIERKLEELHKSWGNLQALSVKRQSILNEAYLAHKFVSDVKELELWVNDMIKKMNNTQSPSTINDCETQLELHQERKVEIEGRQEAFAGLKQQGEQLSKRPQQQQPDNVRKYLLVLEELHQTLNEAWSERARDLTEAHQLQLFKAQVEQVEIWLANKEAFLNNDDLGDSYTAVERLLKKHDEFEKLLHADHVDTLQ--KFANSILEGEPKDADLIREKLAYILRRKQKLLELSEERKQRLTQSHQLQEFLRSLYEIDRWLVQKLQVALDENYREPSNLQSKIQKHAAFDAELLSNSPRVQSVIHEGERLIRGDHFAKDEIAQQVQLLEGDWLKLKGASQTKKDKLQQAYDALAFNRSVDEFNNWMDEVELQLSSEDYGKDLAAVSNL-LKKHERLEADVAHHGELADQLKQKDEQFFQAEHFLRHEIHERATVSIRRYNTLHEPLGIRRENLEDSLSLQQFLRDAEDELQWLAEKQLVAGSQDLGTSLLSVQGLQKKHNSLEAELTSQEPLIQALLQRGQQMIRD-NHFASEQLQYKSELLQKQLVQLRDLAAIRRLRLLDAVESQLFYVEANEADAWMREKRPVLSSSDYG-RDEVSVQGHQKKLEVLQRELTAFKPSIEKVAKLATGLIERNHFDSSNIAEKNAQVGQEYEDLLRLAKERESRLGECKKLFEYLRETEELHEWVGDQMAVTASEDYGEDVEHVEQLILAFESFVSNLNA-NEARVEACLERGDRLIQENNPYRSSIKSKRDETKQLWEELKDLVHARQDALAGAKQVHVYDRVADETIQLINEKDASLISEDYGQDLESIQALGRKHQVFESELVGIQGQVDSVLAEAAKLGEIYPDAKE-HIEVKRDETVEAWTDLKEKTAARKNKLSQAEQLQSYFDEYRDLIAWINEMLAKITAPELANSVAGAELLLASTKDHDTEIRTRDETFAKFAANGQQLIKEKHFLAHEVEDKIKVLQARHELLKHTLNKRREIYELNLDTQLFLKDAEILEQWISSREPQLKDTKLGDSIPQVEDLLRRHEDFEKTVAAQEEKFQAIKRITMLE 3585          

HSP 3 Score: 340.502 bits (872), Expect = 4.173e-93
Identity = 395/1713 (23.06%), Postives = 791/1713 (46.18%), Query Frame = 1
Query: 1267 ALRDELIRQEKLEQLALRFDRKAGMRE---AWLTENQRLITQDNFGQDLSAVEAAGKKHEAIKTDILAYEERVNSVTLVTSELENECYHDVERVLCRRDNVIRLWEKLLDMLAVRKLRLDACYKVQKLFQDIKHLLDLINDLKARLKTEDIGRHLMGVEDLIHKHSLLEIDIRMVGTKIEGIMSDAQPFINSEFGLGSGDFQPADPNEVILRTVNLKEEYDNLLELSRNRKDNLSASKVMWEFLWGVADEEQWMKEKIQLMLNPDLGHDLSSVHRLISKHKVIEEDVRNHSNYLQNVIQGGQQLILDKNPGAEKVADXXXXXXXXXXXXXXXXXXRRSKLEQSLAYFHCLADCGEVEIWIIEQVKLVKIDETSINEESIITDIHKHEQLSKSIEDYESNINSLDEQVKKL---SEGDLELVTIEEKVSNIKSQYAILIELTNQKQNKLTDTLSLFRVLRKADTVKTWIDEKEKLLMSLIPTDELEELEVFRHRFDGFEKEMNIQADQVEFVNTLAEKLSDMDHPQIADVVNKRFELNKLWNSLADLVEARREQLQTSYEFNQYLLECKQTGEWIREKSRLVESTDELGDDLAGIMQLQRRMGGMQRDMDAIRAKLEHLDEEMDTLIAKRPNXXXXXXXXXXXXXXFWAELGDMLADRDDRLSESSELQRFLQDLDHIHIWLSKMQTTVASEDLPKDLADAEKSLVQHEQLKEEIDSYQDEFIRLLDYGRRITEDKTDAQYMFLSQRLNALEEGWQELCQMWENRXXXXXXXXXXXVFLRDAIQSEVLLAQEENFLSKEDIPISIENSQNLLRKHEGFLTTLQANHDHTIAVIEFGRNLVERGHFCSDKINLRVKSILXXXXXXXXXXXXAYEKLKDQVLYQELSQDIDDLSKWIQEKM--IIATDESFREEKNI---ARRYNRHRAFDEEIQANKDRLCQAIDYAMQIVEERPQLADMIYPQIDSLNQQWEELEQTTFLKGEKMIEANREAIFEEGTMDVMTWLXXXXXXXXXXXXXXXXXXXXXXKLKKVEEADNEMEIKRKQIQDLKMHAAKL--KEEQPEKAFGIEQKHLILEHRFTQLQMPXXXXXXXXXXXXXXXXFLRNLDDQKAWVDDKLLLAESTNFGNNLLTVQQLLRRHRYLATEVNNHKPQLEYLKEEGAVLIEEVSPMQREKFVAGLQELESLWNRLEHSIDLRQQRLKESEATQTFLFDAEEAESWLWE--QELFLLSEERGIRDQEAAINVIKKHDARQKTIEDYGEEITKLGTRSRLLIEK-DHPQADRIALAQSHVDKVYAGLRDLCLEKKQRLSEIQKLNHLYREIVDLENWIYERTLVASSHDLGVDFEHCCLLRERFDEFFHETHLLGKDRVKAANDLCASLISQCHADSAEIAQWHDRINDSWAELQELMQTRIQLLRTAWEFYKYLSSCQDVLDRICEKIASIPTDVSKDSQSVAIQQRKHATFLSDAQALEGQVQWVVDEANHLLPSYAGQKEWHICERRDDVLATWNQLNMQAERRRHQLEDAADLQRFFSMVRELLQWMDLVALQINEKTRPKDVSGVELLINDHRSIKAEIAAREESMSICVNLGRTLLHRGRVGVDEVRAALINLITRKYSLEDMWEERWDYLQLILEVYQFARDASVAEAWILAQEPYLANKTLGETLDETLSLLKKHINFEKTVMSQEERFEALEKLTTMEIRAKEITKESILLK 6357
            A++D    +++L Q +  F + A   +    WL +  R+   +N+ +DLS +    +KH+A + ++ A E ++ +VT     L  +  + V  V  R  ++ + W+ LL +   +  +L+     ++  + ++     +++L + L++ D+G  L   +DLI+K  +LE +I +   K+  ++S      +       G F   +   +   T  L++ + +L + ++ R+  L  S    +F++ +  E QW+ E +    + +LG +L     L  KHK +E +++ H   +   +  GQ LI  ++P  E+V    ++LE  W +L      R  KL+ SL     L D GE+E W+ E+  +++  E   + +S    + KH+ +   ++ Y   +  +      +   +  D +++  ++++  I+     L +L +Q+Q +L ++L       ++D V+ WI E+E+   S     + E L++ +++FD  +  + + AD+V+    LA+KL D + P   +V  ++ +L   W +L  L+  R ++L  + E +++  +  +    I++K+  +  + ELG DL   + L R+  G + D+ A+ A+L+ L E+   L AK P++   I +++  +   W +L +    R DRL+ SS+LQ FL D+  I  W S ++  + +E+   D A A    +QH+ +  EI++ +D+F  L +    + +    A    + ++  A+ +  Q+L   W  ++ +L Q + L  FLRDA Q + L + ++  LS  D   ++E+ QN +RKH+ F   +Q   +    + E GR L+E+ H+ S  I   ++ +L RR+  K        KL+D +LY +  +D  +   WI EK   + A   S+ E  N+    ++  +H+AF  E+ AN+ R+ +  D  + ++ ++ + +  I   I+ + + W+ L      +G  + EA     F      +  W+      +  ++   +      + ++K+++ D++M +  ++++ +   A KL  + + P     ++++     + + QLQ  +   +  L     I  F R++DD    + +K L   ST+ G +L  V+ L+RR   L  +++  K +++  +     LI++      +     L+EL   W  L+     RQ  L E+     F+ D +E E W+ +  +++        I D E  + +   H  R+  IE   E    L  +   L ++    Q D +      +++++  L +   E+ + L+E  +L     ++  +E W+  +    ++ DLG  +     L ++ DEF     LL  D V        S++     D+  I +    I     +L EL + R Q L  + +  ++L S  ++   + +K+     +  ++  ++  + +KHA F ++  +   +VQ V+ E   L+      K+  I ++   +   W +L   ++ ++ +L+ A D   F   V E   WMD V LQ++ +   KD++ V  L+  H  ++A++A   E                     E+       I R  +L +    R + L+  L + QF RDA     W+  ++    ++ LG +L     L KKH + E  + SQE   +AL +     IR      E +  K
Sbjct: 1381 AVKDRAFERKRLLQASKDFHKFAAEADDLKVWLQDKTRIAGDENY-RDLSNLPRKLQKHQAFERELRANEGQLRNVTKDGQAL-VQAGNRVPEVESRVADLNKRWKDLLTLSEDKGRKLEQAASQREHNRSLEDAKKKVDELDSALRSGDVGNDLRSCKDLINKQQILESEITIWDQKVAELVSTGDDMAHG------GHF---NAQNIEAGTKELQQRFKDLRDPTQRRRAKLEESLNYHKFVFELDSEFQWINEHLPAAKSNELGQNLHQAQSLHKKHKKLEAEIKGHQPMINKALVAGQSLISQQHPEREQVESLCQQLEQAWQDLERHCGERSRKLDMSLKAQQYLFDAGEIESWLGERNNVLRSTEYGRDRDSAAKLLTKHKTIELELDTYSGIVTEMGHSCAAMVAANHPDSKVLAAKQQL--IEKMLKSLHKLASQRQGRLMESLYKHEYFLESDEVEQWIREQEQAASSEDYGQDFEHLQLLQNKFDDLKHRVEVGADRVDQCELLAKKLIDSESPYANEVEKRQEQLRTSWENLLQLLNQREQKLHAAGEIHRFHRDVAEALFRIQDKNAAL--SQELGRDLNSALALLRKHEGFENDLVALEAQLQVLVEDSVRLQAKYPSNASAIAQQQDKVVAAWNDLKERSTARGDRLAASSDLQTFLTDVRDIVSWSSNLRAALQAEEHVSDAAGATALKIQHDAIYGEIEAREDKFRYLNELSDSMVQTGHYA-AADVEEKCAAMLDERQKLHAAWNKKKIMLEQKIDLFCFLRDAKQIDNLSSSQQAALSSSDFGQTVEDVQNKIRKHDEFERLIQTQEEKVSLLQEHGRKLIEQRHYDSANIQTILQGVLARRQKVKDLCAVRRYKLEDALLYAKFVRDCAEAKYWINEKQKKLEADAASYAEVTNLDEKIKKLQKHQAFQAEVAANQGRIQEIQDTGVILLSKQHESSPEIKRAIEIVLEAWQGLLAELEQRGRGLEEAQDSLEFNSQLDKIEAWIRDKEMMVQASDTGRDLEHCNAL-MRKLDDVDSDMRVDDQRVKHINQLADKLINQAQVPADTQSVDKRRKDFNYNWRQLQGALNAYRALLGGANEIHVFNRDVDDTADRIAEKSLAMSSTDTGRDLAAVEALIRREEALERDMSAVKQKIDQHETAAEFLIKKYPERGAQHIERKLEELHKSWGNLQALSVKRQSILNEAYLAHKFVSDVKELELWVNDMIKKMNNTQSPSTINDCETQLEL---HQERKVEIEGRQEAFAGLKQQGEQLSKRPQQQQPDNVRKYLLVLEELHQTLNEAWSERARDLTEAHQLQLFKAQVEQVEIWLANKEAFLNNDDLGDSYTAVERLLKKHDEF---EKLLHADHVDTLQKFANSILEGEPKDADLIREKLAYILRRKQKLLELSEERKQRLTQSHQLQEFLRSLYEIDRWLVQKLQVALDENYREPSNLQSKIQKHAAFDAELLSNSPRVQSVIHEGERLIRGDHFAKD-EIAQQVQLLEGDWLKLKGASQTKKDKLQQAYDALAFNRSVDEFNNWMDEVELQLSSEDYGKDLAAVSNLLKKHERLEADVAHHGELADQLKQKDEQFFQAEHFLRHEIHERATVSIRRYNTLHEPLGIRRENLEDSLSLQQFLRDAEDELQWLAEKQLVAGSQDLGTSLLSVQGLQKKHNSLEAELTSQEPLIQALLQRGQQMIRDNHFASEQLQYK 3069          

HSP 4 Score: 232.261 bits (591), Expect = 3.108e-60
Identity = 352/1713 (20.55%), Postives = 728/1713 (42.50%), Query Frame = 1
Query: 1216 INNAWNKLDKAEHARELALRDELIRQEKLEQLALRFDRKAGMREAWLTENQRLITQDNFGQDLSAVEAAGKKHEAIKTDILAYEERVNSVTLVTSELENECYHDVERVLCRRDNVIRLWEKLLDMLAVRKLRLDACYKVQKLFQDIKHLLDLINDLKARLKTEDIGRHLMGVEDLIHKHSLLEIDIRMVGTKIEGIMSDAQPFINSEFGLGSGDFQPADPNEVILRTVNLKEEYDNLLELSRNRKDNLSASKVMWEFLWGVADEEQWMKEKIQL-MLN-------------------PDLGHDLSSVHRLISKHKVIEEDVRNHSNYLQNVIQGGQQLILDKNPGAEKVADXXXXXXXXXXXXXXXXXXRRSKLEQSLAYFHCLADCGEVEIWIIEQVKLVKIDETSINEESIITDIHKHEQLSKSIEDYESNINSLDEQVKKLSEGDLELVTIEEKVSNIKSQYAILIELTNQKQNKLTDTLSLFRVLRKADTVKTWIDEKEKLLMSLIPTDELEELEVFRHRFDGFEKEMNIQADQVEFVNTLAEKLSDMDHPQIADVVNKRFELNKLWNSLADLVEARREQLQTSYEFNQYLLECKQTGEWIREKSRLVESTDELGDDLAGIMQLQRRMGGMQRDMDAIRAKLEHLDEEMDTLIAKRPNXXXXXXXXXXXXXXFWAELGDMLADRDDRLSESSELQRFLQDLDHIHIWLSKMQTTVASEDLPKDLADAEKSLVQHEQLKEEIDSYQDEFIRLL-DYGRRITEDKTDAQYMFLSQRLNALEEGWQELCQMWENRXXXXXXXXXXXVFLRDAIQSEVLLAQEENFLSKEDIPISIENSQNLLRKHEGFLTTLQANHDHTIAVIEFGRNLVERGHFCSDKINLRVKSILXXXXXXXXXXXXAYEKLKDQVLYQELSQDIDDLSKWIQEKMIIATDESFREEKNIARRYNRHRAFDEEIQANKDRLCQAIDYAMQIVEERPQLADMIYPQIDSLNQQWEELEQTTFLKGEKMIEANREAIFEEGTMDVMTWLXXXXXXXXXXXXXXXXXXXXXXKLKKVEEADNEMEIKRKQIQDLKMHAAKLKEEQPEKAFGIEQKHLILEHRFTQLQMPXXXXXXXXXXXXXXXXFLRNLDDQKAWVDDKLLLAESTNFGNNLLTVQQLLRRHRYLATEVNNHKPQLEYLKEEGAVLIEEVSPMQREKFVAGLQE-LESLWNRLEHSIDL---RQQRLKESEATQTFLFDAEEAESWLWEQELFLLSEERG---IRDQEAAINVIKKHDARQKTIEDYGEEITKLGTRSRLLIEKDHPQADRIALAQSHVDKVYAGLRDLCLEKKQRLSEIQKLNHLYREIVDLENWIYERTLVASSHDLGVDFEHCCLLRERFDEFFHETHLLGKDRVKAANDLCASLISQCH--ADSAEIAQWHDRINDSWAELQELMQTRIQLLRTAWEFYKYLSSCQDVLDRICEK-IASIPTDVSKDSQSVAIQQRKHATFLSDAQALEGQVQWVVDEANHLLPSYAGQKEWHICERRDDVLATWNQLNMQAERRRHQLEDAADLQRFFSMVRELLQWMDLVALQINEKTRPKDVSGVELLINDHRSIKAEIAAREESMSICVNLGRTLLHRG-RVGVDEVRAALINLITRKYSLEDMWEERWDYLQLILEVYQFARDASVAEAWILAQEPYLANKTLGETLDETLSLLKKHINFEK 6258
            I+  W +L+ A+  RE +L       E    + L F+R     + W++E    +       DL  V+A  ++H+ ++ ++   E++VN VT + + ++N    + + V  R+  V  +W+++    +  + R+++    Q      K LL  I+ +K +L  ++  R +    +L+ KH+ L  DIR   T+   ++         + G    D +P +  E +     LK E D +                      G A++++W+ + + L M N                    +LG  L  V  ++ +H   E+ +      L+       +LI + +  ++ + D   ++      + +    R+  L+ S  +    A+  ++++W+ ++ ++   DE   +  ++   + KH+   + +   E  + ++ +  + L +    +  +E +V+++  ++  L+ L+  K  KL    S     R  +  K  +DE +  L S    ++L   +   ++    E E+ I   +V  + +  + ++   H    ++     EL + +  L D  + RR +L+ S  +++++ E     +WI E     +S +ELG +L     L ++   ++ ++   +  +        +LI+++  + E +      LE  W +L     +R  +L  S + Q++L D   I  WL +    + S +  +D   A K L +H+ ++ E+D+Y      +       +  +  D++ +   Q+L  +E+  + L ++   RQG L +SL    +  ++ + E  + ++E   S ED     E+ Q L  K +     ++   D         + L++     ++++  R + +    E+  +  N+  +KL          +D+ +    IQ+K    + E  R+  +      +H  F+ ++ A + +L   ++ ++++  + P  A  I  Q D +   W +L++ +  +G+++  ++    F     D+++W   +  ++   E   +      +K++  +    E+E +  + + L   +  + +     A  +E+K   +     +L      KKI L Q+  +  FLR+          +     S++FG  +  VQ  +R+H      +   + ++  L+E G  LIE     QR    A +Q  L+ +  R +   DL   R+ +L+++     F+ D  EA+ W+ E++  L ++      + + +  I  ++KH A Q  +      I ++     +L+ K H  +  I  A   V + + GL     ++ + L E Q       ++  +E WI ++ ++  + D G D EHC  L  + D+   +   +   RVK  N L   LI+Q    AD+  + +     N +W +LQ  +     LL  A E + +     D  DRI EK +A   TD  +D  +V    R+      D  A++ ++      A  L+  Y  +   HI  + +++  +W  L   + +R+  L +A    +F S V+EL  W++ +  ++N    P  ++  E  +  H+  K EI  R+E+ +     G  L  R  +   D VR  L+ L     +L + W ER   L    ++  F       E W+  +E +L N  LG++      LLKKH  FEK
Sbjct: 1058 IHQIWQRLNNAKAQREKSL-------EGASSVEL-FNRTCDEAKVWMSEKMLQLDTAVITPDLRTVQALQRRHQNLERELAPVEDKVNRVTYLGNSVKNAYPAEKDNVNARQQEVQDMWQQVQQRGSDLRNRIESEVGQQVFNNSAKVLLAWIDSVKDQLNADESARDVETANNLLKKHNDLGDDIRAHDTEFVEVI---------QLGKQLSDGKP-NMAETVAVIERLKAEQDAIHR--------------------GWAEKQKWLLQCVDLQMFNREADKIDATTKSHEAFLEYNNLGASLDEVEAILKRHLDFEKSLMAQDKILKGFSDNADKLISNDHYDSKYIGDRRNQVLGKRKAVKDRAFERKRLLQASKDFHKFAAEADDLKVWLQDKTRIAG-DENYRDLSNLPRKLQKHQAFERELRANEGQLRNVTKDGQALVQAGNRVPEVESRVADLNKRWKDLLTLSEDKGRKLEQAASQREHNRSLEDAKKKVDELDSALRSGDVGNDLRSCKDLINKQQILESEITIWDQKVAELVSTGDDMAHGGHFNAQNIEAGTKELQQRFKDLRDPTQRRRAKLEESLNYHKFVFELDSEFQWINEHLPAAKS-NELGQNLHQAQSLHKKHKKLEAEIKGHQPMINKALVAGQSLISQQHPEREQVESLCQQLEQAWQDLERHCGERSRKLDMSLKAQQYLFDAGEIESWLGERNNVLRSTEYGRDRDSAAKLLTKHKTIELELDTYSGIVTEMGHSCAAMVAANHPDSKVLAAKQQL--IEKMLKSLHKLASQRQGRLMESLYKHEYFLESDEVEQWIREQEQAASSEDYGQDFEHLQLLQNKFDDLKHRVEVGADRVDQCELLAKKLIDSESPYANEVEKRQEQLRTSWENLLQLLNQREQKLHAAGEIHRFHRDVAEALFRIQDKNAALSQELGRDLNSALALLRKHEGFENDLVALEAQLQVLVEDSVRLQAKYPSNASAIAQQQDKVVAAWNDLKERSTARGDRLAASSDLQTFLTDVRDIVSWSSNLRAALQAEEHVSDAAGATALKIQH-DAIYGEIEAREDKFRYLNELSDSMVQTGHYAAADVEEKCAAMLDERQKLHAAWNKKKIMLEQKIDLFCFLRDAKQIDNLSSSQQAALSSSDFGQTVEDVQNKIRKHDEFERLIQTQEEKVSLLQEHGRKLIE-----QRHYDSANIQTILQGVLARRQKVKDLCAVRRYKLEDALLYAKFVRDCAEAKYWINEKQKKLEADAASYAEVTNLDEKIKKLQKHQAFQAEVAANQGRIQEIQDTGVILLSKQHESSPEIKRAIEIVLEAWQGLLAELEQRGRGLEEAQDSLEFNSQLDKIEAWIRDKEMMVQASDTGRDLEHCNALMRKLDDVDSDMR-VDDQRVKHINQLADKLINQAQVPADTQSVDKRRKDFNYNWRQLQGALNAYRALLGGANEIHVFNRDVDDTADRIAEKSLAMSSTDTGRDLAAVEALIRREEALERDMSAVKQKIDQHETAAEFLIKKYPERGAQHIERKLEELHKSWGNLQALSVKRQSILNEAYLAHKFVSDVKELELWVNDMIKKMNNTQSPSTINDCETQLELHQERKVEIEGRQEAFAGLKQQGEQLSKRPQQQQPDNVRKYLLVLEELHQTLNEAWSERARDLTEAHQLQLFKAQVEQVEIWLANKEAFLNNDDLGDSYTAVERLLKKHDEFEK 2721          

HSP 5 Score: 125.561 bits (314), Expect = 5.836e-28
Identity = 349/1735 (20.12%), Postives = 702/1735 (40.46%), Query Frame = 1
Query: 1321 FDRKAGMREAWLTENQRLITQDNFGQDLSAVEAAGKKHEAIKTDILAYEERVNSVTLVTSELENECYHDVERVLCRRDNVIRLWEKLLDMLAVRKLRLDACYKVQKLFQDIKHLLDLINDLKARLKTEDIGRHLMGVEDLIHKHSLLEIDIRMVGTKIEGIMSDAQPFINSEFGLGSGDFQPADPNEVILRTVNLKEEYDNLLELSRNRKDNL----------SASKVMWEFLWGVADEEQWMKEKIQLMLNPD-LGHDLSSVHRLISKHKVIEEDVRNHSNYLQNVIQGGQQLILDKNPGAEKVADXXXXXXXXXXXXXXXXXXRRSKLEQSLAYFHCLADCGEVEIWIIEQVKLV-------KIDETSINEESII------TDIHKHEQLSKSIEDYESNINSLDEQVKKLSEGDLELVT--------IEEKVSNIKSQYAILIELTNQKQNKLTDTLSLFRVLRKADTVKTWIDEKEKLLMSLIPTDE----LEELEVFRHRFDGFEKEMNIQADQVEFVNTLAEKLSDMDHPQIADVVNKRFELNKLWNSLADLVEARR---EQLQTSYEFNQYLLECKQTGEWIREKSRLVESTDELGDDLAGIMQLQRRMGGMQRDMDAIRAKLEHLDEEMDTLIAKRPNXXXXXXXXXXXXXXFWAELGDMLADRDDRLSESSELQRFLQDLDHIHIWLSKMQTTVASEDLPKDLADAEKSLVQHEQLKEEIDSYQDEFIRLLDYGRRITEDKTD--AQYMFLSQRLNALEEGWQELCQMWENRXXXXXXXXXXXVFLRDAIQSEVLLAQEENFLSKEDIPISIENSQNLLRKHEGFLTTLQANHDHTIAVIEFGRNLVERGHFCSDKI--NLRVKSILXXXXXXXXXXXXAYEKLKDQ-------VLYQ-ELSQDIDDLSKWIQEKMIIATDESFREE-KNIARRYNRHRAFDEEIQANKDRLCQAIDYAMQIVEERPQLADMIYPQIDSLNQQWEELEQTTFLKGEKMIEANREAIFEEGTMDVMTWLXXXXXXXXXXXXXXXXXXXXXXKLKKVEEADNEMEIKRKQIQDLKMHAAKLKEEQPEKAFGIEQKHLILEHRFTQLQMPXXXXXXXXXXXXXXXXFLRNLDDQKAWVDD--KLLLAE---STNFGNNLLTVQQLLRRHRYLATEVNNHKPQLEYLKEEGAVLIEE---VSPMQREKFVAGL---QELESLWNR----LEHSIDLRQQRLKESEATQTFLFDAEEAESWLWEQELFLLSEERGIRDQEAAINVIKKHDARQKTIEDYGEEITKLGTRSRLLIEKDHPQADRIALAQSHVDKVYAGLRDLCLEKKQRLSEIQKLNHLYREIVDLENWIYERTLVASSHDLGVDFEHCCLLRERFDEF-----FHETHLLGKDRVKAANDLCASLISQCHADSAEIAQWHDRINDSWAELQELMQTRIQLLRTAWEFYKYLSSCQDVLDRICEKIASI-PTDVSKDSQSVAIQQRKHATFLSDAQALEGQVQWVVDEANHLL-PSYAGQKEWHICERRDDVLATWNQLNMQAERRRHQLEDAADLQRFFSMVRELLQWMDLVALQINEKTRPKDVSGVELLINDHRSIKAEIAAREESMSICVNLGRTLLHR-GRVGVDEVRAALINLITRKYSLEDMWEERWDYLQLILEVYQFARDASVAEAWILAQEPYLANKTLGETLDETLSLLKKHINFEKTVMSQEERFEALEK 6300
            F R+    E W+ E +R+I  D    +   V+ A +K E   TD+ A  +RV  +         + +  +++++ R+  + ++W++L +  A R+  L+    V+   +        +++   +L T  I   L  V+ L  +H  LE ++  V  K+  +         +  G    +  PA+ + V  R   +++ +  + +   + ++ +          +++KV+  ++  V D+           LN D    D+ + + L+ KH  + +D+R H      VIQ G+QL   K   AE VA                    R K EQ   +        E + W+++ V L        KID T+ + E+ +        + + E + K   D+E ++ + D+ +K  S+   +L++        I ++ + +  +   + +   +++  L  +    +   +AD +K W+ +K +     I  DE    L  L     +   FE+E+     Q+  V    + L    + ++ +V ++  +LNK W  L  L E +    EQ  +  E N+ L + K+    + E    + S D +G+DL     L  +   ++ ++     K+  L    D +      + + I      L+  + +L D    R  +L ES    +F+ +LD    W+++      S +L ++L  A+    +H++L+ EI  +Q    + L  G+ +   +     Q   L Q+   LE+ WQ+L +    R   L  SL  Q +L DA + E  L +  N L   +     +++  LL KH+    T++   D    ++       E GH C+  +  N     +L  ++    +  ++  KL  Q        LY+ E   + D++ +WI+E+   A+ E + ++ +++    N+       ++   DR+ Q    A ++++     A+ +  + + L   WE L Q    + +K+  A     F     + +  ++    ++                L+K E  +N++     Q+Q L   + +L+ + P  A  I Q+   +   +  L+     +  +L     +Q FL ++ D  +W  +    L AE   S   G   L +Q     H  +  E+   + +  YL E    +++     +    EK  A L   Q+L + WN+    LE  IDL             FL DA++ ++    Q+  L S + G +  E   N I+KHD  ++ I+   E+++ L    R LIE+ H  +  I      V      ++DLC  ++ +L +        R+  + + WI E+     +      +     L E+  +      F       + R++   D    L+S+ H  S EI +  + + ++W  L   ++ R + L  A +  ++ S    +   I +K   +  +D  +D +      RK     SD +  + +V+ +   A+ L+  +        + +RR D    W QL       R  L  A ++  F   V +    +   +L ++     +D++ VE LI    +++ +++A ++ +         L+ +    G   +   L  L     +L+ +  +R   L      ++F  D    E W+      + N     T+++  + L+ H   +  +  ++E F  L++
Sbjct:  983 FYRECDDFEKWMKEKERMIKSD----EGEGVDNAKRKFEKFITDLSAASKRVEEIDGAVDTFRRQGHSQLDKIIARQRQIHQIWQRLNNAKAQREKSLEGASSVELFNRTCDEAKVWMSEKMLQLDTAVITPDLRTVQALQRRHQNLERELAPVEDKVNRV---------TYLGNSVKNAYPAEKDNVNARQQEVQDMWQQVQQRGSDLRNRIESEVGQQVFNNSAKVLLAWIDSVKDQ-----------LNADESARDVETANNLLKKHNDLGDDIRAHDTEFVEVIQLGKQLSDGKPNMAETVA-----------------VIERLKAEQDAIH----RGWAEKQKWLLQCVDLQMFNREADKIDATTKSHEAFLEYNNLGASLDEVEAILKRHLDFEKSLMAQDKILKGFSDNADKLISNDHYDSKYIGDRRNQVLGKRKAVKDRAFERKRLLQASKDFHKFAAEADDLKVWLQDKTR-----IAGDENYRDLSNLPRKLQKHQAFERELRANEGQLRNVTKDGQALVQAGN-RVPEVESRVADLNKRWKDLLTLSEDKGRKLEQAASQREHNRSLEDAKKK---VDELDSALRSGD-VGNDLRSCKDLINKQQILESEITIWDQKVAELVSTGDDMAHGGHFNAQNIEAGTKELQQRFKDLRDPTQRRRAKLEESLNYHKFVFELDSEFQWINEHLPAAKSNELGQNLHQAQSLHKKHKKLEAEIKGHQPMINKALVAGQSLISQQHPEREQVESLCQQ---LEQAWQDLERHCGERSRKLDMSLKAQQYLFDAGEIESWLGERNNVLRSTEYGRDRDSAAKLLTKHK----TIELELDTYSGIV------TEMGHSCAAMVAANHPDSKVLAAKQQLIEKMLKSLHKLASQRQGRLMESLYKHEYFLESDEVEQWIREQEQAASSEDYGQDFEHLQLLQNKFDDLKHRVEVGADRVDQCELLAKKLIDSESPYANEVEKRQEQLRTSWENLLQLLNQREQKLHAAGEIHRFHRDVAEALFRIQDKNAALSQELGRDLNSALAL--LRKHEGFENDLVALEAQLQVLVEDSVRLQAKYPSNASAIAQQQDKVVAAWNDLKERSTARGDRLAASSDLQTFLTDVRDIVSWSSNLRAALQAEEHVSDAAGATALKIQ-----HDAIYGEIEAREDKFRYLNELSDSMVQTGHYAAADVEEKCAAMLDERQKLHAAWNKKKIMLEQKIDLF-----------CFLRDAKQIDNLSSSQQAALSSSDFG-QTVEDVQNKIRKHDEFERLIQTQEEKVSLLQEHGRKLIEQRHYDSANIQTILQGVLARRQKVKDLCAVRRYKLEDALLYAKFVRDCAEAKYWINEKQKKLEAD--AASYAEVTNLDEKIKKLQKHQAFQAEVAANQGRIQEIQDTGVILLSKQHESSPEIKRAIEIVLEAWQGLLAELEQRGRGLEEAQDSLEFNSQLDKIEAWIRDKEMMVQASDTGRDLEHCNALMRKLDDVDSDMRVDDQRVKHINQLADKLINQAQVPADTQSVDKRRKDFNYNWRQLQGALNAYRALLGGANEIHVFNRDVDDTADRIAEKSLAMSSTDTGRDLAAVEALIRREEALERDMSAVKQKIDQHETAAEFLIKKYPERGAQHIERKLEELHKSWGNLQALSVKRQSILNEAYLAHKFVSDVKELELWVNDMIKKMNNTQSPSTINDCETQLELHQERKVEIEGRQEAFAGLKQ 2628          

HSP 6 Score: 117.087 bits (292), Expect = 2.093e-25
Identity = 98/408 (24.02%), Postives = 188/408 (46.08%), Query Frame = 1
Query: 5062 ADRIALAQSHVDKVYAGLRDLCLEKKQRLSEIQKLNHLYREIVDLENWIYER-TLVASSHDLGVDFEHCCLLRERFDEFFHETHLLGKDRVKAANDLCASLISQCHADSAEIAQWHDRINDSWAELQELMQTRIQLLRTAWEFYKYLSSCQDVLDRICEKIASIPTDV-SKDSQSVAIQQRKHATFLSDAQALEGQVQWVVDEANHLLPSYAGQKEWHICERRDDVLATWNQLNMQAERRRHQLEDAADLQRFFSMVRELLQWMDLVALQINEKTRPKDVSGVELLINDHRSIKAEIAAREESMSICVNLGRTLLHRGRVGVDEVRAALINLITRKYSLEDMWEERWDYLQLILEVYQFARDASVAEAWILAQEPYLANKTLGETLDETLSLLKKHINFEKTVMSQEE 6279
            AD +   Q  +++ Y  L+++  ++   L +   L   YRE  D E W+ E+  ++ S    GVD       + +F++F  +     K RV+  +    +   Q H+   +I     +I+  W  L      R + L  A     +  +C +    + EK+  + T V + D ++V   QR+H     +   +E +V  V    N +  +Y  +K+ ++  R+ +V   W Q+  +    R+++E     Q F +  + LL W+D V  Q+N     +DV     L+  H  +  +I A +      + LG+ L   G+  + E  A +  L   + ++   W E+  +L   +++  F R+A   +A   + E +L    LG +LDE  ++LK+H++FEK++M+Q++
Sbjct:  946 ADSVEKRQQRINQTYDELQEMAQKRHALLEDSIHLFGFYRECDDFEKWMKEKERMIKSDEGEGVDN-----AKRKFEKFITDLSAASK-RVEEIDGAVDTFRRQGHSQLDKIIARQRQIHQIWQRLNNAKAQREKSLEGASSVELFNRTCDEAKVWMSEKMLQLDTAVITPDLRTVQALQRRHQNLERELAPVEDKVNRVTYLGNSVKNAYPAEKD-NVNARQQEVQDMWQQVQQRGSDLRNRIESEVGQQVFNNSAKVLLAWIDSVKDQLNADESARDVETANNLLKKHNDLGDDIRAHDTEFVEVIQLGKQL-SDGKPNMAETVAVIERLKAEQDAIHRGWAEKQKWLLQCVDLQMFNREADKIDATTKSHEAFLEYNNLGASLDEVEAILKRHLDFEKSLMAQDK 1345          

HSP 7 Score: 77.0258 bits (188), Expect = 2.787e-13
Identity = 279/1527 (18.27%), Postives = 619/1527 (40.54%), Query Frame = 1
Query: 1891 RTVNLKEEYDNLLELSRNRKDNLSASKVMWEFLWGVADEEQWMKEKIQLMLNPDLGHDLSSVHRLISKHKVIEEDVRNHSNYLQNVIQGGQQLILDKNPGAEKVADXXXXXXXXXXXXXXXXXXRRSKLEQSLAYFHCLADCGEVEIWIIEQVKLVKIDETSINEE--SIITDIHKHEQLSK---SIEDYESNINSLDEQVKKLSEGDLELVTIEEKVSNIKSQYAILIELTNQKQNKLTDTLSLFRVLRKADTVKTWIDEKEKLLMSLIPTDELEELEVFRHRFDGFEKEMNIQADQVEFVNT--LAEKLSDMDHPQIADVVNKRFELNKLWNSLADLVEARREQLQTSY-EFNQYLLECKQTGEWIREKSRLVEST---------DELGDDLAGIMQLQRRMGGMQRDMDAIRAKLEHLDEEMDTLIAKRPNXXXXXXXXXXXXXXFWAELGDMLADRDDRLSESSELQRFLQDLDHIHIWLSKMQTTVASEDLPKDLADAEKSLVQHEQLKEEIDSYQDEFIR-------LLDYGRRITEDKTDAQYMFLSQRLNALEEGWQELCQMWENRXXXXXXXXXXXVFLRDAIQSEVLLAQEENFLSKEDIPISIENSQNLLRKHEGFLTTLQANHDHTIAVIEFGRNLVERGHFCSDKINLRVKSILXXXXXXXXXXXXAYEKLKDQVLYQELSQDIDDLSKWIQEKMIIATDESFREEKNIARR-YNRHRAFDEEIQANKDRLCQAIDYAMQIVEERPQLADMIYPQIDSLNQQWEELEQTTFLKGEK--MIEANREAIFEEGTMDVMTWLXXXXXXXXXXXXXXXXXXXXXXKLKKVEEADNEMEIKRKQIQDLKMHAAKLKEEQPEKAFGIEQKHLILEHRFTQLQMPXXXXXXXXXXXXXXXXFLRNLDDQKAWVDDKLLLAESTNFGNNLLTVQQLLRRHRYLATEVNNHKPQLEYLKEEGAVLIEEVSPMQREKFVAGLQE-LESLWNRLEHSIDLRQQRLKESEATQTFLFDAEEAESWLWEQELFLLSEERGIRDQEAAINVIKKHDARQKTIEDYGEEITKLGTRSRLLIEKDHPQADRIALAQSHVDKVYAGLRDLCLEKKQRLSEIQKLNHLYREIVDLENWIYERTLVASSHDLGVDFEHCCLLRERFDEFFHETHLLGKDRVKAANDLCASLISQCHADSAEIAQWHDRINDSWAELQELMQTRIQLLRTAWEFYKYLSSCQDVLD-RICEKIASIPTDVSKDSQSVAIQQRKHATFLSDAQALEGQVQWVVDEANHLLPS--YAGQKEWHICERRDDVLATWNQLNMQAERRRHQLEDAADLQRFFSMVRELLQWMDLVALQINEKTRP--KDVSGVELLIN---------DHRSIKAEIAAREESMSICVNLGRTLLHRGRVGVDEVRAALINLITRKYSLEDMWEERWDYLQLILEVYQFARDASVAEAWILAQEPYLANKTLGETLDETLSLLKKHINFEKTVMSQEERFEALEKLTTMEIRAKEITKES 6345
            R   + + YD L E+++ R   L  S  ++ F     D E+WMKEK + M+  D G  + +  R   K      D+   S  ++ +           +   +K+    +++  +W  L      R   LE + +       C E ++W+ E  K++++D   I  +  ++     +H+ L +    +ED  + +  L   VK     + + V   ++   ++  +  + +  +  +N++   +        A  +  WID  +  L +     ++E       + +      +I+A   EFV    L ++LSD   P +A+ V           ++ + ++A ++ +   + E  ++LL+C     + RE  ++  +T         + LG  L  +  + +R    ++ + A    L+   +  D LI+    D + I + R  +      + D   +R   L  S +  +F  + D + +WL   +T +A ++  +DL++  + L +H+  + E+ + + +          L+  G R+ E         +  R+  L + W++L  + E++   L Q+ S +   R    ++  + + ++ L   D+   + + ++L+ K +   + +         ++  G ++   GHF +  I    K + +R +  +  +     KL++ + Y +   ++D   +WI E +  A      +  + A+  + +H+  + EI+ ++  + +A+     ++ ++    + +      L Q W++LE+    +  K  M    ++ +F+ G  ++ +WL      +  TE   +  +   + L K +  + E++     + ++    A +       +  +  K  ++E     L      ++ +L++     ++    D+ + W+ ++   A S ++G +   +Q L  +   L   V     +++  +     LI+  SP   E  V   QE L + W  L   ++ R+Q+L  +     F  D  EA   + ++    LS+E G RD  +A+ +++KH+  +  +     ++  L   S  L  K    A  IA  Q  V   +  L++    +  RL+    L     ++ D+ +W         + +   D      L+ + D  + E     +D+ +  N+L  S++   H  +A++ +    + D   +L      +  +L    + + +L   + + +    ++ A   +D  +  + V  + RKH  F    Q  E +V  + +    L+    Y       I +    VLA   ++      RR++LEDA    +F     E   W       INEK +    D +    + N          H++ +AE+AA +  +    + G  LL +      E++ A+  ++     L    E+R   L+   +  +F       EAWI  +E  +     G  L+   +L++K  + +  +   ++R + + +L    I   ++  ++
Sbjct:  952 RQQRINQTYDELQEMAQKRHALLEDSIHLFGFYRECDDFEKWMKEK-ERMIKSDEGEGVDNAKRKFEKFIT---DLSAASKRVEEIDGAVDTFRRQGHSQLDKIIARQRQIHQIWQRLNNAKAQREKSLEGASSVELFNRTCDEAKVWMSE--KMLQLDTAVITPDLRTVQALQRRHQNLERELAPVEDKVNRVTYLGNSVKNAYPAEKDNVNARQQ--EVQDMWQQVQQRGSDLRNRIESEVGQQVFNNSAKVLLAWIDSVKDQLNADESARDVETANNLLKKHNDLGD--DIRAHDTEFVEVIQLGKQLSD-GKPNMAETV-----------AVIERLKAEQDAIHRGWAEKQKWLLQCVDLQMFNREADKIDATTKSHEAFLEYNNLGASLDEVEAILKRHLDFEKSLMAQDKILKGFSDNADKLISNDHYDSKYIGDRRNQVLGKRKAVKDRAFERKRLLQASKDFHKFAAEADDLKVWLQD-KTRIAGDENYRDLSNLPRKLQKHQAFERELRANEGQLRNVTKDGQALVQAGNRVPE---------VESRVADLNKRWKDLLTLSEDKGRKLEQAASQREHNRSLEDAKKKVDELDSALRSGDVGNDLRSCKDLINKQQILESEITIWDQKVAELVSTGDDMAHGGHFNAQNIEAGTKELQQRFKDLRDPTQRRRAKLEESLNYHKFVFELDSEFQWINEHLPAAKSNELGQNLHQAQSLHKKHKKLEAEIKGHQPMINKALVAGQSLISQQHPEREQVESLCQQLEQAWQDLERHCGERSRKLDMSLKAQQYLFDAG--EIESWLGERNNVLRSTEYGRDRDSAAKL-LTKHKTIELELDTYSGIVTEMGHSCAAMVAANHPDSKVLAAKQQLIEKMLKSLHKLASQRQGRLMESLYKHEYFLESDEVEQWIREQEQAASSEDYGQDFEHLQLLQNKFDDLKHRVEVGADRVDQCELLAKKLIDSESPYANE--VEKRQEQLRTSWENLLQLLNQREQKLHAAGEIHRFHRDVAEALFRIQDKNA-ALSQELG-RDLNSALALLRKHEGFENDLVALEAQLQVLVEDSVRLQAKYPSNASAIAQQQDKVVAAWNDLKERSTARGDRLAASSDLQTFLTDVRDIVSWSSNLRAALQAEEHVSDAAGATALKIQHDAIYGEIEAR-EDKFRYLNELSDSMVQTGHYAAADVEEKCAAMLDERQKLHAAWNKKKIMLEQKIDLFCFLRDAKQIDNLSSSQQAALSSSDFGQTVEDVQNKIRKHDEFERLIQTQEEKVSLLQEHGRKLIEQRHYDSANIQTILQ---GVLARRQKVKDLCAVRRYKLEDALLYAKFVRDCAEAKYW-------INEKQKKLEADAASYAEVTNLDEKIKKLQKHQAFQAEVAANQGRIQEIQDTGVILLSKQHESSPEIKRAIEIVLEAWQGLLAELEQRGRGLEEAQDSLEFNSQLDKIEAWIRDKEMMVQASDTGRDLEHCNALMRKLDDVDSDMRVDDQRVKHINQLADKLINQAQVPADT 2428          

HSP 8 Score: 73.559 bits (179), Expect = 3.365e-12
Identity = 70/316 (22.15%), Postives = 150/316 (47.47%), Query Frame = 1
Query: 2827 ADVVNKRFE-LNKLWNSLADLVEARREQLQTSYEFNQYLLECKQTGEWIREKSRLVESTDELGDDLAGIMQLQRRMGGMQRDMDAIRAKLEHLDEEMDTLIAKRPNXXXXXXXXXXXXXXFWAELGDMLADRDDRLSESSELQRFLQDLDHIHIWLSKMQTTVASEDLPKDLADAEKSLVQHEQLKEEIDSYQDEFIRLLDYGRRITEDKTDAQYMFLSQRLNALEEGWQELCQMWENRXXXXXXXXXXXVFLRDAIQSEVLLA---QEENFLSKEDIPISIENSQNLLRKHEGFLTTLQANHDHTIAVIEFGRNL 3762
            AD V KR + +N+ ++ L ++ + R   L+ S     +  EC    +W++EK R+++S     D+  G+   +R+      D+ A   ++E +D  +DT   +  +  + I   +  +   W  L +  A R+  L  +S ++ F +  D   +W+S+    + +  +  DL   +    +H+ L+ E+   +D+  R+   G  + ++   A+   ++ R   +++ WQ++ Q   + +  +   +  QVF   A   +VLLA     ++ L+ ++    +E + NLL+KH      ++A+    + VI+ G+ L
Sbjct:  946 ADSVEKRQQRINQTYDELQEMAQKRHALLEDSIHLFGFYRECDDFEKWMKEKERMIKS-----DEGEGVDNAKRKFEKFITDLSAASKRVEEIDGAVDTFRRQGHSQLDKIIARQRQIHQIWQRLNNAKAQREKSLEGASSVELFNRTCDEAKVWMSEKMLQLDTAVITPDLRTVQALQRRHQNLERELAPVEDKVNRVTYLGNSV-KNAYPAEKDNVNARQQEVQDMWQQVQQRGSDLRNRIESEVGQQVFNNSA---KVLLAWIDSVKDQLNADESARDVETANNLLKKHNDLGDDIRAHDTEFVEVIQLGKQL 1252          

HSP 9 Score: 70.0922 bits (170), Expect = 3.492e-11
Identity = 80/311 (25.72%), Postives = 136/311 (43.73%), Query Frame = 1
Query: 5374 HADSAEIAQWHDRINDSWAELQELMQTRIQLLRTAWEFYKYLSSCQDVLDRICEKIASIPTDVSKDSQSVAIQQRKHATFLSDAQALEGQVQWVVDEANHLLPSYAGQKEWHICERRDDVLATWNQLNMQAERRRHQLEDAADLQRFFSMVRELLQWMDLVALQINEKTRPKDVSGVELLINDHRSIKAEIAAREESMSICVNLGRTLLHRGRVGVDEVRAALINLITRKYSLEDMWEE---RWDYLQ--LILEVYQ--FARDASVAEAWILAQEPYLANKTLGETLDETLSLLKKHINFEKTVMSQEERF 6285
            +ADS E  Q   RIN ++ ELQE+ Q R  LL  +   + +   C D    + EK   I +D   + + V   +RK   F++D  A   +V+  +D A          +   I  R+  +   W +LN    +R   LE A+ ++ F     E   WM    LQ++      D+  V+ L   H++++ E+A  E+ ++    LG ++ +      D V A       R+  ++DMW++   R   L+  +  EV Q  F   A V  AWI + +  L        ++   +LLKKH +    + + +  F
Sbjct:  945 NADSVEKRQ--QRINQTYDELQEMAQKRHALLEDSIHLFGFYRECDDFEKWMKEKERMIKSD---EGEGVDNAKRKFEKFITDLSAASKRVE-EIDGAVDTFRRQGHSQLDKIIARQRQIHQIWQRLNNAKAQREKSLEGASSVELFNRTCDEAKVWMSEKMLQLDTAVITPDLRTVQALQRRHQNLERELAPVEDKVNRVTYLGNSVKNAYPAEKDNVNA-------RQQEVQDMWQQVQQRGSDLRNRIESEVGQQVFNNSAKVLLAWIDSVKDQLNADESARDVETANNLLKKHNDLGDDIRAHDTEF 1242          

HSP 10 Score: 61.2326 bits (147), Expect = 1.702e-8
Identity = 40/165 (24.24%), Postives = 84/165 (50.91%), Query Frame = 1
Query: 2632 DTVKTWIDEKEKLLMSLIPTDELEELEVFRHRFDGFEKEMNIQADQVEFVNTLAEKLSDMDHPQIADVVNKRFELNKLWNSLADLVEARREQLQTSYEFNQYLLECKQTGEWIREKSRLVESTDELGDDLAGIMQLQRRMGGMQRDMDAIRAKLEHLDEEMDTLI 3126
            D  ++W+ +K+++  + I   +L  +   + +    E E+  +  +   ++T  ++L    HP+ +++ ++   L + W +L  LVE RR QL+ + E  Q+  +  +   W+ EK  LV S D  G+D      L +R   +Q +++A    + +L+++ D LI
Sbjct:  615 DNEESWLVDKQRICKTGITAKDLRAVLSLQQKHKALEDEIKSRKPKSGQMSTAGKRLIGEQHPRSSEIQSRIDSLAEHWQALEALVELRRRQLEDAAEAYQFYTDANEAESWLNEKIALVNSRD-YGNDEPSAQALLQRHRDLQGELNAYSGDILNLNQQADKLI 778          

HSP 11 Score: 53.9138 bits (128), Expect = 3.160e-6
Identity = 98/420 (23.33%), Postives = 181/420 (43.10%), Query Frame = 1
Query: 4762 LQELESLWNRLEHS-----IDLRQQRLKESEATQ-TFLFDAEEA--ESWLWEQELFLLSEERGIRDQEAAINVIKKHDARQKTIEDYGEEITKLGTRSRLLIEKDHPQADRIALAQSHVDKVYAGLRDLCLEKKQRLSEIQKLNHLYREIVDLENWIYERTLVASSHDLGV------DFEHCCLLRERFDEFFHETHLLGKDRVKAANDLCASLISQCHADSAEIAQWHDRINDSWAELQELMQTRIQLLRTAWEFYKYLSSCQDVLDRICEKIASIPTDVS-KDSQSVAIQQRKHATFLSDAQALEGQVQWVVDEANHLLPSYAGQK---EWH-----ICERRDDVLATWNQLNMQAERRRHQLEDAADLQRFFSMVRELLQWMDLVALQINEKTRPKDVSGVELLINDHRSIKAEIAA 5952
            + ++E  W  LE++     + LR + L++ +  Q  + F+ +    E +L E  + +LS+ R +R  +A    +KKH+A    I    E    L   +  L  +++   +R+   +  V   +  L +L   ++  LS++  L +L REI      + E     +S D+G       +      L+E     + ET       +K  N       S  H D+A +AQ    + ++++EL      R   L  A  F+ ++    +    + +K     T ++ KD ++V   Q+KH       +ALE +++    ++  +  S AG++   E H     I  R D +   W  L    E RR QLEDAA+  +F++   E   W++     +N +    D    + L+  HR ++ E+ A
Sbjct:  363 VNDIEKAWQILEYAEHHREVALRDELLRQEKLEQLNYKFEKKSVLREGYLKEM-IQVLSDPRYLRQVDA---TLKKHEAISADILARVERFNDLTAMAEELDRENYHGKERVRRREQEVMAKWRQLLELLENQRLNLSQMSNLMNLLREIASTTEAVRELQQQFASEDVGPHLLGVEELLQAHSLQELQVNTYGET-------LKRFNRQALPYKSSEHKDAALLAQRLADLEEAYSELLRRSAARRARLEEARNFHHFMEDYDNEESWLVDKQRICKTGITAKDLRAVLSLQQKH-------KALEDEIKSRKPKSGQM--STAGKRLIGEQHPRSSEIQSRIDSLAEHWQALEALVELRRRQLEDAAEAYQFYTDANEAESWLNEKIALVNSRDYGNDEPSAQALLQRHRDLQGELNA 762          
BLAST of Spectrin beta chain vs. Ensembl Fly
Match: kst (gene:FBgn0004167 transcript:FBtr0073070)

HSP 1 Score: 549.666 bits (1415), Expect = 1.059e-157
Identity = 332/801 (41.45%), Postives = 478/801 (59.68%), Query Frame = 1
Query:  160 YERFRIKALAGEREKVQKKTFTKWINSHLNKLKQSIDDLYNXXXXXXXXXXXXXXXXXXXXPYPTKGKMRIHCLENVDKSLNFLIEQRVHLENMGAHDIVDGNARLTLGLIWTIILRFQIQDI---VVEEDDTSEKRQAKDALLLWCQMKTAGYPNTNVRNFSTCWRDGLAFNAIIHRHRPDLLEYSALSRS-NPN-ENLEQAIRIAEEKLGIPRLLDPEDVSVENPDEKSIMTYVVTFYHFFSKMKADSVHSKRVGKILSQSMETEEMMVHYDKLTSNLLEWINQTIELLNDRTFANSLSGVQQQLAAFNTYRVTEKPPKFQEKGNLEMLLFSIQSQMRANNQMPYLPIEGKLISDINNAWNKLDKAEHARELALRDELIRQEKLEQLALRFDRKAGMREAWLTENQRLITQDNFGQDLSAVEAAGKKHEAIKTDILAYEERVNSVTLVTSELENECYHDVERVLCRRDNVIRLWEKLLDMLAVRKLRLDACYKVQKLFQDIKHLLDLINDLKARLKTEDIGRHLMGVEDLIHKHSLLEIDIRMVGTKIEGIMSDAQPFINSEFGLGSGDFQPADPNEVILRTVNLKEEYDNLLELSRNRKDNLSASKVMWEFLWGVADEEQWMKEKIQLMLNPDLGHDLSSVHRLISKHKVIEEDVRNHSNYLQNVIQGGQQLILDKNPGAEKVADXXXXXXXXXXXXXXXXXXRRSKLEQSLAYFHCLADCGEVEIWIIEQVKLVKIDETSINEESIITDIHKHEQLSKSIEDYESNINSLDEQVKKLSEGD---LELVTIEEKVSNI 2538
            +E  RIK L  ER  +QKKTFTKW+NS L K K  ++DL+ DL DG  LL LLEI+S E+L  P  G+MR+H +ENV+KSL FL   +V LE++GA DIVDGN RL LGLIWTIILRFQIQ+I   V EE+++SEKR AKDALLLWCQ KT GYP  N+ +F+  WR GL FNA+IH HRPDL EYS +  S N N +NL  A   A  +LGIP LLD ED+    PDEKSI+TYV ++YH F++MK +    KR+  I+ Q M+ +   + Y+ LT+NLL WI Q    L  R   NSL G+Q++L AF  YR  EKPPK++E+  +E L F+I + ++A NQ PY P +G+L++DI  AW  L+ AEH RE+ALRDEL+RQEKLEQL  +F++K+ +RE +L E  ++++   +   L  V+A  KKHEAI  DILA  ER N +T +  EL+ E YH  ERV  R   V+  W +LL++L  ++L L     +  L ++I    + + +L+ +  +ED+G HL+GVE+L+  HSL E+ +   G  ++     A P+ +SE           D   +  R  +L+E Y  LL  S  R+  L  ++    F+    +EE W+ +K ++        DL +V  L  KHK +E+++++       +   G++LI +++P + ++   +  L   W  L  L E RR +LE +   +    D  E E W+ E++ LV   +   +E S    + +H  L   +  Y  +I +L++Q  KL +     LEL   E ++  +
Sbjct:   10 FENERIKTLQEERLHIQKKTFTKWMNSFLIKAKMEVEDLFTDLADGIKLLKLLEIISSEKLGKPNSGRMRVHKIENVNKSLAFL-HTKVRLESIGAEDIVDGNPRLILGLIWTIILRFQIQEIEIDVDEENESSEKRSAKDALLLWCQRKTHGYPGVNITDFTNSWRSGLGFNALIHSHRPDLFEYSTIVNSKNSNLDNLNHAFDTAANELGIPSLLDAEDIDSARPDEKSILTYVASYYHTFARMKNEQKSGKRIANIVGQLMDADRKKMQYEGLTTNLLSWIRQKTLELEQRDLPNSLEGIQRELLAFKEYRTIEKPPKYKERSEIEALYFTINTLLKALNQPPYNPQDGQLVNDIEKAWQILEYAEHHREVALRDELLRQEKLEQLNYKFEKKSVLREGYLKEMIQVLSDPRY---LRQVDATLKKHEAISADILARVERFNDLTAMAEELDRENYHGKERVRRREQEVMAKWRQLLELLENQRLNLSQMSNLMNLLREIASTTEAVRELQQQFASEDVGPHLLGVEELLQAHSLQELQVNTYGETLKRFNRQALPYKSSEH---------KDAALLAQRLADLEEAYSELLRRSAARRARLEEARNFHHFMEDYDNEESWLVDKQRICKTGITAKDLRAVLSLQQKHKALEDEIKSRKPKSGQMSTAGKRLIGEQHPRSSEIQSRIDSLAEHWQALEALVELRRRQLEDAAEAYQFYTDANEAESWLNEKIALVNSRDYGNDEPSAQALLQRHRDLQGELNAYSGDILNLNQQADKLIKAGICTLELSAAEPELPEV 797          

HSP 2 Score: 419.853 bits (1078), Expect = 2.121e-117
Identity = 415/1654 (25.09%), Postives = 767/1654 (46.37%), Query Frame = 1
Query: 1390 FGQDLSAVEAAGKKHEAIKTDILAYEERVNSVTLVTSELENECYHDVERVLCRRDNVIRLWEKLLDMLAVRKLRLDACYKVQKLFQDIKHLLDLINDLKARLKTEDIGRHLMGVEDLIHKHSLL--EIDIRMVGTKIEGIMSDAQPFINSEFGLGSGDFQPADPNEVILRTVNLKEEYDNLLELSRNRKDNLSASKV-MWEFLWGVADEEQWMKEKIQLMLNPDLGHDLSSVHRLISKHKVIEEDVRNHSNYLQNVIQGGQQLILDKNPGAEKVADXXXXXXXXXXXXXXXXXXRRSKLEQSLAYFHCLADCGEVEIWIIEQVKLVKIDETS----INEESIITDIHKHEQLSKSIEDYESNINSL-DEQVKKLSEGDLELVTIEEKVSNIKSQYAILIELTNQKQNKLTDTLSLFRVLRKADTVKTWIDEKEKLLMSLIPTDELEELEVFRHRFDGFEKEMNIQADQVEFVNTLAEKLSDMDH-PQIADVVNKRF-ELNKLWNSLADLVEARREQLQTSYEFNQYLLECKQTGEWIREKSRLVESTDELGDDLAGIMQLQRRMGGMQRDMDAIRAKLEHLDEEMDTLIAKRPNXXXXXXXXXXXX-XXFWAELGDMLADRDDRLSESSELQRFLQDLDHIHIWLSKMQTTVASEDLPKDLADAEKSLVQHEQLKEEIDSYQDEFIRLLDYGRRITEDKTDAQYMFLSQRLNALEEGWQELCQMWENRXXXXXXXXXXXVFLRDAIQSEVLLAQEENFLSKEDIPISIENSQNLLRKHEGFLTTLQANHDHTIAVIEFGRNLVERGHFCSDKINLRVKSILXXXXXXXXXXXXAYEKLKDQVLYQELSQDIDDLSKWIQEKMIIATDESFREEKNIARRYNRHRAFDEEIQANKDRLCQAIDYAMQIVEERPQLADMIYPQIDSLNQQWEELEQTTFLKGEKMIEANREAIFEEGTMDVMTWLXXXXXXXXXXXXXXXXXXXXXXKLKKVEEADNEMEIKRKQIQDLKMHAAKLKEEQPEKAFGIEQKHLILEHRFTQLQMPXXXXXXXXXXXXXXXXFLRNLDDQKAWVDDKLLLAESTNFGNNLLTVQQLLRRHRYLATEVNNHKPQLEYLKEEGAVLIEEVSPMQREKFVAGLQELESLWNRLEHSIDLRQQRLKESEATQTFLFDAEEAESWLWEQELFLLSEERGIRDQEAAINVIKKHDARQKTIEDYGEEITKLGTRSRLLIEKDHPQADRIALAQSHVDKVYAGLRDLCLEKKQRLSEIQKLNHLYREIVDLENWIYERTLVASSHDLGVDFEHCCLLRERFDEFFHETHLLGKDRVKAANDLCASLISQCHADSAEIAQWHDRINDSWAELQELMQTRIQLLRTAWEFYKYLSSCQDVLDRICEKIAS-IPTDVSKDSQSVAIQQRKHATFLSDAQALEGQVQWVVDEANHLLPSYAGQKEWHICERRDDVLATWNQLNMQAERRRHQLEDAADLQRFFSMVRELLQWMDLVALQINEKTRPKDVSGVELLINDHRSIKAEIAAREESMSICVNLGRTLLHRGRVGVDEVRAALINLITRKYSLEDMWEERWDYLQLILEVYQFARDASVAEAWILAQEPYLANKTLGETLDETLSLLKKHINFEKTVMSQEERFEALEKLTTME 6315
             G+DL++  A  +KHE  + D++A E ++  +   +  L+ +   +   +  ++D V+  W  L +    R  RL A   +Q    D++ ++   ++L+A L+ E+      G   L  +H  +  EI+ R    +    +SD+         + +G +  AD  E     ++ +++    L  + N+K  +   K+ ++ FL      +     +   + + D G  +  V   I KH   E  ++     +  + + G++LI  ++  +  +   L+ +     ++ +L   RR KLE +L Y   + DC E + WI E+ K ++ D  S     N +  I  + KH+     +   +  I  + D  V  LS+       I+  +  +   +  L+    Q+   L +         + D ++ WI +KE ++ +     +LE       + D  + +M +   +V+ +N LA+KL +    P     V+KR  + N  W  L   + A R  L  + E + +  +   T + I EKS  + STD  G DLA +  L RR   ++RDM A++ K++  +   + LI K P       E ++      W  L  +   R   L+E+    +F+ D+  + +W++ M   + +   P  + D E  L  H++ K EI+  Q+ F  L   G ++++     Q   + + L  LEE  Q L + W  R   L+++  LQ+F     Q E+ LA +E FL+ +D+  S    + LL+KH+ F   L A+H  T+   +F  +++E     +D I  ++  IL R++     S E  ++L      QE  + + ++ +W+ +K+ +A DE++RE  N+  +  +H AFD E+ +N  R+   I    +++       D I  Q+  L   W +L+  +  K +K+ +A     F     +   W++ +   +   +   +     N+ LKK E  + ++    +    LK    +  + +      I ++  +   R+  L  P+  ++  L     +QQFLR+ +D+  W+ +K L+A S + G +LL+VQ L ++H  L  E+ + +P ++ L + G  +I + +    E+     + L+    +L     +R+ RL ++  +Q F  +A EA++W+ E+   L S + G RD+ +     KK +  Q+ +  +   I K+   +  LIE++H  +  IA   + V + Y  L  L  E++ RL E +KL    RE  +L  W+ ++  V +S D G D EH   L   F+ F    +   + RV+A  +    LI + +   + I    D     W EL++L+  R   L  A + + Y     + +  I EK AS I  D  +D +S+    RKH  F S+   ++GQV  V+ EA  L   Y   KE HI  +RD+ +  W  L  +   R+++L  A  LQ +F   R+L+ W++ +  +I        V+G ELL+   +    EI  R+E+ +     G+ L+        EV   +  L  R   L+    +R +  +L L+   F +DA + E WI ++EP L +  LG+++ +   LL++H +FEKTV +QEE+F+A++++T +E
Sbjct: 1952 LGRDLNSALALLRKHEGFENDLVALEAQLQVLVEDSVRLQAKYPSNASAIAQQQDKVVAAWNDLKERSTARGDRLAASSDLQTFLTDVRDIVSWSSNLRAALQAEEHVSDAAGATALKIQHDAIYGEIEAREDKFRYLNELSDSM--------VQTGHYAAADVEEKCAAMLDERQK----LHAAWNKKKIMLEQKIDLFCFLRDAKQIDNLSSSQQAALSSSDFGQTVEDVQNKIRKHDEFERLIQTQEEKVSLLQEHGRKLIEQRHYDSANIQTILQGVLARRQKVKDLCAVRRYKLEDALLYAKFVRDCAEAKYWINEKQKKLEADAASYAEVTNLDEKIKKLQKHQAFQAEVAANQGRIQEIQDTGVILLSKQHESSPEIKRAIEIVLEAWQGLLAELEQRGRGLEEAQDSLEFNSQLDKIEAWIRDKEMMVQASDTGRDLEHCNALMRKLDDVDSDMRVDDQRVKHINQLADKLINQAQVPADTQSVDKRRKDFNYNWRQLQGALNAYRALLGGANEIHVFNRDVDDTADRIAEKSLAMSSTD-TGRDLAAVEALIRREEALERDMSAVKQKIDQHETAAEFLIKKYPERGAQHIERKLEELHKSWGNLQALSVKRQSILNEAYLAHKFVSDVKELELWVNDMIKKMNNTQSPSTINDCETQLELHQERKVEIEGRQEAFAGLKQQGEQLSKRPQQQQPDNVRKYLLVLEELHQTLNEAWSERARDLTEAHQLQLFKAQVEQVEIWLANKEAFLNNDDLGDSYTAVERLLKKHDEFEKLLHADHVDTLQ--KFANSILEGEPKDADLIREKLAYILRRKQKLLELSEERKQRLTQSHQLQEFLRSLYEIDRWLVQKLQVALDENYREPSNLQSKIQKHAAFDAELLSNSPRVQSVIHEGERLIRGDHFAKDEIAQQVQLLEGDWLKLKGASQTKKDKLQQAYDALAFNRSVDEFNNWMDEVELQLSSEDYGKDLAAVSNL-LKKHERLEADVAHHGELADQLKQKDEQFFQAEHFLRHEIHERATVSIRRYNTLHEPLGIRRENLEDSLSLQQFLRDAEDELQWLAEKQLVAGSQDLGTSLLSVQGLQKKHNSLEAELTSQEPLIQALLQRGQQMIRD-NHFASEQLQYKSELLQKQLVQLRDLAAIRRLRLLDAVESQLFYVEANEADAWMREKRPVLSSSDYG-RDEVSVQGHQKKLEVLQRELTAFKPSIEKVAKLATGLIERNHFDSSNIAEKNAQVGQEYEDLLRLAKERESRLGECKKLFEYLRETEELHEWVGDQMAVTASEDYGEDVEHVEQLILAFESFVSNLNA-NEARVEACLERGDRLIQENNPYRSSIKSKRDETKQLWEELKDLVHARQDALAGAKQVHVYDRVADETIQLINEKDASLISEDYGQDLESIQALGRKHQVFESELVGIQGQVDSVLAEAAKLGEIYPDAKE-HIEVKRDETVEAWTDLKEKTAARKNKLSQAEQLQSYFDEYRDLIAWINEMLAKITAPELANSVAGAELLLASTKDHDTEIRTRDETFAKFAANGQQLIKEKHFLAHEVEDKIKVLQARHELLKHTLNKRREIYELNLDTQLFLKDAEILEQWISSREPQLKDTKLGDSIPQVEDLLRRHEDFEKTVAAQEEKFQAIKRITMLE 3585          

HSP 3 Score: 340.502 bits (872), Expect = 4.173e-93
Identity = 395/1713 (23.06%), Postives = 791/1713 (46.18%), Query Frame = 1
Query: 1267 ALRDELIRQEKLEQLALRFDRKAGMRE---AWLTENQRLITQDNFGQDLSAVEAAGKKHEAIKTDILAYEERVNSVTLVTSELENECYHDVERVLCRRDNVIRLWEKLLDMLAVRKLRLDACYKVQKLFQDIKHLLDLINDLKARLKTEDIGRHLMGVEDLIHKHSLLEIDIRMVGTKIEGIMSDAQPFINSEFGLGSGDFQPADPNEVILRTVNLKEEYDNLLELSRNRKDNLSASKVMWEFLWGVADEEQWMKEKIQLMLNPDLGHDLSSVHRLISKHKVIEEDVRNHSNYLQNVIQGGQQLILDKNPGAEKVADXXXXXXXXXXXXXXXXXXRRSKLEQSLAYFHCLADCGEVEIWIIEQVKLVKIDETSINEESIITDIHKHEQLSKSIEDYESNINSLDEQVKKL---SEGDLELVTIEEKVSNIKSQYAILIELTNQKQNKLTDTLSLFRVLRKADTVKTWIDEKEKLLMSLIPTDELEELEVFRHRFDGFEKEMNIQADQVEFVNTLAEKLSDMDHPQIADVVNKRFELNKLWNSLADLVEARREQLQTSYEFNQYLLECKQTGEWIREKSRLVESTDELGDDLAGIMQLQRRMGGMQRDMDAIRAKLEHLDEEMDTLIAKRPNXXXXXXXXXXXXXXFWAELGDMLADRDDRLSESSELQRFLQDLDHIHIWLSKMQTTVASEDLPKDLADAEKSLVQHEQLKEEIDSYQDEFIRLLDYGRRITEDKTDAQYMFLSQRLNALEEGWQELCQMWENRXXXXXXXXXXXVFLRDAIQSEVLLAQEENFLSKEDIPISIENSQNLLRKHEGFLTTLQANHDHTIAVIEFGRNLVERGHFCSDKINLRVKSILXXXXXXXXXXXXAYEKLKDQVLYQELSQDIDDLSKWIQEKM--IIATDESFREEKNI---ARRYNRHRAFDEEIQANKDRLCQAIDYAMQIVEERPQLADMIYPQIDSLNQQWEELEQTTFLKGEKMIEANREAIFEEGTMDVMTWLXXXXXXXXXXXXXXXXXXXXXXKLKKVEEADNEMEIKRKQIQDLKMHAAKL--KEEQPEKAFGIEQKHLILEHRFTQLQMPXXXXXXXXXXXXXXXXFLRNLDDQKAWVDDKLLLAESTNFGNNLLTVQQLLRRHRYLATEVNNHKPQLEYLKEEGAVLIEEVSPMQREKFVAGLQELESLWNRLEHSIDLRQQRLKESEATQTFLFDAEEAESWLWE--QELFLLSEERGIRDQEAAINVIKKHDARQKTIEDYGEEITKLGTRSRLLIEK-DHPQADRIALAQSHVDKVYAGLRDLCLEKKQRLSEIQKLNHLYREIVDLENWIYERTLVASSHDLGVDFEHCCLLRERFDEFFHETHLLGKDRVKAANDLCASLISQCHADSAEIAQWHDRINDSWAELQELMQTRIQLLRTAWEFYKYLSSCQDVLDRICEKIASIPTDVSKDSQSVAIQQRKHATFLSDAQALEGQVQWVVDEANHLLPSYAGQKEWHICERRDDVLATWNQLNMQAERRRHQLEDAADLQRFFSMVRELLQWMDLVALQINEKTRPKDVSGVELLINDHRSIKAEIAAREESMSICVNLGRTLLHRGRVGVDEVRAALINLITRKYSLEDMWEERWDYLQLILEVYQFARDASVAEAWILAQEPYLANKTLGETLDETLSLLKKHINFEKTVMSQEERFEALEKLTTMEIRAKEITKESILLK 6357
            A++D    +++L Q +  F + A   +    WL +  R+   +N+ +DLS +    +KH+A + ++ A E ++ +VT     L  +  + V  V  R  ++ + W+ LL +   +  +L+     ++  + ++     +++L + L++ D+G  L   +DLI+K  +LE +I +   K+  ++S      +       G F   +   +   T  L++ + +L + ++ R+  L  S    +F++ +  E QW+ E +    + +LG +L     L  KHK +E +++ H   +   +  GQ LI  ++P  E+V    ++LE  W +L      R  KL+ SL     L D GE+E W+ E+  +++  E   + +S    + KH+ +   ++ Y   +  +      +   +  D +++  ++++  I+     L +L +Q+Q +L ++L       ++D V+ WI E+E+   S     + E L++ +++FD  +  + + AD+V+    LA+KL D + P   +V  ++ +L   W +L  L+  R ++L  + E +++  +  +    I++K+  +  + ELG DL   + L R+  G + D+ A+ A+L+ L E+   L AK P++   I +++  +   W +L +    R DRL+ SS+LQ FL D+  I  W S ++  + +E+   D A A    +QH+ +  EI++ +D+F  L +    + +    A    + ++  A+ +  Q+L   W  ++ +L Q + L  FLRDA Q + L + ++  LS  D   ++E+ QN +RKH+ F   +Q   +    + E GR L+E+ H+ S  I   ++ +L RR+  K        KL+D +LY +  +D  +   WI EK   + A   S+ E  N+    ++  +H+AF  E+ AN+ R+ +  D  + ++ ++ + +  I   I+ + + W+ L      +G  + EA     F      +  W+      +  ++   +      + ++K+++ D++M +  ++++ +   A KL  + + P     ++++     + + QLQ  +   +  L     I  F R++DD    + +K L   ST+ G +L  V+ L+RR   L  +++  K +++  +     LI++      +     L+EL   W  L+     RQ  L E+     F+ D +E E W+ +  +++        I D E  + +   H  R+  IE   E    L  +   L ++    Q D +      +++++  L +   E+ + L+E  +L     ++  +E W+  +    ++ DLG  +     L ++ DEF     LL  D V        S++     D+  I +    I     +L EL + R Q L  + +  ++L S  ++   + +K+     +  ++  ++  + +KHA F ++  +   +VQ V+ E   L+      K+  I ++   +   W +L   ++ ++ +L+ A D   F   V E   WMD V LQ++ +   KD++ V  L+  H  ++A++A   E                     E+       I R  +L +    R + L+  L + QF RDA     W+  ++    ++ LG +L     L KKH + E  + SQE   +AL +     IR      E +  K
Sbjct: 1381 AVKDRAFERKRLLQASKDFHKFAAEADDLKVWLQDKTRIAGDENY-RDLSNLPRKLQKHQAFERELRANEGQLRNVTKDGQAL-VQAGNRVPEVESRVADLNKRWKDLLTLSEDKGRKLEQAASQREHNRSLEDAKKKVDELDSALRSGDVGNDLRSCKDLINKQQILESEITIWDQKVAELVSTGDDMAHG------GHF---NAQNIEAGTKELQQRFKDLRDPTQRRRAKLEESLNYHKFVFELDSEFQWINEHLPAAKSNELGQNLHQAQSLHKKHKKLEAEIKGHQPMINKALVAGQSLISQQHPEREQVESLCQQLEQAWQDLERHCGERSRKLDMSLKAQQYLFDAGEIESWLGERNNVLRSTEYGRDRDSAAKLLTKHKTIELELDTYSGIVTEMGHSCAAMVAANHPDSKVLAAKQQL--IEKMLKSLHKLASQRQGRLMESLYKHEYFLESDEVEQWIREQEQAASSEDYGQDFEHLQLLQNKFDDLKHRVEVGADRVDQCELLAKKLIDSESPYANEVEKRQEQLRTSWENLLQLLNQREQKLHAAGEIHRFHRDVAEALFRIQDKNAAL--SQELGRDLNSALALLRKHEGFENDLVALEAQLQVLVEDSVRLQAKYPSNASAIAQQQDKVVAAWNDLKERSTARGDRLAASSDLQTFLTDVRDIVSWSSNLRAALQAEEHVSDAAGATALKIQHDAIYGEIEAREDKFRYLNELSDSMVQTGHYA-AADVEEKCAAMLDERQKLHAAWNKKKIMLEQKIDLFCFLRDAKQIDNLSSSQQAALSSSDFGQTVEDVQNKIRKHDEFERLIQTQEEKVSLLQEHGRKLIEQRHYDSANIQTILQGVLARRQKVKDLCAVRRYKLEDALLYAKFVRDCAEAKYWINEKQKKLEADAASYAEVTNLDEKIKKLQKHQAFQAEVAANQGRIQEIQDTGVILLSKQHESSPEIKRAIEIVLEAWQGLLAELEQRGRGLEEAQDSLEFNSQLDKIEAWIRDKEMMVQASDTGRDLEHCNAL-MRKLDDVDSDMRVDDQRVKHINQLADKLINQAQVPADTQSVDKRRKDFNYNWRQLQGALNAYRALLGGANEIHVFNRDVDDTADRIAEKSLAMSSTDTGRDLAAVEALIRREEALERDMSAVKQKIDQHETAAEFLIKKYPERGAQHIERKLEELHKSWGNLQALSVKRQSILNEAYLAHKFVSDVKELELWVNDMIKKMNNTQSPSTINDCETQLEL---HQERKVEIEGRQEAFAGLKQQGEQLSKRPQQQQPDNVRKYLLVLEELHQTLNEAWSERARDLTEAHQLQLFKAQVEQVEIWLANKEAFLNNDDLGDSYTAVERLLKKHDEF---EKLLHADHVDTLQKFANSILEGEPKDADLIREKLAYILRRKQKLLELSEERKQRLTQSHQLQEFLRSLYEIDRWLVQKLQVALDENYREPSNLQSKIQKHAAFDAELLSNSPRVQSVIHEGERLIRGDHFAKD-EIAQQVQLLEGDWLKLKGASQTKKDKLQQAYDALAFNRSVDEFNNWMDEVELQLSSEDYGKDLAAVSNLLKKHERLEADVAHHGELADQLKQKDEQFFQAEHFLRHEIHERATVSIRRYNTLHEPLGIRRENLEDSLSLQQFLRDAEDELQWLAEKQLVAGSQDLGTSLLSVQGLQKKHNSLEAELTSQEPLIQALLQRGQQMIRDNHFASEQLQYK 3069          

HSP 4 Score: 232.261 bits (591), Expect = 3.108e-60
Identity = 352/1713 (20.55%), Postives = 728/1713 (42.50%), Query Frame = 1
Query: 1216 INNAWNKLDKAEHARELALRDELIRQEKLEQLALRFDRKAGMREAWLTENQRLITQDNFGQDLSAVEAAGKKHEAIKTDILAYEERVNSVTLVTSELENECYHDVERVLCRRDNVIRLWEKLLDMLAVRKLRLDACYKVQKLFQDIKHLLDLINDLKARLKTEDIGRHLMGVEDLIHKHSLLEIDIRMVGTKIEGIMSDAQPFINSEFGLGSGDFQPADPNEVILRTVNLKEEYDNLLELSRNRKDNLSASKVMWEFLWGVADEEQWMKEKIQL-MLN-------------------PDLGHDLSSVHRLISKHKVIEEDVRNHSNYLQNVIQGGQQLILDKNPGAEKVADXXXXXXXXXXXXXXXXXXRRSKLEQSLAYFHCLADCGEVEIWIIEQVKLVKIDETSINEESIITDIHKHEQLSKSIEDYESNINSLDEQVKKLSEGDLELVTIEEKVSNIKSQYAILIELTNQKQNKLTDTLSLFRVLRKADTVKTWIDEKEKLLMSLIPTDELEELEVFRHRFDGFEKEMNIQADQVEFVNTLAEKLSDMDHPQIADVVNKRFELNKLWNSLADLVEARREQLQTSYEFNQYLLECKQTGEWIREKSRLVESTDELGDDLAGIMQLQRRMGGMQRDMDAIRAKLEHLDEEMDTLIAKRPNXXXXXXXXXXXXXXFWAELGDMLADRDDRLSESSELQRFLQDLDHIHIWLSKMQTTVASEDLPKDLADAEKSLVQHEQLKEEIDSYQDEFIRLL-DYGRRITEDKTDAQYMFLSQRLNALEEGWQELCQMWENRXXXXXXXXXXXVFLRDAIQSEVLLAQEENFLSKEDIPISIENSQNLLRKHEGFLTTLQANHDHTIAVIEFGRNLVERGHFCSDKINLRVKSILXXXXXXXXXXXXAYEKLKDQVLYQELSQDIDDLSKWIQEKMIIATDESFREEKNIARRYNRHRAFDEEIQANKDRLCQAIDYAMQIVEERPQLADMIYPQIDSLNQQWEELEQTTFLKGEKMIEANREAIFEEGTMDVMTWLXXXXXXXXXXXXXXXXXXXXXXKLKKVEEADNEMEIKRKQIQDLKMHAAKLKEEQPEKAFGIEQKHLILEHRFTQLQMPXXXXXXXXXXXXXXXXFLRNLDDQKAWVDDKLLLAESTNFGNNLLTVQQLLRRHRYLATEVNNHKPQLEYLKEEGAVLIEEVSPMQREKFVAGLQE-LESLWNRLEHSIDL---RQQRLKESEATQTFLFDAEEAESWLWEQELFLLSEERG---IRDQEAAINVIKKHDARQKTIEDYGEEITKLGTRSRLLIEKDHPQADRIALAQSHVDKVYAGLRDLCLEKKQRLSEIQKLNHLYREIVDLENWIYERTLVASSHDLGVDFEHCCLLRERFDEFFHETHLLGKDRVKAANDLCASLISQCH--ADSAEIAQWHDRINDSWAELQELMQTRIQLLRTAWEFYKYLSSCQDVLDRICEK-IASIPTDVSKDSQSVAIQQRKHATFLSDAQALEGQVQWVVDEANHLLPSYAGQKEWHICERRDDVLATWNQLNMQAERRRHQLEDAADLQRFFSMVRELLQWMDLVALQINEKTRPKDVSGVELLINDHRSIKAEIAAREESMSICVNLGRTLLHRG-RVGVDEVRAALINLITRKYSLEDMWEERWDYLQLILEVYQFARDASVAEAWILAQEPYLANKTLGETLDETLSLLKKHINFEK 6258
            I+  W +L+ A+  RE +L       E    + L F+R     + W++E    +       DL  V+A  ++H+ ++ ++   E++VN VT + + ++N    + + V  R+  V  +W+++    +  + R+++    Q      K LL  I+ +K +L  ++  R +    +L+ KH+ L  DIR   T+   ++         + G    D +P +  E +     LK E D +                      G A++++W+ + + L M N                    +LG  L  V  ++ +H   E+ +      L+       +LI + +  ++ + D   ++      + +    R+  L+ S  +    A+  ++++W+ ++ ++   DE   +  ++   + KH+   + +   E  + ++ +  + L +    +  +E +V+++  ++  L+ L+  K  KL    S     R  +  K  +DE +  L S    ++L   +   ++    E E+ I   +V  + +  + ++   H    ++     EL + +  L D  + RR +L+ S  +++++ E     +WI E     +S +ELG +L     L ++   ++ ++   +  +        +LI+++  + E +      LE  W +L     +R  +L  S + Q++L D   I  WL +    + S +  +D   A K L +H+ ++ E+D+Y      +       +  +  D++ +   Q+L  +E+  + L ++   RQG L +SL    +  ++ + E  + ++E   S ED     E+ Q L  K +     ++   D         + L++     ++++  R + +    E+  +  N+  +KL          +D+ +    IQ+K    + E  R+  +      +H  F+ ++ A + +L   ++ ++++  + P  A  I  Q D +   W +L++ +  +G+++  ++    F     D+++W   +  ++   E   +      +K++  +    E+E +  + + L   +  + +     A  +E+K   +     +L      KKI L Q+  +  FLR+          +     S++FG  +  VQ  +R+H      +   + ++  L+E G  LIE     QR    A +Q  L+ +  R +   DL   R+ +L+++     F+ D  EA+ W+ E++  L ++      + + +  I  ++KH A Q  +      I ++     +L+ K H  +  I  A   V + + GL     ++ + L E Q       ++  +E WI ++ ++  + D G D EHC  L  + D+   +   +   RVK  N L   LI+Q    AD+  + +     N +W +LQ  +     LL  A E + +     D  DRI EK +A   TD  +D  +V    R+      D  A++ ++      A  L+  Y  +   HI  + +++  +W  L   + +R+  L +A    +F S V+EL  W++ +  ++N    P  ++  E  +  H+  K EI  R+E+ +     G  L  R  +   D VR  L+ L     +L + W ER   L    ++  F       E W+  +E +L N  LG++      LLKKH  FEK
Sbjct: 1058 IHQIWQRLNNAKAQREKSL-------EGASSVEL-FNRTCDEAKVWMSEKMLQLDTAVITPDLRTVQALQRRHQNLERELAPVEDKVNRVTYLGNSVKNAYPAEKDNVNARQQEVQDMWQQVQQRGSDLRNRIESEVGQQVFNNSAKVLLAWIDSVKDQLNADESARDVETANNLLKKHNDLGDDIRAHDTEFVEVI---------QLGKQLSDGKP-NMAETVAVIERLKAEQDAIHR--------------------GWAEKQKWLLQCVDLQMFNREADKIDATTKSHEAFLEYNNLGASLDEVEAILKRHLDFEKSLMAQDKILKGFSDNADKLISNDHYDSKYIGDRRNQVLGKRKAVKDRAFERKRLLQASKDFHKFAAEADDLKVWLQDKTRIAG-DENYRDLSNLPRKLQKHQAFERELRANEGQLRNVTKDGQALVQAGNRVPEVESRVADLNKRWKDLLTLSEDKGRKLEQAASQREHNRSLEDAKKKVDELDSALRSGDVGNDLRSCKDLINKQQILESEITIWDQKVAELVSTGDDMAHGGHFNAQNIEAGTKELQQRFKDLRDPTQRRRAKLEESLNYHKFVFELDSEFQWINEHLPAAKS-NELGQNLHQAQSLHKKHKKLEAEIKGHQPMINKALVAGQSLISQQHPEREQVESLCQQLEQAWQDLERHCGERSRKLDMSLKAQQYLFDAGEIESWLGERNNVLRSTEYGRDRDSAAKLLTKHKTIELELDTYSGIVTEMGHSCAAMVAANHPDSKVLAAKQQL--IEKMLKSLHKLASQRQGRLMESLYKHEYFLESDEVEQWIREQEQAASSEDYGQDFEHLQLLQNKFDDLKHRVEVGADRVDQCELLAKKLIDSESPYANEVEKRQEQLRTSWENLLQLLNQREQKLHAAGEIHRFHRDVAEALFRIQDKNAALSQELGRDLNSALALLRKHEGFENDLVALEAQLQVLVEDSVRLQAKYPSNASAIAQQQDKVVAAWNDLKERSTARGDRLAASSDLQTFLTDVRDIVSWSSNLRAALQAEEHVSDAAGATALKIQH-DAIYGEIEAREDKFRYLNELSDSMVQTGHYAAADVEEKCAAMLDERQKLHAAWNKKKIMLEQKIDLFCFLRDAKQIDNLSSSQQAALSSSDFGQTVEDVQNKIRKHDEFERLIQTQEEKVSLLQEHGRKLIE-----QRHYDSANIQTILQGVLARRQKVKDLCAVRRYKLEDALLYAKFVRDCAEAKYWINEKQKKLEADAASYAEVTNLDEKIKKLQKHQAFQAEVAANQGRIQEIQDTGVILLSKQHESSPEIKRAIEIVLEAWQGLLAELEQRGRGLEEAQDSLEFNSQLDKIEAWIRDKEMMVQASDTGRDLEHCNALMRKLDDVDSDMR-VDDQRVKHINQLADKLINQAQVPADTQSVDKRRKDFNYNWRQLQGALNAYRALLGGANEIHVFNRDVDDTADRIAEKSLAMSSTDTGRDLAAVEALIRREEALERDMSAVKQKIDQHETAAEFLIKKYPERGAQHIERKLEELHKSWGNLQALSVKRQSILNEAYLAHKFVSDVKELELWVNDMIKKMNNTQSPSTINDCETQLELHQERKVEIEGRQEAFAGLKQQGEQLSKRPQQQQPDNVRKYLLVLEELHQTLNEAWSERARDLTEAHQLQLFKAQVEQVEIWLANKEAFLNNDDLGDSYTAVERLLKKHDEFEK 2721          

HSP 5 Score: 125.561 bits (314), Expect = 5.836e-28
Identity = 349/1735 (20.12%), Postives = 702/1735 (40.46%), Query Frame = 1
Query: 1321 FDRKAGMREAWLTENQRLITQDNFGQDLSAVEAAGKKHEAIKTDILAYEERVNSVTLVTSELENECYHDVERVLCRRDNVIRLWEKLLDMLAVRKLRLDACYKVQKLFQDIKHLLDLINDLKARLKTEDIGRHLMGVEDLIHKHSLLEIDIRMVGTKIEGIMSDAQPFINSEFGLGSGDFQPADPNEVILRTVNLKEEYDNLLELSRNRKDNL----------SASKVMWEFLWGVADEEQWMKEKIQLMLNPD-LGHDLSSVHRLISKHKVIEEDVRNHSNYLQNVIQGGQQLILDKNPGAEKVADXXXXXXXXXXXXXXXXXXRRSKLEQSLAYFHCLADCGEVEIWIIEQVKLV-------KIDETSINEESII------TDIHKHEQLSKSIEDYESNINSLDEQVKKLSEGDLELVT--------IEEKVSNIKSQYAILIELTNQKQNKLTDTLSLFRVLRKADTVKTWIDEKEKLLMSLIPTDE----LEELEVFRHRFDGFEKEMNIQADQVEFVNTLAEKLSDMDHPQIADVVNKRFELNKLWNSLADLVEARR---EQLQTSYEFNQYLLECKQTGEWIREKSRLVESTDELGDDLAGIMQLQRRMGGMQRDMDAIRAKLEHLDEEMDTLIAKRPNXXXXXXXXXXXXXXFWAELGDMLADRDDRLSESSELQRFLQDLDHIHIWLSKMQTTVASEDLPKDLADAEKSLVQHEQLKEEIDSYQDEFIRLLDYGRRITEDKTD--AQYMFLSQRLNALEEGWQELCQMWENRXXXXXXXXXXXVFLRDAIQSEVLLAQEENFLSKEDIPISIENSQNLLRKHEGFLTTLQANHDHTIAVIEFGRNLVERGHFCSDKI--NLRVKSILXXXXXXXXXXXXAYEKLKDQ-------VLYQ-ELSQDIDDLSKWIQEKMIIATDESFREE-KNIARRYNRHRAFDEEIQANKDRLCQAIDYAMQIVEERPQLADMIYPQIDSLNQQWEELEQTTFLKGEKMIEANREAIFEEGTMDVMTWLXXXXXXXXXXXXXXXXXXXXXXKLKKVEEADNEMEIKRKQIQDLKMHAAKLKEEQPEKAFGIEQKHLILEHRFTQLQMPXXXXXXXXXXXXXXXXFLRNLDDQKAWVDD--KLLLAE---STNFGNNLLTVQQLLRRHRYLATEVNNHKPQLEYLKEEGAVLIEE---VSPMQREKFVAGL---QELESLWNR----LEHSIDLRQQRLKESEATQTFLFDAEEAESWLWEQELFLLSEERGIRDQEAAINVIKKHDARQKTIEDYGEEITKLGTRSRLLIEKDHPQADRIALAQSHVDKVYAGLRDLCLEKKQRLSEIQKLNHLYREIVDLENWIYERTLVASSHDLGVDFEHCCLLRERFDEF-----FHETHLLGKDRVKAANDLCASLISQCHADSAEIAQWHDRINDSWAELQELMQTRIQLLRTAWEFYKYLSSCQDVLDRICEKIASI-PTDVSKDSQSVAIQQRKHATFLSDAQALEGQVQWVVDEANHLL-PSYAGQKEWHICERRDDVLATWNQLNMQAERRRHQLEDAADLQRFFSMVRELLQWMDLVALQINEKTRPKDVSGVELLINDHRSIKAEIAAREESMSICVNLGRTLLHR-GRVGVDEVRAALINLITRKYSLEDMWEERWDYLQLILEVYQFARDASVAEAWILAQEPYLANKTLGETLDETLSLLKKHINFEKTVMSQEERFEALEK 6300
            F R+    E W+ E +R+I  D    +   V+ A +K E   TD+ A  +RV  +         + +  +++++ R+  + ++W++L +  A R+  L+    V+   +        +++   +L T  I   L  V+ L  +H  LE ++  V  K+  +         +  G    +  PA+ + V  R   +++ +  + +   + ++ +          +++KV+  ++  V D+           LN D    D+ + + L+ KH  + +D+R H      VIQ G+QL   K   AE VA                    R K EQ   +        E + W+++ V L        KID T+ + E+ +        + + E + K   D+E ++ + D+ +K  S+   +L++        I ++ + +  +   + +   +++  L  +    +   +AD +K W+ +K +     I  DE    L  L     +   FE+E+     Q+  V    + L    + ++ +V ++  +LNK W  L  L E +    EQ  +  E N+ L + K+    + E    + S D +G+DL     L  +   ++ ++     K+  L    D +      + + I      L+  + +L D    R  +L ES    +F+ +LD    W+++      S +L ++L  A+    +H++L+ EI  +Q    + L  G+ +   +     Q   L Q+   LE+ WQ+L +    R   L  SL  Q +L DA + E  L +  N L   +     +++  LL KH+    T++   D    ++       E GH C+  +  N     +L  ++    +  ++  KL  Q        LY+ E   + D++ +WI+E+   A+ E + ++ +++    N+       ++   DR+ Q    A ++++     A+ +  + + L   WE L Q    + +K+  A     F     + +  ++    ++                L+K E  +N++     Q+Q L   + +L+ + P  A  I Q+   +   +  L+     +  +L     +Q FL ++ D  +W  +    L AE   S   G   L +Q     H  +  E+   + +  YL E    +++     +    EK  A L   Q+L + WN+    LE  IDL             FL DA++ ++    Q+  L S + G +  E   N I+KHD  ++ I+   E+++ L    R LIE+ H  +  I      V      ++DLC  ++ +L +        R+  + + WI E+     +      +     L E+  +      F       + R++   D    L+S+ H  S EI +  + + ++W  L   ++ R + L  A +  ++ S    +   I +K   +  +D  +D +      RK     SD +  + +V+ +   A+ L+  +        + +RR D    W QL       R  L  A ++  F   V +    +   +L ++     +D++ VE LI    +++ +++A ++ +         L+ +    G   +   L  L     +L+ +  +R   L      ++F  D    E W+      + N     T+++  + L+ H   +  +  ++E F  L++
Sbjct:  983 FYRECDDFEKWMKEKERMIKSD----EGEGVDNAKRKFEKFITDLSAASKRVEEIDGAVDTFRRQGHSQLDKIIARQRQIHQIWQRLNNAKAQREKSLEGASSVELFNRTCDEAKVWMSEKMLQLDTAVITPDLRTVQALQRRHQNLERELAPVEDKVNRV---------TYLGNSVKNAYPAEKDNVNARQQEVQDMWQQVQQRGSDLRNRIESEVGQQVFNNSAKVLLAWIDSVKDQ-----------LNADESARDVETANNLLKKHNDLGDDIRAHDTEFVEVIQLGKQLSDGKPNMAETVA-----------------VIERLKAEQDAIH----RGWAEKQKWLLQCVDLQMFNREADKIDATTKSHEAFLEYNNLGASLDEVEAILKRHLDFEKSLMAQDKILKGFSDNADKLISNDHYDSKYIGDRRNQVLGKRKAVKDRAFERKRLLQASKDFHKFAAEADDLKVWLQDKTR-----IAGDENYRDLSNLPRKLQKHQAFERELRANEGQLRNVTKDGQALVQAGN-RVPEVESRVADLNKRWKDLLTLSEDKGRKLEQAASQREHNRSLEDAKKK---VDELDSALRSGD-VGNDLRSCKDLINKQQILESEITIWDQKVAELVSTGDDMAHGGHFNAQNIEAGTKELQQRFKDLRDPTQRRRAKLEESLNYHKFVFELDSEFQWINEHLPAAKSNELGQNLHQAQSLHKKHKKLEAEIKGHQPMINKALVAGQSLISQQHPEREQVESLCQQ---LEQAWQDLERHCGERSRKLDMSLKAQQYLFDAGEIESWLGERNNVLRSTEYGRDRDSAAKLLTKHK----TIELELDTYSGIV------TEMGHSCAAMVAANHPDSKVLAAKQQLIEKMLKSLHKLASQRQGRLMESLYKHEYFLESDEVEQWIREQEQAASSEDYGQDFEHLQLLQNKFDDLKHRVEVGADRVDQCELLAKKLIDSESPYANEVEKRQEQLRTSWENLLQLLNQREQKLHAAGEIHRFHRDVAEALFRIQDKNAALSQELGRDLNSALAL--LRKHEGFENDLVALEAQLQVLVEDSVRLQAKYPSNASAIAQQQDKVVAAWNDLKERSTARGDRLAASSDLQTFLTDVRDIVSWSSNLRAALQAEEHVSDAAGATALKIQ-----HDAIYGEIEAREDKFRYLNELSDSMVQTGHYAAADVEEKCAAMLDERQKLHAAWNKKKIMLEQKIDLF-----------CFLRDAKQIDNLSSSQQAALSSSDFG-QTVEDVQNKIRKHDEFERLIQTQEEKVSLLQEHGRKLIEQRHYDSANIQTILQGVLARRQKVKDLCAVRRYKLEDALLYAKFVRDCAEAKYWINEKQKKLEAD--AASYAEVTNLDEKIKKLQKHQAFQAEVAANQGRIQEIQDTGVILLSKQHESSPEIKRAIEIVLEAWQGLLAELEQRGRGLEEAQDSLEFNSQLDKIEAWIRDKEMMVQASDTGRDLEHCNALMRKLDDVDSDMRVDDQRVKHINQLADKLINQAQVPADTQSVDKRRKDFNYNWRQLQGALNAYRALLGGANEIHVFNRDVDDTADRIAEKSLAMSSTDTGRDLAAVEALIRREEALERDMSAVKQKIDQHETAAEFLIKKYPERGAQHIERKLEELHKSWGNLQALSVKRQSILNEAYLAHKFVSDVKELELWVNDMIKKMNNTQSPSTINDCETQLELHQERKVEIEGRQEAFAGLKQ 2628          

HSP 6 Score: 117.087 bits (292), Expect = 2.093e-25
Identity = 98/408 (24.02%), Postives = 188/408 (46.08%), Query Frame = 1
Query: 5062 ADRIALAQSHVDKVYAGLRDLCLEKKQRLSEIQKLNHLYREIVDLENWIYER-TLVASSHDLGVDFEHCCLLRERFDEFFHETHLLGKDRVKAANDLCASLISQCHADSAEIAQWHDRINDSWAELQELMQTRIQLLRTAWEFYKYLSSCQDVLDRICEKIASIPTDV-SKDSQSVAIQQRKHATFLSDAQALEGQVQWVVDEANHLLPSYAGQKEWHICERRDDVLATWNQLNMQAERRRHQLEDAADLQRFFSMVRELLQWMDLVALQINEKTRPKDVSGVELLINDHRSIKAEIAAREESMSICVNLGRTLLHRGRVGVDEVRAALINLITRKYSLEDMWEERWDYLQLILEVYQFARDASVAEAWILAQEPYLANKTLGETLDETLSLLKKHINFEKTVMSQEE 6279
            AD +   Q  +++ Y  L+++  ++   L +   L   YRE  D E W+ E+  ++ S    GVD       + +F++F  +     K RV+  +    +   Q H+   +I     +I+  W  L      R + L  A     +  +C +    + EK+  + T V + D ++V   QR+H     +   +E +V  V    N +  +Y  +K+ ++  R+ +V   W Q+  +    R+++E     Q F +  + LL W+D V  Q+N     +DV     L+  H  +  +I A +      + LG+ L   G+  + E  A +  L   + ++   W E+  +L   +++  F R+A   +A   + E +L    LG +LDE  ++LK+H++FEK++M+Q++
Sbjct:  946 ADSVEKRQQRINQTYDELQEMAQKRHALLEDSIHLFGFYRECDDFEKWMKEKERMIKSDEGEGVDN-----AKRKFEKFITDLSAASK-RVEEIDGAVDTFRRQGHSQLDKIIARQRQIHQIWQRLNNAKAQREKSLEGASSVELFNRTCDEAKVWMSEKMLQLDTAVITPDLRTVQALQRRHQNLERELAPVEDKVNRVTYLGNSVKNAYPAEKD-NVNARQQEVQDMWQQVQQRGSDLRNRIESEVGQQVFNNSAKVLLAWIDSVKDQLNADESARDVETANNLLKKHNDLGDDIRAHDTEFVEVIQLGKQL-SDGKPNMAETVAVIERLKAEQDAIHRGWAEKQKWLLQCVDLQMFNREADKIDATTKSHEAFLEYNNLGASLDEVEAILKRHLDFEKSLMAQDK 1345          

HSP 7 Score: 77.0258 bits (188), Expect = 2.787e-13
Identity = 279/1527 (18.27%), Postives = 619/1527 (40.54%), Query Frame = 1
Query: 1891 RTVNLKEEYDNLLELSRNRKDNLSASKVMWEFLWGVADEEQWMKEKIQLMLNPDLGHDLSSVHRLISKHKVIEEDVRNHSNYLQNVIQGGQQLILDKNPGAEKVADXXXXXXXXXXXXXXXXXXRRSKLEQSLAYFHCLADCGEVEIWIIEQVKLVKIDETSINEE--SIITDIHKHEQLSK---SIEDYESNINSLDEQVKKLSEGDLELVTIEEKVSNIKSQYAILIELTNQKQNKLTDTLSLFRVLRKADTVKTWIDEKEKLLMSLIPTDELEELEVFRHRFDGFEKEMNIQADQVEFVNT--LAEKLSDMDHPQIADVVNKRFELNKLWNSLADLVEARREQLQTSY-EFNQYLLECKQTGEWIREKSRLVEST---------DELGDDLAGIMQLQRRMGGMQRDMDAIRAKLEHLDEEMDTLIAKRPNXXXXXXXXXXXXXXFWAELGDMLADRDDRLSESSELQRFLQDLDHIHIWLSKMQTTVASEDLPKDLADAEKSLVQHEQLKEEIDSYQDEFIR-------LLDYGRRITEDKTDAQYMFLSQRLNALEEGWQELCQMWENRXXXXXXXXXXXVFLRDAIQSEVLLAQEENFLSKEDIPISIENSQNLLRKHEGFLTTLQANHDHTIAVIEFGRNLVERGHFCSDKINLRVKSILXXXXXXXXXXXXAYEKLKDQVLYQELSQDIDDLSKWIQEKMIIATDESFREEKNIARR-YNRHRAFDEEIQANKDRLCQAIDYAMQIVEERPQLADMIYPQIDSLNQQWEELEQTTFLKGEK--MIEANREAIFEEGTMDVMTWLXXXXXXXXXXXXXXXXXXXXXXKLKKVEEADNEMEIKRKQIQDLKMHAAKLKEEQPEKAFGIEQKHLILEHRFTQLQMPXXXXXXXXXXXXXXXXFLRNLDDQKAWVDDKLLLAESTNFGNNLLTVQQLLRRHRYLATEVNNHKPQLEYLKEEGAVLIEEVSPMQREKFVAGLQE-LESLWNRLEHSIDLRQQRLKESEATQTFLFDAEEAESWLWEQELFLLSEERGIRDQEAAINVIKKHDARQKTIEDYGEEITKLGTRSRLLIEKDHPQADRIALAQSHVDKVYAGLRDLCLEKKQRLSEIQKLNHLYREIVDLENWIYERTLVASSHDLGVDFEHCCLLRERFDEFFHETHLLGKDRVKAANDLCASLISQCHADSAEIAQWHDRINDSWAELQELMQTRIQLLRTAWEFYKYLSSCQDVLD-RICEKIASIPTDVSKDSQSVAIQQRKHATFLSDAQALEGQVQWVVDEANHLLPS--YAGQKEWHICERRDDVLATWNQLNMQAERRRHQLEDAADLQRFFSMVRELLQWMDLVALQINEKTRP--KDVSGVELLIN---------DHRSIKAEIAAREESMSICVNLGRTLLHRGRVGVDEVRAALINLITRKYSLEDMWEERWDYLQLILEVYQFARDASVAEAWILAQEPYLANKTLGETLDETLSLLKKHINFEKTVMSQEERFEALEKLTTMEIRAKEITKES 6345
            R   + + YD L E+++ R   L  S  ++ F     D E+WMKEK + M+  D G  + +  R   K      D+   S  ++ +           +   +K+    +++  +W  L      R   LE + +       C E ++W+ E  K++++D   I  +  ++     +H+ L +    +ED  + +  L   VK     + + V   ++   ++  +  + +  +  +N++   +        A  +  WID  +  L +     ++E       + +      +I+A   EFV    L ++LSD   P +A+ V           ++ + ++A ++ +   + E  ++LL+C     + RE  ++  +T         + LG  L  +  + +R    ++ + A    L+   +  D LI+    D + I + R  +      + D   +R   L  S +  +F  + D + +WL   +T +A ++  +DL++  + L +H+  + E+ + + +          L+  G R+ E         +  R+  L + W++L  + E++   L Q+ S +   R    ++  + + ++ L   D+   + + ++L+ K +   + +         ++  G ++   GHF +  I    K + +R +  +  +     KL++ + Y +   ++D   +WI E +  A      +  + A+  + +H+  + EI+ ++  + +A+     ++ ++    + +      L Q W++LE+    +  K  M    ++ +F+ G  ++ +WL      +  TE   +  +   + L K +  + E++     + ++    A +       +  +  K  ++E     L      ++ +L++     ++    D+ + W+ ++   A S ++G +   +Q L  +   L   V     +++  +     LI+  SP   E  V   QE L + W  L   ++ R+Q+L  +     F  D  EA   + ++    LS+E G RD  +A+ +++KH+  +  +     ++  L   S  L  K    A  IA  Q  V   +  L++    +  RL+    L     ++ D+ +W         + +   D      L+ + D  + E     +D+ +  N+L  S++   H  +A++ +    + D   +L      +  +L    + + +L   + + +    ++ A   +D  +  + V  + RKH  F    Q  E +V  + +    L+    Y       I +    VLA   ++      RR++LEDA    +F     E   W       INEK +    D +    + N          H++ +AE+AA +  +    + G  LL +      E++ A+  ++     L    E+R   L+   +  +F       EAWI  +E  +     G  L+   +L++K  + +  +   ++R + + +L    I   ++  ++
Sbjct:  952 RQQRINQTYDELQEMAQKRHALLEDSIHLFGFYRECDDFEKWMKEK-ERMIKSDEGEGVDNAKRKFEKFIT---DLSAASKRVEEIDGAVDTFRRQGHSQLDKIIARQRQIHQIWQRLNNAKAQREKSLEGASSVELFNRTCDEAKVWMSE--KMLQLDTAVITPDLRTVQALQRRHQNLERELAPVEDKVNRVTYLGNSVKNAYPAEKDNVNARQQ--EVQDMWQQVQQRGSDLRNRIESEVGQQVFNNSAKVLLAWIDSVKDQLNADESARDVETANNLLKKHNDLGD--DIRAHDTEFVEVIQLGKQLSD-GKPNMAETV-----------AVIERLKAEQDAIHRGWAEKQKWLLQCVDLQMFNREADKIDATTKSHEAFLEYNNLGASLDEVEAILKRHLDFEKSLMAQDKILKGFSDNADKLISNDHYDSKYIGDRRNQVLGKRKAVKDRAFERKRLLQASKDFHKFAAEADDLKVWLQD-KTRIAGDENYRDLSNLPRKLQKHQAFERELRANEGQLRNVTKDGQALVQAGNRVPE---------VESRVADLNKRWKDLLTLSEDKGRKLEQAASQREHNRSLEDAKKKVDELDSALRSGDVGNDLRSCKDLINKQQILESEITIWDQKVAELVSTGDDMAHGGHFNAQNIEAGTKELQQRFKDLRDPTQRRRAKLEESLNYHKFVFELDSEFQWINEHLPAAKSNELGQNLHQAQSLHKKHKKLEAEIKGHQPMINKALVAGQSLISQQHPEREQVESLCQQLEQAWQDLERHCGERSRKLDMSLKAQQYLFDAG--EIESWLGERNNVLRSTEYGRDRDSAAKL-LTKHKTIELELDTYSGIVTEMGHSCAAMVAANHPDSKVLAAKQQLIEKMLKSLHKLASQRQGRLMESLYKHEYFLESDEVEQWIREQEQAASSEDYGQDFEHLQLLQNKFDDLKHRVEVGADRVDQCELLAKKLIDSESPYANE--VEKRQEQLRTSWENLLQLLNQREQKLHAAGEIHRFHRDVAEALFRIQDKNA-ALSQELG-RDLNSALALLRKHEGFENDLVALEAQLQVLVEDSVRLQAKYPSNASAIAQQQDKVVAAWNDLKERSTARGDRLAASSDLQTFLTDVRDIVSWSSNLRAALQAEEHVSDAAGATALKIQHDAIYGEIEAR-EDKFRYLNELSDSMVQTGHYAAADVEEKCAAMLDERQKLHAAWNKKKIMLEQKIDLFCFLRDAKQIDNLSSSQQAALSSSDFGQTVEDVQNKIRKHDEFERLIQTQEEKVSLLQEHGRKLIEQRHYDSANIQTILQ---GVLARRQKVKDLCAVRRYKLEDALLYAKFVRDCAEAKYW-------INEKQKKLEADAASYAEVTNLDEKIKKLQKHQAFQAEVAANQGRIQEIQDTGVILLSKQHESSPEIKRAIEIVLEAWQGLLAELEQRGRGLEEAQDSLEFNSQLDKIEAWIRDKEMMVQASDTGRDLEHCNALMRKLDDVDSDMRVDDQRVKHINQLADKLINQAQVPADT 2428          

HSP 8 Score: 73.559 bits (179), Expect = 3.365e-12
Identity = 70/316 (22.15%), Postives = 150/316 (47.47%), Query Frame = 1
Query: 2827 ADVVNKRFE-LNKLWNSLADLVEARREQLQTSYEFNQYLLECKQTGEWIREKSRLVESTDELGDDLAGIMQLQRRMGGMQRDMDAIRAKLEHLDEEMDTLIAKRPNXXXXXXXXXXXXXXFWAELGDMLADRDDRLSESSELQRFLQDLDHIHIWLSKMQTTVASEDLPKDLADAEKSLVQHEQLKEEIDSYQDEFIRLLDYGRRITEDKTDAQYMFLSQRLNALEEGWQELCQMWENRXXXXXXXXXXXVFLRDAIQSEVLLA---QEENFLSKEDIPISIENSQNLLRKHEGFLTTLQANHDHTIAVIEFGRNL 3762
            AD V KR + +N+ ++ L ++ + R   L+ S     +  EC    +W++EK R+++S     D+  G+   +R+      D+ A   ++E +D  +DT   +  +  + I   +  +   W  L +  A R+  L  +S ++ F +  D   +W+S+    + +  +  DL   +    +H+ L+ E+   +D+  R+   G  + ++   A+   ++ R   +++ WQ++ Q   + +  +   +  QVF   A   +VLLA     ++ L+ ++    +E + NLL+KH      ++A+    + VI+ G+ L
Sbjct:  946 ADSVEKRQQRINQTYDELQEMAQKRHALLEDSIHLFGFYRECDDFEKWMKEKERMIKS-----DEGEGVDNAKRKFEKFITDLSAASKRVEEIDGAVDTFRRQGHSQLDKIIARQRQIHQIWQRLNNAKAQREKSLEGASSVELFNRTCDEAKVWMSEKMLQLDTAVITPDLRTVQALQRRHQNLERELAPVEDKVNRVTYLGNSV-KNAYPAEKDNVNARQQEVQDMWQQVQQRGSDLRNRIESEVGQQVFNNSA---KVLLAWIDSVKDQLNADESARDVETANNLLKKHNDLGDDIRAHDTEFVEVIQLGKQL 1252          

HSP 9 Score: 70.0922 bits (170), Expect = 3.492e-11
Identity = 80/311 (25.72%), Postives = 136/311 (43.73%), Query Frame = 1
Query: 5374 HADSAEIAQWHDRINDSWAELQELMQTRIQLLRTAWEFYKYLSSCQDVLDRICEKIASIPTDVSKDSQSVAIQQRKHATFLSDAQALEGQVQWVVDEANHLLPSYAGQKEWHICERRDDVLATWNQLNMQAERRRHQLEDAADLQRFFSMVRELLQWMDLVALQINEKTRPKDVSGVELLINDHRSIKAEIAAREESMSICVNLGRTLLHRGRVGVDEVRAALINLITRKYSLEDMWEE---RWDYLQ--LILEVYQ--FARDASVAEAWILAQEPYLANKTLGETLDETLSLLKKHINFEKTVMSQEERF 6285
            +ADS E  Q   RIN ++ ELQE+ Q R  LL  +   + +   C D    + EK   I +D   + + V   +RK   F++D  A   +V+  +D A          +   I  R+  +   W +LN    +R   LE A+ ++ F     E   WM    LQ++      D+  V+ L   H++++ E+A  E+ ++    LG ++ +      D V A       R+  ++DMW++   R   L+  +  EV Q  F   A V  AWI + +  L        ++   +LLKKH +    + + +  F
Sbjct:  945 NADSVEKRQ--QRINQTYDELQEMAQKRHALLEDSIHLFGFYRECDDFEKWMKEKERMIKSD---EGEGVDNAKRKFEKFITDLSAASKRVE-EIDGAVDTFRRQGHSQLDKIIARQRQIHQIWQRLNNAKAQREKSLEGASSVELFNRTCDEAKVWMSEKMLQLDTAVITPDLRTVQALQRRHQNLERELAPVEDKVNRVTYLGNSVKNAYPAEKDNVNA-------RQQEVQDMWQQVQQRGSDLRNRIESEVGQQVFNNSAKVLLAWIDSVKDQLNADESARDVETANNLLKKHNDLGDDIRAHDTEF 1242          

HSP 10 Score: 61.2326 bits (147), Expect = 1.702e-8
Identity = 40/165 (24.24%), Postives = 84/165 (50.91%), Query Frame = 1
Query: 2632 DTVKTWIDEKEKLLMSLIPTDELEELEVFRHRFDGFEKEMNIQADQVEFVNTLAEKLSDMDHPQIADVVNKRFELNKLWNSLADLVEARREQLQTSYEFNQYLLECKQTGEWIREKSRLVESTDELGDDLAGIMQLQRRMGGMQRDMDAIRAKLEHLDEEMDTLI 3126
            D  ++W+ +K+++  + I   +L  +   + +    E E+  +  +   ++T  ++L    HP+ +++ ++   L + W +L  LVE RR QL+ + E  Q+  +  +   W+ EK  LV S D  G+D      L +R   +Q +++A    + +L+++ D LI
Sbjct:  615 DNEESWLVDKQRICKTGITAKDLRAVLSLQQKHKALEDEIKSRKPKSGQMSTAGKRLIGEQHPRSSEIQSRIDSLAEHWQALEALVELRRRQLEDAAEAYQFYTDANEAESWLNEKIALVNSRD-YGNDEPSAQALLQRHRDLQGELNAYSGDILNLNQQADKLI 778          

HSP 11 Score: 53.9138 bits (128), Expect = 3.160e-6
Identity = 98/420 (23.33%), Postives = 181/420 (43.10%), Query Frame = 1
Query: 4762 LQELESLWNRLEHS-----IDLRQQRLKESEATQ-TFLFDAEEA--ESWLWEQELFLLSEERGIRDQEAAINVIKKHDARQKTIEDYGEEITKLGTRSRLLIEKDHPQADRIALAQSHVDKVYAGLRDLCLEKKQRLSEIQKLNHLYREIVDLENWIYERTLVASSHDLGV------DFEHCCLLRERFDEFFHETHLLGKDRVKAANDLCASLISQCHADSAEIAQWHDRINDSWAELQELMQTRIQLLRTAWEFYKYLSSCQDVLDRICEKIASIPTDVS-KDSQSVAIQQRKHATFLSDAQALEGQVQWVVDEANHLLPSYAGQK---EWH-----ICERRDDVLATWNQLNMQAERRRHQLEDAADLQRFFSMVRELLQWMDLVALQINEKTRPKDVSGVELLINDHRSIKAEIAA 5952
            + ++E  W  LE++     + LR + L++ +  Q  + F+ +    E +L E  + +LS+ R +R  +A    +KKH+A    I    E    L   +  L  +++   +R+   +  V   +  L +L   ++  LS++  L +L REI      + E     +S D+G       +      L+E     + ET       +K  N       S  H D+A +AQ    + ++++EL      R   L  A  F+ ++    +    + +K     T ++ KD ++V   Q+KH       +ALE +++    ++  +  S AG++   E H     I  R D +   W  L    E RR QLEDAA+  +F++   E   W++     +N +    D    + L+  HR ++ E+ A
Sbjct:  363 VNDIEKAWQILEYAEHHREVALRDELLRQEKLEQLNYKFEKKSVLREGYLKEM-IQVLSDPRYLRQVDA---TLKKHEAISADILARVERFNDLTAMAEELDRENYHGKERVRRREQEVMAKWRQLLELLENQRLNLSQMSNLMNLLREIASTTEAVRELQQQFASEDVGPHLLGVEELLQAHSLQELQVNTYGET-------LKRFNRQALPYKSSEHKDAALLAQRLADLEEAYSELLRRSAARRARLEEARNFHHFMEDYDNEESWLVDKQRICKTGITAKDLRAVLSLQQKH-------KALEDEIKSRKPKSGQM--STAGKRLIGEQHPRSSEIQSRIDSLAEHWQALEALVELRRRQLEDAAEAYQFYTDANEAESWLNEKIALVNSRDYGNDEPSAQALLQRHRDLQGELNA 762          
BLAST of Spectrin beta chain vs. Ensembl Zebrafish
Match: sptbn1 (spectrin, beta, non-erythrocytic 1 [Source:ZFIN;Acc:ZDB-GENE-031006-3])

HSP 1 Score: 1785.39 bits (4623), Expect = 0.000e+0
Identity = 959/2241 (42.79%), Postives = 1448/2241 (64.61%), Query Frame = 1
Query:  343 PYPTKGKMRIHCLENVDKSLNFLIEQRVHLENMGAHDIVDGNARLTLGLIWTIILRFQIQDIVVEEDDTSEKRQAKDALLLWCQMKTAGYPNTNVRNFSTCWRDGLAFNAIIHRHRPDLLEYSALSRSNPNENLEQAIRIAEEKLGIPRLLDPEDVSVENPDEKSIMTYVVTFYHFFSKMKADSVHSKRVGKILSQSMETEEMMVHYDKLTSNLLEWINQTIELLNDRTFANSLSGVQQQLAAFNTYRVTEKPPKFQEKGNLEMLLFSIQSQMRANNQMPYLPIEGKLISDINNAWNKLDKAEHARELALRDELIRQEKLEQLALRFDRKAGMREAWLTENQRLITQDNFGQDLSAVEAAGKKHEAIKTDILAYEERVNSVTLVTSELENECYHDVERVLCRRDNVIRLWEKLLDMLAVRKLRLDACYKVQKLFQDIKHLLDLINDLKARLKTEDIGRHLMGVEDLIHKHSLLEIDIRMVGTKIEGIMSDAQPFINSEFGLGSGDFQPADPNEVILRTVNLKEEYDNLLELSRNRKDNLSASKVMWEFLWGVADEEQWMKEKIQLMLNPDLGHDLSSVHRLISKHKVIEEDVRNHSNYLQNVIQGGQQLILDKNPGAEKVADXXXXXXXXXXXXXXXXXXRRSKLEQSLAYFHCLADCGEVEIWIIEQVKLVKIDETSINEESIITDIHKHEQLSKSIEDYESNINSLDEQVKKLSEGDLELVTIEEKVSNIKSQYAILIELTNQKQNKLTDTLSLFRVLRKADTVKTWIDEKEKLLMSLIPTDELEELEVFRHRFDGFEKEMNIQADQVEFVNTLAEKLSDMDHPQIADVVNKRFELNKLWNSLADLVEARREQLQTSYEFNQYLLECKQTGEWIREKSRLVESTDELGDDLAGIMQLQRRMGGMQRDMDAIRAKLEHLDEEMDTLIAKRPNXXXXXXXXXXXXXXFWAELGDMLADRDDRLSESSELQRFLQDLDHIHIWLSKMQTTVASEDLPKDLADAEKSLVQHEQLKEEIDSYQDEFIRLLDYGRRITEDKTDAQYMFLSQRLNALEEGWQELCQMWENRXXXXXXXXXXXVFLRDAIQSEVLLAQEENFLSKEDIPISIENSQNLLRKHEGFLTTLQANHDHTIAVIEFGRNLVERGHFCSDKINLRVKSILXXXXXXXXXXXXAYEKLKDQVLYQELSQDIDDLSKWIQEKMIIATDESFREEKNIARRYNRHRAFDEEIQANKDRLCQAIDYAMQIVEERPQLADMIYPQIDSLNQQWEELEQTTFLKGEKMIEANREAIFEEGTMDVMTWLXXXXXXXXXXXXXXXXXXXXXXKLKKVEEADNEMEIKRKQIQDLKMHAAKLKEEQPEKAFGIEQKHLILEHRFTQLQMPXXXXXXXXXXXXXXXXFLRNLDDQKAWVDDKLLLAESTNFGNNLLTVQQLLRRHRYLATEVNNHKPQLEYLKEEGAVLIEEVSPMQREKFVAGLQELESLWNRLEHSIDLRQQRLKESEATQTFLFDAEEAESWLWEQELFLLSEERGIRDQEAAINVIKKHDARQKTIEDYGEEITKLGTRSRLLIEKDHPQADRIALAQSHVDKVYAGLRDLCLEKKQRLSEIQKLNHLYREIVDLENWIYERTLVASSHDLGVDFEHCCLLRERFDEFFHETHLLGKDRVKAANDLCASLISQCHADSAEIAQWHDRINDSWAELQELMQTRIQLLRTAWEFYKYLSSCQDVLDRICEKIASIPTDVSKDSQSVAIQQRKHATFLSDAQALEGQVQWVVDEANHLLPSYAGQKEWHICERRDDVLATWNQLNMQAERRRHQLEDAADLQRFFSMVRELLQWMDLVALQINEKTRPKDVSGVELLINDHRSIKAEIAAREESMSICVNLGRTLLHRGRVGVDEVRAALINLITRKYSLEDMWEERWDYLQLILEVYQFARDASVAEAWILAQEPYLANKTLGETLDETLSLLKKHINFEKTVMSQEERFEALEKLTTMEIRA------------KEITKESILLKDKHKQER-----IENAIKIFQPPPSPELVHESPKVSISEEDEEGKSHQHKISVISKEAAEMCQSSETKT-----------DIRGILIRKHEWEYKNRKALNRSWHEFLVVLSIEKNKLLVYKDEKHYNEKPQDTYHKDSGLDLNDLVAAPASDYLKRPFVFRIKITSTGAEYLFQAKDEEDMLRWVNSINE--NSQKDLKSETTAPGKSSTLPACTSDPHVPST 6975
            P PTKG+MRIHCLENVDK+L FL EQRVHLENMG+HDIVDGN RLTLGLIWTIILRFQIQDI VE +D  EKR AKDALLLWCQMKTAGYPN N+ NF+T WRDG+AFNA+IH+HRPDL+++  L +SN + NL+ A  +AE+ LG+ +LLDPED+SV++PDEKS++TYVVT+YH+FSKMKA  V  KR+GK+L  ++ETE+M+  Y+ L S+LLEWI QTI +LN+R FANSL GVQQQL AFNTYR  EKPPKF EKGNLE+LLF+IQS+MRANNQ  Y+P EGKLISDIN AW +L+KAEH RELALR ELIRQEKLEQLA RFDRKA MRE WL+ENQRL++QDNFG DL AVEAA KKHEAI+TDI AYEERV +V  V  ELE E YHD++R+  R+DNV+RLWE LL++L  R+ RL+    +Q++FQ++ +++D ++++K  L ++D G+HL+GVEDL+ KH+L+E DI +   +++ + ++AQ F   E G     ++P DP  +  R  +++  Y  L +L+  R+  L  S+ +W+F W +A+EE W++EK Q++ + D G DL+   RL+S+H+ +E+++   S +LQ+ ++ GQ +    + G  K+ + + +++  W  L +L   R+++LE++ +     AD  +V+ W ++ +++V   +   +E S    + KH+  S  +  Y   I++L EQ + L         + E+++ I+ +Y  + ELT  ++  L D L+L+++  +AD  + WIDEKE+ L S+   ++LE+LEV +HRF+  E EMN QA +V  VN +A +L    HP   D+  ++ +LN  W+   DLV+ ++E L ++     Y L+C +T  WIREK++++EST ELG+DL G+M LQR++ GM+RD+ AI AKL  L  E D L  + P+  + I      +   W E+ + L  R++ L E+S+LQ+FL++LD    WLS+ QT +ASED+P  LA+AEK L QHE +K EI++Y++++ ++ D G  +T+D+TDAQYMFL QRL AL+ GW EL +MWENRQ LLSQS + Q+FLRD  Q+E  L  +E  L+  ++P ++E ++  ++K E F+TT+ AN D    V+E GR L   G+  +D+I  R  SI +R + N+  + E   +LKD    Q+  QD  +LS WI EKM+ A D S+ E +N+  ++ +H+AF  E+Q+NK+ L +      Q+V E+P+   ++  ++ +L + W ELE TT  K + + +AN+  +F +   D+  WL  +   I   +   +  +   + LKK +  +N++E++++++++L+  A  L++E  +    ++ +  ++E +F +L  P+  +K  L+  + I QF R+++D+  WV++++ LA ST+ GNNL TVQ L+++++ L  E+  H+P+ + + E    +++  SP   E     L +L+ LW+ +    + R  RL+E+   Q + FDA EAE+W+ EQEL+++SEE+  +D+++++ ++KKH   ++ +EDY E + +L   SR L+  +HP+++RI + QS VDK+YAGL+DL  E++ +L E  +L  L RE+ DLE WI ER +VA SH+LG D+EH  +L+ERF EF  +T  +G++RV   N +   LI+  HAD+A +A+W D +N++WA+L EL+ TR Q+L  ++E +K+    +++L RI +K   +P ++ +D  +V   QR H TF  D QAL  QV+ + D+A  L  +YAG K   I  R  +VL  W  L    E RR +L D  D  RFFSMVR+L+ WM+ V   I  + +P+DVS VELL+N+H+ IKAEI AR +S + C+ LG++LL R     +E++  L+ L  ++  + D WE+RW++L+LILEV+QF+RDA VAEAW+L QEPYL+++ LG+++DE   L+K+H  FEK+  + EERF ALE+LTT+E+              K  + + +  +D   Q+R      +N +   Q  P   +  E   V+        +S +    + S  A    + S++ T            + G L RKHEWE  N+KA +RSWH    V  I  +++  YKD K+  +     YH +  + L + V   A DY K+  VF++++T  G EYLFQAKD+E+M  W+ +I    +     +   TAP   ST PA +    +P+T
Sbjct:   22 PKPTKGRMRIHCLENVDKALQFLKEQRVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKEKRSAKDALLLWCQMKTAGYPNVNIHNFTTSWRDGMAFNALIHKHRPDLIDFDKLKKSNAHYNLQNAFNLAEQHLGLTKLLDPEDISVDHPDEKSVITYVVTYYHYFSKMKALKVEGKRIGKVLDNAIETEKMIEKYESLASDLLEWIEQTIIILNNRKFANSLVGVQQQLQAFNTYRTVEKPPKFTEKGNLEVLLFTIQSKMRANNQKVYMPREGKLISDINKAWERLEKAEHERELALRTELIRQEKLEQLARRFDRKAAMRETWLSENQRLVSQDNFGFDLQAVEAATKKHEAIETDIAAYEERVQAVVAVARELETENYHDIKRITARKDNVLRLWEYLLELLKARRQRLEMNLSLQRVFQEMLYIMDWMDEMKMLLLSQDYGKHLLGVEDLLQKHALVEADIGIQADRVKAVNNNAQRFAVDEEG-----YKPCDPQVIRDRVAHMEFCYQELTQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEQILSSDDCGKDLTGAVRLLSQHRALEDEMSGRSGHLQHTVREGQAMADAGHFGEAKIRERIADVQAQWAALEQLASVRKTRLEEACSLHQFQADADDVDTWTLDALRIVSTADVGHDEFSTQALVKKHKDASTEVASYRPVIDALHEQAQTLPPEQANSANVSERLAGIEERYKEVSELTRLRKQALQDALALYKMFSEADACELWIDEKEQWLNSMEIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLIHSGHPSEKDIKAQQDKLNTRWSQFRDLVDQKKESLNSALGVQNYHLDCNETKSWIREKTKVIESTQELGNDLTGVMALQRKLTGMERDLAAIEAKLGDLRGEADRLAGEHPDQAKAITGRLAEITAVWEEMKETLRTREESLGEASKLQQFLRELDDFQSWLSRTQTAIASEDMPNTLAEAEKLLAQHEGIKNEINNYEEDYQKMRDMGEMVTQDQTDAQYMFLRQRLQALDTGWNELHKMWENRQNLLSQSHAYQIFLRDTKQAEAFLNNQEYVLAHTEMPTTLEGAEAAIKKQEDFMTTMDANEDKINGVVEAGRRLASDGNINADRIQERAASIDDRHKKNREAAVELLMRLKDNRDLQKFLQDCQELSLWINEKMLTAQDMSYDEARNLHSKWLKHQAFMAELQSNKEWLDKIEKEGKQLVSEKPETEAVVKEKLAALQKMWTELETTTQTKAQCLFDANKAELFTQSCADLDKWLVGLEGQIQSDDYGKDLTSVNIL-LKKQQMLENQVEVRQREVEELQSQAHVLRQEGKDTD-EVDGRRKVVEQKFQELLDPLLKRKNFLMASREIHQFNRDVEDEILWVEERMPLATSTDHGNNLQTVQLLIKKNQTLQKEIQGHQPRCDDIFERSQSILKADSP-NVEGIRTRLSDLQGLWSLIMQETEKRHSRLEEAHKAQQYYFDAAEAEAWMSEQELYMMSEEKA-KDEQSSVAMLKKHQILEQAVEDYAETVHQLSKTSRGLVAANHPESERIGMRQSQVDKLYAGLKDLSEERRGKLEERFRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFREFARDTGNIGQERVDGVNRMADELINAGHADAATVAEWKDGLNEAWADLLELIDTRTQILAASYELHKFYHDAKEILGRILDKHKKLPEELGRDQNTVETLQRMHTTFEHDIQALGTQVRQLQDDAVRLQSAYAGDKADDIQRREGEVLEAWRSLLEACEGRRARLLDTGDKFRFFSMVRDLMLWMEDVIRLIETQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTACIELGKSLLARKHYASEEIKEKLLQLTDKRKDMIDKWEDRWEWLRLILEVHQFSRDAGVAEAWLLGQEPYLSSRELGQSVDEVEKLIKRHEAFEKSAATWEERFSALERLTTLELLEVRRLQEEEERRRKPPSPDPVQAQDGETQQREGEQIAQNGLPSDQDSPRDGVDGEMNGVA-------ERSSKEPSPIPSPGADRRGKGSQSATLPTKGQETPSAQLEGFLHRKHEWEGHNKKASSRSWHNVYCV--INNHEMGFYKDNKNAGQGI--PYHNEIPISLKEAVCEVAVDYKKKKHVFKLRVTD-GNEYLFQAKDDEEMNTWIQAIQNAGSGSSSSEKSETAPSNQST-PASSRAHTLPAT 2240          
BLAST of Spectrin beta chain vs. Ensembl Zebrafish
Match: sptbn1 (spectrin, beta, non-erythrocytic 1 [Source:ZFIN;Acc:ZDB-GENE-031006-3])

HSP 1 Score: 1713.74 bits (4437), Expect = 0.000e+0
Identity = 885/1983 (44.63%), Postives = 1331/1983 (67.12%), Query Frame = 1
Query:  343 PYPTKGKMRIHCLENVDKSLNFLIEQRVHLENMGAHDIVDGNARLTLGLIWTIILRFQIQDIVVEEDDTSEKRQAKDALLLWCQMKTAGYPNTNVRNFSTCWRDGLAFNAIIHRHRPDLLEYSALSRSNPNENLEQAIRIAEEKLGIPRLLDPEDVSVENPDEKSIMTYVVTFYHFFSKMKADSVHSKRVGKILSQSMETEEMMVHYDKLTSNLLEWINQTIELLNDRTFANSLSGVQQQLAAFNTYRVTEKPPKFQEKGNLEMLLFSIQSQMRANNQMPYLPIEGKLISDINNAWNKLDKAEHARELALRDELIRQEKLEQLALRFDRKAGMREAWLTENQRLITQDNFGQDLSAVEAAGKKHEAIKTDILAYEERVNSVTLVTSELENECYHDVERVLCRRDNVIRLWEKLLDMLAVRKLRLDACYKVQKLFQDIKHLLDLINDLKARLKTEDIGRHLMGVEDLIHKHSLLEIDIRMVGTKIEGIMSDAQPFINSEFGLGSGDFQPADPNEVILRTVNLKEEYDNLLELSRNRKDNLSASKVMWEFLWGVADEEQWMKEKIQLMLNPDLGHDLSSVHRLISKHKVIEEDVRNHSNYLQNVIQGGQQLILDKNPGAEKVADXXXXXXXXXXXXXXXXXXRRSKLEQSLAYFHCLADCGEVEIWIIEQVKLVKIDETSINEESIITDIHKHEQLSKSIEDYESNINSLDEQVKKLSEGDLELVTIEEKVSNIKSQYAILIELTNQKQNKLTDTLSLFRVLRKADTVKTWIDEKEKLLMSLIPTDELEELEVFRHRFDGFEKEMNIQADQVEFVNTLAEKLSDMDHPQIADVVNKRFELNKLWNSLADLVEARREQLQTSYEFNQYLLECKQTGEWIREKSRLVESTDELGDDLAGIMQLQRRMGGMQRDMDAIRAKLEHLDEEMDTLIAKRPNXXXXXXXXXXXXXXFWAELGDMLADRDDRLSESSELQRFLQDLDHIHIWLSKMQTTVASEDLPKDLADAEKSLVQHEQLKEEIDSYQDEFIRLLDYGRRITEDKTDAQYMFLSQRLNALEEGWQELCQMWENRXXXXXXXXXXXVFLRDAIQSEVLLAQEENFLSKEDIPISIENSQNLLRKHEGFLTTLQANHDHTIAVIEFGRNLVERGHFCSDKINLRVKSILXXXXXXXXXXXXAYEKLKDQVLYQELSQDIDDLSKWIQEKMIIATDESFREEKNIARRYNRHRAFDEEIQANKDRLCQAIDYAMQIVEERPQLADMIYPQIDSLNQQWEELEQTTFLKGEKMIEANREAIFEEGTMDVMTWLXXXXXXXXXXXXXXXXXXXXXXKLKKVEEADNEMEIKRKQIQDLKMHAAKLKEEQPEKAFGIEQKHLILEHRFTQLQMPXXXXXXXXXXXXXXXXFLRNLDDQKAWVDDKLLLAESTNFGNNLLTVQQLLRRHRYLATEVNNHKPQLEYLKEEGAVLIEEVSPMQREKFVAGLQELESLWNRLEHSIDLRQQRLKESEATQTFLFDAEEAESWLWEQELFLLSEERGIRDQEAAINVIKKHDARQKTIEDYGEEITKLGTRSRLLIEKDHPQADRIALAQSHVDKVYAGLRDLCLEKKQRLSEIQKLNHLYREIVDLENWIYERTLVASSHDLGVDFEHCCLLRERFDEFFHETHLLGKDRVKAANDLCASLISQCHADSAEIAQWHDRINDSWAELQELMQTRIQLLRTAWEFYKYLSSCQDVLDRICEKIASIPTDVSKDSQSVAIQQRKHATFLSDAQALEGQVQWVVDEANHLLPSYAGQKEWHICERRDDVLATWNQLNMQAERRRHQLEDAADLQRFFSMVRELLQWMDLVALQINEKTRPKDVSGVELLINDHRSIKAEIAAREESMSICVNLGRTLLHRGRVGVDEVRAALINLITRKYSLEDMWEERWDYLQLILEVYQFARDASVAEAWILAQEPYLANKTLGETLDETLSLLKKHINFEKTVMSQEERFEA 6291
            P PTKG+MRIHCLENVDK+L FL EQRVHLENMG+HDIVDGN RLTLGLIWTIILRFQIQDI VE +D  EKR AKDALLLWCQMKTAGYPN N+ NF+T WRDG+AFNA+IH+HRPDL+++  L +SN + NL+ A  +AE+ LG+ +LLDPED+SV++PDEKS++TYVVT+YH+FSKMKA  V  KR+GK+L  ++ETE+M+  Y+ L S+LLEWI QTI +LN+R FANSL GVQQQL AFNTYR  EKPPKF EKGNLE+LLF+IQS+MRANNQ  Y+P EGKLISDIN AW +L+KAEH RELALR ELIRQEKLEQLA RFDRKA MRE WL+ENQRL++QDNFG DL AVEAA KKHEAI+TDI AYEERV +V  V  ELE E YHD++R+  R+DNV+RLWE LL++L  R+ RL+    +Q++FQ++ +++D ++++K  L ++D G+HL+GVEDL+ KH+L+E DI +   +++ + ++AQ F   E G     ++P DP  +  R  +++  Y  L +L+  R+  L  S+ +W+F W +A+EE W++EK Q++ + D G DL+   RL+S+H+ +E+++   S +LQ+ ++ GQ +    + G  K+ + + +++  W  L +L   R+++LE++ +     AD  +V+ W ++ +++V   +   +E S    + KH+  S  +  Y   I++L EQ + L         + E+++ I+ +Y  + ELT  ++  L D L+L+++  +AD  + WIDEKE+ L S+   ++LE+LEV +HRF+  E EMN QA +V  VN +A +L    HP   D+  ++ +LN  W+   DLV+ ++E L ++     Y L+C +T  WIREK++++EST ELG+DL G+M LQR++ GM+RD+ AI AKL  L  E D L  + P+  + I      +   W E+ + L  R++ L E+S+LQ+FL++LD    WLS+ QT +ASED+P  LA+AEK L QHE +K EI++Y++++ ++ D G  +T+D+TDAQYMFL QRL AL+ GW EL +MWENRQ LLSQS + Q+FLRD  Q+E  L  +E  L+  ++P ++E ++  ++K E F+TT+ AN D    V+E GR L   G+  +D+I  R  SI +R + N+  + E   +LKD    Q+  QD  +LS WI EKM+ A D S+ E +N+  ++ +H+AF  E+Q+NK+ L +      Q+V E+P+   ++  ++ +L + W ELE TT  K + + +AN+  +F +   D+  WL  +   I   +   +  +   + LKK +  +N++E++++++++L+  A  L++E  +    ++ +  ++E +F +L  P+  +K  L+  + I QF R+++D+  WV++++ LA ST+ GNNL TVQ L+++++ L  E+  H+P+ + + E    +++  SP   E     L +L+ LW+ +    + R  RL+E+   Q + FDA EAE+W+ EQEL+++SEE+  +D+++++ ++KKH   ++ +EDY E + +L   SR L+  +HP+++RI + QS VDK+YAGL+DL  E++ +L E  +L  L RE+ DLE WI ER +VA SH+LG D+EH  +L+ERF EF  +T  +G++RV   N +   LI+  HAD+A +A+W D +N++WA+L EL+ TR Q+L  ++E +K+    +++L RI +K   +P ++ +D  +V   QR H TF  D QAL  QV+ + D+A  L  +YAG K   I  R  +VL  W  L    E RR +L D  D  RFFSMVR+L+ WM+ V   I  + +P+DVS VELL+N+H+ IKAEI AR +S + C+ LG++LL R     +E++  L+ L  ++  + D WE+RW++L+LILEV+QF+RDA VAEAW+L QEPYL+++ LG+++DE   L+K+H  FEK+  + EERF A
Sbjct:   22 PKPTKGRMRIHCLENVDKALQFLKEQRVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKEKRSAKDALLLWCQMKTAGYPNVNIHNFTTSWRDGMAFNALIHKHRPDLIDFDKLKKSNAHYNLQNAFNLAEQHLGLTKLLDPEDISVDHPDEKSVITYVVTYYHYFSKMKALKVEGKRIGKVLDNAIETEKMIEKYESLASDLLEWIEQTIIILNNRKFANSLVGVQQQLQAFNTYRTVEKPPKFTEKGNLEVLLFTIQSKMRANNQKVYMPREGKLISDINKAWERLEKAEHERELALRTELIRQEKLEQLARRFDRKAAMRETWLSENQRLVSQDNFGFDLQAVEAATKKHEAIETDIAAYEERVQAVVAVARELETENYHDIKRITARKDNVLRLWEYLLELLKARRQRLEMNLSLQRVFQEMLYIMDWMDEMKMLLLSQDYGKHLLGVEDLLQKHALVEADIGIQADRVKAVNNNAQRFAVDEEG-----YKPCDPQVIRDRVAHMEFCYQELTQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEQILSSDDCGKDLTGAVRLLSQHRALEDEMSGRSGHLQHTVREGQAMADAGHFGEAKIRERIADVQAQWAALEQLASVRKTRLEEACSLHQFQADADDVDTWTLDALRIVSTADVGHDEFSTQALVKKHKDASTEVASYRPVIDALHEQAQTLPPEQANSANVSERLAGIEERYKEVSELTRLRKQALQDALALYKMFSEADACELWIDEKEQWLNSMEIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLIHSGHPSEKDIKAQQDKLNTRWSQFRDLVDQKKESLNSALGVQNYHLDCNETKSWIREKTKVIESTQELGNDLTGVMALQRKLTGMERDLAAIEAKLGDLRGEADRLAGEHPDQAKAITGRLAEITAVWEEMKETLRTREESLGEASKLQQFLRELDDFQSWLSRTQTAIASEDMPNTLAEAEKLLAQHEGIKNEINNYEEDYQKMRDMGEMVTQDQTDAQYMFLRQRLQALDTGWNELHKMWENRQNLLSQSHAYQIFLRDTKQAEAFLNNQEYVLAHTEMPTTLEGAEAAIKKQEDFMTTMDANEDKINGVVEAGRRLASDGNINADRIQERAASIDDRHKKNREAAVELLMRLKDNRDLQKFLQDCQELSLWINEKMLTAQDMSYDEARNLHSKWLKHQAFMAELQSNKEWLDKIEKEGKQLVSEKPETEAVVKEKLAALQKMWTELETTTQTKAQCLFDANKAELFTQSCADLDKWLVGLEGQIQSDDYGKDLTSVNIL-LKKQQMLENQVEVRQREVEELQSQAHVLRQEGKDTD-EVDGRRKVVEQKFQELLDPLLKRKNFLMASREIHQFNRDVEDEILWVEERMPLATSTDHGNNLQTVQLLIKKNQTLQKEIQGHQPRCDDIFERSQSILKADSP-NVEGIRTRLSDLQGLWSLIMQETEKRHSRLEEAHKAQQYYFDAAEAEAWMSEQELYMMSEEKA-KDEQSSVAMLKKHQILEQAVEDYAETVHQLSKTSRGLVAANHPESERIGMRQSQVDKLYAGLKDLSEERRGKLEERFRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFREFARDTGNIGQERVDGVNRMADELINAGHADAATVAEWKDGLNEAWADLLELIDTRTQILAASYELHKFYHDAKEILGRILDKHKKLPEELGRDQNTVETLQRMHTTFEHDIQALGTQVRQLQDDAVRLQSAYAGDKADDIQRREGEVLEAWRSLLEACEGRRARLLDTGDKFRFFSMVRDLMLWMEDVIRLIETQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTACIELGKSLLARKHYASEEIKEKLLQLTDKRKDMIDKWEDRWEWLRLILEVHQFSRDAGVAEAWLLGQEPYLSSRELGQSVDEVEKLIKRHEAFEKSAATWEERFSA 1995          
BLAST of Spectrin beta chain vs. Ensembl Zebrafish
Match: sptbn2 (spectrin, beta, non-erythrocytic 2 [Source:ZFIN;Acc:ZDB-GENE-030131-787])

HSP 1 Score: 1639.4 bits (4244), Expect = 0.000e+0
Identity = 908/2059 (44.10%), Postives = 1339/2059 (65.03%), Query Frame = 1
Query:  154 KLYERFRIKALAGEREKVQKKTFTKWINSHLNKLKQSIDDLYNXXXXXXXXXXXXXXXXXXXXPYPTKGKMRIHCLENVDKSLNFLIEQRVHLENMGAHDIVDGNARLTLGLIWTIILRFQIQDIVVEEDDTSEKRQAKDALLLWCQMKTAGYPNTNVRNFSTCWRDGLAFNAIIHRHRPDLLEYSALSRSNPNENLEQAIRIAEEKLGIPRLLDPEDVSVENPDEKSIMTYVVTFYHFFSKMKADSVHSKRVGKILSQSMETEEMMVHYDKLTSNLLEWINQTIELLNDRTFANSLSGVQQQLAAFNTYRVTEKPPKFQEKGNLEMLLFSIQSQMRANNQMPYLPIEGKLISDINNAWNKLDKAEHARELALRDELIRQEKLEQLALRFDRKAGMREAWLTENQRLITQDNFGQDLSAVEAAGKKHEAIKTDILAYEERVNSVTLVTSELENECYHDVERVLCRRDNVIRLWEKLLDMLAVRKLRLDACYKVQKLFQDIKHLLDLINDLKARLKTEDIGRHLMGVEDLIHKHSLLEIDIRMVGTKIEGIMSDAQPFINSEFGLGSGDFQPADPNEVILRTVNLKEEYDNLLELSRNRKDNLSASKVMWEFLWGVADEEQWMKEKIQLMLNPDLGHDLSSVHRLISKHKVIEEDVRNHSNYLQNVIQGGQQLILDKNPGAEKVADXXXXXXXXXXXXXXXXXXRRSKLEQSLAYFHCLADCGEVEIWIIEQVKLVKIDETSINEESIITDIHKHEQLSKSIEDYESNINSLDEQVKKLSEGDLELVTIEEKVSNIKSQYAILIELTNQKQNKLTDTLSLFRVLRKADTVKTWIDEKEKLLMSL-IPTDELEELEVFRHRFDGFEKEMNIQADQVEFVNTLAEKLSDMDHPQIADVVNKRFELNKLWNSLADLVEARREQLQTSYEFNQYLLECKQTGEWIREKSRLVESTDELGDDLAGIMQLQRRMGGMQRDMDAIRAKLEHLDEEMDTLIAKRPNXXXXXXXXXXXXXXFWAELGDMLADRDDRLSESSELQRFLQDLDHIHIWLSKMQTTVASEDLPKDLADAEKSLVQHEQLKEEIDSYQDEFIRLLDYGRRITEDKTDAQYMFLSQRLNALEEGWQELCQMWENRXXXXXXXXXXXVFLRDAIQSEVLLAQEENFLSKEDIPISIENSQNLLRKHEGFLTTLQANHDHTIAVIEFGRNLVERGHFCSDKINLRVKSILXXXXXXXXXXXXAYEKLKDQVLYQELSQDIDDLSKWIQEKMIIATDESFREEKNIARRYNRHRAFDEEIQANKDRLCQAIDYAMQIVEERPQLADMIYPQIDSLNQQWEELEQTTFLKGEKMIEANREAIFEEGTMDVMTWLXXXXXXXXXXXXXXXXXXXXXXKLKKVEEADNEMEIKRKQIQDLKMHAAKLKEEQPEKAFGIEQKHLILEHRFTQLQMPXXXXXXXXXXXXXXXXFLRNLDDQKAWVDDKLLLAESTNFGNNLLTVQQLLRRHRYLATEVNNHKPQLEYLKEEGAVLIE-EVSPMQREKFVA---GLQELESLWNRLEHSIDLRQQRLKESEATQTFLFDAEEAESWLWEQELFLLSEERGIRDQEAAINVIKKHDARQKTIEDYGEEITKLGTRSRLLIEKDHPQADRIALAQSHVDKVYAGLRDLCLEKKQRLSEIQKLNHLYREIVDLENWIYERTLVASSHDLGVDFEHCCLLRERFDEFFHETHLLGKDRVKAANDLCASLISQCHADSAEIAQWHDRINDSWAELQELMQTRIQLLRTAWEFYKYLSSCQDVLDRICEKIASIP-TDVSKDSQSVAIQQRKHATFLSDAQALEGQVQWVVDEANHLLPSYAGQKEWHICERRDDVLATWNQLNMQAERRRHQLEDAADLQRFFSMVRELLQWMDLVALQINEKTRPKDVSGVELLINDHRSIKAEIAAREESMSICVNLGRTLLHRGRVGVDEVRAALINLITRKYSLEDMWEERWDYLQLILEVYQFARDASVAEAWILAQEPYLANKTLGETLDETLSLLKKHINFEKTVMSQEERFEALEKLTTM 6312
            +L+ER RIKALA ERE VQKKTFTKW+NSHL ++   I DLY DL+DG+ML+ LLE+LSGEQLP PTKG+MRIHCLENVDK+L FL EQ+VHLENMG+HDIVDGN RLTLGLIWTIILRFQIQDI VE +D  EK+ AKDALLLWCQMKTAGYPN NV NF+T WRDGLAFNAI+H+HR DL+++  L RSN + NL+ A  +AE++LG+ +LLDPEDV+V+ PDEKSI+TYV T+YH+FSKMKA +V  KR+GK+L  ++E ++++  Y+ L S LL+WI QTI  LNDR  ANSLS VQ QL AFNTYR  EKPPKF EKGNLE+LLF+IQS+MRANNQ  Y+P EGKLISDIN AW +L+KAEH RELALR+ELIRQEKLE LA RFDRKA MRE WL+ENQRL++QDNFG +L AVEAA +KHEAI+TDI AY ERV +V  V  ELE E YH+V RVL RRDNV+RLWE L ++LA R+ RL A   +Q+L Q++ ++++ + D+K+RL+++D G+HL  VEDL+ KH+L+E DI     +++ + + A+ F ++E       ++P DP  V  +   L   Y  L +L+ +R+  L  S+ +W+FLW + +E  W++E+ Q++   D G DLSS   L+SKH+   +++      L N I GG+ L+ + + GA +V + +K++   W+ L E ++ R   L +S+A+     D  ++E WI+E ++ V   E   +E S  T   K  ++ + I+ + S I+SL EQ   L E       +E ++  I+ +Y  L  L++  +  L   L+L+R+  +A   + W+ EKE+ L ++ IPT +LE+LEV + RFD  E EMN    ++  VN +A++L   D+     +   + +LN  W+    L   R++ L+++     Y LEC +   W++EK++++EST  LG+DLAG+M LQR++ GM+RD++AI+ KL+ L  E   L+++ P  EE I+ +   +++ W EL   +  R++ L E+S+LQ FL+DLD    WLS+ QTTVASED P  LA+AE+ L QHE +K E+D+Y++++ ++   G  +T+ +TDAQ+MFL+QRL AL+ GW EL +MWE+R  +L+Q+   Q  LRDA Q+E  L  +E  LS  ++P S++ ++  ++KHE FLTT++A+ +    V+E GR LV  G+  +DKI  +  SI ER + NK+ +NE   KLKD    Q   QD  +L+ WI EKM+ A D S+ E +N+  ++ +H+AF  E+ +NKD L +       +V+E+P+L   +   +  L +QW ELE TT  K + + +ANR  +F +    + +WL+ I   +   +   +  +   + LKK +  +++M+++ K++Q L+  A  L +E       ++ +   +  RF+QLQ P+K ++  L+  K   QF R+L+D+  WV +++ LA ST+ G +L +VQ L+++++ L  E+  H+P+++ ++  G  +   + S M RE+  A    L EL  LW  L    + R  RL E+   Q F  DA EAE+W+ EQEL ++SEE+  +D+++A+ ++KKH   ++ +EDY + I +L   SRL++  +HP+++RI L Q+ VDK+YAGL+DL  E++ +L E  +L  L RE+ DLE WI ER +VA SH+LG D+EH  +LR++F EF  +T  +G++RV A N     LI   H ++A +A+W D +N++WA+L EL+ TR Q+L  ++E +++    ++ L  I EK  ++   ++ +D  +V    R+H  +  D QAL GQV  V D+A  L  +YAG+K   I      V   W  L    + RR  L D  +  RF +MVR+L+ WM+ + LQI     P+DVS   L+I +H+ IK+EI  R +S + C  +GRTL++      DE++  L  L  ++  +   W+E+ D+LQ++LEV QF RDAS+AE+W+  QEP +    LG  +DE  SL+K+H  FEK     E+RF  LEKLTT+
Sbjct:   41 RLFERSRIKALADEREAVQKKTFTKWVNSHLGRVTCRIGDLYTDLRDGRMLIRLLEVLSGEQLPKPTKGRMRIHCLENVDKALQFLKEQKVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKEKKSAKDALLLWCQMKTAGYPNVNVHNFTTSWRDGLAFNAIVHKHRSDLIDFDNLKRSNAHYNLQNAFNVAEKELGLTKLLDPEDVNVDQPDEKSIITYVATYYHYFSKMKALAVEGKRIGKVLDYAIEADQLIEKYETLASELLQWIEQTIVTLNDRQLANSLSAVQNQLQAFNTYRTVEKPPKFTEKGNLEVLLFTIQSKMRANNQKVYMPREGKLISDINKAWERLEKAEHERELALRNELIRQEKLEMLAARFDRKAAMRETWLSENQRLVSQDNFGVELGAVEAATRKHEAIETDIQAYGERVAAVEAVARELEAEGYHEVRRVLARRDNVLRLWEYLKELLAARRERLMAHRDLQRLLQELSYIMEWMEDMKSRLQSQDSGKHLHDVEDLLQKHTLVEADISAQAERVKAVQATAKRFASNE-----QSYKPCDPALVEEKVDLLGRAYGELGQLAADRRVRLDDSRRLWQFLWELGEEAAWIREQEQIISGGDYGKDLSSALHLLSKHEAFRDEMAARYGPLGNSIAGGEALVKEGHVGAPEVTERIKDVRAQWSHLEEASQLREQSLNESVAFHQFQTDANDMEAWILETLRQVSSQEVGHDEFSTQTLARKQREVEEEIQSHRSLIDSLHEQGSLLPEAYAHSPQVEGRLPAIEQRYEELEGLSSSWRQALDGALALYRMFSEASACQLWVGEKEQWLHNMEIPT-KLEDLEVIQQRFDTLEPEMNTLGGRISDVNQVAQQLLGSDNRNKDQIDQTQNQLNNRWSDFQSLANQRKQALESALNIQNYHLECNEIKSWMKEKTKVIESTQSLGNDLAGVMALQRKLTGMERDLEAIQGKLDDLRSEAKKLVSEHPEQEEEIKGQLAEIQEVWEELRATMKRREESLGEASKLQGFLRDLDDFQAWLSRTQTTVASEDTPTSLAEAERLLAQHEAIKNEVDNYKEDYEKMRATGAEVTQGQTDAQHMFLAQRLQALDTGWHELRRMWESRHCVLAQAFDFQTLLRDAKQAEGFLNSQEYVLSHTEMPSSLQGAEEAIKKHEDFLTTMEASEEKINGVVESGRRLVSDGNTYADKIQEKTDSIQERHQKNKQAANELLAKLKDNRELQHFLQDGQELTLWINEKMLTAQDMSYDEARNLHSKWQKHQAFMAELASNKDWLDKIDKEGQVLVKEKPELEQTVSETLSGLQKQWVELENTTQAKAQCLFDANRAELFTQSCSALDSWLQNISSQLQSDDFGKDLTSVNIL-LKKHQMLEHQMDVREKEVQSLQSQALALAQEDS-GIVEVDGEQRRVTDRFSQLQDPLKERRQHLLASKEAHQFNRDLEDEILWVKERMPLATSTDHGKDLPSVQLLMKKNQTLQKEIQGHQPRIDDIQAHGTNMSPGKESEMDRERRAALDGRLAELRELWALLISETEQRNVRLAEANRAQQFYTDAAEAEAWMGEQELHMMSEEKA-KDEQSALVMVKKHQILEQALEDYAQTIHQLANSSRLMVNSEHPESERITLRQAQVDKLYAGLKDLAEERRGKLQERLRLTQLKREVDDLEQWIAEREVVAGSHELGQDYEHVTMLRDKFREFARDTSTIGQERVDAVNAQADELIESGHPENASVAEWKDGLNEAWADLLELIDTRTQMLAASYELHRFHQDAREALGLIREKKETLAGAELGRDLNTVQHFLRQHTAYEHDVQALSGQVTQVQDDAARLQKAYAGEKADDIHRHERAVTEAWEGLQSATQTRRLLLLDTVEKFRFLNMVRDLMLWMEGINLQIQSHDSPRDVSSAGLVIANHQDIKSEIETRADSFTACSEMGRTLINNNHYASDEIQEKLDQLQAKRTEINQKWQEKMDHLQIVLEVLQFGRDASMAESWLAGQEPLVRAAELGSNVDEVESLIKRHEAFEKLAAGWEDRFSQLEKLTTL 2090          

HSP 2 Score: 87.8113 bits (216), Expect = 2.044e-16
Identity = 59/147 (40.14%), Postives = 75/147 (51.02%), Query Frame = 1
Query: 6541 TKTDIRGILIRKHEWEYKNRKALNRSWHEFLVVLSIEKNKLLVYKDEKHY-NEKPQDTYHKDSGLDLNDLVAAPASDYLKRPFVFRIKITSTGAEYLFQAKDEEDMLRWVNSINENSQKDLKSETTAPGKSSTLP-ACTSDPHVPST 6975
            T   + GIL RK E E  N+K+ NRSW     VL   K  L  YKD K   N  P   YH +  + L + V   A DY KR  VF++++   G EYLFQAKDE +M  W+ +I    Q  + S   +PG S  L  A T  P  PS+
Sbjct: 2190 TTEAMEGILCRKQEMESHNKKSANRSWQNVYCVL--RKGSLGFYKDNKSASNGIP---YHGEVPISLGEAVCEVAHDYKKRKHVFKLRL-GDGKEYLFQAKDEAEMSSWIRAI----QSSMSSSERSPGASRGLSRAMTMPPMSPSS 2326          
BLAST of Spectrin beta chain vs. Ensembl Zebrafish
Match: sptb (spectrin, beta, erythrocytic [Source:ZFIN;Acc:ZDB-GENE-000906-1])

HSP 1 Score: 1635.54 bits (4234), Expect = 0.000e+0
Identity = 948/2321 (40.84%), Postives = 1448/2321 (62.39%), Query Frame = 1
Query:  154 KLYERFRIKALAGEREKVQKKTFTKWINSHLNKLKQSIDDLYNXXXXXXXXXXXXXXXXXXXXPYPTKGKMRIHCLENVDKSLNFLIEQRVHLENMGAHDIVDGNARLTLGLIWTIILRFQIQDIVVE---EDDTS--EKRQAKDALLLWCQMKTAGYPNTNVRNFSTCWRDGLAFNAIIHRHRPDLLEYSALSRSNPNENLEQAIRIAEEKLGIPRLLDPEDVSVENPDEKSIMTYVVTFYHFFSKMKADSVHSKRVGKILSQSMETEEMMVHYDKLTSNLLEWINQTIELLNDRTFANSLSGVQQQLAAFNTYRVTEKPPKFQEKGNLEMLLFSIQSQMRANNQMPYLPIEGKLISDINNAWNKLDKAEHARELALRDELIRQEKLEQLALRFDRKAGMREAWLTENQRLITQDNFGQDLSAVEAAGKKHEAIKTDILAYEERVNSVTLVTSELENECYHDVERVLCRRDNVIRLWEKLLDMLAVRKLRLDACYKVQKLFQDIKHLLDLINDLKARLKTEDIGRHLMGVEDLIHKHSLLEIDIRMVGTKIEGIMSDAQPFINSEFGLGSGDFQPADPNEVILRTVNLKEEYDNLLELSRNRKDNLSASKVMWEFLWGVADEEQWMKEKIQLMLNPDLGHDLSSVHRLISKHKVIEEDVRNHSNYLQNVIQGGQQLILDKNPGAEKVADXXXXXXXXXXXXXXXXXXRRSKLEQSLAYFHCLADCGEVEIWIIEQVKLVKIDETSINEESIITDIHKHEQLSKSIEDYESNINSLDEQVKKLSEGDLELVTIEEKVSNIKSQYAILIELTNQKQNKLTDTLSLFRVLRKADTVKTWIDEKEKLLMSLIPTDELEELEVFRHRFDGFEKEMNIQADQVEFVNTLAEKLSDMDHPQIADVVNKRFELNKLWNSLADLVEARREQLQTSYEFNQYLLECKQTGEWIREKSRLVESTDELGDDLAGIMQLQRRMGGMQRDMDAIRAKLEHLDEEMDTLIAKRPNXXXXXXXXXXXXXXFWAELGDMLADRDDRLSESSELQRFLQDLDHIHIWLSKMQTTVASEDLPKDLADAEKSLVQHEQLKEEIDSYQDEFIRLLDYGRRITEDK-TDAQYMFLSQRLNALEEGWQELCQMWENRXXXXXXXXXXXVFLRDAIQSEVLLAQEENFLSKEDIPISIENSQNLLRKHEGFLTTLQANHDHTIAVIEFGRNLVERGHFCSDKINLRVKSILXXXXXXXXXXXXAYEKLKDQVLYQELSQDIDDLSKWIQEKMIIATDESFREEKNIARRYNRHRAFDEEIQANKDRLCQAIDYAMQIVEERPQLADMIYPQIDSLNQQWEELEQTTFLKGEKMIEANREAIFEEGTMDVMTWLXXXXXXXXXXXXXXXXXXXXXX-KLKKVEEADNEMEIKRKQIQDLK----MHAAKLKEEQPEKAFGIEQKHLILEHRFTQLQMPXXXXXXXXXXXXXXXXFLRNLDDQKAWVDDKLLLAESTNFGNNLLTVQQLLRRHRYLATEVNNHKPQLEYLKEEG--AVLIEEVSPMQREKFVAGLQELESLWNRLEHSIDLRQQRLKESEATQTFLFDAEEAESWLWEQELFLLSEERGIRDQEAAINVIKKHDARQKTIEDYGEEITKLGTRSRLLIEKDHPQADRIALAQSHVDKVYAGLRDLCLEKKQRLSEIQKLNHLYREIVDLENWIYERTLVASSHDLGVDFEHCCLLRERFDEFFHETHLLGKDRVKAANDLCASLISQCHADSAEIAQWHDRINDSWAELQELMQTRIQLLRTAWEFYKYLSSCQDVLDRICEKIASIPTDVSKDSQSVAIQQRKHATFLSDAQALEGQVQWVVDEANHLLPSYAGQKEWHICERRDDVLATWNQLNMQAERRRHQLEDAADLQRFFSMVRELLQWMDLVALQINEKTRPKDVSGVELLINDHRSIKAEIAAREESMSICVNLGRTLLHRGRVGVDEVRAALINLITRKYSLEDMWEERWDYLQLILEVYQFARDASVAEAWILAQEPYLANKTLGETLDETLSLLKKHINFEKTVMSQEERFEALEKLTTME---IRA-------------KEITKESILLKDKHKQ-----ERIENAIKIFQPPPSP--ELVHESPKVSISEEDEE-----GKSHQHKISVISKEAAEMCQSSETKTDI--RGILIRKHEWEYKNRKALNRSWHEFLVVLSIEKNKLLVYKDEKHYNEKPQDTYHKDSGLDLNDLVAAPASDYLKRPFVFRIKITSTGAEYLFQAKDEEDMLRWVNSINENSQKDLKSETTAPGKSSTL---PACTSDPHVPSTQ 6978
            +L+ER RIKALA ERE VQKKTFTKW+NS L ++   I DLY DL+DG+ML+ LLE+LSGE+LP PTKG+MRIHCLENVDK+L FL EQ+VHLENMG+HDIVDGN RL LGLIWTIILRFQIQDI+VE    D T   E R AKDALLLWCQMKTAGYPN N+ NF+T W+DG+AFNA+IH+HRPDL++Y  L RSNP  NL+QA  +AE+KLG+ +LLDPEDV  ENPDEKSI+TYVV FYH+FSKMKA +V  KR+GK+L Q++ETE+M+  Y+ L+S+LL WI QTI +LN+R  ANSL+GVQQQL AFN+YR  EKPPKFQEKGNLE+LLF+IQS+MRANNQ  Y P EG L+SDIN AW +L+KAE+ RE  LRDELIRQEKLEQ+A RFDRKA MRE WL ENQRL++QDNFG DL AVEAA KKH+AI+TDI AYEERV ++  ++ ELE+E YHD +R+  R+DN++RLW+ L ++L  R+ RLD    +Q++FQ++ H++  ++++K RL + D G+HL+ VEDL+ KHSL+E DI +   +++   + A  F N +       ++P DP  +  R  +L   Y  L  L+  RK  L  S+ +W FLW +A+ E W++E+ Q+  + D G DL+SV  L SKH V E+++    + L+ V+  G+ +I  K+ G+ KV   + +++  W +L EL   R+  L+ +  +F    D  +++ W+++ ++ +  D+   +E +    + KH  L        + I++L +Q   L E       I+ ++++I+  Y  L+ L++ +Q KL DT++L+ +  + D  + W+ +KE  L+ L   + LE+LE+ ++R     +EM     +V+ VN  A++L D  HPQ   V + +  LNK W +   +VE ++ ++ ++   + Y L+C +T  WI+EK+R++EST +LG+DLA ++ +QR++ GM+RD+ AI+ KL+ L +E   L+ + P +   I   +  L+  W  L   L DR+D L E S+LQ FLQD+D    WL K Q  VASED+P  L +AE+ L  H+ L+ ++D +++++ R+ D G  + + +  D QY  L QRL  L++GW EL +MW++R+  L Q L  Q F+RDA Q++ +L  +E  L+  D P +++ ++  L+KHE F+TT+ AN +  ++ +E G+ LV+  +  S K+  ++ SI ER + N+ ++ E   KLKD    Q   Q+  DL+ WI EKM+ A D S+ E +N+  ++ +H+AF  E+ +NKD L        +++E +P+   ++  ++  L++ W++LE TT  K   + +ANR  +F++   D+  WL  + + +    EE           LKK +  +N++  + +++++L+     H + L+E+QPE    IEQ++L  +  F +L  P+  +K +L   K + QF R+L D+  WV+++L +A S + GNNL TVQ LL++++ L  E++ H+P+++ + E G       E SP + E+    +++L+ +W +L+  +  R++RL  S   Q +  DA+++E+W+ EQEL+++++E   +D+++A+ ++K+H   ++T++DY   I +L  R++ ++ ++HP  + I   Q  VDK YAGL++L  ++K++L        L RE+ DLE WI ER +VASS ++G D +H  +LR++F EF  ET  +G++RV   N +   LI   H++SA +A+W D +N+SWA+L EL+ TR QLL ++++  KY    ++++  I EK   +P D+ +D        R HA F  D  +L  QV+   + A  L   YAG +   I     +V+  W  L      RR QLE+ AD  RFF+MVR+L+ WM+ +  QI  + +P+DVS VELL+  H+ I+AEI  R    + CV LG+ LL R      E++  L+ L+ ++  +   W++RWD+L+L+LEV QFARDASVAEAW++AQEPY+A+K +G+T+DE   LLK+H  FEK+  + EERF ALE+LTT+E   IR              KE  +E     ++  Q     E+  + + + +P          ES    ISE  E        S   +++  +++AA +   S     +   G L RKHE E  N+KA NRSW+    VL  +   L +YKD K ++     T+H +  L L +      ++Y K+  VF++++   G+EYLFQ KDEE++  W  +I + +Q  ++     P     L   P  ++   VPST+
Sbjct:   41 RLFERSRIKALADEREAVQKKTFTKWVNSILARVSCRISDLYLDLRDGRMLIKLLEVLSGERLPKPTKGRMRIHCLENVDKALQFLKEQKVHLENMGSHDIVDGNHRLILGLIWTIILRFQIQDIIVETGQADQTGRQETRSAKDALLLWCQMKTAGYPNINITNFTTSWKDGMAFNALIHKHRPDLVDYGNLKRSNPTHNLQQAFNVAEKKLGVTKLLDPEDVFTENPDEKSIITYVVAFYHYFSKMKALAVEGKRIGKVLDQAIETEKMIEKYETLSSDLLTWIEQTIVVLNNRKLANSLTGVQQQLQAFNSYRTVEKPPKFQEKGNLEVLLFTIQSRMRANNQKVYTPKEGALVSDINKAWERLEKAEYDRERVLRDELIRQEKLEQMARRFDRKAAMRETWLMENQRLVSQDNFGYDLPAVEAAKKKHDAIETDIAAYEERVQALVALSKELESERYHDAKRIDARKDNILRLWDYLQELLKARRGRLDKNLTLQRIFQEMLHIISWMDEMKGRLLSPDFGKHLLEVEDLLQKHSLVEADIAVQAERVKSANAAALKFANGD------SYKPCDPQVIRDRVQHLDLCYQELCALAAQRKARLEQSRRLWNFLWEIAELESWIREREQIFSSLDYGKDLTSVLILQSKHSVFEDELAARRDNLKQVMDEGESMIQIKHLGSPKVQQRMNDVQRQWQQLEELAAFRKQNLQDTQRFFQFQGDADDLKAWLVDAMRQMSSDDVGHDEYTTQRLLKKHRDLRDEAAKNGATIDALSKQANALPEELRNTPDIQGRLNDIRDMYIELLTLSDLRQKKLDDTMALYTIFSETDACELWMGQKETWLVGLETPENLEDLEIVQNRLSILAQEMGNMQTRVDNVNKAAKQLEDSRHPQTKQVKDCQIRLNKRWEAFKAMVEDKKHRVDSALSLHNYDLDCDETESWIKEKTRVIESTQDLGNDLAAVITIQRKLFGMERDLAAIQDKLDSLRDEAQKLVKEHPENASDILARQEELDAAWDTLKRTLKDREDSLGEVSKLQTFLQDMDDFQAWLFKSQKAVASEDMPDGLPEAEQLLNLHDALRHDMDGHEEDYHRVKDTGAAVIQGQEDDPQYQQLEQRLEGLDKGWGELHKMWDSRKNFLDQGLGFQQFMRDAKQADAILNNQEYTLAHVDKPDTLDGAEKALKKHEDFVTTMDANKEKILSTLETGQRLVDSENLYSGKVKDKMSSIEERNKKNQDKAKEVSGKLKDNRELQHFLQNTQDLTLWINEKMLTAQDTSYDEARNLHSKWQKHQAFMAELASNKDWLHNIDKEGQELMESKPEFEPIVKDRLAKLHELWDKLESTTQEKARLLFDANRSELFDQSLADLKKWLAELQQQLQGDVEEEVKDLTSANILLKKHQITENQVRDRARELEELQEAVEQHGS-LREDQPE--LEIEQQNL--QRDFQKLLTPLSQRKGKLEAAKAVHQFFRDLADEILWVNERLPMAMSDDHGNNLQTVQLLLKKNQSLQKEIDGHQPRIDEVLERGRRMAAAAEGSP-EEERMSEEMKKLQVVWAQLQEEMAKRRERLYGSNEAQQYYNDADDSEAWIGEQELYMIADEMA-KDEQSAMIMLKRHLVLKQTVDDYAYSIQQLADRAQKMLAEEHPDGEAIIRRQGQVDKQYAGLKELAEDRKKKLDHTYHHFLLSREVEDLEQWIAERDVVASSQEMGQDLDHVTILRDKFREFARETGTVGQERVDTVNRIIDELIEGGHSESATLAEWKDGVNESWADLLELIDTRAQLLTSSYDLLKYFYDGKELVGHIEEKKNELPEDLGEDFSKAESFHRMHAAFERDISSLGKQVKQFQETAARLHAQYAGDQATAIQATEKEVVEAWKGLLDACAGRRKQLEETADKFRFFTMVRDLMAWMESILQQIETQEKPRDVSSVELLMKYHQGIRAEIETRGPKFNQCVQLGQALLERKHKDSAEIKEKLMQLVEKRKEMMLKWDDRWDWLRLLLEVCQFARDASVAEAWLIAQEPYVASKDVGQTVDEVEKLLKRHEAFEKSTATWEERFSALERLTTLELLEIRKQQQEIQQYRQEAEKESRREDTGFAEESSQLYPTEEQSLSGLGVIEPSSGGVDGTAGESTVPLISEMQESVSLELDPSTSIQVTKETEKAASLPTESTQVQPVLMEGTLARKHELEGPNKKAPNRSWNNLYCVL--KPGHLSIYKDAKSFSHSV--TFHGEEPLTLTNSSCEILTNYKKKKQVFKLRL-GDGSEYLFQCKDEEELQNWTQAIEQAAQVQIEEPVAGPSGVKALSLPPPSSTTLEVPSTK 2343          
BLAST of Spectrin beta chain vs. Ensembl Zebrafish
Match: sptb (spectrin, beta, erythrocytic [Source:ZFIN;Acc:ZDB-GENE-000906-1])

HSP 1 Score: 1635.54 bits (4234), Expect = 0.000e+0
Identity = 948/2321 (40.84%), Postives = 1448/2321 (62.39%), Query Frame = 1
Query:  154 KLYERFRIKALAGEREKVQKKTFTKWINSHLNKLKQSIDDLYNXXXXXXXXXXXXXXXXXXXXPYPTKGKMRIHCLENVDKSLNFLIEQRVHLENMGAHDIVDGNARLTLGLIWTIILRFQIQDIVVE---EDDTS--EKRQAKDALLLWCQMKTAGYPNTNVRNFSTCWRDGLAFNAIIHRHRPDLLEYSALSRSNPNENLEQAIRIAEEKLGIPRLLDPEDVSVENPDEKSIMTYVVTFYHFFSKMKADSVHSKRVGKILSQSMETEEMMVHYDKLTSNLLEWINQTIELLNDRTFANSLSGVQQQLAAFNTYRVTEKPPKFQEKGNLEMLLFSIQSQMRANNQMPYLPIEGKLISDINNAWNKLDKAEHARELALRDELIRQEKLEQLALRFDRKAGMREAWLTENQRLITQDNFGQDLSAVEAAGKKHEAIKTDILAYEERVNSVTLVTSELENECYHDVERVLCRRDNVIRLWEKLLDMLAVRKLRLDACYKVQKLFQDIKHLLDLINDLKARLKTEDIGRHLMGVEDLIHKHSLLEIDIRMVGTKIEGIMSDAQPFINSEFGLGSGDFQPADPNEVILRTVNLKEEYDNLLELSRNRKDNLSASKVMWEFLWGVADEEQWMKEKIQLMLNPDLGHDLSSVHRLISKHKVIEEDVRNHSNYLQNVIQGGQQLILDKNPGAEKVADXXXXXXXXXXXXXXXXXXRRSKLEQSLAYFHCLADCGEVEIWIIEQVKLVKIDETSINEESIITDIHKHEQLSKSIEDYESNINSLDEQVKKLSEGDLELVTIEEKVSNIKSQYAILIELTNQKQNKLTDTLSLFRVLRKADTVKTWIDEKEKLLMSLIPTDELEELEVFRHRFDGFEKEMNIQADQVEFVNTLAEKLSDMDHPQIADVVNKRFELNKLWNSLADLVEARREQLQTSYEFNQYLLECKQTGEWIREKSRLVESTDELGDDLAGIMQLQRRMGGMQRDMDAIRAKLEHLDEEMDTLIAKRPNXXXXXXXXXXXXXXFWAELGDMLADRDDRLSESSELQRFLQDLDHIHIWLSKMQTTVASEDLPKDLADAEKSLVQHEQLKEEIDSYQDEFIRLLDYGRRITEDK-TDAQYMFLSQRLNALEEGWQELCQMWENRXXXXXXXXXXXVFLRDAIQSEVLLAQEENFLSKEDIPISIENSQNLLRKHEGFLTTLQANHDHTIAVIEFGRNLVERGHFCSDKINLRVKSILXXXXXXXXXXXXAYEKLKDQVLYQELSQDIDDLSKWIQEKMIIATDESFREEKNIARRYNRHRAFDEEIQANKDRLCQAIDYAMQIVEERPQLADMIYPQIDSLNQQWEELEQTTFLKGEKMIEANREAIFEEGTMDVMTWLXXXXXXXXXXXXXXXXXXXXXX-KLKKVEEADNEMEIKRKQIQDLK----MHAAKLKEEQPEKAFGIEQKHLILEHRFTQLQMPXXXXXXXXXXXXXXXXFLRNLDDQKAWVDDKLLLAESTNFGNNLLTVQQLLRRHRYLATEVNNHKPQLEYLKEEG--AVLIEEVSPMQREKFVAGLQELESLWNRLEHSIDLRQQRLKESEATQTFLFDAEEAESWLWEQELFLLSEERGIRDQEAAINVIKKHDARQKTIEDYGEEITKLGTRSRLLIEKDHPQADRIALAQSHVDKVYAGLRDLCLEKKQRLSEIQKLNHLYREIVDLENWIYERTLVASSHDLGVDFEHCCLLRERFDEFFHETHLLGKDRVKAANDLCASLISQCHADSAEIAQWHDRINDSWAELQELMQTRIQLLRTAWEFYKYLSSCQDVLDRICEKIASIPTDVSKDSQSVAIQQRKHATFLSDAQALEGQVQWVVDEANHLLPSYAGQKEWHICERRDDVLATWNQLNMQAERRRHQLEDAADLQRFFSMVRELLQWMDLVALQINEKTRPKDVSGVELLINDHRSIKAEIAAREESMSICVNLGRTLLHRGRVGVDEVRAALINLITRKYSLEDMWEERWDYLQLILEVYQFARDASVAEAWILAQEPYLANKTLGETLDETLSLLKKHINFEKTVMSQEERFEALEKLTTME---IRA-------------KEITKESILLKDKHKQ-----ERIENAIKIFQPPPSP--ELVHESPKVSISEEDEE-----GKSHQHKISVISKEAAEMCQSSETKTDI--RGILIRKHEWEYKNRKALNRSWHEFLVVLSIEKNKLLVYKDEKHYNEKPQDTYHKDSGLDLNDLVAAPASDYLKRPFVFRIKITSTGAEYLFQAKDEEDMLRWVNSINENSQKDLKSETTAPGKSSTL---PACTSDPHVPSTQ 6978
            +L+ER RIKALA ERE VQKKTFTKW+NS L ++   I DLY DL+DG+ML+ LLE+LSGE+LP PTKG+MRIHCLENVDK+L FL EQ+VHLENMG+HDIVDGN RL LGLIWTIILRFQIQDI+VE    D T   E R AKDALLLWCQMKTAGYPN N+ NF+T W+DG+AFNA+IH+HRPDL++Y  L RSNP  NL+QA  +AE+KLG+ +LLDPEDV  ENPDEKSI+TYVV FYH+FSKMKA +V  KR+GK+L Q++ETE+M+  Y+ L+S+LL WI QTI +LN+R  ANSL+GVQQQL AFN+YR  EKPPKFQEKGNLE+LLF+IQS+MRANNQ  Y P EG L+SDIN AW +L+KAE+ RE  LRDELIRQEKLEQ+A RFDRKA MRE WL ENQRL++QDNFG DL AVEAA KKH+AI+TDI AYEERV ++  ++ ELE+E YHD +R+  R+DN++RLW+ L ++L  R+ RLD    +Q++FQ++ H++  ++++K RL + D G+HL+ VEDL+ KHSL+E DI +   +++   + A  F N +       ++P DP  +  R  +L   Y  L  L+  RK  L  S+ +W FLW +A+ E W++E+ Q+  + D G DL+SV  L SKH V E+++    + L+ V+  G+ +I  K+ G+ KV   + +++  W +L EL   R+  L+ +  +F    D  +++ W+++ ++ +  D+   +E +    + KH  L        + I++L +Q   L E       I+ ++++I+  Y  L+ L++ +Q KL DT++L+ +  + D  + W+ +KE  L+ L   + LE+LE+ ++R     +EM     +V+ VN  A++L D  HPQ   V + +  LNK W +   +VE ++ ++ ++   + Y L+C +T  WI+EK+R++EST +LG+DLA ++ +QR++ GM+RD+ AI+ KL+ L +E   L+ + P +   I   +  L+  W  L   L DR+D L E S+LQ FLQD+D    WL K Q  VASED+P  L +AE+ L  H+ L+ ++D +++++ R+ D G  + + +  D QY  L QRL  L++GW EL +MW++R+  L Q L  Q F+RDA Q++ +L  +E  L+  D P +++ ++  L+KHE F+TT+ AN +  ++ +E G+ LV+  +  S K+  ++ SI ER + N+ ++ E   KLKD    Q   Q+  DL+ WI EKM+ A D S+ E +N+  ++ +H+AF  E+ +NKD L        +++E +P+   ++  ++  L++ W++LE TT  K   + +ANR  +F++   D+  WL  + + +    EE           LKK +  +N++  + +++++L+     H + L+E+QPE    IEQ++L  +  F +L  P+  +K +L   K + QF R+L D+  WV+++L +A S + GNNL TVQ LL++++ L  E++ H+P+++ + E G       E SP + E+    +++L+ +W +L+  +  R++RL  S   Q +  DA+++E+W+ EQEL+++++E   +D+++A+ ++K+H   ++T++DY   I +L  R++ ++ ++HP  + I   Q  VDK YAGL++L  ++K++L        L RE+ DLE WI ER +VASS ++G D +H  +LR++F EF  ET  +G++RV   N +   LI   H++SA +A+W D +N+SWA+L EL+ TR QLL ++++  KY    ++++  I EK   +P D+ +D        R HA F  D  +L  QV+   + A  L   YAG +   I     +V+  W  L      RR QLE+ AD  RFF+MVR+L+ WM+ +  QI  + +P+DVS VELL+  H+ I+AEI  R    + CV LG+ LL R      E++  L+ L+ ++  +   W++RWD+L+L+LEV QFARDASVAEAW++AQEPY+A+K +G+T+DE   LLK+H  FEK+  + EERF ALE+LTT+E   IR              KE  +E     ++  Q     E+  + + + +P          ES    ISE  E        S   +++  +++AA +   S     +   G L RKHE E  N+KA NRSW+    VL  +   L +YKD K ++     T+H +  L L +      ++Y K+  VF++++   G+EYLFQ KDEE++  W  +I + +Q  ++     P     L   P  ++   VPST+
Sbjct:   41 RLFERSRIKALADEREAVQKKTFTKWVNSILARVSCRISDLYLDLRDGRMLIKLLEVLSGERLPKPTKGRMRIHCLENVDKALQFLKEQKVHLENMGSHDIVDGNHRLILGLIWTIILRFQIQDIIVETGQADQTGRQETRSAKDALLLWCQMKTAGYPNINITNFTTSWKDGMAFNALIHKHRPDLVDYGNLKRSNPTHNLQQAFNVAEKKLGVTKLLDPEDVFTENPDEKSIITYVVAFYHYFSKMKALAVEGKRIGKVLDQAIETEKMIEKYETLSSDLLTWIEQTIVVLNNRKLANSLTGVQQQLQAFNSYRTVEKPPKFQEKGNLEVLLFTIQSRMRANNQKVYTPKEGALVSDINKAWERLEKAEYDRERVLRDELIRQEKLEQMARRFDRKAAMRETWLMENQRLVSQDNFGYDLPAVEAAKKKHDAIETDIAAYEERVQALVALSKELESERYHDAKRIDARKDNILRLWDYLQELLKARRGRLDKNLTLQRIFQEMLHIISWMDEMKGRLLSPDFGKHLLEVEDLLQKHSLVEADIAVQAERVKSANAAALKFANGD------SYKPCDPQVIRDRVQHLDLCYQELCALAAQRKARLEQSRRLWNFLWEIAELESWIREREQIFSSLDYGKDLTSVLILQSKHSVFEDELAARRDNLKQVMDEGESMIQIKHLGSPKVQQRMNDVQRQWQQLEELAAFRKQNLQDTQRFFQFQGDADDLKAWLVDAMRQMSSDDVGHDEYTTQRLLKKHRDLRDEAAKNGATIDALSKQANALPEELRNTPDIQGRLNDIRDMYIELLTLSDLRQKKLDDTMALYTIFSETDACELWMGQKETWLVGLETPENLEDLEIVQNRLSILAQEMGNMQTRVDNVNKAAKQLEDSRHPQTKQVKDCQIRLNKRWEAFKAMVEDKKHRVDSALSLHNYDLDCDETESWIKEKTRVIESTQDLGNDLAAVITIQRKLFGMERDLAAIQDKLDSLRDEAQKLVKEHPENASDILARQEELDAAWDTLKRTLKDREDSLGEVSKLQTFLQDMDDFQAWLFKSQKAVASEDMPDGLPEAEQLLNLHDALRHDMDGHEEDYHRVKDTGAAVIQGQEDDPQYQQLEQRLEGLDKGWGELHKMWDSRKNFLDQGLGFQQFMRDAKQADAILNNQEYTLAHVDKPDTLDGAEKALKKHEDFVTTMDANKEKILSTLETGQRLVDSENLYSGKVKDKMSSIEERNKKNQDKAKEVSGKLKDNRELQHFLQNTQDLTLWINEKMLTAQDTSYDEARNLHSKWQKHQAFMAELASNKDWLHNIDKEGQELMESKPEFEPIVKDRLAKLHELWDKLESTTQEKARLLFDANRSELFDQSLADLKKWLAELQQQLQGDVEEEVKDLTSANILLKKHQITENQVRDRARELEELQEAVEQHGS-LREDQPE--LEIEQQNL--QRDFQKLLTPLSQRKGKLEAAKAVHQFFRDLADEILWVNERLPMAMSDDHGNNLQTVQLLLKKNQSLQKEIDGHQPRIDEVLERGRRMAAAAEGSP-EEERMSEEMKKLQVVWAQLQEEMAKRRERLYGSNEAQQYYNDADDSEAWIGEQELYMIADEMA-KDEQSAMIMLKRHLVLKQTVDDYAYSIQQLADRAQKMLAEEHPDGEAIIRRQGQVDKQYAGLKELAEDRKKKLDHTYHHFLLSREVEDLEQWIAERDVVASSQEMGQDLDHVTILRDKFREFARETGTVGQERVDTVNRIIDELIEGGHSESATLAEWKDGVNESWADLLELIDTRAQLLTSSYDLLKYFYDGKELVGHIEEKKNELPEDLGEDFSKAESFHRMHAAFERDISSLGKQVKQFQETAARLHAQYAGDQATAIQATEKEVVEAWKGLLDACAGRRKQLEETADKFRFFTMVRDLMAWMESILQQIETQEKPRDVSSVELLMKYHQGIRAEIETRGPKFNQCVQLGQALLERKHKDSAEIKEKLMQLVEKRKEMMLKWDDRWDWLRLLLEVCQFARDASVAEAWLIAQEPYVASKDVGQTVDEVEKLLKRHEAFEKSTATWEERFSALERLTTLELLEIRKQQQEIQQYRQEAEKESRREDTGFAEESSQLYPTEEQSLSGLGVIEPSSGGVDGTAGESTVPLISEMQESVSLELDPSTSIQVTKETEKAASLPTESTQVQPVLMEGTLARKHELEGPNKKAPNRSWNNLYCVL--KPGHLSIYKDAKSFSHSV--TFHGEEPLTLTNSSCEILTNYKKKKQVFKLRL-GDGSEYLFQCKDEEELQNWTQAIEQAAQVQIEEPVAGPSGVKALSLPPPSSTTLEVPSTK 2343          
BLAST of Spectrin beta chain vs. Ensembl Xenopus
Match: SPTBN1 (spectrin beta, non-erythrocytic 1 [Source:HGNC Symbol;Acc:HGNC:11275])

HSP 1 Score: 1815.43 bits (4701), Expect = 0.000e+0
Identity = 1003/2321 (43.21%), Postives = 1516/2321 (65.32%), Query Frame = 1
Query:  154 KLYERFRIKALAGEREKVQKKTFTKWINSHLNKLKQSIDDLYNXXXXXXXXXXXXXXXXXXXXPYPTKGKMRIHCLENVDKSLNFLIEQRVHLENMGAHDIVDGNARLTLGLIWTIILRFQIQDIVVEEDDTSEKRQAKDALLLWCQMKTAGYPNTNVRNFSTCWRDGLAFNAIIHRHRPDLLEYSALSRSNPNENLEQAIRIAEEKLGIPRLLDPEDVSVENPDEKSIMTYVVTFYHFFSKMKADSVHSKRVGKILSQSMETEEMMVHYDKLTSNLLEWINQTIELLNDRTFANSLSGVQQQLAAFNTYRVTEKPPKFQEKGNLEMLLFSIQSQMRANNQMPYLPIEGKLISDINNAWNKLDKAEHARELALRDELIRQEKLEQLALRFDRKAGMREAWLTENQRLITQDNFGQDLSAVEAAGKKHEAIKTDILAYEERVNSVTLVTSELENECYHDVERVLCRRDNVIRLWEKLLDMLAVRKLRLDACYKVQKLFQDIKHLLDLINDLKARLKTEDIGRHLMGVEDLIHKHSLLEIDIRMVGTKIEGIMSDAQPFINSEFGLGSGDFQPADPNEVILRTVNLKEEYDNLLELSRNRKDNLSASKVMWEFLWGVADEEQWMKEKIQLMLNPDLGHDLSSVHRLISKHKVIEEDVRNHSNYLQNVIQGGQQLILDKNPGAEKVADXXXXXXXXXXXXXXXXXXRRSKLEQSLAYFHCLADCGEVEIWIIEQVKLVKIDETSINEESIITDIHKHEQLSKSIEDYESNINSLDEQVKKLSEGDLELVTIEEKVSNIKSQYAILIELTNQKQNKLTDTLSLFRVLRKADTVKTWIDEKEKLLMSLIPTDELEELEVFRHRFDGFEKEMNIQADQVEFVNTLAEKLSDMDHPQIADVVNKRFELNKLWNSLADLVEARREQLQTSYEFNQYLLECKQTGEWIREKSRLVESTDELGDDLAGIMQLQRRMGGMQRDMDAIRAKLEHLDEEMDTLIAKRPNXXXXXXXXXXXXXXFWAELGDMLADRDDRLSESSELQRFLQDLDHIHIWLSKMQTTVASEDLPKDLADAEKSLVQHEQLKEEIDSYQDEFIRLLDYGRRITEDKTDAQYMFLSQRLNALEEGWQELCQMWENRXXXXXXXXXXXVFLRDAIQSEVLLAQEENFLSKEDIPISIENSQNLLRKHEGFLTTLQANHDHTIAVIEFGRNLVERGHFCSDKINLRVKSILXXXXXXXXXXXXAYEKLKDQVLYQELSQDIDDLSKWIQEKMIIATDESFREEKNIARRYNRHRAFDEEIQANKDRLCQAIDYAMQIVEERPQLADMIYPQIDSLNQQWEELEQTTFLKGEKMIEANREAIFEEGTMDVMTWLXXXXXXXXXXXXXXXXXXXXXXKLKKVEEADNEMEIKRKQIQDLKMHAAKLKEEQPEKAFGIEQKHLILEHRFTQLQMPXXXXXXXXXXXXXXXXFLRNLDDQKAWVDDKLLLAESTNFGNNLLTVQQLLRRHRYLATEVNNHKPQLEYLKEEGAVLIEEVSPMQREKFVAGLQELESLWNRLEHSIDLRQQRLKESEATQTFLFDAEEAESWLWEQELFLLSEERGIRDQEAAINVIKKHDARQKTIEDYGEEITKLGTRSRLLIEKDHPQADRIALAQSHVDKVYAGLRDLCLEKKQRLSEIQKLNHLYREIVDLENWIYERTLVASSHDLGVDFEHCCLLRERFDEFFHETHLLGKDRVKAANDLCASLISQCHADSAEIAQWHDRINDSWAELQELMQTRIQLLRTAWEFYKYLSSCQDVLDRICEKIASIPTDVSKDSQSVAIQQRKHATFLSDAQALEGQVQWVVDEANHLLPSYAGQKEWHICERRDDVLATWNQLNMQAERRRHQLEDAADLQRFFSMVRELLQWMDLVALQINEKTRPKDVSGVELLINDHRSIKAEIAAREESMSICVNLGRTLLHRGRVGVDEVRAALINLITRKYSLEDMWEERWDYLQLILEVYQFARDASVAEAWILAQEPYLANKTLGETLDETLSLLKKHINFEKTVMSQEERFEA-----------LEKLTTMEIRAKEITKESILLK------------DKHKQERIENAIKIFQPPP-------SPELVH----------ESPKVSISEEDEEGKS--HQHKISVISKEAAEMCQSSETKTDIRGILIRKHEWEYKNRKALNRSWHEFLVVLSIEKNKLLVYKDEKHYNEKPQDTYHKDSGLDLNDLVAAPASDYLKRPFVFRIKITSTGAEYLFQAKDEEDMLRWVNSI-----NENSQKDLKSETT-APGKSSTLPACTSDPHVPS 6972
            +L+ER RIKALA ERE VQKKTFTKW+NSHL ++   I DLY DL+DG+ML+ LLE+LSGE+LP PTKG+MRIHCLENVDK+L FL EQRVHLENMG+HDIVDGN RLTLGLIWTIILRFQIQDI VE +D  EK+ AKDALLLWCQMKTAGYPN N+ NF+T WRDG+AFNA+IH+HRPDL+++  L +SN + NL+ A  +AE+ LG+ +LLDPED+SV++PDEKSI+TYVVT+YH+FSKMKA +V  KR+GK+L  ++ETE+M+  Y+ L S+LLEWI QTI +LN+R FANSL GVQQQL AFNTYR  EKPPKF EKGNLE+LLF+IQS+MRANNQ  Y+P EGKLISDIN AW +L+KAEH RELALR+ELIRQEKLEQLA RFDRKA MRE WL+ENQRL++QDNFG DL AVEAA KKHEAI+TDI AYEERV +V  V  ELE E YHD++R+  R+DNVIRLWE LL++L  R+LRL+    +QK+FQ++ +++D ++++K  L ++D G+HL+GVEDL+ KH+L+E DI +   ++  + + AQ      F  G   ++P DP  +  R  +++  Y  L +L+  R+  L  S+ +W+F W +A+EE W++EK Q++ + D G DL+SV RL  KHK  E+++   S +L   I+ G+++I + + G+EK+ + +K+++  W  L  L+  R+ +LE + + +   AD  +V+ W+++ +++V   +   +E S  + + KH+ +++ I +Y S I++L EQ   L E       ++ ++S I+ +Y  L EL   ++  L D L+L+++  +AD  + WI EKE+ L ++   ++LE+LEV +HRF+  E EMN QA +V  VN +A +L    HP   ++  ++ +LN  W+   +LV+  ++ L ++     Y LEC +T  WIREK++++EST ELG+DLAG+M LQR++ GM+RD+ AI AKL  L +E + L A+ P+  + I +    + + W E+   L +R++ L E+S+LQ+FL+DLD    WLS+ QT +ASED+P  LA+AEK L QHE +K EI++Y++++ ++ D G  +T+ +TDAQYMFL QRL AL+ GW EL +MWENRQ LLSQS + Q+FLRD  Q+E  L  +E  L+  ++P ++E ++  ++  E F+TT+ A+ +   AV++ GR LV   +  SDKI  +V SI  R + N+  +N+   +LKD    Q+  QD  +LS WI EKM+ A D S+ E +N+  ++ +H+AF  E+ +NK+ L +      Q++ E+P+   ++  ++ +L+  WEELE TT  K +++ +AN+  +F +   D+  WL  +   I   +   +  +   + LKK +  +N+M++++K++++L+  A  L +E  +    ++ +  ++E RF +L  P+  +K  L+  K I QF R+++D+  WV++++ LA ST+ G+NL TVQ L+++++ L  E+  H+ + + + E   +++++ S +  E     L +L++LW+ L    + R +RL+ES   Q + FD  EAE+W+ EQEL+++SEE+  +D+++A++++KKH   ++ +EDY E + +L   SR L+ + HP+++RI++ QS VDK+YAGL+DL  E++ +L E Q+L  L RE+ DLE WI ER +VA SH+LG D+EH  +L+ERF EF  +T  +G++RV + N +   LI+  H+D+A IA+W D +N++WA+L EL+ TR Q+L  ++E +K+    +++  RI +K   +P ++ +D  +V   QR H TF  D QAL  QV+ + ++A  L  +YAG K   I +R  +VL  W  L    + RR +L D  D  RFFSMVR+L+ WM+ V  QI  + +P+DVS VELL+N+H+ IKAEI AR +S + C+ LG++LL R     +E++  L+ L  ++  + D WE+RW++L+LILEV+QF+RDASVAEAW+  QEPYL+++ +G+++DE   L+K+H  FEK+  + +ERF A           + +L   E R ++     +  K             K  ++  +N +   Q  P       + ELV+          ES  +     D + KS       + +  +  EM  +        G L RKHEWE  N+KA +RSWH    V  I   ++  YKD K  N      YH +   +L + V   A+DY K+  VF++K+   G EYLFQAKD+E+M  W+ +I     ++ ++  L +++T A  ++ TLPA  +    P 
Sbjct:   36 RLFERSRIKALADEREAVQKKTFTKWVNSHLARVSCRITDLYADLRDGRMLIKLLEVLSGERLPKPTKGRMRIHCLENVDKALQFLKEQRVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKEKKSAKDALLLWCQMKTAGYPNVNIHNFTTSWRDGMAFNALIHKHRPDLIDFDKLKKSNAHYNLQNAFNLAEQHLGLTKLLDPEDISVDHPDEKSIITYVVTYYHYFSKMKALAVEGKRIGKVLDNAIETEKMIEKYESLASDLLEWIEQTIIILNNRKFANSLIGVQQQLQAFNTYRTVEKPPKFTEKGNLEVLLFTIQSKMRANNQKVYMPREGKLISDINKAWERLEKAEHERELALRNELIRQEKLEQLARRFDRKAAMRETWLSENQRLVSQDNFGFDLPAVEAATKKHEAIETDIAAYEERVLAVVAVARELEAENYHDIKRITARKDNVIRLWEYLLELLKARRLRLEMNLGLQKVFQEMLYIMDWMDEMKVLLLSQDYGKHLLGVEDLLQKHALVEADIAIQADRVRAVNASAQ-----RFATGGEGYKPCDPQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEQILSSDDYGKDLTSVVRLYCKHKAFEDEMSGRSGHLLQTIKEGEEMIAEDHFGSEKIRERIKDIQEQWANLEHLSAIRKKRLEDTTSSYQFQADADDVDAWMLDILRIVSSSDVGHDEYSTQSLVKKHKDVAEEIANYRSTIDALHEQAAALPEERFNSTDVQNRLSGIEERYKELAELARLRKQALQDALTLYKMFSEADACELWIVEKEQWLNNMQIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLIHSGHPSEKEIKAQQDKLNTRWSQFRELVDKTKDALSSALSIQNYHLECNETKSWIREKTKVIESTQELGNDLAGVMALQRKLTGMERDLAAIEAKLTDLQKEAEKLEAEHPDQAQAIMDRLAEINNVWEEMKTTLKNREESLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLAEAEKLLTQHENIKNEINNYEEDYQKMRDMGEMVTQGQTDAQYMFLRQRLQALDTGWNELHKMWENRQSLLSQSHAYQLFLRDTKQAEAFLNNQEYVLAHTELPNNLEAAEAAIKTQEDFMTTMDASEEKINAVVDTGRRLVNDENINSDKIEEKVDSIDSRHKKNRAGANDLLMRLKDNREMQKFLQDCQELSLWINEKMLTARDMSYDEARNLHSKWLKHQAFMAELASNKEWLDKIEKEGNQLIAEKPETEAIVKEKMSALHAMWEELESTTQTKAQRLFDANKAELFTQSCADLDKWLHGLESQIQSDDYGKDLTSVNIL-LKKQQMLENQMDVRKKEVEELRSQAQALSQE-GKSTDEVDGQRQVVEVRFIELLAPLNERKKYLLASKEIHQFNRDVEDEILWVEERMPLATSTDHGHNLQTVQLLMKKNQTLQKEIQGHQHRNDDIFERSKMILDD-SSLNAEAITQRLADLQALWSLLIEETEKRHRRLEESHRAQQYYFDGAEAEAWMSEQELYMMSEEKA-KDEQSAVSMLKKHQILEQAVEDYAETVHQLSKTSRALVAEGHPESERISMRQSQVDKLYAGLKDLSEERRGKLDERQRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFREFARDTGHIGQERVDSVNHMADDLINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQILAASFELHKFYHDAKEIFGRIQDKHKKLPEELGRDQNTVETLQRMHTTFEHDIQALGTQVRQLQEDAARLQAAYAGDKADDIQKRESEVLEAWKALLDACDGRRLRLVDTGDKFRFFSMVRDLMLWMEDVIRQIEAQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTTCIELGKSLLARKHYASEEIKEKLLQLTEKRKEMIDKWEDRWEWLRLILEVHQFSRDASVAEAWLFGQEPYLSSREIGQSVDEVEKLIKRHEAFEKSAATWDERFSALERLTTLELLEVRRLQEEEERKRKPPTPELSPKLSEDGSPQQWDGTKEGEQISQNGLPSDQESPRMAENADTNELVNGSTEQRSSSKESSPIPSPTADRKSKSGMQPQTAATLPAKTQEMPSAQ-----FEGFLHRKHEWEGHNKKASSRSWHNVYCV--INNQEMGFYKDSK--NAASGIAYHNEIPANLKEAVCEVATDYKKKKHVFKLKLND-GNEYLFQAKDDEEMNTWIQAITNAITSDKTEVSLSTQSTPASSRAQTLPASVTVTDSPG 2337          
BLAST of Spectrin beta chain vs. Ensembl Xenopus
Match: SPTBN1 (spectrin beta, non-erythrocytic 1 [Source:HGNC Symbol;Acc:HGNC:11275])

HSP 1 Score: 1814.66 bits (4699), Expect = 0.000e+0
Identity = 993/2248 (44.17%), Postives = 1491/2248 (66.33%), Query Frame = 1
Query:  154 KLYERFRIKALAGEREKVQKKTFTKWINSHLNKLKQSIDDLYNXXXXXXXXXXXXXXXXXXXXPYPTKGKMRIHCLENVDKSLNFLIEQRVHLENMGAHDIVDGNARLTLGLIWTIILRFQIQDIVVEEDDTSEKRQAKDALLLWCQMKTAGYPNTNVRNFSTCWRDGLAFNAIIHRHRPDLLEYSALSRSNPNENLEQAIRIAEEKLGIPRLLDPEDVSVENPDEKSIMTYVVTFYHFFSKMKADSVHSKRVGKILSQSMETEEMMVHYDKLTSNLLEWINQTIELLNDRTFANSLSGVQQQLAAFNTYRVTEKPPKFQEKGNLEMLLFSIQSQMRANNQMPYLPIEGKLISDINNAWNKLDKAEHARELALRDELIRQEKLEQLALRFDRKAGMREAWLTENQRLITQDNFGQDLSAVEAAGKKHEAIKTDILAYEERVNSVTLVTSELENECYHDVERVLCRRDNVIRLWEKLLDMLAVRKLRLDACYKVQKLFQDIKHLLDLINDLKARLKTEDIGRHLMGVEDLIHKHSLLEIDIRMVGTKIEGIMSDAQPFINSEFGLGSGDFQPADPNEVILRTVNLKEEYDNLLELSRNRKDNLSASKVMWEFLWGVADEEQWMKEKIQLMLNPDLGHDLSSVHRLISKHKVIEEDVRNHSNYLQNVIQGGQQLILDKNPGAEKVADXXXXXXXXXXXXXXXXXXRRSKLEQSLAYFHCLADCGEVEIWIIEQVKLVKIDETSINEESIITDIHKHEQLSKSIEDYESNINSLDEQVKKLSEGDLELVTIEEKVSNIKSQYAILIELTNQKQNKLTDTLSLFRVLRKADTVKTWIDEKEKLLMSLIPTDELEELEVFRHRFDGFEKEMNIQADQVEFVNTLAEKLSDMDHPQIADVVNKRFELNKLWNSLADLVEARREQLQTSYEFNQYLLECKQTGEWIREKSRLVESTDELGDDLAGIMQLQRRMGGMQRDMDAIRAKLEHLDEEMDTLIAKRPNXXXXXXXXXXXXXXFWAELGDMLADRDDRLSESSELQRFLQDLDHIHIWLSKMQTTVASEDLPKDLADAEKSLVQHEQLKEEIDSYQDEFIRLLDYGRRITEDKTDAQYMFLSQRLNALEEGWQELCQMWENRXXXXXXXXXXXVFLRDAIQSEVLLAQEENFLSKEDIPISIENSQNLLRKHEGFLTTLQANHDHTIAVIEFGRNLVERGHFCSDKINLRVKSILXXXXXXXXXXXXAYEKLKDQVLYQELSQDIDDLSKWIQEKMIIATDESFREEKNIARRYNRHRAFDEEIQANKDRLCQAIDYAMQIVEERPQLADMIYPQIDSLNQQWEELEQTTFLKGEKMIEANREAIFEEGTMDVMTWLXXXXXXXXXXXXXXXXXXXXXXKLKKVEEADNEMEIKRKQIQDLKMHAAKLKEEQPEKAFGIEQKHLILEHRFTQLQMPXXXXXXXXXXXXXXXXFLRNLDDQKAWVDDKLLLAESTNFGNNLLTVQQLLRRHRYLATEVNNHKPQLEYLKEEGAVLIEEVSPMQREKFVAGLQELESLWNRLEHSIDLRQQRLKESEATQTFLFDAEEAESWLWEQELFLLSEERGIRDQEAAINVIKKHDARQKTIEDYGEEITKLGTRSRLLIEKDHPQADRIALAQSHVDKVYAGLRDLCLEKKQRLSEIQKLNHLYREIVDLENWIYERTLVASSHDLGVDFEHCCLLRERFDEFFHETHLLGKDRVKAANDLCASLISQCHADSAEIAQWHDRINDSWAELQELMQTRIQLLRTAWEFYKYLSSCQDVLDRICEKIASIPTDVSKDSQSVAIQQRKHATFLSDAQALEGQVQWVVDEANHLLPSYAGQKEWHICERRDDVLATWNQLNMQAERRRHQLEDAADLQRFFSMVRELLQWMDLVALQINEKTRPKDVSGVELLINDHRSIKAEIAAREESMSICVNLGRTLLHRGRVGVDEVRAALINLITRKYSLEDMWEERWDYLQLILEVYQFARDASVAEAWILAQEPYLANKTLGETLDETLSLLKKHINFEKTVMSQEERFEALEKLTTM-----EIRAKEITKESILLKDKHKQERIENAIKIFQPPPSPELVH----------ESPKVSISEEDEEGKS--HQHKISVISKEAAEMCQSSETKTDIRGILIRKHEWEYKNRKALNRSWHEFLVVLSIEKNKLLVYKDEKHYNEKPQDTYHKDSGLDLNDLVAAPASDYLKRPFVFRIKITSTGAEYLFQAKDE 6846
            +L+ER RIKALA ERE VQKKTFTKW+NSHL ++   I DLY DL+DG+ML+ LLE+LSGE+LP PTKG+MRIHCLENVDK+L FL EQRVHLENMG+HDIVDGN RLTLGLIWTIILRFQIQDI VE +D  EK+ AKDALLLWCQMKTAGYPN N+ NF+T WRDG+AFNA+IH+HRPDL+++  L +SN + NL+ A  +AE+ LG+ +LLDPED+SV++PDEKSI+TYVVT+YH+FSKMKA +V  KR+GK+L  ++ETE+M+  Y+ L S+LLEWI QTI +LN+R FANSL GVQQQL AFNTYR  EKPPKF EKGNLE+LLF+IQS+MRANNQ  Y+P EGKLISDIN AW +L+KAEH RELALR+ELIRQEKLEQLA RFDRKA MRE WL+ENQRL++QDNFG DL AVEAA KKHEAI+TDI AYEERV +V  V  ELE E YHD++R+  R+DNVIRLWE LL++L  R+LRL+    +QK+FQ++ +++D ++++K  L ++D G+HL+GVEDL+ KH+L+E DI +   ++  + + AQ      F  G   ++P DP  +  R  +++  Y  L +L+  R+  L  S+ +W+F W +A+EE W++EK Q++ + D G DL+SV RL  KHK  E+++   S +L   I+ G+++I + + G+EK+ + +K+++  W  L  L+  R+ +LE + + +   AD  +V+ W+++ +++V   +   +E S  + + KH+ +++ I +Y S I++L EQ   L E       ++ ++S I+ +Y  L EL   ++  L D L+L+++  +AD  + WI EKE+ L ++   ++LE+LEV +HRF+  E EMN QA +V  VN +A +L    HP   ++  ++ +LN  W+   +LV+  ++ L ++     Y LEC +T  WIREK++++EST ELG+DLAG+M LQR++ GM+RD+ AI AKL  L +E + L A+ P+  + I +    + + W E+   L +R++ L E+S+LQ+FL+DLD    WLS+ QT +ASED+P  LA+AEK L QHE +K EI++Y++++ ++ D G  +T+ +TDAQYMFL QRL AL+ GW EL +MWENRQ LLSQS + Q+FLRD  Q+E  L  +E  L+  ++P ++E ++  ++  E F+TT+ A+ +   AV++ GR LV   +  SDKI  +V SI  R + N+  +N+   +LKD    Q+  QD  +LS WI EKM+ A D S+ E +N+  ++ +H+AF  E+ +NK+ L +      Q++ E+P+   ++  ++ +L+  WEELE TT  K +++ +AN+  +F +   D+  WL  +   I   +   +  +   + LKK +  +N+M++++K++++L+  A  L +E  +    ++ +  ++E RF +L  P+  +K  L+  K I QF R+++D+  WV++++ LA ST+ G+NL TVQ L+++++ L  E+  H+ + + + E   +++++ S +  E     L +L++LW+ L    + R +RL+ES   Q + FD  EAE+W+ EQEL+++SEE+  +D+++A++++KKH   ++ +EDY E + +L   SR L+ + HP+++RI++ QS VDK+YAGL+DL  E++ +L E Q+L  L RE+ DLE WI ER +VA SH+LG D+EH  +L+ERF EF  +T  +G++RV + N +   LI+  H+D+A IA+W D +N++WA+L EL+ TR Q+L  ++E +K+    +++  RI +K   +P ++ +D  +V   QR H TF  D QAL  QV+ + ++A  L  +YAG K   I +R  +VL  W  L    + RR +L D  D  RFFSMVR+L+ WM+ V  QI  + +P+DVS VELL+N+H+ IKAEI AR +S + C+ LG++LL R     +E++  L+ L  ++  + D WE+RW++L+LILEV+QF+RDASVAEAW+  QEPYL+++ +G+++DE   L+K+H  FEK+  + +ERF ALE+LTT+        +   T+ S    D       E A+ + +   + ELV+          ES  +     D + KS       + +  +  EM  +        G L RKHEWE  N+KA +RSWH    V  I   ++  YKD K  N      YH +   +L + V   A+DY K+  VF++K+   G EYLFQAKD+
Sbjct:   36 RLFERSRIKALADEREAVQKKTFTKWVNSHLARVSCRITDLYADLRDGRMLIKLLEVLSGERLPKPTKGRMRIHCLENVDKALQFLKEQRVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKEKKSAKDALLLWCQMKTAGYPNVNIHNFTTSWRDGMAFNALIHKHRPDLIDFDKLKKSNAHYNLQNAFNLAEQHLGLTKLLDPEDISVDHPDEKSIITYVVTYYHYFSKMKALAVEGKRIGKVLDNAIETEKMIEKYESLASDLLEWIEQTIIILNNRKFANSLIGVQQQLQAFNTYRTVEKPPKFTEKGNLEVLLFTIQSKMRANNQKVYMPREGKLISDINKAWERLEKAEHERELALRNELIRQEKLEQLARRFDRKAAMRETWLSENQRLVSQDNFGFDLPAVEAATKKHEAIETDIAAYEERVLAVVAVARELEAENYHDIKRITARKDNVIRLWEYLLELLKARRLRLEMNLGLQKVFQEMLYIMDWMDEMKVLLLSQDYGKHLLGVEDLLQKHALVEADIAIQADRVRAVNASAQ-----RFATGGEGYKPCDPQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEQILSSDDYGKDLTSVVRLYCKHKAFEDEMSGRSGHLLQTIKEGEEMIAEDHFGSEKIRERIKDIQEQWANLEHLSAIRKKRLEDTTSSYQFQADADDVDAWMLDILRIVSSSDVGHDEYSTQSLVKKHKDVAEEIANYRSTIDALHEQAAALPEERFNSTDVQNRLSGIEERYKELAELARLRKQALQDALTLYKMFSEADACELWIVEKEQWLNNMQIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLIHSGHPSEKEIKAQQDKLNTRWSQFRELVDKTKDALSSALSIQNYHLECNETKSWIREKTKVIESTQELGNDLAGVMALQRKLTGMERDLAAIEAKLTDLQKEAEKLEAEHPDQAQAIMDRLAEINNVWEEMKTTLKNREESLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLAEAEKLLTQHENIKNEINNYEEDYQKMRDMGEMVTQGQTDAQYMFLRQRLQALDTGWNELHKMWENRQSLLSQSHAYQLFLRDTKQAEAFLNNQEYVLAHTELPNNLEAAEAAIKTQEDFMTTMDASEEKINAVVDTGRRLVNDENINSDKIEEKVDSIDSRHKKNRAGANDLLMRLKDNREMQKFLQDCQELSLWINEKMLTARDMSYDEARNLHSKWLKHQAFMAELASNKEWLDKIEKEGNQLIAEKPETEAIVKEKMSALHAMWEELESTTQTKAQRLFDANKAELFTQSCADLDKWLHGLESQIQSDDYGKDLTSVNIL-LKKQQMLENQMDVRKKEVEELRSQAQALSQE-GKSTDEVDGQRQVVEVRFIELLAPLNERKKYLLASKEIHQFNRDVEDEILWVEERMPLATSTDHGHNLQTVQLLMKKNQTLQKEIQGHQHRNDDIFERSKMILDD-SSLNAEAITQRLADLQALWSLLIEETEKRHRRLEESHRAQQYYFDGAEAEAWMSEQELYMMSEEKA-KDEQSAVSMLKKHQILEQAVEDYAETVHQLSKTSRALVAEGHPESERISMRQSQVDKLYAGLKDLSEERRGKLDERQRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFREFARDTGHIGQERVDSVNHMADDLINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQILAASFELHKFYHDAKEIFGRIQDKHKKLPEELGRDQNTVETLQRMHTTFEHDIQALGTQVRQLQEDAARLQAAYAGDKADDIQKRESEVLEAWKALLDACDGRRLRLVDTGDKFRFFSMVRDLMLWMEDVIRQIEAQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTTCIELGKSLLARKHYASEEIKEKLLQLTEKRKEMIDKWEDRWEWLRLILEVHQFSRDASVAEAWLFGQEPYLSSREIGQSVDEVEKLIKRHEAFEKSAATWDERFSALERLTTVLTLCFSFLSTNSTRCSFTADDP------ETAVMMAENADTNELVNGSTEQRSSSKESSPIPSPTADRKSKSGMQPQTAATLPAKTQEMPSAQ-----FEGFLHRKHEWEGHNKKASSRSWHNVYCV--INNQEMGFYKDSK--NAASGIAYHNEIPANLKEAVCEVATDYKKKKHVFKLKLND-GNEYLFQAKDD 2258          
BLAST of Spectrin beta chain vs. Ensembl Xenopus
Match: SPTBN1 (spectrin beta, non-erythrocytic 1 [Source:HGNC Symbol;Acc:HGNC:11275])

HSP 1 Score: 1812.74 bits (4694), Expect = 0.000e+0
Identity = 994/2254 (44.10%), Postives = 1492/2254 (66.19%), Query Frame = 1
Query:  154 KLYERFRIKALAG------EREKVQKKTFTKWINSHLNKLKQSIDDLYNXXXXXXXXXXXXXXXXXXXXPYPTKGKMRIHCLENVDKSLNFLIEQRVHLENMGAHDIVDGNARLTLGLIWTIILRFQIQDIVVEEDDTSEKRQAKDALLLWCQMKTAGYPNTNVRNFSTCWRDGLAFNAIIHRHRPDLLEYSALSRSNPNENLEQAIRIAEEKLGIPRLLDPEDVSVENPDEKSIMTYVVTFYHFFSKMKADSVHSKRVGKILSQSMETEEMMVHYDKLTSNLLEWINQTIELLNDRTFANSLSGVQQQLAAFNTYRVTEKPPKFQEKGNLEMLLFSIQSQMRANNQMPYLPIEGKLISDINNAWNKLDKAEHARELALRDELIRQEKLEQLALRFDRKAGMREAWLTENQRLITQDNFGQDLSAVEAAGKKHEAIKTDILAYEERVNSVTLVTSELENECYHDVERVLCRRDNVIRLWEKLLDMLAVRKLRLDACYKVQKLFQDIKHLLDLINDLKARLKTEDIGRHLMGVEDLIHKHSLLEIDIRMVGTKIEGIMSDAQPFINSEFGLGSGDFQPADPNEVILRTVNLKEEYDNLLELSRNRKDNLSASKVMWEFLWGVADEEQWMKEKIQLMLNPDLGHDLSSVHRLISKHKVIEEDVRNHSNYLQNVIQGGQQLILDKNPGAEKVADXXXXXXXXXXXXXXXXXXRRSKLEQSLAYFHCLADCGEVEIWIIEQVKLVKIDETSINEESIITDIHKHEQLSKSIEDYESNINSLDEQVKKLSEGDLELVTIEEKVSNIKSQYAILIELTNQKQNKLTDTLSLFRVLRKADTVKTWIDEKEKLLMSLIPTDELEELEVFRHRFDGFEKEMNIQADQVEFVNTLAEKLSDMDHPQIADVVNKRFELNKLWNSLADLVEARREQLQTSYEFNQYLLECKQTGEWIREKSRLVESTDELGDDLAGIMQLQRRMGGMQRDMDAIRAKLEHLDEEMDTLIAKRPNXXXXXXXXXXXXXXFWAELGDMLADRDDRLSESSELQRFLQDLDHIHIWLSKMQTTVASEDLPKDLADAEKSLVQHEQLKEEIDSYQDEFIRLLDYGRRITEDKTDAQYMFLSQRLNALEEGWQELCQMWENRXXXXXXXXXXXVFLRDAIQSEVLLAQEENFLSKEDIPISIENSQNLLRKHEGFLTTLQANHDHTIAVIEFGRNLVERGHFCSDKINLRVKSILXXXXXXXXXXXXAYEKLKDQVLYQELSQDIDDLSKWIQEKMIIATDESFREEKNIARRYNRHRAFDEEIQANKDRLCQAIDYAMQIVEERPQLADMIYPQIDSLNQQWEELEQTTFLKGEKMIEANREAIFEEGTMDVMTWLXXXXXXXXXXXXXXXXXXXXXXKLKKVEEADNEMEIKRKQIQDLKMHAAKLKEEQPEKAFGIEQKHLILEHRFTQLQMPXXXXXXXXXXXXXXXXFLRNLDDQKAWVDDKLLLAESTNFGNNLLTVQQLLRRHRYLATEVNNHKPQLEYLKEEGAVLIEEVSPMQREKFVAGLQELESLWNRLEHSIDLRQQRLKESEATQTFLFDAEEAESWLWEQELFLLSEERGIRDQEAAINVIKKHDARQKTIEDYGEEITKLGTRSRLLIEKDHPQADRIALAQSHVDKVYAGLRDLCLEKKQRLSEIQKLNHLYREIVDLENWIYERTLVASSHDLGVDFEHCCLLRERFDEFFHETHLLGKDRVKAANDLCASLISQCHADSAEIAQWHDRINDSWAELQELMQTRIQLLRTAWEFYKYLSSCQDVLDRICEKIASIPTDVSKDSQSVAIQQRKHATFLSDAQALEGQVQWVVDEANHLLPSYAGQKEWHICERRDDVLATWNQLNMQAERRRHQLEDAADLQRFFSMVRELLQWMDLVALQINEKTRPKDVSGVELLINDHRSIKAEIAAREESMSICVNLGRTLLHRGRVGVDEVRAALINLITRKYSLEDMWEERWDYLQLILEVYQFARDASVAEAWILAQEPYLANKTLGETLDETLSLLKKHINFEKTVMSQEERFEALEKLTTM-----EIRAKEITKESILLKDKHKQERIENAIKIFQPPPSPELVH----------ESPKVSISEEDEEGKS--HQHKISVISKEAAEMCQSSETKTDIRGILIRKHEWEYKNRKALNRSWHEFLVVLSIEKNKLLVYKDEKHYNEKPQDTYHKDSGLDLNDLVAAPASDYLKRPFVFRIKITSTGAEYLFQAKDE 6846
            +L+ER RIKALAG      ERE VQKKTFTKW+NSHL ++   I DLY DL+DG+ML+ LLE+LSGE+LP PTKG+MRIHCLENVDK+L FL EQRVHLENMG+HDIVDGN RLTLGLIWTIILRFQIQDI VE +D  EK+ AKDALLLWCQMKTAGYPN N+ NF+T WRDG+AFNA+IH+HRPDL+++  L +SN + NL+ A  +AE+ LG+ +LLDPED+SV++PDEKSI+TYVVT+YH+FSKMKA +V  KR+GK+L  ++ETE+M+  Y+ L S+LLEWI QTI +LN+R FANSL GVQQQL AFNTYR  EKPPKF EKGNLE+LLF+IQS+MRANNQ  Y+P EGKLISDIN AW +L+KAEH RELALR+ELIRQEKLEQLA RFDRKA MRE WL+ENQRL++QDNFG DL AVEAA KKHEAI+TDI AYEERV +V  V  ELE E YHD++R+  R+DNVIRLWE LL++L  R+LRL+    +QK+FQ++ +++D ++++K  L ++D G+HL+GVEDL+ KH+L+E DI +   ++  + + AQ      F  G   ++P DP  +  R  +++  Y  L +L+  R+  L  S+ +W+F W +A+EE W++EK Q++ + D G DL+SV RL  KHK  E+++   S +L   I+ G+++I + + G+EK+ + +K+++  W  L  L+  R+ +LE + + +   AD  +V+ W+++ +++V   +   +E S  + + KH+ +++ I +Y S I++L EQ   L E       ++ ++S I+ +Y  L EL   ++  L D L+L+++  +AD  + WI EKE+ L ++   ++LE+LEV +HRF+  E EMN QA +V  VN +A +L    HP   ++  ++ +LN  W+   +LV+  ++ L ++     Y LEC +T  WIREK++++EST ELG+DLAG+M LQR++ GM+RD+ AI AKL  L +E + L A+ P+  + I +    + + W E+   L +R++ L E+S+LQ+FL+DLD    WLS+ QT +ASED+P  LA+AEK L QHE +K EI++Y++++ ++ D G  +T+ +TDAQYMFL QRL AL+ GW EL +MWENRQ LLSQS + Q+FLRD  Q+E  L  +E  L+  ++P ++E ++  ++  E F+TT+ A+ +   AV++ GR LV   +  SDKI  +V SI  R + N+  +N+   +LKD    Q+  QD  +LS WI EKM+ A D S+ E +N+  ++ +H+AF  E+ +NK+ L +      Q++ E+P+   ++  ++ +L+  WEELE TT  K +++ +AN+  +F +   D+  WL  +   I   +   +  +   + LKK +  +N+M++++K++++L+  A  L +E  +    ++ +  ++E RF +L  P+  +K  L+  K I QF R+++D+  WV++++ LA ST+ G+NL TVQ L+++++ L  E+  H+ + + + E   +++++ S +  E     L +L++LW+ L    + R +RL+ES   Q + FD  EAE+W+ EQEL+++SEE+  +D+++A++++KKH   ++ +EDY E + +L   SR L+ + HP+++RI++ QS VDK+YAGL+DL  E++ +L E Q+L  L RE+ DLE WI ER +VA SH+LG D+EH  +L+ERF EF  +T  +G++RV + N +   LI+  H+D+A IA+W D +N++WA+L EL+ TR Q+L  ++E +K+    +++  RI +K   +P ++ +D  +V   QR H TF  D QAL  QV+ + ++A  L  +YAG K   I +R  +VL  W  L    + RR +L D  D  RFFSMVR+L+ WM+ V  QI  + +P+DVS VELL+N+H+ IKAEI AR +S + C+ LG++LL R     +E++  L+ L  ++  + D WE+RW++L+LILEV+QF+RDASVAEAW+  QEPYL+++ +G+++DE   L+K+H  FEK+  + +ERF ALE+LTT+        +   T+ S    D       E A+ + +   + ELV+          ES  +     D + KS       + +  +  EM  +        G L RKHEWE  N+KA +RSWH    V  I   ++  YKD K  N      YH +   +L + V   A+DY K+  VF++K+   G EYLFQAKD+
Sbjct:   36 RLFERSRIKALAGSAMLIDEREAVQKKTFTKWVNSHLARVSCRITDLYADLRDGRMLIKLLEVLSGERLPKPTKGRMRIHCLENVDKALQFLKEQRVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKEKKSAKDALLLWCQMKTAGYPNVNIHNFTTSWRDGMAFNALIHKHRPDLIDFDKLKKSNAHYNLQNAFNLAEQHLGLTKLLDPEDISVDHPDEKSIITYVVTYYHYFSKMKALAVEGKRIGKVLDNAIETEKMIEKYESLASDLLEWIEQTIIILNNRKFANSLIGVQQQLQAFNTYRTVEKPPKFTEKGNLEVLLFTIQSKMRANNQKVYMPREGKLISDINKAWERLEKAEHERELALRNELIRQEKLEQLARRFDRKAAMRETWLSENQRLVSQDNFGFDLPAVEAATKKHEAIETDIAAYEERVLAVVAVARELEAENYHDIKRITARKDNVIRLWEYLLELLKARRLRLEMNLGLQKVFQEMLYIMDWMDEMKVLLLSQDYGKHLLGVEDLLQKHALVEADIAIQADRVRAVNASAQ-----RFATGGEGYKPCDPQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEQILSSDDYGKDLTSVVRLYCKHKAFEDEMSGRSGHLLQTIKEGEEMIAEDHFGSEKIRERIKDIQEQWANLEHLSAIRKKRLEDTTSSYQFQADADDVDAWMLDILRIVSSSDVGHDEYSTQSLVKKHKDVAEEIANYRSTIDALHEQAAALPEERFNSTDVQNRLSGIEERYKELAELARLRKQALQDALTLYKMFSEADACELWIVEKEQWLNNMQIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLIHSGHPSEKEIKAQQDKLNTRWSQFRELVDKTKDALSSALSIQNYHLECNETKSWIREKTKVIESTQELGNDLAGVMALQRKLTGMERDLAAIEAKLTDLQKEAEKLEAEHPDQAQAIMDRLAEINNVWEEMKTTLKNREESLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLAEAEKLLTQHENIKNEINNYEEDYQKMRDMGEMVTQGQTDAQYMFLRQRLQALDTGWNELHKMWENRQSLLSQSHAYQLFLRDTKQAEAFLNNQEYVLAHTELPNNLEAAEAAIKTQEDFMTTMDASEEKINAVVDTGRRLVNDENINSDKIEEKVDSIDSRHKKNRAGANDLLMRLKDNREMQKFLQDCQELSLWINEKMLTARDMSYDEARNLHSKWLKHQAFMAELASNKEWLDKIEKEGNQLIAEKPETEAIVKEKMSALHAMWEELESTTQTKAQRLFDANKAELFTQSCADLDKWLHGLESQIQSDDYGKDLTSVNIL-LKKQQMLENQMDVRKKEVEELRSQAQALSQE-GKSTDEVDGQRQVVEVRFIELLAPLNERKKYLLASKEIHQFNRDVEDEILWVEERMPLATSTDHGHNLQTVQLLMKKNQTLQKEIQGHQHRNDDIFERSKMILDD-SSLNAEAITQRLADLQALWSLLIEETEKRHRRLEESHRAQQYYFDGAEAEAWMSEQELYMMSEEKA-KDEQSAVSMLKKHQILEQAVEDYAETVHQLSKTSRALVAEGHPESERISMRQSQVDKLYAGLKDLSEERRGKLDERQRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFREFARDTGHIGQERVDSVNHMADDLINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQILAASFELHKFYHDAKEIFGRIQDKHKKLPEELGRDQNTVETLQRMHTTFEHDIQALGTQVRQLQEDAARLQAAYAGDKADDIQKRESEVLEAWKALLDACDGRRLRLVDTGDKFRFFSMVRDLMLWMEDVIRQIEAQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTTCIELGKSLLARKHYASEEIKEKLLQLTEKRKEMIDKWEDRWEWLRLILEVHQFSRDASVAEAWLFGQEPYLSSREIGQSVDEVEKLIKRHEAFEKSAATWDERFSALERLTTVLTLCFSFLSTNSTRCSFTADDP------ETAVMMAENADTNELVNGSTEQRSSSKESSPIPSPTADRKSKSGMQPQTAATLPAKTQEMPSAQ-----FEGFLHRKHEWEGHNKKASSRSWHNVYCV--INNQEMGFYKDSK--NAASGIAYHNEIPANLKEAVCEVATDYKKKKHVFKLKLND-GNEYLFQAKDD 2264          
BLAST of Spectrin beta chain vs. Ensembl Xenopus
Match: SPTBN1 (spectrin beta, non-erythrocytic 1 [Source:HGNC Symbol;Acc:HGNC:11275])

HSP 1 Score: 1808.11 bits (4682), Expect = 0.000e+0
Identity = 988/2232 (44.27%), Postives = 1484/2232 (66.49%), Query Frame = 1
Query:  154 KLYERFRIKALAGEREKVQKKTFTKWINSHLNKLKQSIDDLYNXXXXXXXXXXXXXXXXXXXXPYPTKGKMRIHCLENVDKSLNFLIEQRVHLENMGAHDIVDGNARLTLGLIWTIILRFQIQDIVVEEDDTSEKRQAKDALLLWCQMKTAGYPNTNVRNFSTCWRDGLAFNAIIHRHRPDLLEYSALSRSNPNENLEQAIRIAEEKLGIPRLLDPEDVSVENPDEKSIMTYVVTFYHFFSKMKADSVHSKRVGKILSQSMETEEMMVHYDKLTSNLLEWINQTIELLNDRTFANSLSGVQQQLAAFNTYRVTEKPPKFQEKGNLEMLLFSIQSQMRANNQMPYLPIEGKLISDINNAWNKLDKAEHARELALRDELIRQEKLEQLALRFDRKAGMREAWLTENQRLITQDNFGQDLSAVEAAGKKHEAIKTDILAYEERVNSVTLVTSELENECYHDVERVLCRRDNVIRLWEKLLDMLAVRKLRLDACYKVQKLFQDIKHLLDLINDLKARLKTEDIGRHLMGVEDLIHKHSLLEIDIRMVGTKIEGIMSDAQPFINSEFGLGSGDFQPADPNEVILRTVNLKEEYDNLLELSRNRKDNLSASKVMWEFLWGVADEEQWMKEKIQLMLNPDLGHDLSSVHRLISKHKVIEEDVRNHSNYLQNVIQGGQQLILDKNPGAEKVADXXXXXXXXXXXXXXXXXXRRSKLEQSLAYFHCLADCGEVEIWIIEQVKLVKIDETSINEESIITDIHKHEQLSKSIEDYESNINSLDEQVKKLSEGDLELVTIEEKVSNIKSQYAILIELTNQKQNKLTDTLSLFRVLRKADTVKTWIDEKEKLLMSLIPTDELEELEVFRHRFDGFEKEMNIQADQVEFVNTLAEKLSDMDHPQIADVVNKRFELNKLWNSLADLVEARREQLQTSYEFNQYLLECKQTGEWIREKSRLVESTDELGDDLAGIMQLQRRMGGMQRDMDAIRAKLEHLDEEMDTLIAKRPNXXXXXXXXXXXXXXFWAELGDMLADRDDRLSESSELQRFLQDLDHIHIWLSKMQTTVASEDLPKDLADAEKSLVQHEQLKEEIDSYQDEFIRLLDYGRRITEDKTDAQYMFLSQRLNALEEGWQELCQMWENRXXXXXXXXXXXVFLRDAIQSEVLLAQEENFLSKEDIPISIENSQNLLRKHEGFLTTLQANHDHTIAVIEFGRNLVERGHFCSDKINLRVKSILXXXXXXXXXXXXAYEKLKDQVLYQELSQDIDDLSKWIQEKMIIATDESFREEKNIARRYNRHRAFDEEIQANKDRLCQAIDYAMQIVEERPQLADMIYPQIDSLNQQWEELEQTTFLKGEKMIEANREAIFEEGTMDVMTWLXXXXXXXXXXXXXXXXXXXXXXKLKKVEEADNEMEIKRKQIQDLKMHAAKLKEEQPEKAFGIEQKHLILEHRFTQLQMPXXXXXXXXXXXXXXXXFLRNLDDQKAWVDDKLLLAESTNFGNNLLTVQQLLRRHRYLATEVNNHKPQLEYLKEEGAVLIEEVSPMQREKFVAGLQELESLWNRLEHSIDLRQQRLKESEATQTFLFDAEEAESWLWEQELFLLSEERGIRDQEAAINVIKKHDARQKTIEDYGEEITKLGTRSRLLIEKDHPQADRIALAQSHVDKVYAGLRDLCLEKKQRLSEIQKLNHLYREIVDLENWIYERTLVASSHDLGVDFEHCCLLRERFDEFFHETHLLGKDRVKAANDLCASLISQCHADSAEIAQWHDRINDSWAELQELMQTRIQLLRTAWEFYKYLSSCQDVLDRICEKIASIPTDVSKDSQSVAIQQRKHATFLSDAQALEGQVQWVVDEANHLLPSYAGQKEWHICERRDDVLATWNQLNMQAERRRHQLEDAADLQRFFSMVRELLQWMDLVALQINEKTRPKDVSGVELLINDHRSIKAEIAAREESMSICVNLGRTLLHRGRVGVDEVRAALINLITRKYSLEDMWEERWDYLQLILEVYQFARDASVAEAWILAQEPYLANKTLGETLDETLSLLKKHINFEKTVMSQEERFEALEKLTT-MEIRAKEITKESILLKDKHKQERIENAIKIFQPPPSPELVHESPKVSISEEDEEGKSHQHKISVISKEAAEMCQSSETKTDIRGILIRKHEWEYKNRKALNRSWHEFLVVLSIEKNKLLVYKDEKHYNEKPQDTYHKDSGLDLNDLVAAPASDYLKRPFVFRIKITSTGAEYLFQAKDE 6846
            +L+ER RIKALA ERE VQKKTFTKW+NSHL ++   I DLY DL+DG+ML+ LLE+LSGE+LP PTKG+MRIHCLENVDK+L FL EQRVHLENMG+HDIVDGN RLTLGLIWTIILRFQIQDI VE +D  EK+ AKDALLLWCQMKTAGYPN N+ NF+T WRDG+AFNA+IH+HRPDL+++  L +SN + NL+ A  +AE+ LG+ +LLDPED+SV++PDEKSI+TYVVT+YH+FSKMKA +V  KR+GK+L  ++ETE+M+  Y+ L S+LLEWI QTI +LN+R FANSL GVQQQL AFNTYR  EKPPKF EKGNLE+LLF+IQS+MRANNQ  Y+P EGKLISDIN AW +L+KAEH RELALR+ELIRQEKLEQLA RFDRKA MRE WL+ENQRL++QDNFG DL AVEAA KKHEAI+TDI AYEERV +V  V  ELE E YHD++R+  R+DNVIRLWE LL++L  R+LRL+    +QK+FQ++ +++D ++++K  L ++D G+HL+GVEDL+ KH+L+E DI +   ++  + + AQ      F  G   ++P DP  +  R  +++  Y  L +L+  R+  L  S+ +W+F W +A+EE W++EK Q++ + D G DL+SV RL  KHK  E+++   S +L   I+ G+++I + + G+EK+ + +K+++  W  L  L+  R+ +LE + + +   AD  +V+ W+++ +++V   +   +E S  + + KH+ +++ I +Y S I++L EQ   L E       ++ ++S I+ +Y  L EL   ++  L D L+L+++  +AD  + WI EKE+ L ++   ++LE+LEV   +F+  E EMN QA +V  VN +A +L    HP   ++  ++ +LN  W+   +LV+  ++ L ++     Y LEC +T  WIREK++++EST ELG+DLAG+M LQR++ GM+RD+ AI AKL  L +E + L A+ P+  + I +    + + W E+   L +R++ L E+S+LQ+FL+DLD    WLS+ QT +ASED+P  LA+AEK L QHE +K EI++Y++++ ++ D G  +T+ +TDAQYMFL QRL AL+ GW EL +MWENRQ LLSQS + Q+FLRD  Q+E  L  +E  L+  ++P ++E ++  ++  E F+TT+ A+ +   AV++ GR LV   +  SDKI  +V SI  R + N+  +N+   +LKD    Q+  QD  +LS WI EKM+ A D S+ E +N+  ++ +H+AF  E+ +NK+ L +      Q++ E+P+   ++  ++ +L+  WEELE TT  K +++ +AN+  +F +   D+  WL  +   I   +   +  +   + LKK +  +N+M++++K++++L+  A  L +E  +    ++ +  ++E RF +L  P+  +K  L+  K I QF R+++D+  WV++++ LA ST+ G+NL TVQ L+++++ L  E+  H+ + + + E   +++++ S +  E     L +L++LW+ L    + R +RL+ES   Q + FD  EAE+W+ EQEL+++SEE+  +D+++A++++KKH   ++ +EDY E + +L   SR L+ + HP+++RI++ QS VDK+YAGL+DL  E++ +L E Q+L  L RE+ DLE WI ER +VA SH+LG D+EH  +L+ERF EF  +T  +G++RV + N +   LI+  H+D+A IA+W D +N++WA+L EL+ TR Q+L  ++E +K+    +++  RI +K   +P ++ +D  +V   QR H TF  D QAL  QV+ + ++A  L  +YAG K   I +R  +VL  W  L    + RR +L D  D  RFFSMVR+L+ WM+ V  QI  + +P+DVS VELL+N+H+ IKAEI AR +S + C+ LG++LL R     +E++  L+ L  ++  + D WE+RW++L+LILEV+QF+RDASVAEAW+  QEPYL+++ +G+++DE   L+K+H  FEK+  + +ERF ALE+LTT + +   E+   S   +   K+           P PSP         +   + + G   Q   ++ +K   EM  +        G L RKHEWE  N+KA +RSWH    V  I   ++  YKD K  N      YH +   +L + V   A+DY K+  VF++K+   G EYLFQAKD+
Sbjct:   40 RLFERSRIKALADEREAVQKKTFTKWVNSHLARVSCRITDLYADLRDGRMLIKLLEVLSGERLPKPTKGRMRIHCLENVDKALQFLKEQRVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKEKKSAKDALLLWCQMKTAGYPNVNIHNFTTSWRDGMAFNALIHKHRPDLIDFDKLKKSNAHYNLQNAFNLAEQHLGLTKLLDPEDISVDHPDEKSIITYVVTYYHYFSKMKALAVEGKRIGKVLDNAIETEKMIEKYESLASDLLEWIEQTIIILNNRKFANSLIGVQQQLQAFNTYRTVEKPPKFTEKGNLEVLLFTIQSKMRANNQKVYMPREGKLISDINKAWERLEKAEHERELALRNELIRQEKLEQLARRFDRKAAMRETWLSENQRLVSQDNFGFDLPAVEAATKKHEAIETDIAAYEERVLAVVAVARELEAENYHDIKRITARKDNVIRLWEYLLELLKARRLRLEMNLGLQKVFQEMLYIMDWMDEMKVLLLSQDYGKHLLGVEDLLQKHALVEADIAIQADRVRAVNASAQ-----RFATGGEGYKPCDPQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEQILSSDDYGKDLTSVVRLYCKHKAFEDEMSGRSGHLLQTIKEGEEMIAEDHFGSEKIRERIKDIQEQWANLEHLSAIRKKRLEDTTSSYQFQADADDVDAWMLDILRIVSSSDVGHDEYSTQSLVKKHKDVAEEIANYRSTIDALHEQAAALPEERFNSTDVQNRLSGIEERYKELAELARLRKQALQDALTLYKMFSEADACELWIVEKEQWLNNMQIPEKLEDLEVI--QFESLEPEMNNQASRVAVVNQIARQLIHSGHPSEKEIKAQQDKLNTRWSQFRELVDKTKDALSSALSIQNYHLECNETKSWIREKTKVIESTQELGNDLAGVMALQRKLTGMERDLAAIEAKLTDLQKEAEKLEAEHPDQAQAIMDRLAEINNVWEEMKTTLKNREESLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLAEAEKLLTQHENIKNEINNYEEDYQKMRDMGEMVTQGQTDAQYMFLRQRLQALDTGWNELHKMWENRQSLLSQSHAYQLFLRDTKQAEAFLNNQEYVLAHTELPNNLEAAEAAIKTQEDFMTTMDASEEKINAVVDTGRRLVNDENINSDKIEEKVDSIDSRHKKNRAGANDLLMRLKDNREMQKFLQDCQELSLWINEKMLTARDMSYDEARNLHSKWLKHQAFMAELASNKEWLDKIEKEGNQLIAEKPETEAIVKEKMSALHAMWEELESTTQTKAQRLFDANKAELFTQSCADLDKWLHGLESQIQSDDYGKDLTSVNIL-LKKQQMLENQMDVRKKEVEELRSQAQALSQE-GKSTDEVDGQRQVVEVRFIELLAPLNERKKYLLASKEIHQFNRDVEDEILWVEERMPLATSTDHGHNLQTVQLLMKKNQTLQKEIQGHQHRNDDIFERSKMILDD-SSLNAEAITQRLADLQALWSLLIEETEKRHRRLEESHRAQQYYFDGAEAEAWMSEQELYMMSEEKA-KDEQSAVSMLKKHQILEQAVEDYAETVHQLSKTSRALVAEGHPESERISMRQSQVDKLYAGLKDLSEERRGKLDERQRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFREFARDTGHIGQERVDSVNHMADDLINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQILAASFELHKFYHDAKEIFGRIQDKHKKLPEELGRDQNTVETLQRMHTTFEHDIQALGTQVRQLQEDAARLQAAYAGDKADDIQKRESEVLEAWKALLDACDGRRLRLVDTGDKFRFFSMVRDLMLWMEDVIRQIEAQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTTCIELGKSLLARKHYASEEIKEKLLQLTEKRKEMIDKWEDRWEWLRLILEVHQFSRDASVAEAWLFGQEPYLSSREIGQSVDEVEKLIKRHEAFEKSAATWDERFSALERLTTVLTLYTNELVNGSTEQRSSSKES---------SPIPSP---------TADRKSKSGMQPQTAATLPAK-TQEMPSAQ-----FEGFLHRKHEWEGHNKKASSRSWHNVYCV--INNQEMGFYKDSK--NAASGIAYHNEIPANLKEAVCEVATDYKKKKHVFKLKLND-GNEYLFQAKDD 2231          
BLAST of Spectrin beta chain vs. Ensembl Xenopus
Match: SPTBN1 (spectrin beta, non-erythrocytic 1 [Source:HGNC Symbol;Acc:HGNC:11275])

HSP 1 Score: 1803.88 bits (4671), Expect = 0.000e+0
Identity = 997/2315 (43.07%), Postives = 1508/2315 (65.14%), Query Frame = 1
Query:  172 RIKALAGEREKVQKKTFTKWINSHLNKLKQSIDDLYNXXXXXXXXXXXXXXXXXXXXPYPTKGKMRIHCLENVDKSLNFLIEQRVHLENMGAHDIVDGNARLTLGLIWTIILRFQIQDIVVEEDDTSEKRQAKDALLLWCQMKTAGYPNTNVRNFSTCWRDGLAFNAIIHRHRPDLLEYSALSRSNPNENLEQAIRIAEEKLGIPRLLDPEDVSVENPDEKSIMTYVVTFYHFFSKMKADSVHSKRVGKILSQSMETEEMMVHYDKLTSNLLEWINQTIELLNDRTFANSLSGVQQQLAAFNTYRVTEKPPKFQEKGNLEMLLFSIQSQMRANNQMPYLPIEGKLISDINNAWNKLDKAEHARELALRDELIRQEKLEQLALRFDRKAGMREAWLTENQRLITQDNFGQDLSAVEAAGKKHEAIKTDILAYEERVNSVTLVTSELENECYHDVERVLCRRDNVIRLWEKLLDMLAVRKLRLDACYKVQKLFQDIKHLLDLINDLKARLKTEDIGRHLMGVEDLIHKHSLLEIDIRMVGTKIEGIMSDAQPFINSEFGLGSGDFQPADPNEVILRTVNLKEEYDNLLELSRNRKDNLSASKVMWEFLWGVADEEQWMKEKIQLMLNPDLGHDLSSVHRLISKHKVIEEDVRNHSNYLQNVIQGGQQLILDKNPGAEKVADXXXXXXXXXXXXXXXXXXRRSKLEQSLAYFHCLADCGEVEIWIIEQVKLVKIDETSINEESIITDIHKHEQLSKSIEDYESNINSLDEQVKKLSEGDLELVTIEEKVSNIKSQYAILIELTNQKQNKLTDTLSLFRVLRKADTVKTWIDEKEKLLMSLIPTDELEELEVFRHRFDGFEKEMNIQADQVEFVNTLAEKLSDMDHPQIADVVNKRFELNKLWNSLADLVEARREQLQTSYEFNQYLLECKQTGEWIREKSRLVESTDELGDDLAGIMQLQRRMGGMQRDMDAIRAKLEHLDEEMDTLIAKRPNXXXXXXXXXXXXXXFWAELGDMLADRDDRLSESSELQRFLQDLDHIHIWLSKMQTTVASEDLPKDLADAEKSLVQHEQLKEEIDSYQDEFIRLLDYGRRITEDKTDAQYMFLSQRLNALEEGWQELCQMWENRXXXXXXXXXXXVFLRDAIQSEVLLAQEENFLSKEDIPISIENSQNLLRKHEGFLTTLQANHDHTIAVIEFGRNLVERGHFCSDKINLRVKSILXXXXXXXXXXXXAYEKLKDQVLYQELSQDIDDLSKWIQEKMIIATDESFREEKNIARRYNRHRAFDEEIQANKDRLCQAIDYAMQIVEERPQLADMIYPQIDSLNQQWEELEQTTFLKGEKMIEANREAIFEEGTMDVMTWLXXXXXXXXXXXXXXXXXXXXXXKLKKVEEADNEMEIKRKQIQDLKMHAAKLKEEQPEKAFGIEQKHLILEHRFTQLQMPXXXXXXXXXXXXXXXXFLRNLDDQKAWVDDKLLLAESTNFGNNLLTVQQLLRRHRYLATEVNNHKPQLEYLKEEGAVLIEEVSPMQREKFVAGLQELESLWNRLEHSIDLRQQRLKESEATQTFLFDAEEAESWLWEQELFLLSEERGIRDQEAAINVIKKHDARQKTIEDYGEEITKLGTRSRLLIEKDHPQADRIALAQSHVDKVYAGLRDLCLEKKQRLSEIQKLNHLYREIVDLENWIYERTLVASSHDLGVDFEHCCLLRERFDEFFHETHLLGKDRVKAANDLCASLISQCHADSAEIAQWHDRINDSWAELQELMQTRIQLLRTAWEFYKYLSSCQDVLDRICEKIASIPTDVSKDSQSVAIQQRKHATFLSDAQALEGQVQWVVDEANHLLPSYAGQKEWHICERRDDVLATWNQLNMQAERRRHQLEDAADLQRFFSMVRELLQWMDLVALQINEKTRPKDVSGVELLINDHRSIKAEIAAREESMSICVNLGRTLLHRGRVGVDEVRAALINLITRKYSLEDMWEERWDYLQLILEVYQFARDASVAEAWILAQEPYLANKTLGETLDETLSLLKKHINFEKTVMSQEERFEA-----------LEKLTTMEIRAKEITKESILLK------------DKHKQERIENAIKIFQPPP-------SPELVH----------ESPKVSISEEDEEGKS--HQHKISVISKEAAEMCQSSETKTDIRGILIRKHEWEYKNRKALNRSWHEFLVVLSIEKNKLLVYKDEKHYNEKPQDTYHKDSGLDLNDLVAAPASDYLKRPFVFRIKITSTGAEYLFQAKDEEDMLRWVNSI-----NENSQKDLKSETT-APGKSSTLPACTSDPHVPS 6972
            R K L  ERE VQKKTFTKW+NSHL ++   I DLY DL+DG+ML+ LLE+LSGE+LP PTKG+MRIHCLENVDK+L FL EQRVHLENMG+HDIVDGN RLTLGLIWTIILRFQIQDI VE +D  EK+ AKDALLLWCQMKTAGYPN N+ NF+T WRDG+AFNA+IH+HRPDL+++  L +SN + NL+ A  +AE+ LG+ +LLDPED+SV++PDEKSI+TYVVT+YH+FSKMKA +V  KR+GK+L  ++ETE+M+  Y+ L S+LLEWI QTI +LN+R FANSL GVQQQL AFNTYR  EKPPKF EKGNLE+LLF+IQS+MRANNQ  Y+P EGKLISDIN AW +L+KAEH RELALR+ELIRQEKLEQLA RFDRKA MRE WL+ENQRL++QDNFG DL AVEAA KKHEAI+TDI AYEERV +V  V  ELE E YHD++R+  R+DNVIRLWE LL++L  R+LRL+    +QK+FQ++ +++D ++++K  L ++D G+HL+GVEDL+ KH+L+E DI +   ++  + + AQ      F  G   ++P DP  +  R  +++  Y  L +L+  R+  L  S+ +W+F W +A+EE W++EK Q++ + D G DL+SV RL  KHK  E+++   S +L   I+ G+++I + + G+EK+ + +K+++  W  L  L+  R+ +LE + + +   AD  +V+ W+++ +++V   +   +E S  + + KH+ +++ I +Y S I++L EQ   L E       ++ ++S I+ +Y  L EL   ++  L D L+L+++  +AD  + WI EKE+ L ++   ++LE+LEV +HRF+  E EMN QA +V  VN +A +L    HP   ++  ++ +LN  W+   +LV+  ++ L ++     Y LEC +T  WIREK++++EST ELG+DLAG+M LQR++ GM+RD+ AI AKL  L +E + L A+ P+  + I +    + + W E+   L +R++ L E+S+LQ+FL+DLD    WLS+ QT +ASED+P  LA+AEK L QHE +K EI++Y++++ ++ D G  +T+ +TDAQYMFL QRL AL+ GW EL +MWENRQ LLSQS + Q+FLRD  Q+E  L  +E  L+  ++P ++E ++  ++  E F+TT+ A+ +   AV++ GR LV   +  SDKI  +V SI  R + N+  +N+   +LKD    Q+  QD  +LS WI EKM+ A D S+ E +N+  ++ +H+AF  E+ +NK+ L +      Q++ E+P+   ++  ++ +L+  WEELE TT  K +++ +AN+  +F +   D+  WL  +   I   +   +  +   + LKK +  +N+M++++K++++L+  A  L +E  +    ++ +  ++E RF +L  P+  +K  L+  K I QF R+++D+  WV++++ LA ST+ G+NL TVQ L+++++ L  E+  H+ + + + E   +++++ S +  E     L +L++LW+ L    + R +RL+ES   Q + FD  EAE+W+ EQEL+++SEE+  +D+++A++++KKH   ++ +EDY E + +L   SR L+ + HP+++RI++ QS VDK+YAGL+DL  E++ +L E Q+L  L RE+ DLE WI ER +VA SH+LG D+EH  +L+ERF EF  +T  +G++RV + N +   LI+  H+D+A IA+W D +N++WA+L EL+ TR Q+L  ++E +K+    +++  RI +K   +P ++ +D  +V   QR H TF  D QAL  QV+ + ++A  L  +YAG K   I +R  +VL  W  L    + RR +L D  D  RFFSMVR+L+ WM+ V  QI  + +P+DVS VELL+N+H+ IKAEI AR +S + C+ LG++LL R     +E++  L+ L  ++  + D WE+RW++L+LILEV+QF+RDASVAEAW+  QEPYL+++ +G+++DE   L+K+H  FEK+  + +ERF A           + +L   E R ++     +  K             K  ++  +N +   Q  P       + ELV+          ES  +     D + KS       + +  +  EM  +        G L RKHEWE  N+KA +RSWH    V  I   ++  YKD K  N      YH +   +L + V   A+DY K+  VF++K+   G EYLFQAKD+E+M  W+ +I     ++ ++  L +++T A  ++ TLPA  +    P 
Sbjct:   31 RFKQLQDEREAVQKKTFTKWVNSHLARVSCRITDLYADLRDGRMLIKLLEVLSGERLPKPTKGRMRIHCLENVDKALQFLKEQRVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKEKKSAKDALLLWCQMKTAGYPNVNIHNFTTSWRDGMAFNALIHKHRPDLIDFDKLKKSNAHYNLQNAFNLAEQHLGLTKLLDPEDISVDHPDEKSIITYVVTYYHYFSKMKALAVEGKRIGKVLDNAIETEKMIEKYESLASDLLEWIEQTIIILNNRKFANSLIGVQQQLQAFNTYRTVEKPPKFTEKGNLEVLLFTIQSKMRANNQKVYMPREGKLISDINKAWERLEKAEHERELALRNELIRQEKLEQLARRFDRKAAMRETWLSENQRLVSQDNFGFDLPAVEAATKKHEAIETDIAAYEERVLAVVAVARELEAENYHDIKRITARKDNVIRLWEYLLELLKARRLRLEMNLGLQKVFQEMLYIMDWMDEMKVLLLSQDYGKHLLGVEDLLQKHALVEADIAIQADRVRAVNASAQ-----RFATGGEGYKPCDPQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEQILSSDDYGKDLTSVVRLYCKHKAFEDEMSGRSGHLLQTIKEGEEMIAEDHFGSEKIRERIKDIQEQWANLEHLSAIRKKRLEDTTSSYQFQADADDVDAWMLDILRIVSSSDVGHDEYSTQSLVKKHKDVAEEIANYRSTIDALHEQAAALPEERFNSTDVQNRLSGIEERYKELAELARLRKQALQDALTLYKMFSEADACELWIVEKEQWLNNMQIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLIHSGHPSEKEIKAQQDKLNTRWSQFRELVDKTKDALSSALSIQNYHLECNETKSWIREKTKVIESTQELGNDLAGVMALQRKLTGMERDLAAIEAKLTDLQKEAEKLEAEHPDQAQAIMDRLAEINNVWEEMKTTLKNREESLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLAEAEKLLTQHENIKNEINNYEEDYQKMRDMGEMVTQGQTDAQYMFLRQRLQALDTGWNELHKMWENRQSLLSQSHAYQLFLRDTKQAEAFLNNQEYVLAHTELPNNLEAAEAAIKTQEDFMTTMDASEEKINAVVDTGRRLVNDENINSDKIEEKVDSIDSRHKKNRAGANDLLMRLKDNREMQKFLQDCQELSLWINEKMLTARDMSYDEARNLHSKWLKHQAFMAELASNKEWLDKIEKEGNQLIAEKPETEAIVKEKMSALHAMWEELESTTQTKAQRLFDANKAELFTQSCADLDKWLHGLESQIQSDDYGKDLTSVNIL-LKKQQMLENQMDVRKKEVEELRSQAQALSQE-GKSTDEVDGQRQVVEVRFIELLAPLNERKKYLLASKEIHQFNRDVEDEILWVEERMPLATSTDHGHNLQTVQLLMKKNQTLQKEIQGHQHRNDDIFERSKMILDD-SSLNAEAITQRLADLQALWSLLIEETEKRHRRLEESHRAQQYYFDGAEAEAWMSEQELYMMSEEKA-KDEQSAVSMLKKHQILEQAVEDYAETVHQLSKTSRALVAEGHPESERISMRQSQVDKLYAGLKDLSEERRGKLDERQRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFREFARDTGHIGQERVDSVNHMADDLINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQILAASFELHKFYHDAKEIFGRIQDKHKKLPEELGRDQNTVETLQRMHTTFEHDIQALGTQVRQLQEDAARLQAAYAGDKADDIQKRESEVLEAWKALLDACDGRRLRLVDTGDKFRFFSMVRDLMLWMEDVIRQIEAQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTTCIELGKSLLARKHYASEEIKEKLLQLTEKRKEMIDKWEDRWEWLRLILEVHQFSRDASVAEAWLFGQEPYLSSREIGQSVDEVEKLIKRHEAFEKSAATWDERFSALERLTTLELLEVRRLQEEEERKRKPPTPELSPKLSEDGSPQQWDGTKEGEQISQNGLPSDQESPRMAENADTNELVNGSTEQRSSSKESSPIPSPTADRKSKSGMQPQTAATLPAKTQEMPSAQ-----FEGFLHRKHEWEGHNKKASSRSWHNVYCV--INNQEMGFYKDSK--NAASGIAYHNEIPANLKEAVCEVATDYKKKKHVFKLKLND-GNEYLFQAKDDEEMNTWIQAITNAITSDKTEVSLSTQSTPASSRAQTLPASVTVTDSPG 2326          
BLAST of Spectrin beta chain vs. Ensembl Mouse
Match: Sptbn1 (spectrin beta, non-erythrocytic 1 [Source:MGI Symbol;Acc:MGI:98388])

HSP 1 Score: 1778.45 bits (4605), Expect = 0.000e+0
Identity = 935/2046 (45.70%), Postives = 1401/2046 (68.48%), Query Frame = 1
Query:  154 KLYERFRIKALAGEREKVQKKTFTKWINSHLNKLKQSIDDLYNXXXXXXXXXXXXXXXXXXXXPYPTKGKMRIHCLENVDKSLNFLIEQRVHLENMGAHDIVDGNARLTLGLIWTIILRFQIQDIVVEEDDTSEKRQAKDALLLWCQMKTAGYPNTNVRNFSTCWRDGLAFNAIIHRHRPDLLEYSALSRSNPNENLEQAIRIAEEKLGIPRLLDPEDVSVENPDEKSIMTYVVTFYHFFSKMKADSVHSKRVGKILSQSMETEEMMVHYDKLTSNLLEWINQTIELLNDRTFANSLSGVQQQLAAFNTYRVTEKPPKFQEKGNLEMLLFSIQSQMRANNQMPYLPIEGKLISDINNAWNKLDKAEHARELALRDELIRQEKLEQLALRFDRKAGMREAWLTENQRLITQDNFGQDLSAVEAAGKKHEAIKTDILAYEERVNSVTLVTSELENECYHDVERVLCRRDNVIRLWEKLLDMLAVRKLRLDACYKVQKLFQDIKHLLDLINDLKARLKTEDIGRHLMGVEDLIHKHSLLEIDIRMVGTKIEGIMSDAQPFINSEFGLGSGDFQPADPNEVILRTVNLKEEYDNLLELSRNRKDNLSASKVMWEFLWGVADEEQWMKEKIQLMLNPDLGHDLSSVHRLISKHKVIEEDVRNHSNYLQNVIQGGQQLILDKNPGAEKVADXXXXXXXXXXXXXXXXXXRRSKLEQSLAYFHCLADCGEVEIWIIEQVKLVKIDETSINEESIITDIHKHEQLSKSIEDYESNINSLDEQVKKLSEGDLELVTIEEKVSNIKSQYAILIELTNQKQNKLTDTLSLFRVLRKADTVKTWIDEKEKLLMSLIPTDELEELEVFRHRFDGFEKEMNIQADQVEFVNTLAEKLSDMDHPQIADVVNKRFELNKLWNSLADLVEARREQLQTSYEFNQYLLECKQTGEWIREKSRLVESTDELGDDLAGIMQLQRRMGGMQRDMDAIRAKLEHLDEEMDTLIAKRPNXXXXXXXXXXXXXXFWAELGDMLADRDDRLSESSELQRFLQDLDHIHIWLSKMQTTVASEDLPKDLADAEKSLVQHEQLKEEIDSYQDEFIRLLDYGRRITEDKTDAQYMFLSQRLNALEEGWQELCQMWENRXXXXXXXXXXXVFLRDAIQSEVLLAQEENFLSKEDIPISIENSQNLLRKHEGFLTTLQANHDHTIAVIEFGRNLVERGHFCSDKINLRVKSILXXXXXXXXXXXXAYEKLKDQVLYQELSQDIDDLSKWIQEKMIIATDESFREEKNIARRYNRHRAFDEEIQANKDRLCQAIDYAMQIVEERPQLADMIYPQIDSLNQQWEELEQTTFLKGEKMIEANREAIFEEGTMDVMTWLXXXXXXXXXXXXXXXXXXXXXXKLKKVEEADNEMEIKRKQIQDLKMHAAKLKEEQPEKAFGIEQKHLILEHRFTQLQMPXXXXXXXXXXXXXXXXFLRNLDDQKAWVDDKLLLAESTNFGNNLLTVQQLLRRHRYLATEVNNHKPQLEYLKEEGAVLIEEVSPMQREKFVAGLQELESLWNRLEHSIDLRQQRLKESEATQTFLFDAEEAESWLWEQELFLLSEERGIRDQEAAINVIKKHDARQKTIEDYGEEITKLGTRSRLLIEKDHPQADRIALAQSHVDKVYAGLRDLCLEKKQRLSEIQKLNHLYREIVDLENWIYERTLVASSHDLGVDFEHCCLLRERFDEFFHETHLLGKDRVKAANDLCASLISQCHADSAEIAQWHDRINDSWAELQELMQTRIQLLRTAWEFYKYLSSCQDVLDRICEKIASIPTDVSKDSQSVAIQQRKHATFLSDAQALEGQVQWVVDEANHLLPSYAGQKEWHICERRDDVLATWNQLNMQAERRRHQLEDAADLQRFFSMVRELLQWMDLVALQINEKTRPKDVSGVELLINDHRSIKAEIAAREESMSICVNLGRTLLHRGRVGVDEVRAALINLITRKYSLEDMWEERWDYLQLILEVYQFARDASVAEAWILAQEPYLANKTLGETLDETLSLLKKHINFEKTVMSQEERFEA 6291
            +L+ER RIKALA ERE VQKKTFTKW+NSHL ++   I DLY DL+DG+ML+ LLE+LSGE+LP PTKG+MRIHCLENVDK+L FL EQRVHLENMG+HDIVDGN RLTLGLIWTIILRFQIQDI VE +D  EK+ AKDALLLWCQMKTAGYPN N+ NF+T WRDG+AFNA+IH+HRPDL+++  L +SN + NL+ A  +AE+ LG+ +LLDPED+SV++PDEKSI+TYVVT+YH+FSKMKA +V  KR+GK+L  ++ETE+M+  Y+ L S+LLEWI QTI +LN+R FANSL GVQQQL AFNTYR  EKPPKF EKGNLE+LLF+IQS+MRANNQ  Y+P EGKLISDIN AW +L+KAEH RELALR+ELIRQEKLEQLA RFDRKA MRE WL+ENQRL++QDNFG DL AVEAA KKHEAI+TDI AYEERV +V  V  ELE E YHD++R+  R+DNVIRLWE LL++L  R+ RL+    +QK+FQ++ +++D ++++K  L ++D G+HL+GVEDL+ KH+L+E DI +   ++ G+ + AQ F       G G ++P DP  +  R  +++  Y  L +L+  R+  L  S+ +W+F W +A+EE W++EK +++ + D G DL+SV RL+SKH+  E+++   S + +  I+ G+ +I +++ G+EK+ + +  +   W  L +L+  R+ +LE++       AD  +++ W+++ +K+V  ++   +E S  + + KH+ +++ I +Y   I++L EQ   L +   E   ++ +++ I+ +   + ELT  ++  L DTL+L+++  +AD  + WIDEKE+ L ++   ++LE+LEV +HRF+  E EMN QA +V  VN +A +L    HP   ++  ++ +LN  W+   +LV+ +++ L ++     Y LEC +T  WIREK++++EST +LG+DLAG+M LQR++ GM+RD+ AI AKL  L +E + L ++ P+  + I      + D W E+   L +R+  L E+S+LQ+FL+DLD    WLS+ QT +ASED+P  L +AEK L QHE +K EID+Y++++ ++ D G  +T+ +TDAQYMFL QRL AL+ GW EL +MWENRQ LLSQS + Q FLRD  Q+E  L  +E  L+  ++P ++E ++  ++K E F+TT+ AN +   AV+E GR LV  G+  SD+I  +V SI +R   N+  ++E   +LKD    Q+  QD  +LS WI EKM+ A D S+ E +N+  ++ +H+AF  E+ +NK+ L +     MQ++ E+P+   ++  ++  L++ WE LE TT  K +++ +AN+  +F +   D+  WL  +   I   +   +  +   + LKK +  +N+ME+++K+I++L+  A  L +E  +    ++ K L ++ +F +L  P+  +K  L+  K I QF R+++D+  WV +++ LA ST+ G+NL TVQ L+++++ L  E+  H+P+++ + E    +I + S +  E     L +L+ LW  L    + R +RL+E+   Q + FDA EAE+W+ EQEL+++SEE+  +D+++A++++KKH   ++ +EDY E + +L   SR L+   HP+++RI++ QS VDK+YAGL+DL  E++ +L E  +L  L RE+ DLE WI ER +VA SH+LG D+EH  +L+ERF EF  +T  +G++RV   N++   LI+  H+D+A IA+W D +N++WA+L EL+ TR Q+L  ++E +K+    +++  RI +K   +P ++ +D  +V   QR H TF  D QAL  QV+ + ++A  L  +YAG K   I +R ++VL  W  L    E RR +L D  D  RFFSMVR+L+ WM+ V  QI  + +P+DVS VELL+N+H+ IKAEI AR +S + C+ LG++LL R     +E++  L+ L  ++  + D WE+RW++L+LILEV+QF+RDASVAEAW+L QEPYL+++ +G+++DE   L+K+H  FEK+  + +ERF A
Sbjct:   38 RLFERSRIKALADEREAVQKKTFTKWVNSHLARVSCRITDLYTDLRDGRMLIKLLEVLSGERLPKPTKGRMRIHCLENVDKALQFLKEQRVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKEKKSAKDALLLWCQMKTAGYPNVNIHNFTTSWRDGMAFNALIHKHRPDLIDFDKLKKSNAHYNLQNAFNLAEQHLGLTKLLDPEDISVDHPDEKSIITYVVTYYHYFSKMKALAVEGKRIGKVLDNAIETEKMIEKYESLASDLLEWIEQTIIILNNRKFANSLVGVQQQLQAFNTYRTVEKPPKFTEKGNLEVLLFTIQSKMRANNQKVYMPREGKLISDINKAWERLEKAEHERELALRNELIRQEKLEQLARRFDRKAAMRETWLSENQRLVSQDNFGFDLPAVEAATKKHEAIETDIAAYEERVQAVVAVARELEAENYHDIKRITARKDNVIRLWEYLLELLRARRQRLEMNLGLQKIFQEMLYIMDWMDEMKVLLLSQDYGKHLLGVEDLLQKHALVEADIAIQAERVRGVNASAQKFATD----GEG-YKPCDPQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEKILSSDDYGKDLTSVMRLLSKHRAFEDEMSGRSGHFEQAIKEGEDMIAEEHFGSEKIRERIIYIREQWANLEQLSAIRKKRLEEASLLHQFQADADDIDAWMLDILKIVSSNDVGHDEYSTQSLVKKHKDVAEEITNYRPTIDTLHEQASALPQAHAESPDVKGRLAGIEERCKEMAELTRLRKQALQDTLALYKMFSEADACELWIDEKEQWLNNMQIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLMHNGHPSEKEIRAQQDKLNTRWSQFRELVDRKKDALLSALSIQNYHLECNETKSWIREKTKVIESTQDLGNDLAGVMALQRKLTGMERDLVAIEAKLSDLQKEAEKLESEHPDQAQAILSRLAEISDVWEEMKTTLKNREASLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLTEAEKLLTQHENIKNEIDNYEEDYQKMRDMGEMVTQGQTDAQYMFLRQRLQALDTGWNELHKMWENRQNLLSQSHAYQQFLRDTKQAEAFLNNQEYVLAHTEMPTTLEGAEAAIKKQEDFMTTMDANEEKINAVVETGRRLVSDGNINSDRIQEKVDSIDDRHRKNREAASELLMRLKDNRDLQKFLQDCQELSLWINEKMLTAQDMSYDEARNLHSKWLKHQAFMAELASNKEWLDKIEKEGMQLISEKPETEAVVKEKLTGLHKMWEVLESTTQTKAQRLFDANKAELFTQSCADLDKWLHGLESQIQSDDYGKDLTSVNIL-LKKQQMLENQMEVRKKEIEELQSQAQALSQE-GKSTDEVDSKRLTVQTKFMELLEPLSERKHNLLASKEIHQFNRDVEDEILWVGERMPLATSTDHGHNLQTVQLLIKKNQTLQKEIQGHQPRIDDIFERSQNIITDSSSLNAEAIRQRLADLKQLWGLLIEETEKRHRRLEEAHKAQQYYFDAAEAEAWMSEQELYMMSEEKA-KDEQSAVSMLKKHQILEQAVEDYAETVHQLSKTSRALVADSHPESERISMRQSKVDKLYAGLKDLAEERRGKLDERHRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFREFARDTGNIGQERVDTVNNMADELINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQILAASYELHKFYHDAKEIFGRIQDKHKKLPEELGRDQNTVETLQRMHTTFEHDIQALGTQVRQLQEDAARLQAAYAGDKADDIQKRENEVLEAWKSLLDACEGRRVRLVDTGDKFRFFSMVRDLMLWMEDVIRQIEAQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTACIELGKSLLARKHYASEEIKEKLLQLTEKRKEMIDKWEDRWEWLRLILEVHQFSRDASVAEAWLLGQEPYLSSREIGQSVDEVEKLIKRHEAFEKSAATWDERFSA 2075          

HSP 2 Score: 162.155 bits (409), Expect = 6.152e-39
Identity = 269/1242 (21.66%), Postives = 541/1242 (43.56%), Query Frame = 1
Query: 2614 RVLRKADTVKTWIDEKEKLLMSLIPTDELEELEVFRHRFDGFEKEMNIQADQVEFVNTLAEKLSDMDHPQIADVVNKRFELNKLWNSLADLVEARREQLQTSYEFNQYLLECKQTGEWIREKSRLVESTDELGDDLAGIMQLQRRMGGMQRDMDAIRAKLEHLDEEMDTLI----AKRPNXXXXXXXXXXXXXXFWAELGDMLADRDDRLSESSELQRFLQDLDHIHIWLSKMQTTVASEDLPKDLADAEKSLVQHEQLKEEIDSYQDEFIRLLDYGR-RITEDKTDAQYMFLSQRLNALEEGWQELCQMWENRXXXXXXXXXXXVFLRDAIQSEVLLAQEENFLSKEDIPISIENSQNLLRKHEGFLTTLQANHDHTIAVIEFGRNLVERGHFCSDKINLRVKSILXXXXXXXXXXXXAYEKLKDQVLYQELSQDIDDLSKWIQEKMIIATDESFREE-KNIARRYNRHRAFDEEIQANKDRLCQAIDYAMQIVEERPQLADMIYPQIDSLNQQWEELEQTTFLKGEKMIEANREAIFEEGTMDVMTWLXXXXXXXXXXXXXXXXXXXXXXKLKKVEEADNEMEIKRKQIQDLKMHAAKLKEEQPEKAFGIEQKHLILEHRFTQLQMPXXXXXXXXXXXXXXXXFLRNLDDQKAWVDDKLLLAESTNFGNNLLTVQQLLRRHRYLATEVNNHKPQLEYLKEEGAVLIEEVSPMQREKFVAGLQELESLWNRLEHSIDLRQQRLKESEATQTFLFDAEEAESWLWEQELFLLSEERGIRDQEAAINVIKKHDARQKTIEDYGEEITKLGTRSRLLIEKDHPQADRIALAQSHVDKVYAGLRDLCLEKKQRLSEIQKLNHLYREIVDLENWIYERTLVAS--SHDLGVDFEHCCLLRERFDEFFHETHLLGKDRVKAANDLCASLISQCHADSAEIAQWHDRINDSWAELQELMQTRIQLLRTAWEFYKYLSSCQDVLDRICEKIASI--PTDVSKDSQSVAIQQRKHATFLSDAQALEGQVQWVVDEANHLLPSYAGQKEWHICERRDDVLATWNQLNMQAERRRHQLEDAADLQRFFSMVRELLQWMDLVALQINEKTRPKDVSGVELLINDHRSIKAEIAAREESMSICVNLGRTLL-HRGRVGVDEVRAALINLITRKYSLEDMWEERWDYLQLILEVYQFARDASVAEAWILAQEPYLANKTLGETLDETLSLLKKHINFEKTVMSQEERFEALEKLT 6306
            R  RKA   +TW+ E ++L+       +L  +E    + +  E ++    ++V+ V  +A +L   ++  I  +  ++  + +LW  L +L+ ARR++L+ +    +   E     +W+ E   L+ S D  G  L G+  L ++   ++ D+     ++  ++             +P D ++IR+    +E  + EL  + A+R  RL ES  L +F  ++     W+ + +  ++S+D  KDL    + L +H   ++E+      F + +  G   I E+   ++   + +R+  + E W  L Q+   R+  L ++  L  F  DA   +  +      +S  D+     ++Q+L++KH+     +  N+  TI  +    + + + H  S  +  R+  I ER +     +    + L+D +   ++  + D    WI EK     +    E+ +++    +R  + + E+     R+      A Q++         I  Q D LN +W +  +    K + ++ A     +     +  +W+    + I  T++    L  V    +K+   + ++     ++ DL+  A KL+ E P++A  I  +   +   + +++  +KN++  L +  ++QQFLR+LDD ++W+        S +  N L   ++LL +H  +  E++N++   + +++ G ++ +  +  Q       LQ L++ WN L    + RQ  L +S A Q FL D ++AE++L  QE ++L+        E A   IKK +    T++   E+I  +    R L+   +  +DRI      +D  +   R+   E   RL + + L    ++  +L  WI E+ L A   S+D   +  H   L+    + F       K+ +         LIS+     A + +    ++  W  L+   QT+ Q L  A +   +  SC D LD+    + S     D  KD  SV I  +K     +  +  + +++ +  +A  L  S  G+    +  +R  V   + +L      R+H L  + ++ +F   V + + W+              ++  V+LLI  +++++ EI   +  +       + ++     +  + +R  L +L      L +  E+R   L+   +  Q+  DA+ AEAW+  QE Y+ ++   +     +S+LKKH   E+ V    E    L K +
Sbjct:  426 RFDRKAAMRETWLSENQRLVSQDNFGFDLPAVEAATKKHEAIETDIAAYEERVQAVVAVARELEAENYHDIKRITARKDNVIRLWEYLLELLRARRQRLEMNLGLQKIFQEMLYIMDWMDEMKVLLLSQD-YGKHLLGVEDLLQKHALVEADIAIQAERVRGVNASAQKFATDGEGYKPCDPQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEKILSSDDYGKDLTSVMRLLSKHRAFEDEMSGRSGHFEQAIKEGEDMIAEEHFGSEK--IRERIIYIREQWANLEQLSAIRKKRLEEASLLHQFQADADDIDAWMLDILKIVSSNDVGHDEYSTQSLVKKHKDVAEEI-TNYRPTIDTLHEQASALPQAHAESPDVKGRLAGIEERCKEMAELTRLRKQALQDTLALYKMFSEADACELWIDEKEQWLNNMQIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLMHNGHPSEKEIRAQQDKLNTRWSQFRELVDRKKDALLSALSIQNYHLECNETKSWIREKTKVIESTQDLGNDLAGVMALQRKLTGMERDLVAIEAKLSDLQKEAEKLESEHPDQAQAILSRLAEISDVWEEMKTTLKNREASLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLTEAEKLLTQHENIKNEIDNYEEDYQKMRDMGEMVTQGQTDAQYMFLRQRLQALDTGWNELHKMWENRQNLLSQSHAYQQFLRDTKQAEAFLNNQE-YVLAHTEMPTTLEGAEAAIKKQEDFMTTMDANEEKINAVVETGRRLVSDGNINSDRIQEKVDSIDDRHRKNREAASELLMRLKDNRDLQKFLQDCQELSLWINEKMLTAQDMSYDEARNL-HSKWLKH---QAFMAELASNKEWLDKIEKEGMQLISEKPETEAVVKEKLTGLHKMWEVLESTTQTKAQRLFDANKAELFTQSCAD-LDKWLHGLESQIQSDDYGKDLTSVNILLKKQQMLENQMEVRKKEIEELQSQAQAL--SQEGKSTDEVDSKRLTVQTKFMELLEPLSERKHNLLASKEIHQFNRDVEDEILWVGERMPLATSTDHGHNLQTVQLLIKKNQTLQKEIQGHQPRIDDIFERSQNIITDSSSLNAEAIRQRLADLKQLWGLLIEETEKRHRRLEEAHKAQQYYFDAAEAEAWMSEQELYMMSEEKAKDEQSAVSMLKKHQILEQAVEDYAETVHQLSKTS 1655          
BLAST of Spectrin beta chain vs. Ensembl Mouse
Match: Sptbn1 (spectrin beta, non-erythrocytic 1 [Source:MGI Symbol;Acc:MGI:98388])

HSP 1 Score: 1764.59 bits (4569), Expect = 0.000e+0
Identity = 929/2040 (45.54%), Postives = 1393/2040 (68.28%), Query Frame = 1
Query:  172 RIKALAGEREKVQKKTFTKWINSHLNKLKQSIDDLYNXXXXXXXXXXXXXXXXXXXXPYPTKGKMRIHCLENVDKSLNFLIEQRVHLENMGAHDIVDGNARLTLGLIWTIILRFQIQDIVVEEDDTSEKRQAKDALLLWCQMKTAGYPNTNVRNFSTCWRDGLAFNAIIHRHRPDLLEYSALSRSNPNENLEQAIRIAEEKLGIPRLLDPEDVSVENPDEKSIMTYVVTFYHFFSKMKADSVHSKRVGKILSQSMETEEMMVHYDKLTSNLLEWINQTIELLNDRTFANSLSGVQQQLAAFNTYRVTEKPPKFQEKGNLEMLLFSIQSQMRANNQMPYLPIEGKLISDINNAWNKLDKAEHARELALRDELIRQEKLEQLALRFDRKAGMREAWLTENQRLITQDNFGQDLSAVEAAGKKHEAIKTDILAYEERVNSVTLVTSELENECYHDVERVLCRRDNVIRLWEKLLDMLAVRKLRLDACYKVQKLFQDIKHLLDLINDLKARLKTEDIGRHLMGVEDLIHKHSLLEIDIRMVGTKIEGIMSDAQPFINSEFGLGSGDFQPADPNEVILRTVNLKEEYDNLLELSRNRKDNLSASKVMWEFLWGVADEEQWMKEKIQLMLNPDLGHDLSSVHRLISKHKVIEEDVRNHSNYLQNVIQGGQQLILDKNPGAEKVADXXXXXXXXXXXXXXXXXXRRSKLEQSLAYFHCLADCGEVEIWIIEQVKLVKIDETSINEESIITDIHKHEQLSKSIEDYESNINSLDEQVKKLSEGDLELVTIEEKVSNIKSQYAILIELTNQKQNKLTDTLSLFRVLRKADTVKTWIDEKEKLLMSLIPTDELEELEVFRHRFDGFEKEMNIQADQVEFVNTLAEKLSDMDHPQIADVVNKRFELNKLWNSLADLVEARREQLQTSYEFNQYLLECKQTGEWIREKSRLVESTDELGDDLAGIMQLQRRMGGMQRDMDAIRAKLEHLDEEMDTLIAKRPNXXXXXXXXXXXXXXFWAELGDMLADRDDRLSESSELQRFLQDLDHIHIWLSKMQTTVASEDLPKDLADAEKSLVQHEQLKEEIDSYQDEFIRLLDYGRRITEDKTDAQYMFLSQRLNALEEGWQELCQMWENRXXXXXXXXXXXVFLRDAIQSEVLLAQEENFLSKEDIPISIENSQNLLRKHEGFLTTLQANHDHTIAVIEFGRNLVERGHFCSDKINLRVKSILXXXXXXXXXXXXAYEKLKDQVLYQELSQDIDDLSKWIQEKMIIATDESFREEKNIARRYNRHRAFDEEIQANKDRLCQAIDYAMQIVEERPQLADMIYPQIDSLNQQWEELEQTTFLKGEKMIEANREAIFEEGTMDVMTWLXXXXXXXXXXXXXXXXXXXXXXKLKKVEEADNEMEIKRKQIQDLKMHAAKLKEEQPEKAFGIEQKHLILEHRFTQLQMPXXXXXXXXXXXXXXXXFLRNLDDQKAWVDDKLLLAESTNFGNNLLTVQQLLRRHRYLATEVNNHKPQLEYLKEEGAVLIEEVSPMQREKFVAGLQELESLWNRLEHSIDLRQQRLKESEATQTFLFDAEEAESWLWEQELFLLSEERGIRDQEAAINVIKKHDARQKTIEDYGEEITKLGTRSRLLIEKDHPQADRIALAQSHVDKVYAGLRDLCLEKKQRLSEIQKLNHLYREIVDLENWIYERTLVASSHDLGVDFEHCCLLRERFDEFFHETHLLGKDRVKAANDLCASLISQCHADSAEIAQWHDRINDSWAELQELMQTRIQLLRTAWEFYKYLSSCQDVLDRICEKIASIPTDVSKDSQSVAIQQRKHATFLSDAQALEGQVQWVVDEANHLLPSYAGQKEWHICERRDDVLATWNQLNMQAERRRHQLEDAADLQRFFSMVRELLQWMDLVALQINEKTRPKDVSGVELLINDHRSIKAEIAAREESMSICVNLGRTLLHRGRVGVDEVRAALINLITRKYSLEDMWEERWDYLQLILEVYQFARDASVAEAWILAQEPYLANKTLGETLDETLSLLKKHINFEKTVMSQEERFEA 6291
            R K L  ERE VQKKTFTKW+NSHL ++   I DLY DL+DG+ML+ LLE+LSGE+LP PTKG+MRIHCLENVDK+L FL EQRVHLENMG+HDIVDGN RLTLGLIWTIILRFQIQDI VE +D  EK+ AKDALLLWCQMKTAGYPN N+ NF+T WRDG+AFNA+IH+HRPDL+++  L +SN + NL+ A  +AE+ LG+ +LLDPED+SV++PDEKSI+TYVVT+YH+FSKMKA +V  KR+GK+L  ++ETE+M+  Y+ L S+LLEWI QTI +LN+R FANSL GVQQQL AFNTYR  EKPPKF EKGNLE+LLF+IQS+MRANNQ  Y+P EGKLISDIN AW +L+KAEH RELALR+ELIRQEKLEQLA RFDRKA MRE WL+ENQRL++QDNFG DL AVEAA KKHEAI+TDI AYEERV +V  V  ELE E YHD++R+  R+DNVIRLWE LL++L  R+ RL+    +QK+FQ++ +++D ++++K  L ++D G+HL+GVEDL+ KH+L+E DI +   ++ G+ + AQ F       G G ++P DP  +  R  +++  Y  L +L+  R+  L  S+ +W+F W +A+EE W++EK +++ + D G DL+SV RL+SKH+  E+++   S + +  I+ G+ +I +++ G+EK+ + +  +   W  L +L+  R+ +LE++       AD  +++ W+++ +K+V  ++   +E S  + + KH+ +++ I +Y   I++L EQ   L +   E   ++ +++ I+ +   + ELT  ++  L DTL+L+++  +AD  + WIDEKE+ L ++   ++LE+LEV +HRF+  E EMN QA +V  VN +A +L    HP   ++  ++ +LN  W+   +LV+ +++ L ++     Y LEC +T  WIREK++++EST +LG+DLAG+M LQR++ GM+RD+ AI AKL  L +E + L ++ P+  + I      + D W E+   L +R+  L E+S+LQ+FL+DLD    WLS+ QT +ASED+P  L +AEK L QHE +K EID+Y++++ ++ D G  +T+ +TDAQYMFL QRL AL+ GW EL +MWENRQ LLSQS + Q FLRD  Q+E  L  +E  L+  ++P ++E ++  ++K E F+TT+ AN +   AV+E GR LV  G+  SD+I  +V SI +R   N+  ++E   +LKD    Q+  QD  +LS WI EKM+ A D S+ E +N+  ++ +H+AF  E+ +NK+ L +     MQ++ E+P+   ++  ++  L++ WE LE TT  K +++ +AN+  +F +   D+  WL  +   I   +   +  +   + LKK +  +N+ME+++K+I++L+  A  L +E  +    ++ K L ++ +F +L  P+  +K  L+  K I QF R+++D+  WV +++ LA ST+ G+NL TVQ L+++++ L  E+  H+P+++ + E    +I + S +  E     L +L+ LW  L    + R +RL+E+   Q + FDA EAE+W+ EQEL+++SEE+  +D+++A++++KKH   ++ +EDY E + +L   SR L+   HP+++RI++ QS VDK+YAGL+DL  E++ +L E  +L  L RE+ DLE WI ER +VA SH+LG D+EH  +L+ERF EF  +T  +G++RV   N++   LI+  H+D+A IA+W D +N++WA+L EL+ TR Q+L  ++E +K+    +++  RI +K   +P ++ +D  +V   QR H TF  D QAL  QV+ + ++A  L  +YAG K   I +R ++VL  W  L    E RR +L D  D  RFFSMVR+L+ WM+ V  QI  + +P+DVS VELL+N+H+ IKAEI AR +S + C+ LG++LL R     +E++  L+ L  ++  + D WE+RW++L+LILEV+QF+RDASVAEAW+L QEPYL+++ +G+++DE   L+K+H  FEK+  + +ERF A
Sbjct:   31 RFKQLQDEREAVQKKTFTKWVNSHLARVSCRITDLYTDLRDGRMLIKLLEVLSGERLPKPTKGRMRIHCLENVDKALQFLKEQRVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKEKKSAKDALLLWCQMKTAGYPNVNIHNFTTSWRDGMAFNALIHKHRPDLIDFDKLKKSNAHYNLQNAFNLAEQHLGLTKLLDPEDISVDHPDEKSIITYVVTYYHYFSKMKALAVEGKRIGKVLDNAIETEKMIEKYESLASDLLEWIEQTIIILNNRKFANSLVGVQQQLQAFNTYRTVEKPPKFTEKGNLEVLLFTIQSKMRANNQKVYMPREGKLISDINKAWERLEKAEHERELALRNELIRQEKLEQLARRFDRKAAMRETWLSENQRLVSQDNFGFDLPAVEAATKKHEAIETDIAAYEERVQAVVAVARELEAENYHDIKRITARKDNVIRLWEYLLELLRARRQRLEMNLGLQKIFQEMLYIMDWMDEMKVLLLSQDYGKHLLGVEDLLQKHALVEADIAIQAERVRGVNASAQKFATD----GEG-YKPCDPQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEKILSSDDYGKDLTSVMRLLSKHRAFEDEMSGRSGHFEQAIKEGEDMIAEEHFGSEKIRERIIYIREQWANLEQLSAIRKKRLEEASLLHQFQADADDIDAWMLDILKIVSSNDVGHDEYSTQSLVKKHKDVAEEITNYRPTIDTLHEQASALPQAHAESPDVKGRLAGIEERCKEMAELTRLRKQALQDTLALYKMFSEADACELWIDEKEQWLNNMQIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLMHNGHPSEKEIRAQQDKLNTRWSQFRELVDRKKDALLSALSIQNYHLECNETKSWIREKTKVIESTQDLGNDLAGVMALQRKLTGMERDLVAIEAKLSDLQKEAEKLESEHPDQAQAILSRLAEISDVWEEMKTTLKNREASLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLTEAEKLLTQHENIKNEIDNYEEDYQKMRDMGEMVTQGQTDAQYMFLRQRLQALDTGWNELHKMWENRQNLLSQSHAYQQFLRDTKQAEAFLNNQEYVLAHTEMPTTLEGAEAAIKKQEDFMTTMDANEEKINAVVETGRRLVSDGNINSDRIQEKVDSIDDRHRKNREAASELLMRLKDNRDLQKFLQDCQELSLWINEKMLTAQDMSYDEARNLHSKWLKHQAFMAELASNKEWLDKIEKEGMQLISEKPETEAVVKEKLTGLHKMWEVLESTTQTKAQRLFDANKAELFTQSCADLDKWLHGLESQIQSDDYGKDLTSVNIL-LKKQQMLENQMEVRKKEIEELQSQAQALSQE-GKSTDEVDSKRLTVQTKFMELLEPLSERKHNLLASKEIHQFNRDVEDEILWVGERMPLATSTDHGHNLQTVQLLIKKNQTLQKEIQGHQPRIDDIFERSQNIITDSSSLNAEAIRQRLADLKQLWGLLIEETEKRHRRLEEAHKAQQYYFDAAEAEAWMSEQELYMMSEEKA-KDEQSAVSMLKKHQILEQAVEDYAETVHQLSKTSRALVADSHPESERISMRQSKVDKLYAGLKDLAEERRGKLDERHRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFREFARDTGNIGQERVDTVNNMADELINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQILAASYELHKFYHDAKEIFGRIQDKHKKLPEELGRDQNTVETLQRMHTTFEHDIQALGTQVRQLQEDAARLQAAYAGDKADDIQKRENEVLEAWKSLLDACEGRRVRLVDTGDKFRFFSMVRDLMLWMEDVIRQIEAQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTACIELGKSLLARKHYASEEIKEKLLQLTEKRKEMIDKWEDRWEWLRLILEVHQFSRDASVAEAWLLGQEPYLSSREIGQSVDEVEKLIKRHEAFEKSAATWDERFSA 2062          
BLAST of Spectrin beta chain vs. Ensembl Mouse
Match: Sptb (spectrin beta, erythrocytic [Source:MGI Symbol;Acc:MGI:98387])

HSP 1 Score: 1614.36 bits (4179), Expect = 0.000e+0
Identity = 944/2294 (41.15%), Postives = 1400/2294 (61.03%), Query Frame = 1
Query:  154 KLYERFRIKALAGEREKVQKKTFTKWINSHLNKLKQSIDDLYNXXXXXXXXXXXXXXXXXXXXPYPTKGKMRIHCLENVDKSLNFLIEQRVHLENMGAHDIVDGNARLTLGLIWTIILRFQIQDIVVEEDDTSEKRQAKDALLLWCQMKTAGYPNTNVRNFSTCWRDGLAFNAIIHRHRPDLLEYSALSRSNPNENLEQAIRIAEEKLGIPRLLDPEDVSVENPDEKSIMTYVVTFYHFFSKMKADSVHSKRVGKILSQSMETEEMMVHYDKLTSNLLEWINQTIELLNDRTFANSLSGVQQQLAAFNTYRVTEKPPKFQEKGNLEMLLFSIQSQMRANNQMPYLPIEGKLISDINNAWNKLDKAEHARELALRDELIRQEKLEQLALRFDRKAGMREAWLTENQRLITQDNFGQDLSAVEAAGKKHEAIKTDILAYEERVNSVTLVTSELENECYHDVERVLCRRDNVIRLWEKLLDMLAVRKLRLDACYKVQKLFQDIKHLLDLINDLKARLKTEDIGRHLMGVEDLIHKHSLLEIDIRMVGTKIEGIMSDAQPFINSEFGLGSGDFQPADPNEVILRTVNLKEEYDNLLELSRNRKDNLSASKVMWEFLWGVADEEQWMKEKIQLMLNPDLGHDLSSVHRLISKHKVIEEDVRNHSNYLQNVIQGGQQLILDKNPGAEKVADXXXXXXXXXXXXXXXXXXRRSKLEQSLAYFHCLADCGEVEIWIIEQVKLVKIDETSINEESIITDIHKHEQLSKSIEDYESNINSLDEQVKKLSEGDLELVTIEEKVSNIKSQYAILIELTNQKQNKLTDTLSLFRVLRKADTVKTWIDEKEKLLMSLIPTDELEELEVFRHRFDGFEKEMNIQADQVEFVNTLAEKLSDMDHPQIADVVNKRFELNKLWNSLADLVEARREQLQTSYEFNQYLLECKQTGEWIREKSRLVESTDELGDDLAGIMQLQRRMGGMQRDMDAIRAKLEHLDEEMDTLIAKRPNXXXXXXXXXXXXXXFWAELGDMLADRDDRLSESSELQRFLQDLDHIHIWLSKMQTTVASEDLPKDLADAEKSLVQHEQLKEEIDSYQDEFIRLLDYGRRITEDKTDAQYMFLSQRLNALEEGWQELCQMWENRXXXXXXXXXXXVFLRDAIQSEVLLAQEENFLSKEDIPISIENSQNLLRKHEGFLTTLQANHDHTIAVIEFGRNLVERGHFCSDKINLRVKSILXXXXXXXXXXXXAYEKLKDQVLYQELSQDIDDLSKWIQEKMIIATDESFREEKNIARRYNRHRAFDEEIQANKDRLCQAIDYAMQIVEERPQLADMIYPQIDSLNQQWEELEQTTFLKGEKMIEANREAIFEEGTMDVMTWLXXXXXXXXXX--XXXXXXXXXXXXKLKKVEEADNEMEIKRKQIQDLKMHAAKLKEEQPEKAFGIEQKHLILEHRFTQLQMPXXXXXXXXXXXXXXXXFLRNLDDQKAWVDDKLLLAESTNFGNNLLTVQQLLRRHRYLATEVNNHKPQLEYLKEEGAVLIEEVSPMQREKFVAGLQELESLWNRLEHSIDLRQQRLKESEATQTFLFDAEEAESWLWEQELFLLSEERGIRDQEAAINVIKKHDARQKTIEDYGEEITKLGTRSRLLIEKDHPQADRIALAQSHVDKVYAGLRDLCLEKKQRLSEIQKLNHLYREIVDLENWIYERTLVASSHDLGVDFEHCCLLRERFDEFFHETHLLGKDRVKAANDLCASLISQCHADSAEIAQWHDRINDSWAELQELMQTRIQLLRTAWEFYKYLSSCQDVLDRICEKIASIPTDVSKDSQSVAIQQRKHATFLSDAQALEGQVQWVVDEANHLLPSYAGQKEWHICERRDDVLATWNQLNMQAERRRHQLEDAADLQRFFSMVRELLQWMDLVALQINEKTRPKDVSGVELLINDHRSIKAEIAAREESMSICVNLGRTLLHRGRVGVDEVRAALINLITRKYSLEDMWEERWDYLQLILEVYQFARDASVAEAWILAQEPYLANKTLGETLDETLSLLKKHINFEKTVMSQEERFEALEKLTTMEIRAKEITKESILLKDKHKQERIENAIKIFQPPPSPELVHESPKVSISEEDEEG---------------KSHQHKISVISKEAAE---------MCQSSETKT-----------DIRGILIRKHEWEYKNRKALNRSWHEFLVVLSIEKNKLLVYKDEKHYNEKPQDTYHKDSGLDLNDLVAAPASDYLKRPFVFRIKITSTGAEYLFQAKDEEDMLRWVNS----INENSQKDLKSET 6912
            +L+ER RIKALA ERE VQKKTFTKW+NSHL ++   I DLY DL+DG+ML+ LLE+LSGE LP PTKGKMRIHCLENVDK+L FL EQRVHLENMG+HDIVDGN RL LGLIWTIILRFQIQDIVV+  +  E R AKDALLLWCQMKTAGYP+ NV NF++ W+DGLAFNA+IH+HRPDL+++  L  SN   NLE A  +AE +LGI  LLDPEDV  ENPDEKSI+TYVV FYH+FSKMK  +V  KRVGK++  ++ETE+M+  Y  L S+LL WI QTI +LN R FANSLSGVQQQL AF+TYR  EKPPKFQEKGNLE+LLF+IQS+MRANNQ  Y P +GKL+SDIN AW  L++AE+ RELALR ELIRQEKLEQLA RFDRKA MRE WL ENQRL+TQDNFG DL+AVEAA KKHEAI+TD  AYEERV ++  +  ELE E YHD +R++ R+DN++RLW  L ++L  R+ RL+A   +QKLFQD+ H +D ++++KA + + + G+HL+ VEDL+ KH L+E DI + G K++ I +        +F  G G +QP DP  +  R  +L++ +  L  ++  RK  L  SK +W+F W + + E W+KEK Q+  + D G DL+SV  L  KHK  E+++R    +L+ + Q    ++  K  G  ++   +KE+   W+ L EL   R+  L+ +  +F    D  +++ W+ +  +L+  ++   +E +      KH++  + +E+    +  L+ Q +   E   +   +  ++  ++  Y  ++     + +KL + L L+ V  ++D  + W+ EK K L  +   + LE+LEV +HRFD  ++EM     Q++ VN  A  L +  HP+  +V   +  LNK W +   +V  +RE + ++   N Y ++C++T +WI +K+++VEST +LG DLAG++ +QR++ G++RD+ AIR ++  L+ E   L+   P  +E I + +  +E  W  L D L  ++  L E+S+LQ FLQDLD    WLS  Q  VASED+P+ L +AE+ L QH  +KEEID+++D++ R+   G ++ E +TD  Y  L QRL  L+  W  L +MWE+R   L+Q L  Q F +DA Q+E +L+ +E  L+  + P S+  ++  +RK E FL +++ N D  ++ ++ G  LV  G+  S+KI  +V+ I +R + N  ++ EA   LKD +  Q   Q+  +L+ WI +K++ + D S+ E +N+  ++ +H+AF  E+ +++  L        Q++ E+PQ  D++  ++++L++ WEEL+ T   K E++  A    +  +   D+  W+  + + +      +++ T+  +  KLK+VEE  N   ++++++++L   A  L  E  +    IE+       RF  L  P+  +K QL   K   Q  R+L+D+  WV+++L LA+S ++G NL TVQ  +++++ L  E+  H P++E +   G  L+ + + +  +     L  L+S W+ L  +   R QRL+++   Q +  DA EAE+W+ EQEL++ S+E   +D+E AI ++K+H  +Q+T+E+YG  I +L  R++ L+   HP+ ++I   Q  VDK YAGL+D+  E+++RL  +  L  L RE  DLE WI E+ +VASS ++G DF+H  +LR++F +F  ET  +G++RV   N +   LI   H+++A IA+W D +ND WA+L EL+ TR+QLL  +++ ++Y  +  ++L  I EK   +P DV  D+ +     R H  F  +   L  QVQ   D A  L  +YAG+K   I  +  +V A W  L      RR QL D AD  RFFSMVR+LL WM+ +  QI  + RP+DVS VELL+  H+ IKAEI  R ++ S C+ LG +LL R     DE+R  L  +I+R+  + D WE R D L ++LEV QF+RDASVAEAW++AQEPYLA++  G T+D    L+K+H  FEK+  S  ERF ALEK TT+E++ ++  +         ++E             +P+ VH +     S  +E G               K  Q K     + A E         + +  E  T            + G L RKH+ E  N+KA NRSW+    VL    ++L  YKD K  N      YH +  L L   +   A +Y K+  VF++++ S G+E+LF  KDEE+ML W+ S    INE+    +K+++
Sbjct:   38 RLFERSRIKALADEREVVQKKTFTKWVNSHLARVSCRISDLYKDLRDGRMLIKLLEVLSGEMLPRPTKGKMRIHCLENVDKALQFLKEQRVHLENMGSHDIVDGNHRLVLGLIWTIILRFQIQDIVVQTQEGRETRSAKDALLLWCQMKTAGYPHVNVTNFTSSWKDGLAFNALIHKHRPDLIDFDKLKDSNARHNLEHAFDVAERQLGIIPLLDPEDVFTENPDEKSIITYVVAFYHYFSKMKVLAVEGKRVGKVIDHAIETEKMIEKYSGLASDLLTWIEQTISVLNSRKFANSLSGVQQQLQAFSTYRTVEKPPKFQEKGNLEVLLFTIQSRMRANNQKVYTPHDGKLVSDINRAWESLEEAEYQRELALRSELIRQEKLEQLARRFDRKAAMRETWLNENQRLVTQDNFGYDLAAVEAAKKKHEAIETDTAAYEERVKALEDLAQELEKENYHDQKRIIARKDNILRLWSYLQELLRSRRQRLEATLALQKLFQDMLHSIDWMDEIKAHILSAEFGKHLLEVEDLLQKHKLMEADIAIQGDKVKAITA-----ATLQFAEGKG-YQPCDPQVIQDRVSHLEQCFSELSNMAAGRKAQLEQSKRLWKFFWEMDEAESWIKEKEQIYSSLDYGKDLTSVLILQRKHKAFEDELRGLDAHLKQIFQEADDMVAQKQFGHPQIETRVKEVSAQWDHLKELAAFRKKDLQDAENFFQFQGDADDLKAWLQDAHRLLSGEDVGQDEGATRALGKKHKEFLEELEESRGVMEHLEHQAQGFPEEFRDSPDVTNRLQALRKLYQQVLTQAELRGHKLQEALDLYTVFGESDACELWMTEKGKWLDQMDIPNTLEDLEVVQHRFDILDQEMKTLMAQIDGVNLAANNLVESGHPRSGEVKQYQDRLNKRWQAFQAVVSEQREAVDSALRVNNYCVDCEETSKWIMDKTKVVESTKDLGQDLAGVIAIQRKLSGLERDVLAIRDRVSALERESQYLMESHPEQKEDIGQRQADVEKLWKGLQDALQGQELSLGEASKLQAFLQDLDDFKAWLSMAQKAVASEDMPESLPEAEQLLQQHAAIKEEIDAHRDDYHRVKASGEKVIEGQTDPDYQLLGQRLEGLDTDWDALRRMWESRGNTLTQCLGFQEFQKDAKQAEAILSNQEYTLAHLEPPDSLAAAEAGIRKFEDFLVSMENNRDKILSPVDSGNKLVAEGNLYSNKIMEKVQLIEDRHKKNNEKAQEATVLLKDNLELQNFLQNCKELTLWINDKLLTSPDVSYDEARNLHNKWMKHQAFMAELASHQGWLENIDAEGRQLMAEKPQFKDVVSERLEALHKLWEELQSTAKAKAEQLSAARSSDLRLQTHADLNKWIGAMEDQLRSDDLGKDLTTVNRMLAKLKRVEEQVN---LRKEELEELFADAPSLGAEAGDTDMSIEK-------RFLDLLEPLGRRKKQLELSKAKLQISRDLEDETLWVEERLPLAQSADYGTNLQTVQLFMKKNQTLQNEILGHAPRVEDVLRRGQELV-KAAEIDCQDIEERLGHLQSSWDTLREAAAGRLQRLRDAHEAQQYYLDAGEAEAWISEQELYVFSDE-PPKDEEGAIVMLKRHLRQQRTVEEYGRNIKQLAGRAQSLLSAGHPEGEQIIRLQGQVDKQYAGLKDMAEERRRRLENMYHLFQLKREADDLEQWITEKEMVASSQEMGQDFDHVTMLRDKFRDFARETGAIGQERVDNVNTIIERLIDAGHSEAATIAEWKDGLNDMWADLLELIDTRMQLLAASYDLHRYFYTGTEILGLIDEKHRELPEDVGLDASTAESFHRVHTAFERELHLLGVQVQQFQDVATRLQTAYAGEKADAIQSKEQEVSAAWQALLDACAGRRAQLVDTADKFRFFSMVRDLLSWMESIIRQIETQERPRDVSSVELLLKYHQGIKAEINTRAKNFSTCLELGESLLQRQHQASDEIREKLQQVISRRQEMNDKWEARSDRLHMLLEVCQFSRDASVAEAWLIAQEPYLASRDFGHTVDSVEKLIKRHEAFEKSTASWAERFAALEKPTTLELKERQTPERPTEEPGPQEEEGETAGE-------APQ-VHHAATERTSPGEERGPWPQDLQPPPLPGHHKDEQEKSVGDERPATEPLFKVLDTPLSEGDEPTTLPAQRDLGHTVQMEGYLGRKHDLEGPNKKASNRSWNNLYCVL--RNSQLTFYKDAK--NLALGVPYHGEEPLALRHAICEIAVNYKKKKHVFKLRL-SNGSEWLFHGKDEEEMLMWLQSMSTAINESQSIRVKAQS 2300          
BLAST of Spectrin beta chain vs. Ensembl Mouse
Match: Sptbn2 (spectrin beta, non-erythrocytic 2 [Source:MGI Symbol;Acc:MGI:1313261])

HSP 1 Score: 1588.93 bits (4113), Expect = 0.000e+0
Identity = 873/2053 (42.52%), Postives = 1300/2053 (63.32%), Query Frame = 1
Query:  154 KLYERFRIKALAGEREKVQKKTFTKWINSHLNKLKQSIDDLYNXXXXXXXXXXXXXXXXXXXXPYPTKGKMRIHCLENVDKSLNFLIEQRVHLENMGAHDIVDGNARLTLGLIWTIILRFQIQDIVVEEDDTSEKRQAKDALLLWCQMKTAGYPNTNVRNFSTCWRDGLAFNAIIHRHRPDLLEYSALSRSNPNENLEQAIRIAEEKLGIPRLLDPEDVSVENPDEKSIMTYVVTFYHFFSKMKADSVHSKRVGKILSQSMETEEMMVHYDKLTSNLLEWINQTIELLNDRTFANSLSGVQQQLAAFNTYRVTEKPPKFQEKGNLEMLLFSIQSQMRANNQMPYLPIEGKLISDINNAWNKLDKAEHARELALRDELIRQEKLEQLALRFDRKAGMREAWLTENQRLITQDNFGQDLSAVEAAGKKHEAIKTDILAYEERVNSVTLVTSELENECYHDVERVLCRRDNVIRLWEKLLDMLAVRKLRLDACYKVQKLFQDIKHLLDLINDLKARLKTEDIGRHLMGVEDLIHKHSLLEIDIRMVGTKIEGIMSDAQPFINSEFGLGSGDFQPADPNEVILRTVNLKEEYDNLLELSRNRKDNLSASKVMWEFLWGVADEEQWMKEKIQLMLNPDLGHDLSSVHRLISKHKVIEEDVRNHSNYLQNVIQGGQQLILDKNPGAEKVADXXXXXXXXXXXXXXXXXXRRSKLEQSLAYFHCLADCGEVEIWIIEQVKLVKIDETSINEESIITDIHKHEQLSKSIEDYESNINSLDEQVKKLSEGDLELVTIEEKVSNIKSQYAILIELTNQKQNKLTDTLSLFRVLRKADTVKTWIDEKEKLLMSLIPTDELEELEVFRHRFDGFEKEMNIQADQVEFVNTLAEKLSDMDHPQIADVVNKRFELNKLWNSLADLVEARREQLQTSYEFNQYLLECKQTGEWIREKSRLVESTDELGDDLAGIMQLQRRMGGMQRDMDAIRAKLEHLDEEMDTLIAKRPNXXXXXXXXXXXXXXFWAELGDMLADRDDRLSESSELQRFLQDLDHIHIWLSKMQTTVASEDLPKDLADAEKSLVQHEQLKEEIDSYQDEFIRLLDYGRRITEDKTDAQYMFLSQRLNALEEGWQELCQMWENRXXXXXXXXXXXVFLRDAIQSEVLLAQEENFLSKEDIPISIENSQNLLRKHEGFLTTLQANHDHTIAVIEFGRNLVERGHFCSDKINLRVKSILXXXXXXXXXXXXAYEKLKDQVLYQELSQDIDDLSKWIQEKMIIATDESFREEKNIARRYNRHRAFDEEIQANKDRLCQAIDYAMQIVEERPQLADMIYPQIDSLNQQWEELEQTTFLKGEKMIEANREAIFEEGTMDVMTWLXXXXXXXXXXXXXXXXXXXXXXKLKKVEEADNEMEIKRKQIQDLKMHAAKLKEEQPEKAFGIEQKHLILEHRFTQLQMPXXXXXXXXXXXXXXXXFLRNLDDQKAWVDDKLLLAESTNFGNNLLTVQQLLRRHRYLATEVNNHKPQLEYLKEEGAVLIEEVSPMQREKFVAGLQELESLWNRLEHSIDLRQQRLKESEATQTFLFDAEEAESWLWEQELFLLSEERGIRDQEAAINVIKKHDARQKTIEDYGEEITKLGTRSRLLIEKDHPQADRIALAQSHVDKVYAGLRDLCLEKKQRLSEIQKLNHLYREIVDLENWIYERTLVASSHDLGVDFEHCCLLRERFDEFFHETHLLGKDRVKAANDLCASLISQCHADSAEIAQWHDRINDSWAELQELMQTRIQLLRTAWEFYKYLSSCQDVLDRICEKIASIPTDVSKDSQSVAIQQRKHATFLSDAQALEGQVQWVVDEANHLLPSYAGQKEWHICERRDDVLATWNQLNMQAERRRHQLEDAADLQRFFSMVRELLQWMDLVALQINEKTRPKDVSGVELLINDHRSIKAEIAAREESMSICVNLGRTLLHRGRVGVDEVRAALINLITRKYSLEDMWEERWDYLQLILEVYQFARDASVAEAWILAQEPYLANKTLGETLDETLSLLKKHINFEKTVMSQEERFEALEKLTTM 6312
            +L+ER RIKALA ERE VQKKTFTKW+NSHL ++   + DLY+DL+DG+ LL LLE+LSGE LP PTKG+MRIHCLENVDK+L FL EQ+VHLENMG+HDIVDGN RLTLGL+WTIILRFQIQDI VE +D  EK+ AKDALLLWCQMKTAGYPN NV NF+T WRDGLAFNAI+H+HRPDLL++ +L + N + NL+ A  +AE++LG+ +LLDPEDV+V+ PDEKSI+TYV T+YH+FSKMKA +V  KR+GK+L  +ME E ++  Y+ L S LL+WI QTI  LNDR  ANSLSGVQ QL +FN+YR  EKPPKF EKGNLE+LLF+IQS++RANNQ  Y P EG+LISDIN AW +L+KAEH RELALR ELIRQEKLEQLA RFDRKA MRE WL+ENQRL++QDNFG +L+AVEAA +KHEAI+TDI+AY  RV +V  V +EL  E YHD++R+  R++NV RLW+ L  M+A R+ RL    ++QK+FQD+ +L+D + ++K RL+++D+G+HL GVEDL+  H L+E DI +   ++  + + A  F +        +++P DP  V  R   L++ Y+ L EL+  R+  L  S+ +W FLW V + E W++E+  L+ + D G DL+ V RL++KH  +  ++      L+  ++ GQQL+ + +PGA + +    EL+  W  L  L E R  +L Q+ + +   AD  ++E W+++ ++LV   E   +E S      +H  L + I  +   +++L EQ   L         ++ +V  ++  Y  L     ++   L   L+ + +L +A     W++EKE+ L  L   + LE+LEV + RF+  E EMN  A +V  VN +AE+L     P    ++  + +LN+ W     L + ++  L ++     Y LEC +T  W+REK++++EST  LG+DLAG++ LQR++ G +RD++AI A++  L +E + L A  P     I      ++  W +L   +  R++ L E+  LQ FL+ LD    WL + QT VASE+ P  L +AE  L QH  L+ E++  Q E+ RL   G  +T D+ D Q +FL QRL AL  GW+EL +MWE+RQG L+Q+   Q FLRDA Q+E +L+ +E  LS  ++P +++ +   ++K E F++T+ AN +    ++E GR LV +G+  ++KI  +  SI +R   N+    +   +L+D    Q   QD  +L  WI EKM+ A D S+ E +N+  ++ +H+AF  E+ ANKD L +      ++  E+P+L  ++  +++ L+++W+ELE TT  K   + +ANR  +F +    + +WLE++   +   +   +  +   + LKK +  + EM ++ K+++ ++  A  L +E  + A  +E+    +E +F  L  P+K +  +L   +   QF R+++D+  WV ++L +A S   G +L +VQ L+++++ L  E+  H+P++  LKE    L    +  +       L EL+ +W RL H ++LR +RL+E+   Q F  DA EAE+W+ EQEL ++ +E+  +D+ +A   +KKH   ++ + DY + I +L   S+ +I+ +HP++ R+ + Q+ VDK+YA L++L  E+++RL E  +L  L RE+ DLE WI ER +VA+SH+LG D+EH  +LR++F EF  +T  +G++RV +AN L   LI+  HA  A +A+W D +N++WA+L EL+ TR Q+L  A+E  ++L   +  L R+  K   +P    +D  +    QR+H  +  D QAL  QVQ V D+   L  +YAG K   I      V   W QL   +  RR  L D  D  RFF  VREL+ WMD + LQ++ + RP+DVS  +L+I + + IKAEI AR +  S C+++G+ LL R     +E+   L  L +R+    D W+E+ D+LQL+LEV  F RDA +AEAW+ +QEP + +  LG T+DE  SL+K+H  F+K+ ++ EERF ALEKLT +
Sbjct:   41 RLFERSRIKALADEREAVQKKTFTKWVNSHLARVTCRVGDLYSDLRDGRNLLRLLEVLSGETLPKPTKGRMRIHCLENVDKALQFLKEQKVHLENMGSHDIVDGNHRLTLGLVWTIILRFQIQDISVETEDNKEKKSAKDALLLWCQMKTAGYPNVNVHNFTTSWRDGLAFNAIVHKHRPDLLDFESLKKCNAHYNLQNAFNLAEKELGLTKLLDPEDVNVDQPDEKSIITYVATYYHYFSKMKALAVEGKRIGKVLDHAMEAEHLVEKYESLASELLQWIEQTIVTLNDRQLANSLSGVQNQLQSFNSYRTVEKPPKFTEKGNLEVLLFTIQSKLRANNQKVYTPREGRLISDINKAWERLEKAEHERELALRTELIRQEKLEQLAARFDRKAAMRETWLSENQRLVSQDNFGLELAAVEAAVRKHEAIETDIVAYSGRVQAVDAVAAELAAEHYHDIKRIAARQNNVARLWDFLRQMVAARRERLLLNLELQKVFQDLLYLMDWMAEMKGRLQSQDLGKHLAGVEDLLQLHELVEADIAVQAERVRAVSASALRFCDP-----GKEYRPCDPQLVSERVATLEQSYEALCELAATRRARLEESRRLWRFLWEVGEAEAWVREQQHLLASADTGRDLTGVLRLLNKHAALRGEMSGRLGPLKLTLEQGQQLVAEGHPGANQASTRAAELQAQWERLEALAEERAQQLAQAASLYQFQADANDMEAWLVDALRLVSSPEVGHDEFSTQALARQHRALEEEIRAHRPTLDALREQAAALPPALSHTPEVQGRVPTLEQHYEELQARAGERARALEAALAFYTMLSEAGACGLWVEEKEQWLNGLALPERLEDLEVVQQRFETLEPEMNALAARVTAVNDIAEQLLKASPPGKDRIIGTQEQLNQRWQQFRSLADGKKAALTSALSIQNYHLECTETQAWMREKTKVIESTQGLGNDLAGVLALQRKLAGTERDLEAISARVGELTQEANALAAGHPAQAPAINTRLGEVQAGWEDLRATMRRREESLGEARRLQDFLRSLDDFQAWLGRTQTAVASEEGPATLPEAEALLAQHAALRGEVERAQSEYSRLRTLGEEVTRDQADPQCLFLRQRLEALGTGWEELGRMWESRQGRLAQAHGFQGFLRDARQAEGVLSSQEYVLSHTEMPGTLQAADAAIKKLEDFMSTMDANGERIRGLLEAGRQLVSKGNIHAEKIQEKADSIEKRHRKNQEAVQQLLGRLRDNREQQHFLQDCQELRLWIDEKMLTAQDVSYDEARNLHTKWQKHQAFMAELAANKDWLDKVDKEGRELTLEKPELKVVVSEKLEDLHRRWDELETTTQAKARSLFDANRAELFAQSCSALESWLESLQAQLHSDDYGKDLTSVNIL-LKKQQMLEREMAVREKEVEAIQAQAQALAQED-QSAGEVERTSRAVEEKFRALCQPMKERCRRLHASREQHQFHRDVEDEILWVTERLPMASSLEHGKDLPSVQLLMKKNQTLQKEIQGHEPRIADLKERQRTLGTAAAGPE-------LAELQEMWKRLSHELELRGKRLEEALRAQQFYRDAAEAEAWMGEQELHMMGQEKA-KDELSAQAEVKKHQVLEQALADYAQTIKQLAASSQDMIDHEHPESTRLTIRQAQVDKLYASLKELAGERRERLQEHLRLCQLRRELDDLEQWIQEREVVAASHELGQDYEHVTMLRDKFREFSKDTSTIGQERVDSANALANGLIAGGHAARATVAEWKDSLNEAWADLLELLDTRGQVLAAAYELQRFLHGARQALARVQHKQQQLPDGTGRDLNAAEALQRRHCAYEHDIQALSTQVQQVQDDGQRLQKAYAGDKAEEIGRHMQAVAEAWAQLQGSSAARRQLLLDTTDKFRFFKAVRELMLWMDGINLQMDAQERPRDVSSADLVIKNQQGIKAEIEARADRFSSCIDMGQELLARSHYAAEEISEKLSQLQSRRQETADKWQEKMDWLQLVLEVLVFGRDAGMAEAWLCSQEPLVRSAELGCTVDEVESLIKRHEAFQKSAVAWEERFSALEKLTAL 2078          

HSP 2 Score: 78.1814 bits (191), Expect = 1.564e-13
Identity = 50/141 (35.46%), Postives = 71/141 (50.35%), Query Frame = 1
Query: 6553 IRGILIRKHEWEYKNRKALNRSWHEFLVVLSIEKNKLLVYKDEKHYNEKPQDTYHKDSGLDLNDLVAAPASDYLKRPFVFRIKITSTGAEYLFQAKDEEDMLRWVNSINENSQKDLKSETTAPGKSSTLPACTSDPHVPST 6975
            + G+L RK E E  N+KA NRSW     VL   +  L  YKD +  +      YH +  + L     + A DY KR  VF++ +   G EYLFQAKDE +M  W+  +N      + + ++APG+S        +P VPS 
Sbjct: 2221 MEGMLCRKQEMEAFNKKAANRSWQNVYCVL--RRGSLGFYKDARAASAGV--PYHGEVPVSLARAQGSVAFDYRKRKHVFKLGLQD-GKEYLFQAKDEAEMSSWLRVVN----AAIATASSAPGES-------EEPVVPSA 2345          
BLAST of Spectrin beta chain vs. Ensembl Mouse
Match: Sptb (spectrin beta, erythrocytic [Source:MGI Symbol;Acc:MGI:98387])

HSP 1 Score: 1566.21 bits (4054), Expect = 0.000e+0
Identity = 882/2061 (42.79%), Postives = 1305/2061 (63.32%), Query Frame = 1
Query:  154 KLYERFRIKALAGEREKVQKKTFTKWINSHLNKLKQSIDDLYNXXXXXXXXXXXXXXXXXXXXPYPTKGKMRIHCLENVDKSLNFLIEQRVHLENMGAHDIVDGNARLTLGLIWTIILRFQIQDIVVEEDDTSEKRQAKDALLLWCQMKTAGYPNTNVRNFSTCWRDGLAFNAIIHRHRPDLLEYSALSRSNPNENLEQAIRIAEEKLGIPRLLDPEDVSVENPDEKSIMTYVVTFYHFFSKMKADSVHSKRVGKILSQSMETEEMMVHYDKLTSNLLEWINQTIELLNDRTFANSLSGVQQQLAAFNTYRVTEKPPKFQEKGNLEMLLFSIQSQMRANNQMPYLPIEGKLISDINNAWNKLDKAEHARELALRDELIRQEKLEQLALRFDRKAGMREAWLTENQRLITQDNFGQDLSAVEAAGKKHEAIKTDILAYEERVNSVTLVTSELENECYHDVERVLCRRDNVIRLWEKLLDMLAVRKLRLDACYKVQKLFQDIKHLLDLINDLKARLKTEDIGRHLMGVEDLIHKHSLLEIDIRMVGTKIEGIMSDAQPFINSEFGLGSGDFQPADPNEVILRTVNLKEEYDNLLELSRNRKDNLSASKVMWEFLWGVADEEQWMKEKIQLMLNPDLGHDLSSVHRLISKHKVIEEDVRNHSNYLQNVIQGGQQLILDKNPGAEKVADXXXXXXXXXXXXXXXXXXRRSKLEQSLAYFHCLADCGEVEIWIIEQVKLVKIDETSINEESIITDIHKHEQLSKSIEDYESNINSLDEQVKKLSEGDLELVTIEEKVSNIKSQYAILIELTNQKQNKLTDTLSLFRVLRKADTVKTWIDEKEKLLMSLIPTDELEELEVFRHRFDGFEKEMNIQADQVEFVNTLAEKLSDMDHPQIADVVNKRFELNKLWNSLADLVEARREQLQTSYEFNQYLLECKQTGEWIREKSRLVESTDELGDDLAGIMQLQRRMGGMQRDMDAIRAKLEHLDEEMDTLIAKRPNXXXXXXXXXXXXXXFWAELGDMLADRDDRLSESSELQRFLQDLDHIHIWLSKMQTTVASEDLPKDLADAEKSLVQHEQLKEEIDSYQDEFIRLLDYGRRITEDKTDAQYMFLSQRLNALEEGWQELCQMWENRXXXXXXXXXXXVFLRDAIQSEVLLAQEENFLSKEDIPISIENSQNLLRKHEGFLTTLQANHDHTIAVIEFGRNLVERGHFCSDKINLRVKSILXXXXXXXXXXXXAYEKLKDQVLYQELSQDIDDLSKWIQEKMIIATDESFREEKNIARRYNRHRAFDEEIQANKDRLCQAIDYAMQIVEERPQLADMIYPQIDSLNQQWEELEQTTFLKGEKMIEANREAIFEEGTMDVMTWLXXXXXXXXXX--XXXXXXXXXXXXKLKKVEEADNEMEIKRKQIQDLKMHAAKLKEEQPEKAFGIEQKHLILEHRFTQLQMPXXXXXXXXXXXXXXXXFLRNLDDQKAWVDDKLLLAESTNFGNNLLTVQQLLRRHRYLATEVNNHKPQLEYLKEEGAVLIEEVSPMQREKFVAGLQELESLWNRLEHSIDLRQQRLKESEATQTFLFDAEEAESWLWEQELFLLSEERGIRDQEAAINVIKKHDARQKTIEDYGEEITKLGTRSRLLIEKDHPQADRIALAQSHVDKVYAGLRDLCLEKKQRLSEIQKLNHLYREIVDLENWIYERTLVASSHDLGVDFEHCCLLRERFDEFFHETHLLGKDRVKAANDLCASLISQCHADSAEIAQWHDRINDSWAELQELMQTRIQLLRTAWEFYKYLSSCQDVLDRICEKIASIPTDVSKDSQSVAIQQRKHATFLSDAQALEGQVQWVVDEANHLLPSYAGQKEWHICERRDDVLATWNQLNMQAERRRHQLEDAADLQRFFSMVRELLQWMDLVALQINEKTRPKDVSGVELLINDHRSIKAEIAAREESMSICVNLGRTLLHRGRVGVDEVRAALINLITRKYSLEDMWEERWDYLQLILEVYQFARDASVAEAWILAQEPYLANKTLGETLDETLSLLKKHINFEKTVMSQEERFEALEKLTTMEIRAKE 6330
            +L+ER RIKALA ERE VQKKTFTKW+NSHL ++   I DLY DL+DG+ML+ LLE+LSGE LP PTKGKMRIHCLENVDK+L FL EQRVHLENMG+HDIVDGN RL LGLIWTIILRFQIQDIVV+  +  E R AKDALLLWCQMKTAGYP+ NV NF++ W+DGLAFNA+IH+HRPDL+++  L  SN   NLE A  +AE +LGI  LLDPEDV  ENPDEKSI+TYVV FYH+FSKMK  +V  KRVGK++  ++ETE+M+  Y  L S+LL WI QTI +LN R FANSLSGVQQQL AF+TYR  EKPPKFQEKGNLE+LLF+IQS+MRANNQ  Y P +GKL+SDIN AW  L++AE+ RELALR ELIRQEKLEQLA RFDRKA MRE WL ENQRL+TQDNFG DL+AVEAA KKHEAI+TD  AYEERV ++  +  ELE E YHD +R++ R+DN++RLW  L ++L  R+ RL+A   +QKLFQD+ H +D ++++KA + + + G+HL+ VEDL+ KH L+E DI + G K++ I +        +F  G G +QP DP  +  R  +L++ +  L  ++  RK  L  SK +W+F W + + E W+KEK Q+  + D G DL+SV  L  KHK  E+++R    +L+ + Q    ++  K  G  ++   +KE+   W+ L EL   R+  L+ +  +F    D  +++ W+ +  +L+  ++   +E +      KH++  + +E+    +  L+ Q +   E   +   +  ++  ++  Y  ++     + +KL + L L+ V  ++D  + W+ EK K L  +   + LE+LEV +HRFD  ++EM     Q++ VN  A  L +  HP+  +V   +  LNK W +   +V  +RE + ++   N Y ++C++T +WI +K+++VEST +LG DLAG++ +QR++ G++RD+ AIR ++  L+ E   L+   P  +E I + +  +E  W  L D L  ++  L E+S+LQ FLQDLD    WLS  Q  VASED+P+ L +AE+ L QH  +KEEID+++D++ R+   G ++ E +TD  Y  L QRL  L+  W  L +MWE+R   L+Q L  Q F +DA Q+E +L+ +E  L+  + P S+  ++  +RK E FL +++ N D  ++ ++ G  LV  G+  S+KI  +V+ I +R + N  ++ EA   LKD +  Q   Q+  +L+ WI +K++ + D S+ E +N+  ++ +H+AF  E+ +++  L        Q++ E+PQ  D++  ++++L++ WEEL+ T   K E++  A    +  +   D+  W+  + + +      +++ T+  +  KLK +EE  N   ++++++++L   A  L  E  +    IE+       RF  L  P+  +K QL   K   Q  R+L+D+  WV+++L LA+S ++G NL TVQ  +++++ L  E+  H P++E +   G  L+ + + +  +     L  L+S W+ L  +   R QRL+++   Q +  DA EAE+W+ EQEL++ S+E   +D+E AI ++K+H  +Q+T+E+YG  I +L  R++ L+   HP+ ++I   Q  VDK YAGL+D+  E+++RL  +  L  L RE  DLE WI E+ +VASS ++G DF+H  +LR++F +F  ET  +G++RV   N +   LI   H+++A IA+W D +ND WA+L EL+ TR+QLL  +++ ++Y  +  ++L  I EK   +P DV  D+ +     R H  F  +   L  QVQ   D A  L  +YAG+K   I  +  +V A W  L      RR QL D AD  RFFSMVR+LL WM+ +  QI  + RP+DVS VELL+  H+ IKAEI  R ++ S C+ LG +LL R     DE+R  L  +I+R+  + D WE R D L ++LEV QF+RDASVAEAW++AQEPYLA++  G T+D    L+K+H  FEK+  S  ERF ALEK TT+E++ ++
Sbjct:   38 RLFERSRIKALADEREVVQKKTFTKWVNSHLARVSCRISDLYKDLRDGRMLIKLLEVLSGEMLPRPTKGKMRIHCLENVDKALQFLKEQRVHLENMGSHDIVDGNHRLVLGLIWTIILRFQIQDIVVQTQEGRETRSAKDALLLWCQMKTAGYPHVNVTNFTSSWKDGLAFNALIHKHRPDLIDFDKLKDSNARHNLEHAFDVAERQLGIIPLLDPEDVFTENPDEKSIITYVVAFYHYFSKMKVLAVEGKRVGKVIDHAIETEKMIEKYSGLASDLLTWIEQTISVLNSRKFANSLSGVQQQLQAFSTYRTVEKPPKFQEKGNLEVLLFTIQSRMRANNQKVYTPHDGKLVSDINRAWESLEEAEYQRELALRSELIRQEKLEQLARRFDRKAAMRETWLNENQRLVTQDNFGYDLAAVEAAKKKHEAIETDTAAYEERVKALEDLAQELEKENYHDQKRIIARKDNILRLWSYLQELLRSRRQRLEATLALQKLFQDMLHSIDWMDEIKAHILSAEFGKHLLEVEDLLQKHKLMEADIAIQGDKVKAITA-----ATLQFAEGKG-YQPCDPQVIQDRVSHLEQCFSELSNMAAGRKAQLEQSKRLWKFFWEMDEAESWIKEKEQIYSSLDYGKDLTSVLILQRKHKAFEDELRGLDAHLKQIFQEADDMVAQKQFGHPQIETRVKEVSAQWDHLKELAAFRKKDLQDAENFFQFQGDADDLKAWLQDAHRLLSGEDVGQDEGATRALGKKHKEFLEELEESRGVMEHLEHQAQGFPEEFRDSPDVTNRLQALRKLYQQVLTQAELRGHKLQEALDLYTVFGESDACELWMTEKGKWLDQMDIPNTLEDLEVVQHRFDILDQEMKTLMAQIDGVNLAANNLVESGHPRSGEVKQYQDRLNKRWQAFQAVVSEQREAVDSALRVNNYCVDCEETSKWIMDKTKVVESTKDLGQDLAGVIAIQRKLSGLERDVLAIRDRVSALERESQYLMESHPEQKEDIGQRQADVEKLWKGLQDALQGQELSLGEASKLQAFLQDLDDFKAWLSMAQKAVASEDMPESLPEAEQLLQQHAAIKEEIDAHRDDYHRVKASGEKVIEGQTDPDYQLLGQRLEGLDTDWDALRRMWESRGNTLTQCLGFQEFQKDAKQAEAILSNQEYTLAHLEPPDSLAAAEAGIRKFEDFLVSMENNRDKILSPVDSGNKLVAEGNLYSNKIMEKVQLIEDRHKKNNEKAQEATVLLKDNLELQNFLQNCKELTLWINDKLLTSPDVSYDEARNLHNKWMKHQAFMAELASHQGWLENIDAEGRQLMAEKPQFKDVVSERLEALHKLWEELQSTAKAKAEQLSAARSSDLRLQTHADLNKWIGAMEDQLRSDDLGKDLTTVNRMLAKLKALEEQVN---LRKEELEELFADAPSLGAEAGDTDMSIEK-------RFLDLLEPLGRRKKQLELSKAKLQISRDLEDETLWVEERLPLAQSADYGTNLQTVQLFMKKNQTLQNEILGHAPRVEDVLRRGQELV-KAAEIDCQDIEERLGHLQSSWDTLREAAAGRLQRLRDAHEAQQYYLDAGEAEAWISEQELYVFSDE-PPKDEEGAIVMLKRHLRQQRTVEEYGRNIKQLAGRAQSLLSAGHPEGEQIIRLQGQVDKQYAGLKDMAEERRRRLENMYHLFQLKREADDLEQWITEKEMVASSQEMGQDFDHVTMLRDKFRDFARETGAIGQERVDNVNTIIERLIDAGHSEAATIAEWKDGLNDMWADLLELIDTRMQLLAASYDLHRYFYTGTEILGLIDEKHRELPEDVGLDASTAESFHRVHTAFERELHLLGVQVQQFQDVATRLQTAYAGEKADAIQSKEQEVSAAWQALLDACAGRRAQLVDTADKFRFFSMVRDLLSWMESIIRQIETQERPRDVSSVELLLKYHQGIKAEINTRAKNFSTCLELGESLLQRQHQASDEIREKLQQVISRRQEMNDKWEARSDRLHMLLEVCQFSRDASVAEAWLIAQEPYLASRDFGHTVDSVEKLIKRHEAFEKSTASWAERFAALEKPTTLELKERQ 2080          

HSP 2 Score: 116.701 bits (291), Expect = 3.954e-25
Identity = 225/1137 (19.79%), Postives = 488/1137 (42.92%), Query Frame = 1
Query: 2965 WIREKSRLVESTDELGDDLAGIMQLQRRMGGMQRDMDAIRAKLEHLDEEMDTLIAKRPNXXXXXXXXXXXXXXFWAELGDMLADRDDRLSESSELQRFLQDLDHIHIWLSKMQTTVASEDLPKDLADAEKSLVQHEQLKEEIDSYQDEFIRLLDYGRRITEDK----TDAQYMFLSQRLNALEEGWQELCQMWENRXXXXXXXXXXXVFLRDAIQSEVLLAQEENFLSKEDIPISIENSQNLLRKHEGFLTTLQANHDHTIAVIEFGRNLVERGHFCSDKINLRVKSILXXXXXXXXXXXXAYEKLKDQVLYQELSQDIDDLSKWIQEKMIIATDESFREEKNIARRYNR-HRAFDEEIQANKDRLCQAIDYAMQIVEERPQLADMIYPQIDSLNQQWEELEQTTFLKGEKMIEA-NREAIFEEGTMDVMTWLXXXXXXXXXXXXXXXXXXXXXXKLKKVEEADNEMEIKRKQIQDLKMHAAKLKEEQPEKAFGIEQKHLILEHRFTQLQMPXXXXXXXXXXXXXXXXFLRNLDDQKAWVDDKLLLAEST-NFGNNLLTVQQLLRRHRYLATEVNNHKPQLEYLKEEGAVLIEEVSPMQREKFVAGLQELESLWNRLEHSIDLRQQRLKESEATQTFLFDAEEAESWLWEQELFLLSEERGIRDQEAAINVIKKHDARQKTIEDYGEEITKLGTRSRLLIE-KDHPQADRIALAQSHVDKVYAGLRDLCLEKKQRLSEIQKLNHLYREIVDLENWIYERTLVASSHDLGVDFEHCCLLRERFDEFFHETHLLGKDRVKAANDLCASLISQCHADSAEIAQWHDRINDSWAELQELMQTRIQLLRTAWEFYKYLSSCQDVLDRICEKIASIPTDVSKD-SQSVAIQQRKHATFLSDAQALEGQVQWVVDEANHLLPSYAGQKEWHICERRDDVLATWNQLNMQAERRRHQLEDAADLQRFFSMVRELLQWMDLVALQINEKTRPKDVSGVELLINDHRSIKAEIAAREESMSICVNLGRTLLHRGRVGVDEVRAALINLITRKYSLEDMWEERWDYLQLILEVYQFARDASVAEAWILAQEPYLANKTLGETLDETLSLLKKHINFEKTVMSQEERFEALEKLTTMEIRAKEITKESI 6348
            W+ E  RLV + D  G DLA +   +++   ++ D  A   +++ L++    L  +  +D++ I   +  +   W+ L ++L  R  RL  +  LQ+  QD+ H   W+ +++  + S +  K L + E  L +H+ ++ +I    D+   +     +  E K     D Q   +  R++ LE+ + EL  M   R+  L QS  L  F  +  ++E  + ++E   S  D    + +   L RKH+ F   L+    H   + +   ++V +  F   +I  RVK +  + +  K  +    + L+D   + +   D DDL  W+Q+   + + E   +++   R   + H+ F EE++ ++  + + +++  Q   E  + +  +  ++ +L + ++++     L+G K+ EA +   +F E       W+   G+ +   +          V+  + +  D EM+    QI  + + A  L E    ++  ++Q    L  R+   Q  +  ++  +    R+  +  + ++   W+ DK  + EST + G +L  V  + R+   L  +V   + ++  L+ E   L+E   P Q+E       ++E LW  L+ ++  ++  L E+   Q FL D ++ ++WL   +  + SE+      EA   ++++H A ++ I+ + ++  ++      +IE +  P    +      +D  +  LR +   +   L++        ++    E  +  +    +  +             +F++F        +D++ +  D    L+++ +  S +I +    I D   +  E  Q    LL+   E   +L +C+++   I +K+ + P DVS D ++++  +  KH  F+++  + +G ++ +  E   L+      K+  + ER + +   W +L   A+ +  QL  A           +L +W+  +  Q+      KD++ V  ++   ++++ ++  R+E +        +L      G  E     +++  R   L +    R   L+L     Q +RD      W+  + P   +   G  L      +KK+   +  ++    R E + +     ++A EI  + I
Sbjct:  437 WLNENQRLV-TQDNFGYDLAAVEAAKKKHEAIETDTAAYEERVKALEDLAQELEKENYHDQKRIIARKDNILRLWSYLQELLRSRRQRLEATLALQKLFQDMLHSIDWMDEIKAHILSAEFGKHLLEVEDLLQKHKLMEADIAIQGDKVKAITAATLQFAEGKGYQPCDPQ--VIQDRVSHLEQCFSELSNMAAGRKAQLEQSKRLWKFFWEMDEAESWIKEKEQIYSSLDYGKDLTSVLILQRKHKAFEDELRGLDAHLKQIFQEADDMVAQKQFGHPQIETRVKEVSAQWDHLKELAAFRKKDLQDAENFFQFQGDADDLKAWLQDAHRLLSGEDVGQDEGATRALGKKHKEFLEELEESRG-VMEHLEHQAQGFPEEFRDSPDVTNRLQALRKLYQQVLTQAELRGHKLQEALDLYTVFGESDA-CELWMTEKGKWLDQMDIPNTLEDLEVVQ-HRFDILDQEMKTLMAQIDGVNLAANNLVESGHPRSGEVKQYQDRLNKRWQAFQAVVSEQREAVDSALRVNNYCVDCEETSKWIMDKTKVVESTKDLGQDLAGVIAIQRKLSGLERDVLAIRDRVSALERESQYLMES-HPEQKEDIGQRQADVEKLWKGLQDALQGQELSLGEASKLQAFLQDLDDFKAWLSMAQKAVASEDMPESLPEAE-QLLQQHAAIKEEIDAHRDDYHRVKASGEKVIEGQTDPDYQLLGQRLEGLDTDWDALRRMWESRGNTLTQCLGFQEFQKDAKQAEAILSNQEYTLAHLEPPDSLAAAEAGIRKFEDFLVSMEN-NRDKILSPVDSGNKLVAEGNLYSNKIMEKVQLIEDRHKKNNEKAQEATVLLKDNLELQNFLQNCKELTLWINDKLLTSP-DVSYDEARNLHNKWMKHQAFMAELASHQGWLENIDAEGRQLMAEKPQFKDV-VSERLEALHKLWEELQSTAKAKAEQLSAARSSDLRLQTHADLNKWIGAMEDQLRSDDLGKDLTTVNRMLAKLKALEEQVNLRKEELEELFADAPSL------GA-EAGDTDMSIEKRFLDLLEPLGRRKKQLELSKAKLQISRDLEDETLWVEERLPLAQSADYGTNLQTVQLFMKKNQTLQNEILGHAPRVEDVLRRGQELVKAAEIDCQDI 1555          
BLAST of Spectrin beta chain vs. UniProt/SwissProt
Match: sp|Q00963|SPTCB_DROME (Spectrin beta chain OS=Drosophila melanogaster OX=7227 GN=beta-Spec PE=1 SV=2)

HSP 1 Score: 1908.65 bits (4943), Expect = 0.000e+0
Identity = 1023/2271 (45.05%), Postives = 1541/2271 (67.86%), Query Frame = 1
Query:  154 KLYERFRIKALAGEREKVQKKTFTKWINSHLNKLKQSIDDLYNXXXXXXXXXXXXXXXXXXXXPYPTKGKMRIHCLENVDKSLNFLIEQRVHLENMGAHDIVDGNARLTLGLIWTIILRFQIQDIVVEEDDTSEKRQAKDALLLWCQMKTAGYPNTNVRNFSTCWRDGLAFNAIIHRHRPDLLEYSALSRSNPNENLEQAIRIAEEKLGIPRLLDPEDVSVENPDEKSIMTYVVTFYHFFSKMKADSVHSKRVGKILSQSMETEEMMVHYDKLTSNLLEWINQTIELLNDRTFANSLSGVQQQLAAFNTYRVTEKPPKFQEKGNLEMLLFSIQSQMRANNQMPYLPIEGKLISDINNAWNKLDKAEHARELALRDELIRQEKLEQLALRFDRKAGMREAWLTENQRLITQDNFGQDLSAVEAAGKKHEAIKTDILAYEERVNSVTLVTSELENECYHDVERVLCRRDNVIRLWEKLLDMLAVRKLRLDACYKVQKLFQDIKHLLDLINDLKARLKTEDIGRHLMGVEDLIHKHSLLEIDIRMVGTKIEGIMSDAQPFINSEFGLGSGDFQPADPNEVILRTVNLKEEYDNLLELSRNRKDNLSASKVMWEFLWGVADEEQWMKEKIQLMLNPDLGHDLSSVHRLISKHKVIEEDVRNHSNYLQNVIQGGQQLILDKNPGAEKVADXXXXXXXXXXXXXXXXXXRRSKLEQSLAYFHCLADCGEVEIWIIEQVKLVKIDETSINEESIITDIHKHEQLSKSIEDYESNINSLDEQVKKLSEGDLELVTIEEKVSNIKSQYAILIELTNQKQNKLTDTLSLFRVLRKADTVKTWIDEKEKLLMSLIPTDELEELEVFRHRFDGFEKEMNIQADQVEFVNTLAEKLSDMDHPQIADVVNKRFELNKLWNSLADLVEARREQLQTSYEFNQYLLECKQTGEWIREKSRLVESTDELGDDLAGIMQLQRRMGGMQRDMDAIRAKLEHLDEEMDTLIAKRPNXXXXXXXXXXXXXXFWAELGDMLADRDDRLSESSELQRFLQDLDHIHIWLSKMQTTVASEDLPKDLADAEKSLVQHEQLKEEIDSYQDEFIRLLDYGRRITEDKT---DAQYMFLSQRLNALEEGWQELCQMWENRXXXXXXXXXXXVFLRDAIQSEVLLAQEENFLSKEDIPISIENSQNLLRKHEGFLTTLQANHDHTIAVIEFGRNLVERGHFCSDKINLRVKSILXXXXXXXXXXXXAYEKLKDQVLYQELSQDIDDLSKWIQEKMIIATDESFREEKNIARRYNRHRAFDEEIQANKDRLCQAIDYAMQIVEERPQLADMIYPQIDSLNQQWEELEQTTFLKGEKMIEANREAIFEEGTMDVMTWLXXXXXXXXXXXXXXXXXXXXXXKLKKVEEADNEMEIKRKQIQDLKMHAAKLKEEQPEKAFG--IEQKHLILEHRFTQLQMPXXXXXXXXXXXXXXXXFLRNLDDQKAWVDDKLLLAESTNFGNNLLTVQQLLRRHRYLATEVNNHKPQLEYLKEEGAVLIEEVSPMQREKFVAGLQELESLWNRLEHSIDLRQQRLKESEATQTFLFDAEEAESWLWEQELFLLSEERGIRDQEAAINVIKKHDARQKTIEDYGEEITKLGTRSRLLIEKDHPQADRIALAQSHVDKVYAGLRDLCLEKKQRLSEIQKLNHLYREIVDLENWIYERTLVASSHDLGVDFEHCCLLRERFDEFFHETHLLGKDRVKAANDLCASLISQCHADSAEIAQWHDRINDSWAELQELMQTRIQLLRTAWEFYKYLSSCQDVLDRICEKIASIPTDVSKDSQSVAIQQRKHATFLSDAQALEGQVQWVVDEANHLLPSYAGQKEWHICERRDDVLATWNQLNMQAERRRHQLEDAADLQRFFSMVRELLQWMDLVALQINEKTRPKDVSGVELLINDHRSIKAEIAAREESMSICVNLGRTLLHRGRVGVDEVRAALINLITRKYSLEDMWEERWDYLQLILEVYQFARDASVAEAWILAQEPYLANKTLGETLDETLSLLKKHINFEKTVMSQEERFEALEKLTTMEIRAKEITKESILLKDKHKQERIENAIKIFQPPPSPELVHESPKVSISEEDEEGKSHQHKISVISKEAAEMCQSSETKTDIRGILIRKHEWEYKNRKALNRSWHEFLVVLSIEKNKLLVYKDEKHYNEKPQDTYHKDSGLDLNDLVAAPASDYLKRPFVFRIKITSTGAEYLFQAKDEEDMLRWVNSINENSQKDLKSETTAPGKSSTLPACT 6951
            +L+ER RIKALA ERE VQKKTFTKW+NSHL ++   I DLY D++DGK L+ LLE+LSGE+LP PTKGKMRIHCLENVDK+L FL EQRVHLEN+G+HDIVDGNA L LGLIWTIILRFQIQDI +EE D  E + AKDALLLWCQMKTAGY N NVRNF+T WRDGLAFNAIIH+HRPDL+++  LS++N   NL  A  +AE+KLG+ +LLD EDV VE+PDEKSI+TYVVT+YH+FSK+K ++V  KR+GK++  +ME ++M+  Y+  TS+LL+WI  TI+ L +R F NSL+GVQ QLA F+ YR  EKPPKF EKGNLE+LLF++QS+MRANNQ PY P EGK+ISDIN AW +L+KAEH RELALR+ELIRQEKLEQLA RFDRKA MRE WL+ENQRL++QDNFG DL+AVEAA KKHEAI+TDI AYEERV +V  V  ELE+E YHDV+R+L R+DNV+RLW  LL++L  R++RL+   ++Q+ FQ++ ++LD + ++K  L T+D G+HLMGVEDL+ KHSL+E DI ++G +++ ++ ++Q F++ +       ++P DP  ++ R   L++ Y  L+ L+  R+  L  S+ +W+F W  ADEE W+KEK Q++   ++GHDL++V+ ++SKHK +E ++ +H   LQNV + G +LI + + GA+++ D LKE+   W+ L++LT+ RR +LE ++ YF   AD  +V+ W+++ +++V  ++   +E ++ + + KH+ ++  +++Y   I++L +Q + L   + E   +++++  I ++Y  L EL   ++ +L D LSL++++ +AD V+ WI EK K+L ++ P  ++E++E+ +HRF+GF+KEMN  A +V  VN LA +L  ++HP   +++ ++  LN+ W++L +  EA+ + L++++    + +EC++T  WI +K R++  TD L  DL G+M LQRR+ GM RD+ AI+AKL  L+ E +++  + P + ++IRE    +E  W +L  ML +RD +L E+ +L RFL+DLDH   WL+K QT VASED P  L +AEK L QH+ ++EEID+Y +++  +++YG R+T + +   D QYMFL +RLNAL++GW+EL QMWENRQ LLSQSL  Q+F RDA Q+EVLL+Q+E+FLSK+D P+++E ++N L++HE FLTT++AN D    +++    LVE+ HF +DKI  R ++I  RR+ N++R+ + +EKLK+QV   E  QD+++L++W+QEK   + DES+R  K I  ++ RH+AF+ EI ANK+RL +A   A ++ +E+P+  D+I P++  L +Q+++LE  T  KG  + +ANRE + ++   D+ +++  + + I+  +   +  +   + ++K +    +M +K +Q++++      L++  PE+     + +K  +LE RF +++ P+  ++  L ++K   QF R+++D+K W+D+KL +A S ++GN+L  V  L ++++ LATE++NH+P++  +   G  LI+E      +KF A + +L   W  L+ +I+ R++ L ESE  Q + FDA+EAESW+ EQEL+++ E+RG +D+ +A N++KKH+  ++++EDY   I +LG  +R     D    D +A+ QS +DK+YAGL+DL  E++ RL+E  +L  L RE+ DLE WI +R +VA S +LG DF+H  LL ERF+EF  +T  +G +RV   N +  +LI   H+DSA IA+W D +N+SW +L EL++TR Q+L  + E +K+   C+DVL RI EK   +  ++ +D+ SV+  QRKH  FL D   L  QVQ + +E+  L  +YAG K   I  R  +VL  W+ L    + R+ +L D  DL RFF+MVR L+ WM+ +  Q+N   +P+DVSGVELL+N+H+S+KAEI  RE++   C++LG+ LL R      +++  L+ L   + +L   WEERW+ LQLILEVYQFARDA+VAEAW++AQEPYL +  LG T+DE  +L+KKH  FEK+  +QEERF ALE+LTT E+  KE+ +   L ++  +Q   E          + +   E+ +    ++ + G SH       +  A E  +         G + RKHEW+   +KA NRSW +  V ++ +  ++  YKD+K Y   P+ T+  +   DL +     ASDY K+  V R+K+ + GA +L QA D+ +M +WV S+   S     S   A  +S TLPA +
Sbjct:   34 RLFERSRIKALAEERESVQKKTFTKWVNSHLCRVNCRIADLYVDMRDGKHLIKLLEVLSGERLPKPTKGKMRIHCLENVDKALQFLREQRVHLENIGSHDIVDGNASLNLGLIWTIILRFQIQDITIEEVDNKETKSAKDALLLWCQMKTAGYHNVNVRNFTTSWRDGLAFNAIIHKHRPDLVQFEKLSKTNAIHNLNNAFDVAEDKLGLAKLLDAEDVFVEHPDEKSIITYVVTYYHYFSKLKQETVQGKRIGKVVGIAMENDKMVHDYENFTSDLLKWIETTIQSLGEREFENSLAGVQGQLAQFSNYRTIEKPPKFVEKGNLEVLLFTLQSKMRANNQKPYTPKEGKMISDINKAWERLEKAEHERELALREELIRQEKLEQLAARFDRKASMRETWLSENQRLVSQDNFGFDLAAVEAAAKKHEAIETDIFAYEERVQAVVAVCDELESERYHDVKRILLRKDNVMRLWTYLLELLRARRMRLEISLQLQQNFQEMLYILDNMEEIKQLLMTDDYGKHLMGVEDLLQKHSLVEADINILGERVKVVVQNSQKFLSDD----PESYKPCDPEIIVSRVQQLEDAYAELVRLAVERRSRLEESRKLWQFYWDTADEENWIKEKEQIVSTDEVGHDLTTVNLMLSKHKALESEITSHDPQLQNVAKVGSELITEGHFGADRIKDRLKEILNKWDHLLDLTKYRRQRLENAVEYFQLFADADDVDNWMLDTLRIVSSEDVGRDEANVQSLLKKHKDVADELKNYAEVIDALHKQAESLKLNEAEKANVDKRLEAIDNRYKELTELAKLRKQRLLDALSLYKLMSEADGVEQWIKEKTKMLDTMTPGKDIEDVEIMKHRFEGFDKEMNANASRVAVVNQLARQLLHVEHPNSDEILERQNHLNQEWSTLREKAEAKMDDLKSAHGVQTFYIECRETISWIEDKKRILTETDSLEMDLTGVMTLQRRLSGMDRDLAAIQAKLSSLEREANSIEDEHPEEAKIIRERIAQIELIWEQLTQMLKERDSKLEEAGDLHRFLRDLDHFQTWLTKTQTDVASEDTPTSLPEAEKLLNQHQSIREEIDNYTEDYKNMMEYGERLTSEGSTSDDPQYMFLRERLNALKDGWEELHQMWENRQVLLSQSLDQQLFNRDARQTEVLLSQQEHFLSKDDTPVNLEQAENQLKRHEAFLTTMEANDDKINTLLQVADTLVEKDHFDADKIGKRAENITGRRDDNRQRALDQHEKLKNQVKLHEFLQDLEELAEWVQEKYATSQDESYRSAKTIHSKWTRHQAFEAEIAANKERLFEAEKSAQELSKEKPEFKDVIEPKLKELAKQFDDLEVHTKEKGAMLFDANREVLVQQTCDDIDSYITDLEKQIVSGDTANDLTSVNIL-MQKQQVIQTQMAVKARQVEEIDKQTEYLQKTVPEEKIEPIVVKKTAVLE-RFEKIKAPLLERQKALEKKKEAFQFCRDVEDEKLWIDEKLPVANSPDYGNSLFNVHVLKKKNQSLATEIDNHEPRINAICNNGRKLIDE-GHEDAKKFEALISDLTQKWQELKDAIENRRKHLLESEKVQQYFFDAQEAESWMSEQELYMMVEDRG-KDEISAQNLMKKHENLEQSVEDYANTIRQLGEVARQFSGDDISSGDAVAVKQSQLDKLYAGLKDLAGERRARLNEALQLFMLSREVDDLEQWITDREVVAGSQELGQDFDHVTLLSERFNEFARDTEAVGGERVAKVNGIADNLIQAGHSDSATIAEWKDNLNESWQDLLELIETRTQMLAASRELHKFFHDCKDVLGRILEKQHGVSDELGRDAGSVSTLQRKHYNFLQDLITLYSQVQQIQEESAKLQDAYAGDKAKEITNREQEVLHAWDNLQAMCDARKQKLADTGDLFRFFNMVRILMIWMEDLVRQMNTSEKPRDVSGVELLMNNHQSLKAEIDTREDNFGACISLGKELLTRNHYASADIKDRLMTLSNSRNALLRRWEERWENLQLILEVYQFARDAAVAEAWLIAQEPYLLSSELGHTIDEVENLIKKHEAFEKSAAAQEERFSALERLTTFEL--KEMKRRQELAEEAERQRIKEEQEAKAASEAAEQAKREAER---RDDVDVGASHDDSERGGTPGAGEGHE---------GYVTRKHEWDSTTKKASNRSWDK--VYMAAKAGRISFYKDQKGYKSNPELTFRGEPSYDLQNAAIEIASDYTKKKHVLRVKL-ANGALFLLQAHDDTEMSQWVTSLKAQSD----STAVAASRSQTLPATS 2275          
BLAST of Spectrin beta chain vs. UniProt/SwissProt
Match: sp|Q01082|SPTB2_HUMAN (Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTBN1 PE=1 SV=2)

HSP 1 Score: 1840.08 bits (4765), Expect = 0.000e+0
Identity = 1008/2311 (43.62%), Postives = 1527/2311 (66.08%), Query Frame = 1
Query:  154 KLYERFRIKALAGEREKVQKKTFTKWINSHLNKLKQSIDDLYNXXXXXXXXXXXXXXXXXXXXPYPTKGKMRIHCLENVDKSLNFLIEQRVHLENMGAHDIVDGNARLTLGLIWTIILRFQIQDIVVEEDDTSEKRQAKDALLLWCQMKTAGYPNTNVRNFSTCWRDGLAFNAIIHRHRPDLLEYSALSRSNPNENLEQAIRIAEEKLGIPRLLDPEDVSVENPDEKSIMTYVVTFYHFFSKMKADSVHSKRVGKILSQSMETEEMMVHYDKLTSNLLEWINQTIELLNDRTFANSLSGVQQQLAAFNTYRVTEKPPKFQEKGNLEMLLFSIQSQMRANNQMPYLPIEGKLISDINNAWNKLDKAEHARELALRDELIRQEKLEQLALRFDRKAGMREAWLTENQRLITQDNFGQDLSAVEAAGKKHEAIKTDILAYEERVNSVTLVTSELENECYHDVERVLCRRDNVIRLWEKLLDMLAVRKLRLDACYKVQKLFQDIKHLLDLINDLKARLKTEDIGRHLMGVEDLIHKHSLLEIDIRMVGTKIEGIMSDAQPFINSEFGLGSGDFQPADPNEVILRTVNLKEEYDNLLELSRNRKDNLSASKVMWEFLWGVADEEQWMKEKIQLMLNPDLGHDLSSVHRLISKHKVIEEDVRNHSNYLQNVIQGGQQLILDKNPGAEKVADXXXXXXXXXXXXXXXXXXRRSKLEQSLAYFHCLADCGEVEIWIIEQVKLVKIDETSINEESIITDIHKHEQLSKSIEDYESNINSLDEQVKKLSEGDLELVTIEEKVSNIKSQYAILIELTNQKQNKLTDTLSLFRVLRKADTVKTWIDEKEKLLMSLIPTDELEELEVFRHRFDGFEKEMNIQADQVEFVNTLAEKLSDMDHPQIADVVNKRFELNKLWNSLADLVEARREQLQTSYEFNQYLLECKQTGEWIREKSRLVESTDELGDDLAGIMQLQRRMGGMQRDMDAIRAKLEHLDEEMDTLIAKRPNXXXXXXXXXXXXXXFWAELGDMLADRDDRLSESSELQRFLQDLDHIHIWLSKMQTTVASEDLPKDLADAEKSLVQHEQLKEEIDSYQDEFIRLLDYGRRITEDKTDAQYMFLSQRLNALEEGWQELCQMWENRXXXXXXXXXXXVFLRDAIQSEVLLAQEENFLSKEDIPISIENSQNLLRKHEGFLTTLQANHDHTIAVIEFGRNLVERGHFCSDKINLRVKSILXXXXXXXXXXXXAYEKLKDQVLYQELSQDIDDLSKWIQEKMIIATDESFREEKNIARRYNRHRAFDEEIQANKDRLCQAIDYAMQIVEERPQLADMIYPQIDSLNQQWEELEQTTFLKGEKMIEANREAIFEEGTMDVMTWLXXXXXXXXXXXXXXXXXXXXXXKLKKVEEADNEMEIKRKQIQDLKMHAAKLKEEQPEKAFGIEQKHLILEHRFTQLQMPXXXXXXXXXXXXXXXXFLRNLDDQKAWVDDKLLLAESTNFGNNLLTVQQLLRRHRYLATEVNNHKPQLEYLKEEGAVLIEEVSPMQREKFVAGLQELESLWNRLEHSIDLRQQRLKESEATQTFLFDAEEAESWLWEQELFLLSEERGIRDQEAAINVIKKHDARQKTIEDYGEEITKLGTRSRLLIEKDHPQADRIALAQSHVDKVYAGLRDLCLEKKQRLSEIQKLNHLYREIVDLENWIYERTLVASSHDLGVDFEHCCLLRERFDEFFHETHLLGKDRVKAANDLCASLISQCHADSAEIAQWHDRINDSWAELQELMQTRIQLLRTAWEFYKYLSSCQDVLDRICEKIASIPTDVSKDSQSVAIQQRKHATFLSDAQALEGQVQWVVDEANHLLPSYAGQKEWHICERRDDVLATWNQLNMQAERRRHQLEDAADLQRFFSMVRELLQWMDLVALQINEKTRPKDVSGVELLINDHRSIKAEIAAREESMSICVNLGRTLLHRGRVGVDEVRAALINLITRKYSLEDMWEERWDYLQLILEVYQFARDASVAEAWILAQEPYLANKTLGETLDETLSLLKKHINFEKTVMSQEERFEALEKLTTMEIR--------------------AKEITKESILLK--DKHKQERI-ENAIKIFQPPP-------SPELVHESPKVSISEEDEE-----GKSHQHKISVISKEAAEM-CQSSETKT-DIRGILIRKHEWEYKNRKALNRSWHEFLVVLSIEKNKLLVYKDEKHYNEKPQDTYHKDSGLDLNDLVAAPASDYLKRPFVFRIKITSTGAEYLFQAKDEEDMLRWVNSINENSQKDLKSETTAPGKSSTLPACTSDPHVPST 6975
            +L+ER RIKALA ERE VQKKTFTKW+NSHL ++   I DLY DL+DG+ML+ LLE+LSGE+LP PTKG+MRIHCLENVDK+L FL EQRVHLENMG+HDIVDGN RLTLGLIWTIILRFQIQDI VE +D  EK+ AKDALLLWCQMKTAGYPN N+ NF+T WRDG+AFNA+IH+HRPDL+++  L +SN + NL+ A  +AE+ LG+ +LLDPED+SV++PDEKSI+TYVVT+YH+FSKMKA +V  KR+GK+L  ++ETE+M+  Y+ L S+LLEWI QTI +LN+R FANSL GVQQQL AFNTYR  EKPPKF EKGNLE+LLF+IQS+MRANNQ  Y+P EGKLISDIN AW +L+KAEH RELALR+ELIRQEKLEQLA RFDRKA MRE WL+ENQRL++QDNFG DL AVEAA KKHEAI+TDI AYEERV +V  V  ELE E YHD++R+  R+DNVIRLWE LL++L  R+ RL+    +QK+FQ++ +++D ++++K  + ++D G+HL+GVEDL+ KH+L+E DI +   ++ G+ + AQ F       G G ++P DP  +  R  +++  Y  L +L+  R+  L  S+ +W+F W +A+EE W++EK +++ + D G DL+SV RL+SKH+  E+++   S + +  I+ G+ +I +++ G+EK+ + +  +   W  L +L+  R+ +LE++       AD  +++ W+++ +K+V   +   +E S  + + KH+ +++ I +Y   +++L EQ   L +   E   +  ++S I+ +Y  + ELT  ++  L DTL+L+++  +AD  + WIDEKE+ L ++   ++LE+LEV +HRF+  E EMN QA +V  VN +A +L    HP   ++  ++ +LN  W+   +LV+ +++ L ++     Y LEC +T  WIREK++++EST +LG+DLAG+M LQR++ GM+RD+ AI AKL  L +E + L ++ P+  + I      + D W E+   L +R+  L E+S+LQ+FL+DLD    WLS+ QT +ASED+P  L +AEK L QHE +K EID+Y++++ ++ D G  +T+ +TDAQYMFL QRL AL+ GW EL +MWENRQ LLSQS + Q FLRD  Q+E  L  +E  L+  ++P ++E ++  ++K E F+TT+ AN +   AV+E GR LV  G+  SD+I  +V SI +R   N+  ++E   +LKD    Q+  QD  +LS WI EKM+ A D S+ E +N+  ++ +H+AF  E+ +NK+ L +     MQ++ E+P+   ++  ++  L++ WE LE TT  K +++ +AN+  +F +   D+  WL  +   I   +   +  +   + LKK +  +N+ME+++K+I++L+  A  L +E  +    ++ K L ++ +F +L  P+  +K  L+  K I QF R+++D+  WV +++ LA ST+ G+NL TVQ L+++++ L  E+  H+P+++ + E    ++ + S +  E     L +L+ LW  L    + R +RL+E+   Q + FDA EAE+W+ EQEL+++SEE+  +D+++A++++KKH   ++ +EDY E + +L   SR L+   HP+++RI++ QS VDK+YAGL+DL  E++ +L E  +L  L RE+ DLE WI ER +VA SH+LG D+EH  +L+ERF EF  +T  +G++RV   N L   LI+  H+D+A IA+W D +N++WA+L EL+ TR Q+L  ++E +K+    +++  RI +K   +P ++ +D  +V   QR H TF  D QAL  QV+ + ++A  L  +YAG K   I +R ++VL  W  L    E RR +L D  D  RFFSMVR+L+ WM+ V  QI  + +P+DVS VELL+N+H+ IKAEI AR +S + C+ LG++LL R     +E++  L+ L  ++  + D WE+RW++L+LILEV+QF+RDASVAEAW+L QEPYL+++ +G+++DE   L+K+H  FEK+  + +ERF ALE+LTT+E+                     + ++++E+   +  D  K E++ +N +   Q  P       + E+V+ + +   S ++           + K ++ ++ AA +  ++ ET +  + G L RKHEWE  N+KA +RSWH    V  I   ++  YKD K         YH +  + L + V   A DY K+  VF++++   G EYLFQAKD+E+M  W+ +I+     D K E +A  +S+  PA +    +P++
Sbjct:   38 RLFERSRIKALADEREAVQKKTFTKWVNSHLARVSCRITDLYTDLRDGRMLIKLLEVLSGERLPKPTKGRMRIHCLENVDKALQFLKEQRVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKEKKSAKDALLLWCQMKTAGYPNVNIHNFTTSWRDGMAFNALIHKHRPDLIDFDKLKKSNAHYNLQNAFNLAEQHLGLTKLLDPEDISVDHPDEKSIITYVVTYYHYFSKMKALAVEGKRIGKVLDNAIETEKMIEKYESLASDLLEWIEQTIIILNNRKFANSLVGVQQQLQAFNTYRTVEKPPKFTEKGNLEVLLFTIQSKMRANNQKVYMPREGKLISDINKAWERLEKAEHERELALRNELIRQEKLEQLARRFDRKAAMRETWLSENQRLVSQDNFGFDLPAVEAATKKHEAIETDIAAYEERVQAVVAVARELEAENYHDIKRITARKDNVIRLWEYLLELLRARRQRLEMNLGLQKIFQEMLYIMDWMDEMKVLVLSQDYGKHLLGVEDLLQKHTLVEADIGIQAERVRGVNASAQKFATD----GEG-YKPCDPQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEKILSSDDYGKDLTSVMRLLSKHRAFEDEMSGRSGHFEQAIKEGEDMIAEEHFGSEKIRERIIYIREQWANLEQLSAIRKKRLEEASLLHQFQADADDIDAWMLDILKIVSSSDVGHDEYSTQSLVKKHKDVAEEIANYRPTLDTLHEQASALPQEHAESPDVRGRLSGIEERYKEVAELTRLRKQALQDTLALYKMFSEADACELWIDEKEQWLNNMQIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLMHSGHPSEKEIKAQQDKLNTRWSQFRELVDRKKDALLSALSIQNYHLECNETKSWIREKTKVIESTQDLGNDLAGVMALQRKLTGMERDLVAIEAKLSDLQKEAEKLESEHPDQAQAILSRLAEISDVWEEMKTTLKNREASLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLTEAEKLLTQHENIKNEIDNYEEDYQKMRDMGEMVTQGQTDAQYMFLRQRLQALDTGWNELHKMWENRQNLLSQSHAYQQFLRDTKQAEAFLNNQEYVLAHTEMPTTLEGAEAAIKKQEDFMTTMDANEEKINAVVETGRRLVSDGNINSDRIQEKVDSIDDRHRKNRETASELLMRLKDNRDLQKFLQDCQELSLWINEKMLTAQDMSYDEARNLHSKWLKHQAFMAELASNKEWLDKIEKEGMQLISEKPETEAVVKEKLTGLHKMWEVLESTTQTKAQRLFDANKAELFTQSCADLDKWLHGLESQIQSDDYGKDLTSVNIL-LKKQQMLENQMEVRKKEIEELQSQAQALSQE-GKSTDEVDSKRLTVQTKFMELLEPLNERKHNLLASKEIHQFNRDVEDEILWVGERMPLATSTDHGHNLQTVQLLIKKNQTLQKEIQGHQPRIDDIFERSQNIVTDSSSLSAEAIRQRLADLKQLWGLLIEETEKRHRRLEEAHRAQQYYFDAAEAEAWMSEQELYMMSEEKA-KDEQSAVSMLKKHQILEQAVEDYAETVHQLSKTSRALVADSHPESERISMRQSKVDKLYAGLKDLAEERRGKLDERHRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFREFARDTGNIGQERVDTVNHLADELINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQILAASYELHKFYHDAKEIFGRIQDKHKKLPEELGRDQNTVETLQRMHTTFEHDIQALGTQVRQLQEDAARLQAAYAGDKADDIQKRENEVLEAWKSLLDACESRRVRLVDTGDKFRFFSMVRDLMLWMEDVIRQIEAQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTTCIELGKSLLARKHYASEEIKEKLLQLTEKRKEMIDKWEDRWEWLRLILEVHQFSRDASVAEAWLLGQEPYLSSREIGQSVDEVEKLIKRHEAFEKSAATWDERFSALERLTTLELLEVRRQQEEEERKRRPPSPEPSTKVSEEAESQQQWDTSKGEQVSQNGLPAEQGSPRMAETVDTSEMVNGATEQRTSSKESSPIPSPTSDRKAKTALPAQSAATLPARTQETPSAQMEGFLNRKHEWEAHNKKASSRSWHNVYCV--INNQEMGFYKDAK--TAASGIPYHSEVPVSLKEAVCEVALDYKKKKHVFKLRLND-GNEYLFQAKDDEEMNTWIQAISSAISSD-KHEVSASTQST--PASSRAQTLPTS 2332          
BLAST of Spectrin beta chain vs. UniProt/SwissProt
Match: sp|Q9QWN8|SPTN2_RAT (Spectrin beta chain, non-erythrocytic 2 OS=Rattus norvegicus OX=10116 GN=Sptbn2 PE=1 SV=2)

HSP 1 Score: 1612.05 bits (4173), Expect = 0.000e+0
Identity = 874/2056 (42.51%), Postives = 1307/2056 (63.57%), Query Frame = 1
Query:  154 KLYERFRIKALAGEREKVQKKTFTKWINSHLNKLKQSIDDLYNXXXXXXXXXXXXXXXXXXXXPYPTKGKMRIHCLENVDKSLNFLIEQRVHLENMGAHDIVDGNARLTLGLIWTIILRFQIQDIVVEEDDTSEKRQAKDALLLWCQMKTAGYPNTNVRNFSTCWRDGLAFNAIIHRHRPDLLEYSALSRSNPNENLEQAIRIAEEKLGIPRLLDPEDVSVENPDEKSIMTYVVTFYHFFSKMKADSVHSKRVGKILSQSMETEEMMVHYDKLTSNLLEWINQTIELLNDRTFANSLSGVQQQLAAFNTYRVTEKPPKFQEKGNLEMLLFSIQSQMRANNQMPYLPIEGKLISDINNAWNKLDKAEHARELALRDELIRQEKLEQLALRFDRKAGMREAWLTENQRLITQDNFGQDLSAVEAAGKKHEAIKTDILAYEERVNSVTLVTSELENECYHDVERVLCRRDNVIRLWEKLLDMLAVRKLRLDACYKVQKLFQDIKHLLDLINDLKARLKTEDIGRHLMGVEDLIHKHSLLEIDIRMVGTKIEGIMSDAQPFINSEFGLGSGDFQPADPNEVILRTVNLKEEYDNLLELSRNRKDNLSASKVMWEFLWGVADEEQWMKEKIQLMLNPDLGHDLSSVHRLISKHKVIEEDVRNHSNYLQNVIQGGQQLILDKNPGAEKVADXXXXXXXXXXXXXXXXXXRRSKLEQSLAYFHCLADCGEVEIWIIEQVKLVKIDETSINEESIITDIHKHEQLSKSIEDYESNINSLDEQVKKLSEGDLELVTIEEKVSNIKSQYAILIELTNQKQNKLTDTLSLFRVLRKADTVKTWIDEKEKLLMSLIPTDELEELEVFRHRFDGFEKEMNIQADQVEFVNTLAEKLSDMDHPQIADVVNKRFELNKLWNSLADLVEARREQLQTSYEFNQYLLECKQTGEWIREKSRLVESTDELGDDLAGIMQLQRRMGGMQRDMDAIRAKLEHLDEEMDTLIAKRPNXXXXXXXXXXXXXXFWAELGDMLADRDDRLSESSELQRFLQDLDHIHIWLSKMQTTVASEDLPKDLADAEKSLVQHEQLKEEIDSYQDEFIRLLDYGRRITEDKTDAQYMFLSQRLNALEEGWQELCQMWENRXXXXXXXXXXXVFLRDAIQSEVLLAQEENFLSKEDIPISIENSQNLLRKHEGFLTTLQANHDHTIAVIEFGRNLVERGHFCSDKINLRVKSILXXXXXXXXXXXXAYEKLKDQVLYQELSQDIDDLSKWIQEKMIIATDESFREEKNIARRYNRHRAFDEEIQANKDRLCQAIDYAMQIVEERPQLADMIYPQIDSLNQQWEELEQTTFLKGEKMIEANREAIFEEGTMDVMTWLXXXXXXXXXXXXXXXXXXXXXXKLKKVEEADNEMEIKRKQIQDLKMHAAKLKEEQPEKAFGIEQKHLILEHRFTQLQMPXXXXXXXXXXXXXXXXFLRNLDDQKAWVDDKLLLAESTNFGNNLLTVQQLLRRHRYLATEVNNHKPQLEYLKEEGAVLIEEVSPMQREKFVAGLQELESLWNRLEHSIDLRQQRLKESEATQTFLFDAEEAESWLWEQELFLLSEERGIRDQEAAINVIKKHDARQKTIEDYGEEITKLGTRSRLLIEKDHPQADRIALAQSHVDKVYAGLRDLCLEKKQRLSEIQKLNHLYREIVDLENWIYERTLVASSHDLGVDFEHCCLLRERFDEFFHETHLLGKDRVKAANDLCASLISQCHADSAEIAQWHDRINDSWAELQELMQTRIQLLRTAWEFYKYLSSCQDVLDRICEKIASIPTDVSKDSQSVAIQQRKHATFLSDAQALEGQVQWVVDEANHLLPSYAGQKEWHICERRDDVLATWNQLNMQAERRRHQLEDAADLQRFFSMVRELLQWMDLVALQINEKTRPKDVSGVELLINDHRSIKAEIAAREESMSICVNLGRTLLHRGRVGVDEVRAALINLITRKYSLEDMWEERWDYLQLILEVYQFARDASVAEAWILAQEPYLANKTLGETLDETLSLLKKHINFEKTVMSQEERFEALEKLTTMEIR 6321
            +L+ER RIKALA ERE VQKKTFTKW+NSHL ++   + DLY+DL+DG+ LL LLE+LSGE LP PTKG+MRIHCLENVDK+L FL EQ+VHLENMG+HDIVDGN RLTLGL+WTIILRFQIQDI VE +D  EK+ AKDALLLWCQMKTAGYPN NV NF+T WRDGLAFNAI+H+HRPDLL++ +L + N + NL+ A  +AE++LG+ +LLDPEDV+V+ PDEKSI+TYV T+YH+FSKMKA +V  KR+GK+L  +ME E ++  Y+ L S LL+WI QTI  LNDR  ANSLSGVQ QL +FN+YR  EKPPKF EKGNLE+LLF+IQS++RANNQ  Y P EG+LISDIN AW +L+KAEH RELALR ELIRQEKLEQLA RFDRKA MRE WL+ENQRL++QDNFG +L+AVEAA +KHEAI+TDI+AY  RV +V  V +EL  E YHD++R+  R++NV RLW+ L +M+A R+ RL    ++QK+FQD+ +L+D + ++K RL+++D+G+HL GVEDL+  H L+E DI +   ++  + + A  F +        +++P DP  V  R   L++ Y+ L EL+  R+  L  S+ +W FLW V + E W++E+  L+ + + G DL+ V RL++KH  +  ++      L+  ++ GQQL+ + +PGA + +    EL+  W  L  L E R  +L Q+ + +   AD  ++E W+++ ++LV   E   +E S      +H  L + I  +   +++L EQ   L         ++ +V  ++  Y  L     ++   L   L+ + +L +A     W++EKE+ L  L   + LE+LEV + RF+  E EMN  A +V  V+ +AE+L     P    ++  + +LN+ W     L + ++  L ++     Y LEC +T  W+REK++++EST +LG+DLAG++ LQR++ G +RD++AI A++  L +E + L A  P     I      ++  W +L   +  R++ L E+  LQ FL+ LD    WL + QT VASE+ P  L +AE  L QH  L+ E++  Q E+ RL   G  +T D+ D Q +FL QRL AL  GW+EL +MWE+RQG L+Q+   Q FLRDA Q+E +L+ +E FLS  ++P +++ +   ++K E F++T+ AN +    ++E GR LV +G+  ++KI  +  SI +R   N+    +   +L+D    Q   QD  +L  WI EKM+ A D S+ E +N+  ++ +H+AF  E+ ANKD L +      ++  E+P+L  ++  +++ L+++W+ELE TT  K   + +ANR  +F +    + +WLE++   +   +   +  +   + LKK +  + EM ++ K+++ ++  A  L +E  + A  +E+    +E +F  L  P+K++  +L   +   QF R+++D+  WV ++L +A S   G +L +VQ L+++++ L  E+  H+P++  LKE    L    +  +       L EL+ +W RL H ++LR +RL+E+   Q F  DA EAE+W+ EQEL ++ +E+  +D+ +A   +KKH   ++ + DY + I +L   S+ +I+ +HP++ R+ + Q+ VDK+YAGL++L  E+++RL E  +L  L RE+ DLE WI ER +VA+SH+LG D+EH  +LR++F EF  +T  +G++RV +AN L   LI+  HA  A +A+W D +N++WA+L EL+ TR Q+L  A+E  ++L   +  L R+  K   +P    +D  +    QR+H  +  D QAL  QVQ V D+   L  +YAG K   I      V   W QL   +  RR  L D  D  RFF  VREL+ WMD + LQ++ + RP+DVS  +L+I + + IKAEI AR +  S C+++G+ LL R     +E+   L  L +R+    + W+E+ D+LQL+LEV  F RDA +AEAW+ +QEP + +  LG T+DE  SL+K+H  F+K+ ++ EERF ALEKLT +E R
Sbjct:   41 RLFERSRIKALADEREAVQKKTFTKWVNSHLARVTCRVGDLYSDLRDGRNLLRLLEVLSGETLPKPTKGRMRIHCLENVDKALQFLKEQKVHLENMGSHDIVDGNHRLTLGLVWTIILRFQIQDISVETEDNKEKKSAKDALLLWCQMKTAGYPNVNVHNFTTSWRDGLAFNAIVHKHRPDLLDFESLKKCNAHYNLQNAFNLAEKELGLTKLLDPEDVNVDQPDEKSIITYVATYYHYFSKMKALAVEGKRIGKVLDHAMEAEHLVEKYESLASELLQWIEQTIVTLNDRQLANSLSGVQNQLQSFNSYRTVEKPPKFTEKGNLEVLLFTIQSKLRANNQKVYTPREGRLISDINKAWERLEKAEHERELALRTELIRQEKLEQLAARFDRKAAMRETWLSENQRLVSQDNFGLELAAVEAAVRKHEAIETDIVAYSGRVQAVDAVAAELAAEHYHDIKRIAARQNNVARLWDFLREMVAARRERLLLNLELQKVFQDLLYLMDWMAEMKGRLQSQDLGKHLAGVEDLLQLHELVEADIAVQAERVRAVSASALRFCDP-----GKEYRPCDPQLVSERVATLEQSYEALCELAATRRARLEESRRLWRFLWEVGEAEAWVREQQHLLASAETGRDLTGVLRLLNKHTALRGEMSGRLGPLKLTLEQGQQLVAEGHPGANQASTRAAELQAQWERLEALAEERAQRLAQAASLYQFQADANDMEAWLVDALRLVSSPEVGHDEFSTQALARQHRALEEEIRAHRPTLDALREQAAALPPALSHTPEVQGRVPTLEQHYEELQARAGERARALEAALAFYTMLSEAGACGLWVEEKEQWLNGLALPERLEDLEVVQQRFETLEPEMNALAARVTAVSDIAEQLLKASPPGKDRIIGTQEQLNQRWQQFRSLADGKKAALTSALSIQNYHLECTETQAWMREKTKVIESTQDLGNDLAGVLALQRKLAGTERDLEAISARVGELTQEANALAAGHPAQAPAINTRLGEVQTGWEDLRATMRRREESLGEARRLQDFLRSLDDFQAWLGRTQTAVASEEGPATLPEAEALLAQHAALRGEVERAQSEYSRLRTLGEEVTRDQADPQCLFLRQRLEALGTGWEELGRMWESRQGRLAQAHGFQGFLRDARQAEGVLSSQEYFLSHTEMPGTLQAADAAIKKLEDFMSTMDANGERIRGLLEAGRQLVSKGNIHAEKIQEKADSIEKRHRKNQEAVQQLLGRLRDNREQQHFLQDCQELKLWIDEKMLTAQDVSYDEARNLHTKWQKHQAFMAELAANKDWLDKVDKEGRELTLEKPELKVLVSEKLEDLHRRWDELETTTQAKARSLFDANRAELFAQSCSALESWLESLQAQLHSDDYGKDLTSVNIL-LKKQQMLEREMAVREKEVEAIQAQAKALAQED-QSAGEVERTSRAVEEKFRALCQPMKDRCRRLQASREQHQFHRDVEDEILWVTERLPMASSLEHGKDLPSVQLLMKKNQTLQKEIQGHEPRIADLKERQRTLGTAAAGPE-------LAELQEMWKRLSHELELRGKRLEEALRAQQFYRDAAEAEAWMGEQELHMMGQEKA-KDELSAQAEVKKHQVLEQALADYAQTIKQLAASSQDMIDHEHPESTRLTIRQAQVDKLYAGLKELAGERRERLQEHLRLCQLRRELDDLEQWIQEREVVAASHELGQDYEHVTMLRDKFREFSRDTSTIGQERVDSANALANGLIAGGHAARATVAEWKDSLNEAWADLLELLDTRGQVLAAAYELQRFLHGARQALARVQHKQQQLPDGTGRDLNAAEALQRRHCAYEHDIQALSTQVQQVQDDGLRLQKAYAGDKAEEIGRHMQAVAEAWAQLQGSSAARRQLLLDTTDKFRFFKAVRELMLWMDGINLQMDAQERPRDVSSADLVIKNQQGIKAEIEARADRFSACIDMGQELLARNHYAAEEISEKLSQLQSRRQETAEKWQEKMDWLQLVLEVLVFGRDAGMAEAWLCSQEPLVRSAELGCTVDEVESLIKRHEAFQKSAVAWEERFSALEKLTALEER 2081          

HSP 2 Score: 73.559 bits (179), Expect = 2.969e-11
Identity = 58/192 (30.21%), Postives = 81/192 (42.19%), Query Frame = 1
Query: 6406 PPPSPELVHESPKVSISEEDEEGKSHQHKISVISKEAAEMCQSSETKTDIRGILIRKHEWEYKNRKALNRSWHEFLVVLSIEKNKLLVYKDEKHYNEKPQDTYHKDSGLDLNDLVAAPASDYLKRPFVFRIKITSTGAEYLFQAKDEEDMLRWVNSINENSQKDLKS-----ETTAPGKSSTLPACTSDPHV 6966
            P PSP      P+   SE      +H   ++ +    AE+      +  + G L RK E E  N+KA NRSW     VL   +  L  YKD +  +      YH +  + L     + A DY KR  VF++ +   G EYLFQAKDE +M  W+  +N        +     E   P  S  L    + P V
Sbjct: 2189 PAPSP-----MPQSRSSE-----SAH---VATLPARGAELS----AQEQMEGTLCRKQEMEAFNKKAANRSWQNVYCVL--RRGSLGFYKDARAASAGV--PYHGEVPVSLARAQGSVAFDYRKRKHVFKLGLQD-GKEYLFQAKDEAEMSSWLRVVNAAIATASSASGEPEEPVVPSASRGLTRAMTMPPV 2358          
BLAST of Spectrin beta chain vs. UniProt/SwissProt
Match: sp|O15020|SPTN2_HUMAN (Spectrin beta chain, non-erythrocytic 2 OS=Homo sapiens OX=9606 GN=SPTBN2 PE=1 SV=3)

HSP 1 Score: 1606.27 bits (4158), Expect = 0.000e+0
Identity = 877/2053 (42.72%), Postives = 1300/2053 (63.32%), Query Frame = 1
Query:  154 KLYERFRIKALAGEREKVQKKTFTKWINSHLNKLKQSIDDLYNXXXXXXXXXXXXXXXXXXXXPYPTKGKMRIHCLENVDKSLNFLIEQRVHLENMGAHDIVDGNARLTLGLIWTIILRFQIQDIVVEEDDTSEKRQAKDALLLWCQMKTAGYPNTNVRNFSTCWRDGLAFNAIIHRHRPDLLEYSALSRSNPNENLEQAIRIAEEKLGIPRLLDPEDVSVENPDEKSIMTYVVTFYHFFSKMKADSVHSKRVGKILSQSMETEEMMVHYDKLTSNLLEWINQTIELLNDRTFANSLSGVQQQLAAFNTYRVTEKPPKFQEKGNLEMLLFSIQSQMRANNQMPYLPIEGKLISDINNAWNKLDKAEHARELALRDELIRQEKLEQLALRFDRKAGMREAWLTENQRLITQDNFGQDLSAVEAAGKKHEAIKTDILAYEERVNSVTLVTSELENECYHDVERVLCRRDNVIRLWEKLLDMLAVRKLRLDACYKVQKLFQDIKHLLDLINDLKARLKTEDIGRHLMGVEDLIHKHSLLEIDIRMVGTKIEGIMSDAQPFINSEFGLGSGDFQPADPNEVILRTVNLKEEYDNLLELSRNRKDNLSASKVMWEFLWGVADEEQWMKEKIQLMLNPDLGHDLSSVHRLISKHKVIEEDVRNHSNYLQNVIQGGQQLILDKNPGAEKVADXXXXXXXXXXXXXXXXXXRRSKLEQSLAYFHCLADCGEVEIWIIEQVKLVKIDETSINEESIITDIHKHEQLSKSIEDYESNINSLDEQVKKLSEGDLELVTIEEKVSNIKSQYAILIELTNQKQNKLTDTLSLFRVLRKADTVKTWIDEKEKLLMSLIPTDELEELEVFRHRFDGFEKEMNIQADQVEFVNTLAEKLSDMDHPQIADVVNKRFELNKLWNSLADLVEARREQLQTSYEFNQYLLECKQTGEWIREKSRLVESTDELGDDLAGIMQLQRRMGGMQRDMDAIRAKLEHLDEEMDTLIAKRPNXXXXXXXXXXXXXXFWAELGDMLADRDDRLSESSELQRFLQDLDHIHIWLSKMQTTVASEDLPKDLADAEKSLVQHEQLKEEIDSYQDEFIRLLDYGRRITEDKTDAQYMFLSQRLNALEEGWQELCQMWENRXXXXXXXXXXXVFLRDAIQSEVLLAQEENFLSKEDIPISIENSQNLLRKHEGFLTTLQANHDHTIAVIEFGRNLVERGHFCSDKINLRVKSILXXXXXXXXXXXXAYEKLKDQVLYQELSQDIDDLSKWIQEKMIIATDESFREEKNIARRYNRHRAFDEEIQANKDRLCQAIDYAMQIVEERPQLADMIYPQIDSLNQQWEELEQTTFLKGEKMIEANREAIFEEGTMDVMTWLXXXXXXXXXXXXXXXXXXXXXXKLKKVEEADNEMEIKRKQIQDLKMHAAKLKEEQPEKAFGIEQKHLILEHRFTQLQMPXXXXXXXXXXXXXXXXFLRNLDDQKAWVDDKLLLAESTNFGNNLLTVQQLLRRHRYLATEVNNHKPQLEYLKEEGAVLIEEVSPMQREKFVAGLQELESLWNRLEHSIDLRQQRLKESEATQTFLFDAEEAESWLWEQELFLLSEERGIRDQEAAINVIKKHDARQKTIEDYGEEITKLGTRSRLLIEKDHPQADRIALAQSHVDKVYAGLRDLCLEKKQRLSEIQKLNHLYREIVDLENWIYERTLVASSHDLGVDFEHCCLLRERFDEFFHETHLLGKDRVKAANDLCASLISQCHADSAEIAQWHDRINDSWAELQELMQTRIQLLRTAWEFYKYLSSCQDVLDRICEKIASIPTDVSKDSQSVAIQQRKHATFLSDAQALEGQVQWVVDEANHLLPSYAGQKEWHICERRDDVLATWNQLNMQAERRRHQLEDAADLQRFFSMVRELLQWMDLVALQINEKTRPKDVSGVELLINDHRSIKAEIAAREESMSICVNLGRTLLHRGRVGVDEVRAALINLITRKYSLEDMWEERWDYLQLILEVYQFARDASVAEAWILAQEPYLANKTLGETLDETLSLLKKHINFEKTVMSQEERFEALEKLTTM 6312
            +L+ER RIKALA ERE VQKKTFTKW+NSHL ++   + DLY+DL+DG+ LL LLE+LSGE LP PTKG+MRIHCLENVDK+L FL EQ+VHLENMG+HDIVDGN RLTLGL+WTIILRFQIQDI VE +D  EK+ AKDALLLWCQMKTAGYPN NV NF+T WRDGLAFNAI+H+HRPDLL++ +L + N + NL+ A  +AE++LG+ +LLDPEDV+V+ PDEKSI+TYV T+YH+FSKMKA +V  KR+GK+L  +ME E ++  Y+ L S LL+WI QTI  LNDR  ANSLSGVQ QL +FN+YR  EKPPKF EKGNLE+LLF+IQS++RANNQ  Y P EG+LISDIN AW +L+KAEH RELALR ELIRQEKLEQLA RFDRKA MRE WL+ENQRL++QDNFG +L+AVEAA +KHEAI+TDI+AY  RV +V  V +EL  E YHD++R+  R+ NV RLW+ L  M+A R+ RL    ++QK+FQD+ +L+D + ++K RL+++D+GRHL GVEDL+  H L+E DI +   ++  + + A  F N        +++P DP  V  R   L++ Y+ L EL+  R+  L  S+ +W FLW V + E W++E+  L+ + D G DL+   RL++KH  +  ++      L+  ++ GQQL+ + +PGA + +    EL+  W  L  L E R  +L Q+ + +   AD  ++E W+++ ++LV   E   +E S      +H  L + I  +   +++L EQ   L         ++ +V  ++  Y  L     ++   L   L+L+ +L +A     W++EKE+ L  L   + LE+LEV + RF+  E EMN  A Q+  VN +AE+L   + P    +VN + +LN  W     L + ++  L ++     Y LEC +T  W+REK++++EST  LG+DLAG++ LQR++ G +RD++AI A++  L  E + L A  P     I      ++  W +L   +  R++ L E+  LQ FL+ LD    WL + QT VASE+ P  L +AE  L QH  L+ E++  Q E+ RL   G  +T D+ D Q +FL QRL AL  GW+EL +MWE+RQG L+Q+   Q FLRDA Q+E +L+ +E  LS  ++P +++ +   ++K E F++T+ AN +    ++E GR LV  G+  +DKI  +  SI  R + N+  + +   +L+D    Q   QD  +L  WI EKM+ A D S+ E +N+  ++ +H+AF  E+ ANKD L +      ++  E+P+L  ++  ++  L+++W+ELE TT  K   + +ANR  +F +    + +WLE++   +   +   +  +   + LKK +  + EM ++ K+++ ++  A  L +E  + A  +E+    +E +F  L  P++ +  +L   +   QF R+++D+  WV ++L +A S   G +L +VQ L+++++ L  E+  H+P++  L+E    L    +  +       L EL+ +W RL H ++LR +RL+++   Q F  DA EAE+W+ EQEL ++ +E+  +D+ +A   +KKH   ++ + DY + I +L   S+ +I+ +HP++ RI++ Q+ VDK+YAGL++L  E+++RL E  +L  L RE+ DLE WI ER +VA+SH+LG D+EH  +LR++F EF  +T  +G++RV +AN L   LI+  HA  A +A+W D +N++WA+L EL+ TR Q+L  A+E  ++L   +  L R+  K   +P    +D  +    QR+H  +  D QAL  QVQ V D+ + L  +YAG K   I      V   W QL   +  RR  L D  D  RFF  VREL+ WMD V LQ++ + RP+DVS  +L+I + + IKAEI AR +  S C+++G+ LL R     +E+   L  L  R+    + W+E+ D+LQL+LEV  F RDA +AEAW+ +QEP + +  LG T+DE  SL+K+H  F+K+ ++ EERF ALEKLT +
Sbjct:   41 RLFERSRIKALADEREAVQKKTFTKWVNSHLARVTCRVGDLYSDLRDGRNLLRLLEVLSGEILPKPTKGRMRIHCLENVDKALQFLKEQKVHLENMGSHDIVDGNHRLTLGLVWTIILRFQIQDISVETEDNKEKKSAKDALLLWCQMKTAGYPNVNVHNFTTSWRDGLAFNAIVHKHRPDLLDFESLKKCNAHYNLQNAFNLAEKELGLTKLLDPEDVNVDQPDEKSIITYVATYYHYFSKMKALAVEGKRIGKVLDHAMEAERLVEKYESLASELLQWIEQTIVTLNDRQLANSLSGVQNQLQSFNSYRTVEKPPKFTEKGNLEVLLFTIQSKLRANNQKVYTPREGRLISDINKAWERLEKAEHERELALRTELIRQEKLEQLAARFDRKAAMRETWLSENQRLVSQDNFGLELAAVEAAVRKHEAIETDIVAYSGRVQAVDAVAAELAAERYHDIKRIAARQHNVARLWDFLRQMVAARRERLLLNLELQKVFQDLLYLMDWMEEMKGRLQSQDLGRHLAGVEDLLQLHELVEADIAVQAERVRAVSASALRFCNP-----GKEYRPCDPQLVSERVAKLEQSYEALCELAAARRARLEESRRLWRFLWEVGEAEAWVREQQHLLASADTGRDLTGALRLLNKHTALRGEMSGRLGPLKLTLEQGQQLVAEGHPGASQASARAAELQAQWERLEALAEERAQRLAQAASLYQFQADANDMEAWLVDALRLVSSPELGHDEFSTQALARQHRALEEEIRSHRPTLDALREQAAALPPTLSRTPEVQSRVPTLERHYEELQARAGERARALEAALALYTMLSEAGACGLWVEEKEQWLNGLALPERLEDLEVVQQRFETLEPEMNTLAAQITAVNDIAEQLLKANPPGKDRIVNTQEQLNHRWQQFRRLADGKKAALTSALSIQNYHLECTETQAWMREKTKVIESTQGLGNDLAGVLALQRKLAGTERDLEAIAARVGELTREANALAAGHPAQAVAINARLREVQTGWEDLRATMRRREESLGEARRLQDFLRSLDDFQAWLGRTQTAVASEEGPATLPEAEALLAQHAALRGEVERAQSEYSRLRALGEEVTRDQADPQCLFLRQRLEALGTGWEELGRMWESRQGRLAQAHGFQGFLRDARQAEGVLSSQEYVLSHTEMPGTLQAADAAIKKLEDFMSTMDANGERIHGLLEAGRQLVSEGNIHADKIREKADSIERRHKKNQDAAQQFLGRLRDNREQQHFLQDCHELKLWIDEKMLTAQDVSYDEARNLHTKWQKHQAFMAELAANKDWLDKVDKEGRELTLEKPELKALVSEKLRDLHRRWDELETTTQAKARSLFDANRAELFAQSCCALESWLESLQAQLHSDDYGKDLTSVNIL-LKKQQMLEWEMAVREKEVEAIQAQAKALAQED-QGAGEVERTSRAVEEKFRALCQPMRERCRRLQASREQHQFHRDVEDEILWVTERLPMASSMEHGKDLPSVQLLMKKNQTLQKEIQGHEPRIADLRERQRALGAAAAGPE-------LAELQEMWKRLGHELELRGKRLEDALRAQQFYRDAAEAEAWMGEQELHMMGQEKA-KDELSAQAEVKKHQVLEQALADYAQTIHQLAASSQDMIDHEHPESTRISIRQAQVDKLYAGLKELAGERRERLQEHLRLCQLRRELDDLEQWIQEREVVAASHELGQDYEHVTMLRDKFREFSRDTSTIGQERVDSANALANGLIAGGHAARATVAEWKDSLNEAWADLLELLDTRGQVLAAAYELQRFLHGARQALARVQHKQQQLPDGTGRDLNAAEALQRRHCAYEHDIQALSPQVQQVQDDGHRLQKAYAGDKAEEIGRHMQAVAEAWAQLQGSSAARRQLLLDTTDKFRFFKAVRELMLWMDEVNLQMDAQERPRDVSSADLVIKNQQGIKAEIEARADRFSSCIDMGKELLARSHYAAEEISEKLSQLQARRQETAEKWQEKMDWLQLVLEVLVFGRDAGMAEAWLCSQEPLVRSAELGCTVDEVESLIKRHEAFQKSAVAWEERFCALEKLTAL 2078          

HSP 2 Score: 70.4774 bits (171), Expect = 2.750e-10
Identity = 42/109 (38.53%), Postives = 56/109 (51.38%), Query Frame = 1
Query: 6553 IRGILIRKHEWEYKNRKALNRSWHEFLVVLSIEKNKLLVYKDEKHYNEKPQDTYHKDSGLDLNDLVAAPASDYLKRPFVFRIKITSTGAEYLFQAKDEEDMLRWVNSIN 6879
            + G+L RK E E   +KA NRSW     VL   +  L  YKD K  +      YH +  + L     + A DY KR  VF++ +   G EYLFQAKDE +M  W+  +N
Sbjct: 2221 MEGMLCRKQEMEAFGKKAANRSWQNVYCVL--RRGSLGFYKDAKAASAGV--PYHGEVPVSLARAQGSVAFDYRKRKHVFKLGLQD-GKEYLFQAKDEAEMSSWLRVVN 2324          
BLAST of Spectrin beta chain vs. UniProt/SwissProt
Match: sp|P11277|SPTB1_HUMAN (Spectrin beta chain, erythrocytic OS=Homo sapiens OX=9606 GN=SPTB PE=1 SV=5)

HSP 1 Score: 1565.44 bits (4052), Expect = 0.000e+0
Identity = 876/2064 (42.44%), Postives = 1311/2064 (63.52%), Query Frame = 1
Query:  154 KLYERFRIKALAGEREKVQKKTFTKWINSHLNKLKQSIDDLYNXXXXXXXXXXXXXXXXXXXXPYPTKGKMRIHCLENVDKSLNFLIEQRVHLENMGAHDIVDGNARLTLGLIWTIILRFQIQDIVVEEDDTSEKRQAKDALLLWCQMKTAGYPNTNVRNFSTCWRDGLAFNAIIHRHRPDLLEYSALSRSNPNENLEQAIRIAEEKLGIPRLLDPEDVSVENPDEKSIMTYVVTFYHFFSKMKADSVHSKRVGKILSQSMETEEMMVHYDKLTSNLLEWINQTIELLNDRTFANSLSGVQQQLAAFNTYRVTEKPPKFQEKGNLEMLLFSIQSQMRANNQMPYLPIEGKLISDINNAWNKLDKAEHARELALRDELIRQEKLEQLALRFDRKAGMREAWLTENQRLITQDNFGQDLSAVEAAGKKHEAIKTDILAYEERVNSVTLVTSELENECYHDVERVLCRRDNVIRLWEKLLDMLAVRKLRLDACYKVQKLFQDIKHLLDLINDLKARLKTEDIGRHLMGVEDLIHKHSLLEIDIRMVGTKIEGIMSDAQPFINSEFGLGSGDFQPADPNEVILRTVNLKEEYDNLLELSRNRKDNLSASKVMWEFLWGVADEEQWMKEKIQLMLNPDLGHDLSSVHRLISKHKVIEEDVRNHSNYLQNVIQGGQQLILDKNPGAEKVADXXXXXXXXXXXXXXXXXXRRSKLEQSLAYFHCLADCGEVEIWIIEQVKLVKIDETSINEESIITDIHKHEQLSKSIEDYESNINSLDEQVKKLSEGDLELVTIEEKVSNIKSQYAILIELTNQKQNKLTDTLSLFRVLRKADTVKTWIDEKEKLLMSLIPTDELEELEVFRHRFDGFEKEMNIQADQVEFVNTLAEKLSDMDHPQIADVVNKRFELNKLWNSLADLVEARREQLQTSYEFNQYLLECKQTGEWIREKSRLVESTDELGDDLAGIMQLQRRMGGMQRDMDAIRAKLEHLDEEMDTLIAKRPNXXXXXXXXXXXXXXFWAELGDMLADRDDRLSESSELQRFLQDLDHIHIWLSKMQTTVASEDLPKDLADAEKSLVQHEQLKEEIDSYQDEFIRLLDYGRRITEDKTDAQYMFLSQRLNALEEGWQELCQMWENRXXXXXXXXXXXVFLRDAIQSEVLLAQEENFLSKEDIPISIENSQNLLRKHEGFLTTLQANHDHTIAVIEFGRNLVERGHFCSDKINLRVKSILXXXXXXXXXXXXAYEKLKDQVLYQELSQDIDDLSKWIQEKMIIATDESFREEKNIARRYNRHRAFDEEIQANKDRLCQAIDYAMQIVEERPQLADMIYPQIDSLNQQWEELEQTTFLKGEKMIEANREAIFEEGTMDVMTWLXXXXXXXXXXXXXX--XXXXXXXXKLKKVEEADNEMEIKRKQIQDLKMHAAKLKEEQPEKAFGIEQKHLILEHRFTQLQMPXXXXXXXXXXXXXXXXFLRNLDDQKAWVDDKLLLAESTNFGNNLLTVQQLLRRHRYLATEVNNHKPQLEYLKEEGAVLIEEVSPMQREKFVAGLQELESLWNRLEHSIDLRQQRLKESEATQTFLFDAEEAESWLWEQELFLLSEERGIRDQEAAINVIKKHDARQKTIEDYGEEITKLGTRSRLLIEKDHPQADRIALAQSHVDKVYAGLRDLCLEKKQRLSEIQKLNHLYREIVDLENWIYERTLVASSHDLGVDFEHCCLLRERFDEFFHETHLLGKDRVKAANDLCASLISQCHADSAEIAQWHDRINDSWAELQELMQTRIQLLRTAWEFYKYLSSCQDVLDRICEKIASIPTDVSKDSQSVAIQQRKHATFLSDAQALEGQVQWVVDEANHLLPSYAGQKEWHICERRDDVLATWNQLNMQAERRRHQLEDAADLQRFFSMVRELLQWMDLVALQINEKTRPKDVSGVELLINDHRSIKAEIAAREESMSICVNLGRTLLHRGRVGVDEVRAALINLITRKYSLEDMWEERWDYLQLILEVYQFARDASVAEAWILAQEPYLANKTLGETLDETLSLLKKHINFEKTVMSQEERFEALEKLTTMEIRAKEITK 6339
            +L+ER RIKALA ERE VQKKTFTKW+NSHL ++   I DLY DL+DG+ML+ LLE+LSGE LP PTKGKMRIHCLENVDK+L FL EQRVHLENMG+HDIVDGN RL LGLIWTIILRFQIQDIVV+  +  E R AKDALLLWCQMKTAGYP+ NV NF++ W+DGLAFNA+IH+HRPDL+++  L  SN   NLE A  +AE +LGI  LLDPEDV  ENPDEKSI+TYVV FYH+FSKMK  +V  KRVGK++  ++ETE+M+  Y  L S+LL WI QTI +LN R FANSL+GVQQQL AF+TYR  EKPPKFQEKGNLE+LLF+IQS+MRANNQ  Y P +GKL+SDIN AW  L++AE+ RELALR+ELIRQEKLEQLA RFDRKA MRE WL+ENQRL+ QDNFG DL+AVEAA KKHEAI+TD  AYEERV ++  +  ELE E YHD +R+  R+DN++RLW  L ++L  R+ RL+    +QKLFQD+ H +D ++++KA L + + G+HL+ VEDL+ KH L+E DI + G K++ I +    F       G G +QP DP  +  R  +L++ ++ L  ++  RK  L  SK +W+F W + + E W+KEK Q+  + D G DL+SV  L  KHK  E+++R    +L+ + Q    ++  K  G  ++   +KE+   W++L +L    +  L+ +  +F    D  +++ W+ +  +L+  ++   +E +      KH+   + +E+    +  L++Q +   E   +   +  ++  ++  Y  ++   + +Q +L + L L+ V  + D  + W+ EKEK L  +   D LE+LEV +HRFD  ++EM     Q++ VN  A  L +  HP+  +V   +  LN  W +   LV  RRE + ++   + Y ++C++T +WI +K+++VEST +LG DLAGI+ +QR++ G++RD+ AI+A+++ L+ E   L+   P  +E I + +  LE+ W  L   L  ++D L E S+LQ FLQDLD    WLS  Q  VASED+P+ L +AE+ L QH  +K+EID +QD + R+ + G ++ + +TD +Y+ L QRL  L+ GW  L +MWE+R   L+Q L  Q F +DA Q+E +L+ +E  L+  + P S+E ++  +RK E FL +++ N D  ++ ++ G  LV  G+  SDKI  +V+ I +R   N  ++ EA   L+D +  Q   Q+  +L+ WI +K++ + D S+ E +N+  ++ +H+AF  E+ +++  L        Q+++E+PQ   ++  ++++L++ W+EL+ TT  K + +  A    +  +   D+  W+  + + +   +      ++  +  KLK+VE   +++ ++++++ +L      + EE  +    IE+       RF  L  P+  +K QL   +   Q  R+L+D+  WV+++L LA+S ++G NL TVQ  +++++ L  E+  H P++E + + G  L+ E + +  +     L  L+S W+RL  +   R QRL+++   Q +  DA+EAE+W+ EQEL+++S+E   +D+E AI ++K+H  +Q+ +EDYG  I +L +R++ L+   HP+ ++I   Q  VDK YAGL+D+  E+K++L  +  L  L RE  DLE WI E+ LVASS ++G DF+H  LLR++F +F  ET  +G++RV   N     LI   H+++A IA+W D +N+ WA+L EL+ TR+QLL  +++ ++Y  +  ++L  I EK   +P DV  D+ +     R H  F  +   L  QVQ   D A  L  +YAG+K   I  +  +V A W  L      RR QL D AD  RFFSM R+LL WM+ +  QI  + RP+DVS VELL+  H+ I AEI  R ++ S C+ LG +LL R     +E+R  L  +++R+  + + WE RW+ L+++LEV QF+RDASVAEAW++AQEPYLA+   G T+D    L+K+H  FEK+  S  ERF ALEK TT+E++ ++I +
Sbjct:   38 RLFERSRIKALADEREVVQKKTFTKWVNSHLARVSCRITDLYKDLRDGRMLIKLLEVLSGEMLPKPTKGKMRIHCLENVDKALQFLKEQRVHLENMGSHDIVDGNHRLVLGLIWTIILRFQIQDIVVQTQEGRETRSAKDALLLWCQMKTAGYPHVNVTNFTSSWKDGLAFNALIHKHRPDLIDFDKLKDSNARHNLEHAFNVAERQLGIIPLLDPEDVFTENPDEKSIITYVVAFYHYFSKMKVLAVEGKRVGKVIDHAIETEKMIEKYSGLASDLLTWIEQTITVLNSRKFANSLTGVQQQLQAFSTYRTVEKPPKFQEKGNLEVLLFTIQSRMRANNQKVYTPHDGKLVSDINRAWESLEEAEYRRELALRNELIRQEKLEQLARRFDRKAAMRETWLSENQRLVAQDNFGYDLAAVEAAKKKHEAIETDTAAYEERVRALEDLAQELEKENYHDQKRITARKDNILRLWSYLQELLQSRRQRLETTLALQKLFQDMLHSIDWMDEIKAHLLSAEFGKHLLEVEDLLQKHKLMEADIAIQGDKVKAITAATLKFTE-----GKG-YQPCDPQVIQDRISHLEQCFEELSNMAAGRKAQLEQSKRLWKFFWEMDEAESWIKEKEQIYSSLDYGKDLTSVLILQRKHKAFEDELRGLDAHLEQIFQEAHGMVARKQFGHPQIEARIKEVSAQWDQLKDLAAFCKKNLQDAENFFQFQGDADDLKAWLQDAHRLLSGEDVGQDEGATRALGKKHKDFLEELEESRGVMEHLEQQAQGFPEEFRDSPDVTHRLQALRELYQQVVAQADLRQQRLQEALDLYTVFGETDACELWMGEKEKWLAEMEMPDTLEDLEVVQHRFDILDQEMKTLMTQIDGVNLAANSLVESGHPRSREVKQYQDHLNTRWQAFQTLVSERREAVDSALRVHNYCVDCEETSKWITDKTKVVESTKDLGRDLAGIIAIQRKLSGLERDVAAIQARVDALERESQQLMDSHPEQKEDIGQRQKHLEELWQGLQQSLQGQEDLLGEVSQLQAFLQDLDDFQAWLSITQKAVASEDMPESLPEAEQLLQQHAGIKDEIDGHQDSYQRVKESGEKVIQGQTDPEYLLLGQRLEGLDTGWNALGRMWESRSHTLAQCLGFQEFQKDAKQAEAILSNQEYTLAHLEPPDSLEAAEAGIRKFEDFLGSMENNRDKVLSPVDSGNKLVAEGNLYSDKIKEKVQLIEDRHRKNNEKAQEASVLLRDNLELQNFLQNCQELTLWINDKLLTSQDVSYDEARNLHNKWLKHQAFVAELASHEGWLENIDAEGKQLMDEKPQFTALVSQKLEALHRLWDELQATTKEKTQHLSAARSSDLRLQTHADLNKWISAMEDQLRSDDPGKDLTSVNRMLAKLKRVE---DQVNVRKEELGELFAQVPSMGEEGGDADLSIEK-------RFLDLLEPLGRRKKQLESSRAKLQISRDLEDETLWVEERLPLAQSADYGTNLQTVQLFMKKNQTLQNEILGHTPRVEDVLQRGQQLV-EAAEIDCQDLEERLGHLQSSWDRLREAAAGRLQRLRDANEAQQYYLDADEAEAWIGEQELYVISDEIP-KDEEGAIVMLKRHLRQQRAVEDYGRNIKQLASRAQGLLSAGHPEGEQIIRLQGQVDKHYAGLKDVAEERKRKLENMYHLFQLKRETDDLEQWISEKELVASSPEMGQDFDHVTLLRDKFRDFARETGAIGQERVDNVNAFIERLIDAGHSEAATIAEWKDGLNEMWADLLELIDTRMQLLAASYDLHRYFYTGAEILGLIDEKHRELPEDVGLDASTAESFHRVHTAFERELHLLGVQVQQFQDVATRLQTAYAGEKAEAIQNKEQEVSAAWQALLDACAGRRTQLVDTADKFRFFSMARDLLSWMESIIRQIETQERPRDVSSVELLMKYHQGINAEIETRSKNFSACLELGESLLQRQHQASEEIREKLQQVMSRRKEMNEKWEARWERLRMLLEVCQFSRDASVAEAWLIAQEPYLASGDFGHTVDSVEKLIKRHEAFEKSTASWAERFAALEKPTTLELKERQIAE 2083          

HSP 2 Score: 93.5893 bits (231), Expect = 2.610e-17
Identity = 134/633 (21.17%), Postives = 272/633 (42.97%), Query Frame = 1
Query: 4531 FLRNLDDQKAWVDDKLLLAESTNFGNNLLTVQQLLRRHRYLATEVNNHKPQLEYLKEEGAVLIEEVSPMQREKFVAGLQELESLWNRLEHSIDLRQQRLKESEATQTFLFDAEEAESWLWEQELFLLSEERGIRDQEAAINVIKKHDARQKTIEDYGEEITKLGTRSRLLIEKDH-----PQA--DRIALAQSHVDKVYAGLRDLCLEKKQRLSEIQKLNHLYREIVDLENWIYERTLVASSHDLGVDFEHCCLLRERFDEFFHETHLLGKDRVKAANDLCASLISQCHADSAEIAQWHDRI-------NDSWAELQELMQTRIQLLRTAWEFYKYLSSCQDVLDRI--CEKIASIPTDVSKDSQSVAIQQRKHATFLSDAQALEGQVQWVVDEANHLLPSYAGQKEWHICERRDDVLATWNQLNMQAERRRHQLEDAADLQRFFSMVRELLQWMDLVALQINEKTRPKDVSGVELLINDHRSIKAEIAAREESMSICVNLG-RTLLHRGRVGVDEVRAALINLITRKYSLEDMWEERWDYLQLILEVYQFARDASVAEAWILAQEPYL-ANKTLGETLDETLSLLKKHINFEKTVMSQEERFEALEKLTTMEIRAKEITKESILLKDKHKQE 6375
            F R    ++ W+ +   L    NFG +L  V+   ++H  + T+   ++ ++  L E+ A  +E+ +   +++  A    +  LW+ L+  +  R+QRL+ + A Q    D   +  W+ E +  LLS E G    E   ++++KH   +  I   G+++  +   +    E        PQ   DRI    SH+++ +  L ++   +K +L + ++L   + E+ + E+WI E+  + SS D G D     +L+ +   F        +D ++  +     +  + H   A     H +I       +  W +L++L     + L+ A  F+++     D+   +    ++ S   DV +D  +     +KH  FL + +   G ++ +  +A      +    +  +  R   +   + Q+  QA+ R+ +L++A DL   F        WM      + E   P  +  +E++ +    +  E+      +   VNL   +L+  G     EV+    +L TR  + + +  ER + +   L V+ +  D      WI  +   + + K LG  L   +++ +K    E+ V + + R +ALE+ +   + +    KE I  + KH +E
Sbjct:  427 FDRKAAMRETWLSENQRLVAQDNFGYDLAAVEAAKKKHEAIETDTAAYEERVRAL-EDLAQELEKENYHDQKRITARKDNILRLWSYLQELLQSRRQRLETTLALQKLFQDMLHSIDWMDEIKAHLLSAEFGKHLLEVE-DLLQKHKLMEADIAIQGDKVKAITAATLKFTEGKGYQPCDPQVIQDRI----SHLEQCFEELSNMAAGRKAQLEQSKRLWKFFWEMDEAESWIKEKEQIYSSLDYGKDLTSVLILQRKHKAF--------EDELRGLDAHLEQIFQEAHGMVARKQFGHPQIEARIKEVSAQWDQLKDLAAFCKKNLQDAENFFQFQGDADDLKAWLQDAHRLLS-GEDVGQDEGATRALGKKHKDFLEELEESRGVMEHLEQQAQGFPEEFRDSPD--VTHRLQALRELYQQVVAQADLRQQRLQEALDLYTVFGETDACELWMGEKEKWLAEMEMPDTLEDLEVVQHRFDILDQEMKTLMTQID-GVNLAANSLVESGHPRSREVKQYQDHLNTRWQAFQTLVSERREAVDSALRVHNYCVDCEETSKWITDKTKVVESTKDLGRDLAGIIAIQRKLSGLERDVAAIQARVDALERESQQLMDSHPEQKEDIGQRQKHLEE 1041          
BLAST of Spectrin beta chain vs. TrEMBL
Match: A0A075A6I1 (Spectrin beta chain OS=Opisthorchis viverrini OX=6198 GN=T265_02435 PE=3 SV=1)

HSP 1 Score: 2216.42 bits (5742), Expect = 0.000e+0
Identity = 1169/2288 (51.09%), Postives = 1631/2288 (71.28%), Query Frame = 1
Query:  154 KLYERFRIKALAGEREKVQKKTFTKWINSHLNKLKQSIDDLYNXXXXXXXXXXXXXXXXXXXXPYPTKGKMRIHCLENVDKSLNFLIEQRVHLENMGAHDIVDGNARLTLGLIWTIILRFQIQDIVVEEDDTSEKRQAKDALLLWCQMKTAGYPNTNVRNFSTCWRDGLAFNAIIHRHRPDLLEYSALSRSNPNENLEQAIRIAEEKLGIPRLLDPEDVSVENPDEKSIMTYVVTFYHFFSKMKADSVHSKRVGKILSQSMETEEMMVHYDKLTSNLLEWINQTIELLNDRTFANSLSGVQQQLAAFNTYRVTEKPPKFQEKGNLEMLLFSIQSQMRANNQMPYLPIEGKLISDINNAWNKLDKAEHARELALRDELIRQEKLEQLALRFDRKAGMREAWLTENQRLITQDNFGQDLSAVEAAGKKHEAIKTDILAYEERVNSVTLVTSELENECYHDVERVLCRRDNVIRLWEKLLDMLAVRKLRLDACYKVQKLFQDIKHLLDLINDLKARLKTEDIGRHLMGVEDLIHKHSLLEIDIRMVGTKIEGIMSDAQPFINSEFGLGSGDFQPADPNEVILRTVNLKEEYDNLLELSRNRKDNLSASKVMWEFLWGVADEEQWMKEKIQLMLNPDLGHDLSSVHRLISKHKVIEEDVRNHSNYLQNVIQGGQQLILDKNPGAEKVADXXXXXXXXXXXXXXXXXXRRSKLEQSLAYFHCLADCGEVEIWIIEQVKLVKIDETSINEESIITDIHKHEQLSKSIEDYESNINSLDEQVKKLSE-GDLELVTIEEKVSNIKSQYAILIELTNQKQNKLTDTLSLFRVLRKADTVKTWIDEKEKLLMSLIPTDELEELEVFRHRFDGFEKEMNIQADQVEFVNTLAEKLSDMDHPQIADVVNKRFELNKLWNSLADLVEARREQLQTSYEFNQYLLECKQTGEWIREKSRLVESTDELGDDLAGIMQLQRRMGGMQRDMDAIRAKLEHLDEEMDTLIAKRPNXXXXXXXXXXXXXXFWAELGDMLADRDDRLSESSELQRFLQDLDHIHIWLSKMQTTVASEDLPKDLADAEKSLVQHEQLKEEIDSYQDEFIRLLDYGRRITEDKTDAQYMFLSQRLNALEEGWQELCQMWENRXXXXXXXXXXXVFLRDAIQSEVLLAQEENFLSKEDIPISIENSQNLLRKHEGFLTTLQANHDHTIAVIEFGRNLVERGHFCSDKINLRVKSILXXXXXXXXXXXXAYEKLKDQVLYQELSQDIDDLSKWIQEKMIIATDESFREEKNIARRYNRHRAFDEEIQANKDRLCQAIDYAMQIVEERPQLADMIYPQIDSLNQQWEELEQTTFLKGEKMIEANREAIFEEGTMDVMTWLXXXXXXXXXXXXXXXXX---XXXXXKLKKVEEADNEMEIKRKQIQDLKMHAAKLKEEQPEKAFGIEQKHLILEHRFTQLQMPXXXXXXXXXXXXXXXXFLRNLDDQKAWVDDKLLLAE-STNFGNNLLTVQQLLRRHRYLATEVNNHKPQLEYLKEEGAVLIEEVSPMQREKFVAGLQELESLWNRLEHSIDLRQQRLKESEATQTFLFDAEEAESWLWEQELFLLSEERGIRDQEAAINVIKKHDARQKTIEDYGEEITKLGTRSRLLIEKDHPQADRIALAQSHVDKVYAGLRDLCLEKKQRLSEIQKLNHLYREIVDLENWIYERTLVASSHDLGVDFEHCCLLRERFDEFFHETHLLGKDRVKAANDLCASLISQCHADSAEIAQWHDRINDSWAELQELMQTRIQLLRTAWEFYKYLSSCQDVLDRICEKIASIPTDVSKDSQSVAIQQRKHATFLSDAQALEGQVQWVVDEANHLLPSYAGQKEWHICERRDDVLATWNQLNMQAERRRHQLEDAADLQRFFSMVRELLQWMDLVALQINEKTRPKDVSGVELLINDHRSIKAEIAAREESMSICVNLGRTLLHRGRVGVDEVRAALINLITRKYSLEDMWEERWDYLQLILEVYQFARDASVAEAWILAQEPYLANKTLGETLDETLSLLKKHINFEKTVMSQEERFEALEKLTTMEIRAKEITKESILLKDKHKQERIENAIKIFQ--PPPSPELVHESPKVSISEEDEEGKSHQHKISVISKEAAEMCQSSETKTDIRGILIRKHEWEYKNRKALNRSWHEFLVVLSIEKNKLLVYKDEKHYNEKPQDTYHKDSGLDLNDLVAAPASDYLKRPFVFRIKITSTGAEYLFQAKDEEDMLRWVNSINEN----SQKDLKSETTAPGKSSTLPA-CTSDPHVPSTQA 6981
            KLYER RIKALA ERE VQKKTFTKW+NSHL  +  SI+DLY DL+DGKMLL LLEILSGE+LP PT+GKMRIHCLENVDKSLNFL +Q VHLEN+GAHDIVDG+ RLTLGLIWTIILRFQIQDIVVEE  TSE R AKDALLLWCQMKTAGYPN NVRNF+T WRDGLAFNA+IH+HRPDL+ Y+ALS++ P +NL  A  +AEE+L +  LLDP DV VE PDEKSI+TYVVT+YH+F+KMKAD+VHSKR+GKI++Q++ETE+M+  Y++LTS+LLEWI +TIELLN+RTF+NSLSGVQ QLA FNTYR  +KPPKF+EKG LE+LLF+I+S+MR+NNQ  Y P EGKLISDIN AW +L++AEHARELALRDELIRQEKLEQLA RFDRKAG+REAWLT+NQRL+ QDNFGQDL+AVEAA KKHEAI+TDI AY+ERVN++  V  ELE E YHD+ERV  RRDNV+ LW  L+  L +R+ RLD   ++Q +FQ++ +L+D I ++K RL++ D G+HLMGVEDLI KH+L+E DIR++G ++E ++  A PFI   F    G ++P +P+ V  R   L+  Y+ L +L   R   L  SK MW+F W + DE++W+KEK QLM +PDLGHDLSSV RL+ KHK IEED   H   LQN ++ G +LI + N G E++  +++E++ LW++L++ T +R+ +L +S  +F  LADC + ++W+ EQ + V  ++  +   +  + +  ++++  ++ +Y+  I+ L +Q   +S+  D +  TI  ++  +   YA ++ L   +Q +L D L+++++   +DTV+TWI EKE+LL +L+P+DEL ELEV RHRF+ FE+E+   A++VE VN L+E +   DHP  + ++ ++  LN  WN LADLV+ R+ QL  +Y++NQ+L+E  +T  WI+EK++LVESTDELG+DL+GIMQLQRR+GG+QRD+ AI AK+EHLD++ + L   +P    ++  ER  + + W EL +ML DRDDRL+ SSELQRFLQDLDH  +WL + QT VASED+P +L +AE  +  H+QL  EID Y+ +F RL+D+GRR TE KTDAQY +L++RL+ +EE W  L  M+  R  +LSQ++    F RDA+Q++++LA+ E  ++KE+ P S+E ++  LR+ +    ++  N +    V+  G++L++R  F  +K+  + + +  RRES K+R+ E  E L++Q+  Q+  Q++DD+ +W+ EK +  T++     KNIA  Y R +AF+ E+ ANKD++   I     +++  P L   I P+I++L +QW ELE T   K  KM +ANRE +F+E    +MTW+  +   I+ T E+V       ++N  LK  +  D E++ KR+ ++D+  HA KLKE+ P++    EQ H  +  R T+L+ P+ +++ +L+++KR++QFLR+++D+K W+ DKL L E S+  GN+LL  QQLLRRHR LA EV NH+P+++ + +EG  +I+E  P + ++F   + EL  LW +LE  +  R Q+L E+E  Q +LFDA EAE+W+ EQEL+L+ EER  +D++ A N +K+H+  QK +E+Y  EI  LG RSR ++E +HP+A+ +A+ Q+ VDK+YAGLR+LC+E++ RL EI KL  L R+I+DLE WI ER  VASSH+LG D+EHCCLLRERF EF  ET  LG+ R+ AAN+LC +LI Q H ++AEIA W DR+N++WA+L EL+ TRIQLL+TAW+ +K+LS CQDVLDRI EK +SIP +V +D+++VA  QRKHATF  D   L  QV+ +++ AN LLPSYAG KE  IC+RRD+V+  W QL    E+R+  L DAAD+ RFF+MVREL  WM+ +  ++  K +P+DVSG++LL+N+HRS+KAEI AREE+ SIC++LGRTLL+R     +EVR   I L+T +  L D W ERW+ LQL+LEVYQFARDA VAEAW++AQEPYLA+K LGETLDETL+LLKKH+ FE+   +QEERF AL+KLTT+E++A+E T E+   +   K+ RI  AI+ FQ  P      V E+ +V++   DE  +    ++    K A +   S     D  G+L RKHEW+   +KA +RSWH+   VLS  +  L  YK+++   EKP + Y  ++ ++L    AAPA +Y KR FVFR+K+ + G E LFQA+ +E M  WV +IN        + ++S + A G+++TLP+    +P   S+ A
Sbjct:   51 KLYERSRIKALADEREIVQKKTFTKWVNSHLVVVSCSIEDLYLDLRDGKMLLKLLEILSGERLPPPTRGKMRIHCLENVDKSLNFLCDQHVHLENVGAHDIVDGSPRLTLGLIWTIILRFQIQDIVVEEQMTSETRCAKDALLLWCQMKTAGYPNVNVRNFTTSWRDGLAFNALIHKHRPDLINYAALSKAEPMKNLTNAFSVAEERLHLTPLLDPSDVCVEQPDEKSIITYVVTYYHYFNKMKADTVHSKRIGKIVNQAIETEDMINQYEQLTSDLLEWIEKTIELLNNRTFSNSLSGVQHQLAGFNTYRTADKPPKFEEKGGLEVLLFTIRSRMRSNNQAIYNPPEGKLISDINRAWEELERAEHARELALRDELIRQEKLEQLASRFDRKAGLREAWLTDNQRLVAQDNFGQDLAAVEAATKKHEAIETDIYAYQERVNAMVNVAEELERENYHDLERVQLRRDNVLALWGNLISSLTLRRHRLDLSLQLQHVFQEMSYLMDWIEEIKGRLRSTDYGKHLMGVEDLIQKHALIEADIRVLGGRMEQVLQQADPFITCAFPQEVGSYRPIEPDVVQERGRELRAAYEELHDLKDARLQGLQDSKKMWQFFWDMEDEKEWIKEKSQLMSSPDLGHDLSSVGRLLRKHKAIEEDSTVHLGVLQNALKNGDKLIEEGNLGKEQIEQHMREMKQLWDQLVDQTADRKQRLMESQEFFQLLADCDDADVWLAEQQRTVSNEDVGLKLATTESLLKNNQEIMDNLNEYQKTIDQLHQQAATVSDYPDCDAATIGSRLDAVDRHYADVVGLCKLRQQRLLDALAMYKLFDVSDTVRTWITEKERLLTTLVPSDEL-ELEVIRHRFECFERELTANAEKVESVNKLSEGMLVTDHPDGSKILAQQDTLNASWNQLADLVDNRKRQLDLAYQYNQFLIESAETANWIKEKAKLVESTDELGNDLSGIMQLQRRLGGLQRDLKAIEAKVEHLDKQAEELCQAKPEQANVVSAERAKIHELWDELKEMLKDRDDRLNYSSELQRFLQDLDHFQMWLRRTQTDVASEDIPNNLQEAEALVDNHKQLGAEIDGYEADFHRLMDFGRRETEGKTDAQYEYLAKRLDLIEEDWDALHNMYAKRGEILSQNVEAHTFFRDALQADIVLAKLEQAVAKEETPTSLEAAEENLRQWDVLEASILKNDERIDHVLAQGQDLIDRKIFPVEKMQAKCEQLASRRESLKKRAAERKEALEEQLHLQQFCQEVDDVEEWLTEKAVAVTEQPTPLAKNIALLYGRFKAFEGELDANKDKIADVIKEGQVLMQSHPMLEAQIQPRIEALQRQWVELETTAADKSAKMADANRETLFDETAKSMMTWITEVRTQIVTTTEDVTEEIGLVELNEHLKDQDRKDQELQSKRRMLEDMATHAEKLKEQYPDRQEEFEQVHQEVRIRLTELEAPLASRREKLLKQKRVRQFLRDIEDEKDWIKDKLALIEDSSKMGNSLLAAQQLLRRHRMLANEVENHRPRIDSVCQEGEQMIQEGHP-RSDRFRKAIDELWDLWGQLEEVVSSRHQKLLENEVAQQYLFDASEAEAWMGEQELYLMGEERA-KDEQGANNAMKRHEQLQKVVENYSAEIRNLGERSRAMLEANHPEAEAVAIKQARVDKMYAGLRELCVERRARLEEILKLYSLLRDILDLEAWIAERIAVASSHELGADYEHCCLLRERFAEFARETSELGRHRIGAANELCDALIDQGHGEAAEIAGWKDRVNEAWADLLELIDTRIQLLKTAWDLHKFLSDCQDVLDRIAEKASSIPEEVGRDAKAVAALQRKHATFEYDLSRLGSQVEGIIEAANGLLPSYAGDKERLICDRRDEVIHAWRQLQCSTEQRKIHLLDAADVHRFFAMVRELRMWMETMRTEMATKEKPRDVSGIDLLMNNHRSLKAEIDAREENFSICLSLGRTLLNRRHPREEEVREKCIQLVTERIQLIDQWTERWETLQLLLEVYQFARDAEVAEAWLMAQEPYLASKDLGETLDETLALLKKHLAFERAAATQEERFIALQKLTTLELKARERTPETEAARRAEKERRIAEAIREFQPPPTLPTVPVTEAEQVTL---DERTREIVGQVPSTPKRARDSKDSGRPPRDFEGLLTRKHEWQSGGKKAPSRSWHDLYFVLSASQGTLSAYKEQRLAKEKPGELYRHETPVNLAGASAAPAFNYTKRRFVFRLKL-ANGGETLFQARSDESMHEWVQAINAVVASLPAEQVESTSGAGGRAATLPSGAQPEPQPGSSSA 2331          
BLAST of Spectrin beta chain vs. TrEMBL
Match: A0A419PFY3 (Spectrin beta chain OS=Clonorchis sinensis OX=79923 GN=beta-Spec PE=3 SV=1)

HSP 1 Score: 2216.42 bits (5742), Expect = 0.000e+0
Identity = 1167/2288 (51.01%), Postives = 1632/2288 (71.33%), Query Frame = 1
Query:  154 KLYERFRIKALAGEREKVQKKTFTKWINSHLNKLKQSIDDLYNXXXXXXXXXXXXXXXXXXXXPYPTKGKMRIHCLENVDKSLNFLIEQRVHLENMGAHDIVDGNARLTLGLIWTIILRFQIQDIVVEEDDTSEKRQAKDALLLWCQMKTAGYPNTNVRNFSTCWRDGLAFNAIIHRHRPDLLEYSALSRSNPNENLEQAIRIAEEKLGIPRLLDPEDVSVENPDEKSIMTYVVTFYHFFSKMKADSVHSKRVGKILSQSMETEEMMVHYDKLTSNLLEWINQTIELLNDRTFANSLSGVQQQLAAFNTYRVTEKPPKFQEKGNLEMLLFSIQSQMRANNQMPYLPIEGKLISDINNAWNKLDKAEHARELALRDELIRQEKLEQLALRFDRKAGMREAWLTENQRLITQDNFGQDLSAVEAAGKKHEAIKTDILAYEERVNSVTLVTSELENECYHDVERVLCRRDNVIRLWEKLLDMLAVRKLRLDACYKVQKLFQDIKHLLDLINDLKARLKTEDIGRHLMGVEDLIHKHSLLEIDIRMVGTKIEGIMSDAQPFINSEFGLGSGDFQPADPNEVILRTVNLKEEYDNLLELSRNRKDNLSASKVMWEFLWGVADEEQWMKEKIQLMLNPDLGHDLSSVHRLISKHKVIEEDVRNHSNYLQNVIQGGQQLILDKNPGAEKVADXXXXXXXXXXXXXXXXXXRRSKLEQSLAYFHCLADCGEVEIWIIEQVKLVKIDETSINEESIITDIHKHEQLSKSIEDYESNINSLDEQVKKLSE-GDLELVTIEEKVSNIKSQYAILIELTNQKQNKLTDTLSLFRVLRKADTVKTWIDEKEKLLMSLIPTDELEELEVFRHRFDGFEKEMNIQADQVEFVNTLAEKLSDMDHPQIADVVNKRFELNKLWNSLADLVEARREQLQTSYEFNQYLLECKQTGEWIREKSRLVESTDELGDDLAGIMQLQRRMGGMQRDMDAIRAKLEHLDEEMDTLIAKRPNXXXXXXXXXXXXXXFWAELGDMLADRDDRLSESSELQRFLQDLDHIHIWLSKMQTTVASEDLPKDLADAEKSLVQHEQLKEEIDSYQDEFIRLLDYGRRITEDKTDAQYMFLSQRLNALEEGWQELCQMWENRXXXXXXXXXXXVFLRDAIQSEVLLAQEENFLSKEDIPISIENSQNLLRKHEGFLTTLQANHDHTIAVIEFGRNLVERGHFCSDKINLRVKSILXXXXXXXXXXXXAYEKLKDQVLYQELSQDIDDLSKWIQEKMIIATDESFREEKNIARRYNRHRAFDEEIQANKDRLCQAIDYAMQIVEERPQLADMIYPQIDSLNQQWEELEQTTFLKGEKMIEANREAIFEEGTMDVMTWLXXXXXXXXXXXXXXXXX---XXXXXKLKKVEEADNEMEIKRKQIQDLKMHAAKLKEEQPEKAFGIEQKHLILEHRFTQLQMPXXXXXXXXXXXXXXXXFLRNLDDQKAWVDDKLLLAE-STNFGNNLLTVQQLLRRHRYLATEVNNHKPQLEYLKEEGAVLIEEVSPMQREKFVAGLQELESLWNRLEHSIDLRQQRLKESEATQTFLFDAEEAESWLWEQELFLLSEERGIRDQEAAINVIKKHDARQKTIEDYGEEITKLGTRSRLLIEKDHPQADRIALAQSHVDKVYAGLRDLCLEKKQRLSEIQKLNHLYREIVDLENWIYERTLVASSHDLGVDFEHCCLLRERFDEFFHETHLLGKDRVKAANDLCASLISQCHADSAEIAQWHDRINDSWAELQELMQTRIQLLRTAWEFYKYLSSCQDVLDRICEKIASIPTDVSKDSQSVAIQQRKHATFLSDAQALEGQVQWVVDEANHLLPSYAGQKEWHICERRDDVLATWNQLNMQAERRRHQLEDAADLQRFFSMVRELLQWMDLVALQINEKTRPKDVSGVELLINDHRSIKAEIAAREESMSICVNLGRTLLHRGRVGVDEVRAALINLITRKYSLEDMWEERWDYLQLILEVYQFARDASVAEAWILAQEPYLANKTLGETLDETLSLLKKHINFEKTVMSQEERFEALEKLTTMEIRAKEITKESILLKDKHKQERIENAIKIFQ--PPPSPELVHESPKVSISEEDEEGKSHQHKISVISKEAAEMCQSSETKTDIRGILIRKHEWEYKNRKALNRSWHEFLVVLSIEKNKLLVYKDEKHYNEKPQDTYHKDSGLDLNDLVAAPASDYLKRPFVFRIKITSTGAEYLFQAKDEEDMLRWVNSINEN----SQKDLKSETTAPGKSSTLPA-CTSDPHVPSTQA 6981
            KLYER RIKALA ERE VQKKTFTKW+NSHL  +  SI+DLY DL+DGKMLL LLEILSGE+LP PT+GKMRIHCLENVDKSLNFL +Q VHLEN+GAHDIVDG+ RLTLGLIWTIILRFQIQDIVVEE  TSE R AKDALLLWCQMKTAGYPN NVRNF+T WRDGLAFNA+IH+HRPDL+ Y+ALS++ P +NL  A  +AEE+L +  LLDP DV VE PDEKSI+TYVVT+YH+F+KMKAD+VHSKR+GKI++Q++ETE+M+  Y++LTS+LLEWI +TIELLN+RTF+NSLSGVQ QLA FNTYR  +KPPKF+EKG LE+LLF+I+S+MR+NNQ  Y P EGKLISDIN AW +L++AEHARELALRDELIRQEKLEQLA RFDRKAG+REAWLT+NQRL+ QDNFGQDL+AVEAA KKHEAI+TDI AY+ERVN++  V  ELE E YHD+ERV  RRDNV+ LW  L+  L +R+ RLD   ++Q +FQ++ +L+D I ++K RL++ D G+HLMGVEDLI KH+L+E DIR++G ++E ++  A PFI   F    G ++P +P+ V  R   L+  Y+ L +L   R   L  SK MW+F W + DE++W+KEK QLM +PDLGHDLSSV RL+ KHK IEED   H   LQN ++ G +LI + N G E++  +++E++ LW++L++ T +R+ +L +S  +F  LADC + ++W+ EQ + V  ++  +   +  + +  ++++  ++++Y   I+ L +Q   +S+  D +  TI  ++  +   YA ++ L   +Q +L D L+++++   +DTV+TWI EKE+LL +L+P+DEL ELEV RHRF+ FE+E+   A++VE VN L+E +   DHP  + ++ ++  LN  WN LADLV+ R+ QL  +Y++NQ+L+E  +T  WI+EK++LVESTDELG+DL+GIMQLQRR+GG+QRD+ AI AK+ HLD++ + L   +P    ++  ER  + + W EL +ML DRDDRL+ SSELQRFLQDLDH  +WL + QT VASED+P +L +AE  + +H+QL  EID Y+ +F RL+D+GRR TE KTDAQY +L++RL+ +EE W  L  M++ R  +LSQ++    F RDA+Q++++LA+ E  ++K++ P S+E ++  LR+ +    ++  N +    V+  G++L++R  F  +K+  + + +  RR+S K+R+ E  E L++Q+  Q+  Q++DD+ +W+ EK +  T++     KNIA  Y R +AF+ E+ ANKD++   I     +++  P L   I P+I++L +QW ELE T   K  KM +ANRE +F+E    +MTW+  +   I+ T E+V       ++N  LK  +  D E++ KR+ ++D+  HA KLKE+ P++    EQ H  +  R T+L+ P+ +++ +L+++KR++QFLR+++D+K W+ DKL L E S+  GN+LL  QQLLRRHR LA EV NH+P+++ + +EG  +I+E  P + ++F   + EL  LW +LE  +  R Q+L E+E  Q +LFDA EAE+W+ EQEL+L+ EER  +D++ A N +K+H+  QK +E+Y  EI  LG RSR ++E +HP+A+ +A+ Q+ VDK+YAGLR+LC+E++ RL EI KL  L R+I+DLE WI ER  VASSH+LG D+EHCCLLRERF EF  ET  LG+ R+ AAN+LC +LI Q H ++AEIA W DR+N++WA+L EL+ TRIQLL+TAW+ +K+LS CQDVLDRI EK +SIP +V +D+++VA  QRKHATF  D   L  QV+ +++ AN LLPSYAG KE  IC+RRD+V+  W QL    E+R+  L DAAD+ RFF+MVREL  WM+ +  ++  K +P+DVSG++LL+N+HRS+KAEI AREE+ SIC++LGRTLL+R     +EVR   I L+T +  L D W ERW+ LQL+LEVYQFARDA VAEAW++AQEPYLA+K LGETLDETL+LLKKH+ FE+   +QEERF AL+KLTT+E++A+E T E+   +   K+ RI  AI+ FQ  P      V E+ +V++   DE  +    ++    K A +   S     D  G+L RKHEW+   +KA +RSWH+   VLS  +  L  YK+++   EKP + Y  ++ ++L    AAPA +Y KR FVFR+K+ + G E LFQA+ +E M  WV +IN        + L+S + A G+++TLP+    +P   S+ A
Sbjct:   37 KLYERSRIKALADEREIVQKKTFTKWVNSHLVVVSCSIEDLYLDLRDGKMLLKLLEILSGERLPPPTRGKMRIHCLENVDKSLNFLCDQHVHLENVGAHDIVDGSPRLTLGLIWTIILRFQIQDIVVEEQMTSETRCAKDALLLWCQMKTAGYPNVNVRNFTTSWRDGLAFNALIHKHRPDLINYAALSKAEPMKNLTNAFSVAEERLHLTPLLDPSDVCVEQPDEKSIITYVVTYYHYFNKMKADTVHSKRIGKIVNQAIETEDMINQYEQLTSDLLEWIEKTIELLNNRTFSNSLSGVQHQLAGFNTYRTADKPPKFEEKGGLEVLLFTIRSRMRSNNQAIYNPPEGKLISDINRAWEELERAEHARELALRDELIRQEKLEQLASRFDRKAGLREAWLTDNQRLVAQDNFGQDLAAVEAATKKHEAIETDIYAYQERVNAMVNVAEELERENYHDLERVQLRRDNVLGLWGNLISSLTLRRHRLDLSLQLQHVFQEMSYLMDWIEEIKGRLRSTDYGKHLMGVEDLIQKHALIEADIRVLGGRMEQVLQQADPFITCAFPQEVGSYRPIEPDVVQERGRELRAAYEELHDLKDARLQGLQDSKKMWQFFWDMEDEKEWIKEKSQLMSSPDLGHDLSSVGRLLRKHKAIEEDSTVHLGVLQNALKNGDKLIEEGNLGKEQIEQHMREMKQLWDQLVDQTADRKQRLMESQEFFQLLADCDDADVWLAEQQRSVSNEDVGLKLATTESLLKNNQEIMDNLDEYRKTIDQLHQQAATVSDYPDCDAATIASRLDAVDRHYADVVGLCKLRQQRLLDALAMYKLFDVSDTVRTWITEKERLLTTLVPSDEL-ELEVIRHRFECFERELTANAEKVESVNKLSEGMLGTDHPDGSKILAQQDTLNASWNQLADLVDTRKRQLDLAYQYNQFLIESAETANWIKEKAKLVESTDELGNDLSGIMQLQRRLGGLQRDLKAIEAKVAHLDKQAEELCQAKPEQANVVSAERAKIHELWDELKEMLKDRDDRLNYSSELQRFLQDLDHFQMWLRRTQTDVASEDIPNNLQEAEALVDKHKQLGAEIDGYEADFHRLMDFGRRETEGKTDAQYEYLAKRLDLIEEDWDALHNMYDKRGEILSQNVEAHTFFRDALQADIVLAKLEQAVAKDETPTSLEAAEENLRQWDVLEASILKNDERIDHVLAQGQDLIDRKIFPVEKMQAKCEQLASRRDSLKKRAAERKEALEEQLHLQQFCQEVDDVEEWLTEKAVAVTEQPTPLAKNIALLYGRFKAFEGELDANKDKIADVIKEGQVLMQSHPMLEAQIQPRIEALQRQWVELETTAADKSAKMADANRETLFDETAKSMMTWITEVRTQIVTTTEDVTEEIGLVELNEHLKDQDRKDQELQSKRRMLEDMATHAEKLKEQYPDRQEEFEQVHQEVRIRLTELEAPLASRREKLLKQKRVRQFLRDIEDEKDWIKDKLALIEDSSKMGNSLLAAQQLLRRHRMLANEVENHRPRIDSVCQEGEQMIQEGHP-RSDRFRKAIDELWDLWGQLEEVVSSRHQKLLENEVAQQYLFDASEAEAWMGEQELYLMGEERA-KDEQGANNAMKRHEQLQKVVENYSTEIRNLGERSRAMLEANHPEAEAVAIKQARVDKMYAGLRELCVERRARLEEILKLYSLLRDILDLEAWIAERIAVASSHELGADYEHCCLLRERFAEFARETSELGRHRIGAANELCDALIDQGHGEAAEIAGWKDRVNEAWADLLELIDTRIQLLKTAWDLHKFLSDCQDVLDRIAEKASSIPEEVGRDAKAVAALQRKHATFEYDLSRLGSQVEGIIEAANGLLPSYAGDKERLICDRRDEVIHAWRQLQCSTEQRKVHLLDAADVHRFFAMVRELRMWMETMRTEMATKEKPRDVSGIDLLMNNHRSLKAEIDAREENFSICLSLGRTLLNRRHPREEEVREKCIQLVTERIQLIDQWTERWETLQLLLEVYQFARDAEVAEAWLMAQEPYLASKDLGETLDETLALLKKHLAFERAAATQEERFIALQKLTTLELKARERTPETEAARRAEKERRIAEAIREFQPPPTLPTVPVTEAEQVTL---DERTREIIGQVPSTPKRARDSKDSGRPPRDFEGLLTRKHEWQSGGKKAPSRSWHDLYFVLSASQGTLSAYKEQRLAKEKPGELYRHETPVNLAGASAAPAFNYTKRRFVFRLKL-ANGGETLFQARSDESMHEWVQAINAVVANLPAEQLESTSGAGGRAATLPSGAQPEPQPGSSSA 2317          
BLAST of Spectrin beta chain vs. TrEMBL
Match: A0A4S2LQ90 (Spectrin beta chain OS=Opisthorchis felineus OX=147828 GN=CRM22_007109 PE=3 SV=1)

HSP 1 Score: 2215.27 bits (5739), Expect = 0.000e+0
Identity = 1168/2288 (51.05%), Postives = 1632/2288 (71.33%), Query Frame = 1
Query:  154 KLYERFRIKALAGEREKVQKKTFTKWINSHLNKLKQSIDDLYNXXXXXXXXXXXXXXXXXXXXPYPTKGKMRIHCLENVDKSLNFLIEQRVHLENMGAHDIVDGNARLTLGLIWTIILRFQIQDIVVEEDDTSEKRQAKDALLLWCQMKTAGYPNTNVRNFSTCWRDGLAFNAIIHRHRPDLLEYSALSRSNPNENLEQAIRIAEEKLGIPRLLDPEDVSVENPDEKSIMTYVVTFYHFFSKMKADSVHSKRVGKILSQSMETEEMMVHYDKLTSNLLEWINQTIELLNDRTFANSLSGVQQQLAAFNTYRVTEKPPKFQEKGNLEMLLFSIQSQMRANNQMPYLPIEGKLISDINNAWNKLDKAEHARELALRDELIRQEKLEQLALRFDRKAGMREAWLTENQRLITQDNFGQDLSAVEAAGKKHEAIKTDILAYEERVNSVTLVTSELENECYHDVERVLCRRDNVIRLWEKLLDMLAVRKLRLDACYKVQKLFQDIKHLLDLINDLKARLKTEDIGRHLMGVEDLIHKHSLLEIDIRMVGTKIEGIMSDAQPFINSEFGLGSGDFQPADPNEVILRTVNLKEEYDNLLELSRNRKDNLSASKVMWEFLWGVADEEQWMKEKIQLMLNPDLGHDLSSVHRLISKHKVIEEDVRNHSNYLQNVIQGGQQLILDKNPGAEKVADXXXXXXXXXXXXXXXXXXRRSKLEQSLAYFHCLADCGEVEIWIIEQVKLVKIDETSINEESIITDIHKHEQLSKSIEDYESNINSLDEQVKKLSE-GDLELVTIEEKVSNIKSQYAILIELTNQKQNKLTDTLSLFRVLRKADTVKTWIDEKEKLLMSLIPTDELEELEVFRHRFDGFEKEMNIQADQVEFVNTLAEKLSDMDHPQIADVVNKRFELNKLWNSLADLVEARREQLQTSYEFNQYLLECKQTGEWIREKSRLVESTDELGDDLAGIMQLQRRMGGMQRDMDAIRAKLEHLDEEMDTLIAKRPNXXXXXXXXXXXXXXFWAELGDMLADRDDRLSESSELQRFLQDLDHIHIWLSKMQTTVASEDLPKDLADAEKSLVQHEQLKEEIDSYQDEFIRLLDYGRRITEDKTDAQYMFLSQRLNALEEGWQELCQMWENRXXXXXXXXXXXVFLRDAIQSEVLLAQEENFLSKEDIPISIENSQNLLRKHEGFLTTLQANHDHTIAVIEFGRNLVERGHFCSDKINLRVKSILXXXXXXXXXXXXAYEKLKDQVLYQELSQDIDDLSKWIQEKMIIATDESFREEKNIARRYNRHRAFDEEIQANKDRLCQAIDYAMQIVEERPQLADMIYPQIDSLNQQWEELEQTTFLKGEKMIEANREAIFEEGTMDVMTWLXXXXXXXXXXXXXXXXX---XXXXXKLKKVEEADNEMEIKRKQIQDLKMHAAKLKEEQPEKAFGIEQKHLILEHRFTQLQMPXXXXXXXXXXXXXXXXFLRNLDDQKAWVDDKLLLAE-STNFGNNLLTVQQLLRRHRYLATEVNNHKPQLEYLKEEGAVLIEEVSPMQREKFVAGLQELESLWNRLEHSIDLRQQRLKESEATQTFLFDAEEAESWLWEQELFLLSEERGIRDQEAAINVIKKHDARQKTIEDYGEEITKLGTRSRLLIEKDHPQADRIALAQSHVDKVYAGLRDLCLEKKQRLSEIQKLNHLYREIVDLENWIYERTLVASSHDLGVDFEHCCLLRERFDEFFHETHLLGKDRVKAANDLCASLISQCHADSAEIAQWHDRINDSWAELQELMQTRIQLLRTAWEFYKYLSSCQDVLDRICEKIASIPTDVSKDSQSVAIQQRKHATFLSDAQALEGQVQWVVDEANHLLPSYAGQKEWHICERRDDVLATWNQLNMQAERRRHQLEDAADLQRFFSMVRELLQWMDLVALQINEKTRPKDVSGVELLINDHRSIKAEIAAREESMSICVNLGRTLLHRGRVGVDEVRAALINLITRKYSLEDMWEERWDYLQLILEVYQFARDASVAEAWILAQEPYLANKTLGETLDETLSLLKKHINFEKTVMSQEERFEALEKLTTMEIRAKEITKESILLKDKHKQERIENAIKIFQ--PPPSPELVHESPKVSISEEDEEGKSHQHKISVISKEAAEMCQSSETKTDIRGILIRKHEWEYKNRKALNRSWHEFLVVLSIEKNKLLVYKDEKHYNEKPQDTYHKDSGLDLNDLVAAPASDYLKRPFVFRIKITSTGAEYLFQAKDEEDMLRWVNSINEN----SQKDLKSETTAPGKSSTLPA-CTSDPHVPSTQA 6981
            KLYER RIKALA ERE VQKKTFTKW+NSHL  +  SI+DLY DL+DGKMLL LLEILSGE+LP PT+GKMRIHCLENVDKSLNFL +Q VHLEN+GAHDIVDG+ RLTLGLIWTIILRFQIQDIVVEE  TSE R AKDALLLWCQMKTAGYPN NVRNF+T WRDGLAFNA+IH+HRPDL+ Y+ALS++ P +NL  A  +AEE+L +  LLDP DV VE PDEKSI+TYVVT+YH+F+KMKAD+VHSKR+GKI++Q++ETE+M+  Y++LTS+LLEWI +TIELLN+RTF+NSLSGVQ QLA FNTYR  +KPPKF+EKG LE+LLF+I+S+MR+NNQ  Y P EGKLISDIN AW +L++AEHARELALRDELIRQEKLEQLA RFDRKAG+REAWLT+NQRL+ QDNFGQDL+AVEAA KKHEAI+TDI AY+ERVN++  V  ELE E YHD+ERV  RRDNV+ LW  L+  L +R+ RLD   ++Q +FQ++ +L+D I ++K RL++ D G+HLMGVEDLI KH+L+E DIR++G ++E ++  A PFI   F    G ++P +P+ V  R   L+  Y+ L +L   R   L  SK MW+F W + DE++W+KEK QLM +PDLGHDLSSV RL+ KHK IEED   H   LQN ++ G +LI + N G E++  +++E++ LW++L++ T +R+ +L +S  +F  LADC + ++W+ EQ + V  ++  +   +  + +  ++++  ++++Y+  I+ L +Q   +S+  D +  TI  ++  +   YA ++ L   +Q +L D L+++++   +DTV+TWI EKE+LL +L+P+DEL ELEV RHRF+ FE+E+   A++VE VN L+E +   DHP  + ++ ++  LN  WN LADLV+ R+ QL  +Y++NQ+L+E  +T  WI+EK++LVESTDELG+DL+GIMQLQRR+GG+QRD+ AI AK+EHLD + + L   +P    ++  ER  + + W EL +ML DRDDRL+ SSELQRFLQDLDH  +WL + QT VASED+P +L +AE  + +H+QL  EID Y+ +F RL+D+GRR TE KTDAQY +L++RL+ +EE W  L  M+  R  +LSQ++    F RDA+Q++++LA+ E  ++K++ P S+E ++  LR+ +    ++  + +    V+  G++L++R  F  +K+  + + +  RRES K+R+ E  E L++Q+  Q+  Q++DD+ +W+ EK +  T++     KNIA  Y R +AF+ E+ ANKD++   I     +++  P L   I P+I++L +QW ELE T   K  KM +ANRE +F+E    +MTW+  +   I+ T E+V       ++N  LK  +  D E++ KR+ ++D+  HA KLKE+ P++    EQ H  +  R T+L+ P+ +++ +L+++KR++QFLR+++D+K W+ DKL L E S+  GN+LL  QQLLRRHR LA EV NH+P+++ + +EG  +I+E  P + ++F   + EL  LW +LE  +  R Q+L E+E  Q +LFDA EAE+W+ EQEL+L+ EER  +D++ A N +K+H+  QK +E+Y  EI  LG RSR ++E +HP+A+ +A+ Q+ VDK+YAGLR+LC+E++ RL EI KL  L R+I+DLE WI ER  VASSH+LG D+EHCCLLRERF EF  ET  LG+ R+ AAN+LC +LI Q H ++AEIA W DR+N++WA+L EL+ TRIQLL+TAW+ +K+LS CQDVLDRI EK +SIP +V +D+++VA  QRKHATF  D   L  QV+ +++ AN LLPSYAG KE  IC+RRD+V+  W QL    E+R+  L DAAD+ RFF+MVREL  WM+ +  ++  K +P+DVSG++LL+N+HRS+KAEI AREE+ SIC++LGRTLL+R     +EVR   I L+T +  L D W ERW+ LQL+LEVYQFARDA VAEAW++AQEPYLA+K LGETLDETL+LLKKH+ FE+   +QEERF AL+KLTT+E++A+E T E+   +   K+ RI  AI+ FQ  P      V E+ +V++   DE  +    ++    K A +   S     D  G+L RKHEW+   +KA +RSWH+   VLS  +  L  YK+++   EKP + Y  ++ ++L    AAPA +Y KR FVFR+K+ + G E LFQA+ +E M  WV +IN        + L+S + A G+++TLP+    +P   S+ A
Sbjct:   37 KLYERSRIKALADEREIVQKKTFTKWVNSHLVVVSCSIEDLYLDLRDGKMLLKLLEILSGERLPPPTRGKMRIHCLENVDKSLNFLCDQHVHLENVGAHDIVDGSPRLTLGLIWTIILRFQIQDIVVEEQMTSETRCAKDALLLWCQMKTAGYPNVNVRNFTTSWRDGLAFNALIHKHRPDLINYAALSKAEPMKNLTNAFSVAEERLHLTPLLDPSDVCVEQPDEKSIITYVVTYYHYFNKMKADTVHSKRIGKIVNQAIETEDMINQYEQLTSDLLEWIEKTIELLNNRTFSNSLSGVQHQLAGFNTYRTADKPPKFEEKGGLEVLLFTIRSRMRSNNQAIYNPPEGKLISDINRAWEELERAEHARELALRDELIRQEKLEQLASRFDRKAGLREAWLTDNQRLVAQDNFGQDLAAVEAATKKHEAIETDIYAYQERVNAMVNVAEELERENYHDLERVQLRRDNVLALWGNLISSLTLRRHRLDLSLQLQHVFQEMSYLMDWIEEIKGRLRSTDYGKHLMGVEDLIQKHALIEADIRVLGGRMEQVLQQADPFITCAFPQEVGSYRPIEPDIVQERGRELRAAYEELHDLKDARLQGLQDSKKMWQFFWDMEDEKEWIKEKSQLMSSPDLGHDLSSVGRLLRKHKAIEEDSTVHLGVLQNALKNGDKLIEEGNLGKEQIEQHMREMKQLWDQLVDQTADRKQRLMESQEFFQLLADCDDADVWLAEQQRSVSNEDVGLKLATTESLLKNNQEIMDNLDEYQKTIDQLHQQAATVSDYPDCDAATIASRLDAVDRHYADVVGLCKLRQQRLLDALAMYKLFDVSDTVRTWITEKERLLTTLVPSDEL-ELEVIRHRFECFERELTANAEKVESVNKLSEGMLGTDHPDGSKILAQQDTLNASWNQLADLVDNRKRQLDLAYQYNQFLIESAETANWIKEKAKLVESTDELGNDLSGIMQLQRRLGGLQRDLKAIEAKVEHLDNQAEELCQAKPEQANVVSAERAKIHELWDELKEMLKDRDDRLNYSSELQRFLQDLDHFQMWLRRTQTDVASEDIPNNLQEAEALVDKHKQLGAEIDGYEADFHRLMDFGRRETEGKTDAQYEYLAKRLDLIEEDWDALHNMYAKRGEILSQNVEAHTFFRDALQADIVLAKLEQAVAKDETPTSLEAAEENLRQWDVLEASILKSDERIDHVLAQGQDLIDRKIFPVEKMQAKCEQLASRRESLKKRAAERKEALEEQLHLQQFCQEVDDVEEWLTEKAVAVTEQPTPLAKNIALLYGRFKAFEGELDANKDKIADVIKEGQVLMQSHPMLEAQIQPRIEALQRQWVELETTAADKSAKMADANRETLFDETAKSMMTWITEVRTQIVTTTEDVTEEIGLVELNEHLKDQDRKDQELQSKRRMLEDMATHAEKLKEQYPDRQEEFEQVHQEVRIRLTELEAPLASRRDKLLKQKRVRQFLRDIEDEKDWIKDKLALIEDSSKMGNSLLAAQQLLRRHRMLANEVENHRPRIDSVCQEGEQMIQEGHP-RSDRFRKAIDELWDLWGQLEEVVSSRHQKLLENEVAQQYLFDASEAEAWMGEQELYLMGEERA-KDEQGANNAMKRHEQLQKVVENYSTEIRNLGERSRAMLEANHPEAEAVAIKQARVDKMYAGLRELCVERRARLEEILKLYSLLRDILDLEAWIAERIAVASSHELGADYEHCCLLRERFAEFARETSELGRHRIGAANELCDALIDQGHGEAAEIAGWKDRVNEAWADLLELIDTRIQLLKTAWDLHKFLSDCQDVLDRIAEKASSIPEEVGRDAKAVAALQRKHATFEYDLSRLGSQVEGIIEAANGLLPSYAGDKERLICDRRDEVIHAWRQLQCSTEQRKVHLLDAADVHRFFAMVRELRMWMEAMRTEMATKEKPRDVSGIDLLMNNHRSLKAEIDAREENFSICLSLGRTLLNRRHPREEEVREKCIQLVTERIQLIDQWTERWETLQLLLEVYQFARDAEVAEAWLMAQEPYLASKDLGETLDETLALLKKHLAFERAAATQEERFIALQKLTTLELKARERTPETEAARRAEKERRIAEAIREFQPPPTLPTVPVTEAEQVTL---DERTREIVGQVPSTPKRARDSKDSGRPPRDFEGLLTRKHEWQSGGKKAPSRSWHDLYFVLSASQGTLSAYKEQRLAKEKPGELYRHETPVNLAGASAAPAFNYTKRRFVFRLKL-ANGGETLFQARSDESMHEWVQAINAVVANLPAEQLESTSGAGGRAATLPSGAQPEPQPGSSSA 2317          
BLAST of Spectrin beta chain vs. TrEMBL
Match: A0A4S2LQP2 (Spectrin beta chain OS=Opisthorchis felineus OX=147828 GN=CRM22_007109 PE=3 SV=1)

HSP 1 Score: 2215.27 bits (5739), Expect = 0.000e+0
Identity = 1168/2288 (51.05%), Postives = 1632/2288 (71.33%), Query Frame = 1
Query:  154 KLYERFRIKALAGEREKVQKKTFTKWINSHLNKLKQSIDDLYNXXXXXXXXXXXXXXXXXXXXPYPTKGKMRIHCLENVDKSLNFLIEQRVHLENMGAHDIVDGNARLTLGLIWTIILRFQIQDIVVEEDDTSEKRQAKDALLLWCQMKTAGYPNTNVRNFSTCWRDGLAFNAIIHRHRPDLLEYSALSRSNPNENLEQAIRIAEEKLGIPRLLDPEDVSVENPDEKSIMTYVVTFYHFFSKMKADSVHSKRVGKILSQSMETEEMMVHYDKLTSNLLEWINQTIELLNDRTFANSLSGVQQQLAAFNTYRVTEKPPKFQEKGNLEMLLFSIQSQMRANNQMPYLPIEGKLISDINNAWNKLDKAEHARELALRDELIRQEKLEQLALRFDRKAGMREAWLTENQRLITQDNFGQDLSAVEAAGKKHEAIKTDILAYEERVNSVTLVTSELENECYHDVERVLCRRDNVIRLWEKLLDMLAVRKLRLDACYKVQKLFQDIKHLLDLINDLKARLKTEDIGRHLMGVEDLIHKHSLLEIDIRMVGTKIEGIMSDAQPFINSEFGLGSGDFQPADPNEVILRTVNLKEEYDNLLELSRNRKDNLSASKVMWEFLWGVADEEQWMKEKIQLMLNPDLGHDLSSVHRLISKHKVIEEDVRNHSNYLQNVIQGGQQLILDKNPGAEKVADXXXXXXXXXXXXXXXXXXRRSKLEQSLAYFHCLADCGEVEIWIIEQVKLVKIDETSINEESIITDIHKHEQLSKSIEDYESNINSLDEQVKKLSE-GDLELVTIEEKVSNIKSQYAILIELTNQKQNKLTDTLSLFRVLRKADTVKTWIDEKEKLLMSLIPTDELEELEVFRHRFDGFEKEMNIQADQVEFVNTLAEKLSDMDHPQIADVVNKRFELNKLWNSLADLVEARREQLQTSYEFNQYLLECKQTGEWIREKSRLVESTDELGDDLAGIMQLQRRMGGMQRDMDAIRAKLEHLDEEMDTLIAKRPNXXXXXXXXXXXXXXFWAELGDMLADRDDRLSESSELQRFLQDLDHIHIWLSKMQTTVASEDLPKDLADAEKSLVQHEQLKEEIDSYQDEFIRLLDYGRRITEDKTDAQYMFLSQRLNALEEGWQELCQMWENRXXXXXXXXXXXVFLRDAIQSEVLLAQEENFLSKEDIPISIENSQNLLRKHEGFLTTLQANHDHTIAVIEFGRNLVERGHFCSDKINLRVKSILXXXXXXXXXXXXAYEKLKDQVLYQELSQDIDDLSKWIQEKMIIATDESFREEKNIARRYNRHRAFDEEIQANKDRLCQAIDYAMQIVEERPQLADMIYPQIDSLNQQWEELEQTTFLKGEKMIEANREAIFEEGTMDVMTWLXXXXXXXXXXXXXXXXX---XXXXXKLKKVEEADNEMEIKRKQIQDLKMHAAKLKEEQPEKAFGIEQKHLILEHRFTQLQMPXXXXXXXXXXXXXXXXFLRNLDDQKAWVDDKLLLAE-STNFGNNLLTVQQLLRRHRYLATEVNNHKPQLEYLKEEGAVLIEEVSPMQREKFVAGLQELESLWNRLEHSIDLRQQRLKESEATQTFLFDAEEAESWLWEQELFLLSEERGIRDQEAAINVIKKHDARQKTIEDYGEEITKLGTRSRLLIEKDHPQADRIALAQSHVDKVYAGLRDLCLEKKQRLSEIQKLNHLYREIVDLENWIYERTLVASSHDLGVDFEHCCLLRERFDEFFHETHLLGKDRVKAANDLCASLISQCHADSAEIAQWHDRINDSWAELQELMQTRIQLLRTAWEFYKYLSSCQDVLDRICEKIASIPTDVSKDSQSVAIQQRKHATFLSDAQALEGQVQWVVDEANHLLPSYAGQKEWHICERRDDVLATWNQLNMQAERRRHQLEDAADLQRFFSMVRELLQWMDLVALQINEKTRPKDVSGVELLINDHRSIKAEIAAREESMSICVNLGRTLLHRGRVGVDEVRAALINLITRKYSLEDMWEERWDYLQLILEVYQFARDASVAEAWILAQEPYLANKTLGETLDETLSLLKKHINFEKTVMSQEERFEALEKLTTMEIRAKEITKESILLKDKHKQERIENAIKIFQ--PPPSPELVHESPKVSISEEDEEGKSHQHKISVISKEAAEMCQSSETKTDIRGILIRKHEWEYKNRKALNRSWHEFLVVLSIEKNKLLVYKDEKHYNEKPQDTYHKDSGLDLNDLVAAPASDYLKRPFVFRIKITSTGAEYLFQAKDEEDMLRWVNSINEN----SQKDLKSETTAPGKSSTLPA-CTSDPHVPSTQA 6981
            KLYER RIKALA ERE VQKKTFTKW+NSHL  +  SI+DLY DL+DGKMLL LLEILSGE+LP PT+GKMRIHCLENVDKSLNFL +Q VHLEN+GAHDIVDG+ RLTLGLIWTIILRFQIQDIVVEE  TSE R AKDALLLWCQMKTAGYPN NVRNF+T WRDGLAFNA+IH+HRPDL+ Y+ALS++ P +NL  A  +AEE+L +  LLDP DV VE PDEKSI+TYVVT+YH+F+KMKAD+VHSKR+GKI++Q++ETE+M+  Y++LTS+LLEWI +TIELLN+RTF+NSLSGVQ QLA FNTYR  +KPPKF+EKG LE+LLF+I+S+MR+NNQ  Y P EGKLISDIN AW +L++AEHARELALRDELIRQEKLEQLA RFDRKAG+REAWLT+NQRL+ QDNFGQDL+AVEAA KKHEAI+TDI AY+ERVN++  V  ELE E YHD+ERV  RRDNV+ LW  L+  L +R+ RLD   ++Q +FQ++ +L+D I ++K RL++ D G+HLMGVEDLI KH+L+E DIR++G ++E ++  A PFI   F    G ++P +P+ V  R   L+  Y+ L +L   R   L  SK MW+F W + DE++W+KEK QLM +PDLGHDLSSV RL+ KHK IEED   H   LQN ++ G +LI + N G E++  +++E++ LW++L++ T +R+ +L +S  +F  LADC + ++W+ EQ + V  ++  +   +  + +  ++++  ++++Y+  I+ L +Q   +S+  D +  TI  ++  +   YA ++ L   +Q +L D L+++++   +DTV+TWI EKE+LL +L+P+DEL ELEV RHRF+ FE+E+   A++VE VN L+E +   DHP  + ++ ++  LN  WN LADLV+ R+ QL  +Y++NQ+L+E  +T  WI+EK++LVESTDELG+DL+GIMQLQRR+GG+QRD+ AI AK+EHLD + + L   +P    ++  ER  + + W EL +ML DRDDRL+ SSELQRFLQDLDH  +WL + QT VASED+P +L +AE  + +H+QL  EID Y+ +F RL+D+GRR TE KTDAQY +L++RL+ +EE W  L  M+  R  +LSQ++    F RDA+Q++++LA+ E  ++K++ P S+E ++  LR+ +    ++  + +    V+  G++L++R  F  +K+  + + +  RRES K+R+ E  E L++Q+  Q+  Q++DD+ +W+ EK +  T++     KNIA  Y R +AF+ E+ ANKD++   I     +++  P L   I P+I++L +QW ELE T   K  KM +ANRE +F+E    +MTW+  +   I+ T E+V       ++N  LK  +  D E++ KR+ ++D+  HA KLKE+ P++    EQ H  +  R T+L+ P+ +++ +L+++KR++QFLR+++D+K W+ DKL L E S+  GN+LL  QQLLRRHR LA EV NH+P+++ + +EG  +I+E  P + ++F   + EL  LW +LE  +  R Q+L E+E  Q +LFDA EAE+W+ EQEL+L+ EER  +D++ A N +K+H+  QK +E+Y  EI  LG RSR ++E +HP+A+ +A+ Q+ VDK+YAGLR+LC+E++ RL EI KL  L R+I+DLE WI ER  VASSH+LG D+EHCCLLRERF EF  ET  LG+ R+ AAN+LC +LI Q H ++AEIA W DR+N++WA+L EL+ TRIQLL+TAW+ +K+LS CQDVLDRI EK +SIP +V +D+++VA  QRKHATF  D   L  QV+ +++ AN LLPSYAG KE  IC+RRD+V+  W QL    E+R+  L DAAD+ RFF+MVREL  WM+ +  ++  K +P+DVSG++LL+N+HRS+KAEI AREE+ SIC++LGRTLL+R     +EVR   I L+T +  L D W ERW+ LQL+LEVYQFARDA VAEAW++AQEPYLA+K LGETLDETL+LLKKH+ FE+   +QEERF AL+KLTT+E++A+E T E+   +   K+ RI  AI+ FQ  P      V E+ +V++   DE  +    ++    K A +   S     D  G+L RKHEW+   +KA +RSWH+   VLS  +  L  YK+++   EKP + Y  ++ ++L    AAPA +Y KR FVFR+K+ + G E LFQA+ +E M  WV +IN        + L+S + A G+++TLP+    +P   S+ A
Sbjct:   42 KLYERSRIKALADEREIVQKKTFTKWVNSHLVVVSCSIEDLYLDLRDGKMLLKLLEILSGERLPPPTRGKMRIHCLENVDKSLNFLCDQHVHLENVGAHDIVDGSPRLTLGLIWTIILRFQIQDIVVEEQMTSETRCAKDALLLWCQMKTAGYPNVNVRNFTTSWRDGLAFNALIHKHRPDLINYAALSKAEPMKNLTNAFSVAEERLHLTPLLDPSDVCVEQPDEKSIITYVVTYYHYFNKMKADTVHSKRIGKIVNQAIETEDMINQYEQLTSDLLEWIEKTIELLNNRTFSNSLSGVQHQLAGFNTYRTADKPPKFEEKGGLEVLLFTIRSRMRSNNQAIYNPPEGKLISDINRAWEELERAEHARELALRDELIRQEKLEQLASRFDRKAGLREAWLTDNQRLVAQDNFGQDLAAVEAATKKHEAIETDIYAYQERVNAMVNVAEELERENYHDLERVQLRRDNVLALWGNLISSLTLRRHRLDLSLQLQHVFQEMSYLMDWIEEIKGRLRSTDYGKHLMGVEDLIQKHALIEADIRVLGGRMEQVLQQADPFITCAFPQEVGSYRPIEPDIVQERGRELRAAYEELHDLKDARLQGLQDSKKMWQFFWDMEDEKEWIKEKSQLMSSPDLGHDLSSVGRLLRKHKAIEEDSTVHLGVLQNALKNGDKLIEEGNLGKEQIEQHMREMKQLWDQLVDQTADRKQRLMESQEFFQLLADCDDADVWLAEQQRSVSNEDVGLKLATTESLLKNNQEIMDNLDEYQKTIDQLHQQAATVSDYPDCDAATIASRLDAVDRHYADVVGLCKLRQQRLLDALAMYKLFDVSDTVRTWITEKERLLTTLVPSDEL-ELEVIRHRFECFERELTANAEKVESVNKLSEGMLGTDHPDGSKILAQQDTLNASWNQLADLVDNRKRQLDLAYQYNQFLIESAETANWIKEKAKLVESTDELGNDLSGIMQLQRRLGGLQRDLKAIEAKVEHLDNQAEELCQAKPEQANVVSAERAKIHELWDELKEMLKDRDDRLNYSSELQRFLQDLDHFQMWLRRTQTDVASEDIPNNLQEAEALVDKHKQLGAEIDGYEADFHRLMDFGRRETEGKTDAQYEYLAKRLDLIEEDWDALHNMYAKRGEILSQNVEAHTFFRDALQADIVLAKLEQAVAKDETPTSLEAAEENLRQWDVLEASILKSDERIDHVLAQGQDLIDRKIFPVEKMQAKCEQLASRRESLKKRAAERKEALEEQLHLQQFCQEVDDVEEWLTEKAVAVTEQPTPLAKNIALLYGRFKAFEGELDANKDKIADVIKEGQVLMQSHPMLEAQIQPRIEALQRQWVELETTAADKSAKMADANRETLFDETAKSMMTWITEVRTQIVTTTEDVTEEIGLVELNEHLKDQDRKDQELQSKRRMLEDMATHAEKLKEQYPDRQEEFEQVHQEVRIRLTELEAPLASRRDKLLKQKRVRQFLRDIEDEKDWIKDKLALIEDSSKMGNSLLAAQQLLRRHRMLANEVENHRPRIDSVCQEGEQMIQEGHP-RSDRFRKAIDELWDLWGQLEEVVSSRHQKLLENEVAQQYLFDASEAEAWMGEQELYLMGEERA-KDEQGANNAMKRHEQLQKVVENYSTEIRNLGERSRAMLEANHPEAEAVAIKQARVDKMYAGLRELCVERRARLEEILKLYSLLRDILDLEAWIAERIAVASSHELGADYEHCCLLRERFAEFARETSELGRHRIGAANELCDALIDQGHGEAAEIAGWKDRVNEAWADLLELIDTRIQLLKTAWDLHKFLSDCQDVLDRIAEKASSIPEEVGRDAKAVAALQRKHATFEYDLSRLGSQVEGIIEAANGLLPSYAGDKERLICDRRDEVIHAWRQLQCSTEQRKVHLLDAADVHRFFAMVRELRMWMEAMRTEMATKEKPRDVSGIDLLMNNHRSLKAEIDAREENFSICLSLGRTLLNRRHPREEEVREKCIQLVTERIQLIDQWTERWETLQLLLEVYQFARDAEVAEAWLMAQEPYLASKDLGETLDETLALLKKHLAFERAAATQEERFIALQKLTTLELKARERTPETEAARRAEKERRIAEAIREFQPPPTLPTVPVTEAEQVTL---DERTREIVGQVPSTPKRARDSKDSGRPPRDFEGLLTRKHEWQSGGKKAPSRSWHDLYFVLSASQGTLSAYKEQRLAKEKPGELYRHETPVNLAGASAAPAFNYTKRRFVFRLKL-ANGGETLFQARSDESMHEWVQAINAVVANLPAEQLESTSGAGGRAATLPSGAQPEPQPGSSSA 2322          
BLAST of Spectrin beta chain vs. TrEMBL
Match: A0A1S8X3X0 (Spectrin beta chain OS=Opisthorchis viverrini OX=6198 GN=X801_02770 PE=3 SV=1)

HSP 1 Score: 2211.42 bits (5729), Expect = 0.000e+0
Identity = 1166/2288 (50.96%), Postives = 1629/2288 (71.20%), Query Frame = 1
Query:  154 KLYERFRIKALAGEREKVQKKTFTKWINSHLNKLKQSIDDLYNXXXXXXXXXXXXXXXXXXXXPYPTKGKMRIHCLENVDKSLNFLIEQRVHLENMGAHDIVDGNARLTLGLIWTIILRFQIQDIVVEEDDTSEKRQAKDALLLWCQMKTAGYPNTNVRNFSTCWRDGLAFNAIIHRHRPDLLEYSALSRSNPNENLEQAIRIAEEKLGIPRLLDPEDVSVENPDEKSIMTYVVTFYHFFSKMKADSVHSKRVGKILSQSMETEEMMVHYDKLTSNLLEWINQTIELLNDRTFANSLSGVQQQLAAFNTYRVTEKPPKFQEKGNLEMLLFSIQSQMRANNQMPYLPIEGKLISDINNAWNKLDKAEHARELALRDELIRQEKLEQLALRFDRKAGMREAWLTENQRLITQDNFGQDLSAVEAAGKKHEAIKTDILAYEERVNSVTLVTSELENECYHDVERVLCRRDNVIRLWEKLLDMLAVRKLRLDACYKVQKLFQDIKHLLDLINDLKARLKTEDIGRHLMGVEDLIHKHSLLEIDIRMVGTKIEGIMSDAQPFINSEFGLGSGDFQPADPNEVILRTVNLKEEYDNLLELSRNRKDNLSASKVMWEFLWGVADEEQWMKEKIQLMLNPDLGHDLSSVHRLISKHKVIEEDVRNHSNYLQNVIQGGQQLILDKNPGAEKVADXXXXXXXXXXXXXXXXXXRRSKLEQSLAYFHCLADCGEVEIWIIEQVKLVKIDETSINEESIITDIHKHEQLSKSIEDYESNINSLDEQVKKLSE-GDLELVTIEEKVSNIKSQYAILIELTNQKQNKLTDTLSLFRVLRKADTVKTWIDEKEKLLMSLIPTDELEELEVFRHRFDGFEKEMNIQADQVEFVNTLAEKLSDMDHPQIADVVNKRFELNKLWNSLADLVEARREQLQTSYEFNQYLLECKQTGEWIREKSRLVESTDELGDDLAGIMQLQRRMGGMQRDMDAIRAKLEHLDEEMDTLIAKRPNXXXXXXXXXXXXXXFWAELGDMLADRDDRLSESSELQRFLQDLDHIHIWLSKMQTTVASEDLPKDLADAEKSLVQHEQLKEEIDSYQDEFIRLLDYGRRITEDKTDAQYMFLSQRLNALEEGWQELCQMWENRXXXXXXXXXXXVFLRDAIQSEVLLAQEENFLSKEDIPISIENSQNLLRKHEGFLTTLQANHDHTIAVIEFGRNLVERGHFCSDKINLRVKSILXXXXXXXXXXXXAYEKLKDQVLYQELSQDIDDLSKWIQEKMIIATDESFREEKNIARRYNRHRAFDEEIQANKDRLCQAIDYAMQIVEERPQLADMIYPQIDSLNQQWEELEQTTFLKGEKMIEANREAIFEEGTMDVMTWLXXXXXXXXXXXXXXXXX---XXXXXKLKKVEEADNEMEIKRKQIQDLKMHAAKLKEEQPEKAFGIEQKHLILEHRFTQLQMPXXXXXXXXXXXXXXXXFLRNLDDQKAWVDDKLLLAE-STNFGNNLLTVQQLLRRHRYLATEVNNHKPQLEYLKEEGAVLIEEVSPMQREKFVAGLQELESLWNRLEHSIDLRQQRLKESEATQTFLFDAEEAESWLWEQELFLLSEERGIRDQEAAINVIKKHDARQKTIEDYGEEITKLGTRSRLLIEKDHPQADRIALAQSHVDKVYAGLRDLCLEKKQRLSEIQKLNHLYREIVDLENWIYERTLVASSHDLGVDFEHCCLLRERFDEFFHETHLLGKDRVKAANDLCASLISQCHADSAEIAQWHDRINDSWAELQELMQTRIQLLRTAWEFYKYLSSCQDVLDRICEKIASIPTDVSKDSQSVAIQQRKHATFLSDAQALEGQVQWVVDEANHLLPSYAGQKEWHICERRDDVLATWNQLNMQAERRRHQLEDAADLQRFFSMVRELLQWMDLVALQINEKTRPKDVSGVELLINDHRSIKAEIAAREESMSICVNLGRTLLHRGRVGVDEVRAALINLITRKYSLEDMWEERWDYLQLILEVYQFARDASVAEAWILAQEPYLANKTLGETLDETLSLLKKHINFEKTVMSQEERFEALEKLTTMEIRAKEITKESILLKDKHKQERIENAIKIFQ--PPPSPELVHESPKVSISEEDEEGKSHQHKISVISKEAAEMCQSSETKTDIRGILIRKHEWEYKNRKALNRSWHEFLVVLSIEKNKLLVYKDEKHYNEKPQDTYHKDSGLDLNDLVAAPASDYLKRPFVFRIKITSTGAEYLFQAKDEEDMLRWVNSINEN----SQKDLKSETTAPGKSSTLPA-CTSDPHVPSTQA 6981
            KLYER RIKALA ERE VQKKTFTKW+NSHL  +  SI+DLY DL+DGKMLL LLEILSGE+LP PT+GKMRIHCLENVDKSLNFL +Q VHLEN+GAHDIVDG+ RLTLGLIWTIILRFQIQDIVVEE  TSE R AKDALLLWCQMKTAGYPN NVRNF+T WRDGLAFNA+IH+HRPDL+ Y+ALS++ P +NL  A  +AEE+L +  LLDP DV VE PDEKSI+TYVVT+YH+F+KMKAD+VHSKR+GKI++Q++ETE+M+  Y++LTS+LLEWI +TIELLN+RTF+NSLSGVQ QLA FNTYR  +KPPKF+EKG LE+LLF+I+S+MR+NNQ  Y P EGKLISDIN AW +L++AEHARELALRDELIRQEKLEQLA RF RKAG+REAWLT+NQRL+ QDNFGQDL+AVEAA KKH+AI+T I AY+ERVN++  V  ELE E YHD+ERV  RRDNV+ LW  L+  L +R+ RLD   ++Q +FQ++ +L+D I ++K RL++ D G+HLMGVEDLI KH+L+E DIR++G ++E ++  A PFI   F    G ++P +P+ V  R   L+  Y+ L +L   R   L  SK MW+F W + DE++W+KEK QLM +PDLGHDLSSV RL+ KHK IEED   H   LQN ++ G +LI + N G E++  +++E++ LW++L++ T +R+ +L +S  +F  LADC + ++W+ EQ + V  ++  +   +  + +  ++++  ++ +Y+  I+ L +Q   +S+  D +  TI  ++  +   YA ++ L   +Q +L D L+++++   +DTV+TWI EKE+LL +L+P+DEL ELEV RHRF+ FE+E+   A++VE VN L+E +   DHP  + ++ ++  LN  WN LADLV+ R+ QL  +Y++NQ+L+E  +T  WI+EK++LVESTDELG+DL+GIMQLQRR+GG+QRD+ AI AK+EHLD++ + L   +P    ++  ER  + + W EL +ML DRDDRL+ SSELQRFLQDLDH  +WL + QT VASED+P +L +AE  +  H+QL  EID Y+ +F RL+D+GRR TE KTDAQY +L++RL+ +EE W  L  M+  R  +LSQ++    F RDA+Q++++LA+ E  ++KE+ P S+E ++  LR+ +    ++  N +    V+  G++L++R  F  +K+  + + +  RRES K+R+ E  E L++Q+  Q+  Q++DD+ +W+ EK +  T++     KNIA  Y R +AF+ E+ ANKD++   I     +++  P L   I P+I++L +QW ELE T   K  KM +ANRE +F+E    +MTW+  +   I+ T E+V       ++N  LK  +  D E++ KR+ ++D+  HA KLKE+ P++    EQ H  +  R T+L+ P+ +++ +L+++KR++QFLR+++D+K W+ DKL L E S+  GN+LL  QQLLRRHR LA EV NH+P+++ + +EG  +I+E  P + ++F   + EL  LW +LE  +  R Q+L E+E  Q +LFDA EAE+W+ EQEL+L+ EER  +D++ A N +K+H+  QK +E+Y  EI  LG RSR ++E +HP+A+ +A+ Q+ VDK+YAGLR+LC+E++ RL EI KL  L R+I+DLE WI ER  VASSH+LG D+EHCCLLRERF EF  ET  LG+ R+ AAN+LC +LI Q H ++AEIA W DR+N++WA+L EL+ TRIQLL+TAW+ +K+LS CQDVLDRI EK +SIP +V +D+++VA  QRKHATF  D   L  QV+ +++ AN LLPSYAG KE  IC+RRD+V+  W QL    E+R+  L DAAD+ RFF+MVREL  WM+ +  ++  K +P+DVSG++LL+N+HRS+KAEI AREE+ SIC++LGRTLL+R     +EVR   I L+T +  L D W ERW+ LQL+LEVYQFARDA VAEAW++AQEPYLA+K LGETLDETL+LLKKH+ FE+   +QEERF AL+KLTT+E++A+E T E+   +   K+ RI  AI+ FQ  P      V E+ +V++   DE  +    ++    K A +   S     D  G+L RKHEW+   +KA +RSWH+   VLS  +  L  YK+++   EKP + Y  ++ ++L    AAPA +Y KR FVFR+K+ + G E LFQA+ +E M  WV +IN        + ++S + A G+++TLP+    +P   S+ A
Sbjct:   37 KLYERSRIKALADEREIVQKKTFTKWVNSHLVVVSCSIEDLYLDLRDGKMLLKLLEILSGERLPPPTRGKMRIHCLENVDKSLNFLCDQHVHLENVGAHDIVDGSPRLTLGLIWTIILRFQIQDIVVEEQMTSETRCAKDALLLWCQMKTAGYPNVNVRNFTTSWRDGLAFNALIHKHRPDLINYAALSKAEPMKNLTNAFSVAEERLHLTPLLDPSDVCVEQPDEKSIITYVVTYYHYFNKMKADTVHSKRIGKIVNQAIETEDMINQYEQLTSDLLEWIEKTIELLNNRTFSNSLSGVQHQLAGFNTYRTADKPPKFEEKGGLEVLLFTIRSRMRSNNQAIYNPPEGKLISDINRAWEELERAEHARELALRDELIRQEKLEQLASRFGRKAGLREAWLTDNQRLVAQDNFGQDLAAVEAATKKHDAIETSIYAYQERVNAMVNVAEELERENYHDLERVQLRRDNVLALWGNLISSLTLRRHRLDLSLQLQHVFQEMSYLMDWIEEIKGRLRSTDYGKHLMGVEDLIQKHALIEADIRVLGGRMEQVLQQADPFITCAFPQEVGSYRPIEPDVVQERGRELRAAYEELHDLKDARLQGLQDSKKMWQFFWDMEDEKEWIKEKSQLMSSPDLGHDLSSVGRLLRKHKAIEEDSTVHLGVLQNALKNGDKLIEEGNLGKEQIEQHMREMKQLWDQLVDQTADRKQRLMESQEFFQLLADCDDADVWLAEQQRTVSNEDVGLKLATTESLLKNNQEIMDNLNEYQKTIDQLHQQAATVSDYPDCDAATIGSRLDAVDRHYADVVGLCKLRQQRLLDALAMYKLFDVSDTVRTWITEKERLLTTLVPSDEL-ELEVIRHRFECFERELTANAEKVESVNKLSEGMLVTDHPDGSKILAQQDTLNASWNQLADLVDNRKRQLDLAYQYNQFLIESAETANWIKEKAKLVESTDELGNDLSGIMQLQRRLGGLQRDLKAIEAKVEHLDKQAEELCQAKPEQANVVSAERAKIHELWDELKEMLKDRDDRLNYSSELQRFLQDLDHFQMWLRRTQTDVASEDIPNNLQEAEALVDNHKQLGAEIDGYEADFHRLMDFGRRETEGKTDAQYEYLAKRLDLIEEDWDALHNMYAKRGEILSQNVEAHTFFRDALQADIVLAKLEQAVAKEETPTSLEAAEENLRQWDVLEASILKNDERIDHVLAQGQDLIDRKIFPVEKMQAKCEQLASRRESLKKRAAERKEALEEQLHLQQFCQEVDDVEEWLTEKAVAVTEQPTPLAKNIALLYGRFKAFEGELDANKDKIADVIKEGQVLMQSHPMLEAQIQPRIEALQRQWVELETTAADKSAKMADANRETLFDETAKSMMTWITEVRTQIVTTTEDVTEEIGLVELNEHLKDQDRKDQELQSKRRMLEDMATHAEKLKEQYPDRQEEFEQVHQEVRIRLTELEAPLASRREKLLKQKRVRQFLRDIEDEKDWIKDKLALIEDSSKMGNSLLAAQQLLRRHRMLANEVENHRPRIDSVCQEGEQMIQEGHP-RSDRFRKAIDELWDLWGQLEEVVSSRHQKLLENEVAQQYLFDASEAEAWMGEQELYLMGEERA-KDEQGANNAMKRHEQLQKVVENYSAEIRNLGERSRAMLEANHPEAEAVAIKQARVDKMYAGLRELCVERRARLEEILKLYSLLRDILDLEAWIAERIAVASSHELGADYEHCCLLRERFAEFARETSELGRHRIGAANELCDALIDQGHGEAAEIAGWKDRVNEAWADLLELIDTRIQLLKTAWDLHKFLSDCQDVLDRIAEKASSIPEEVGRDAKAVAALQRKHATFEYDLSRLGSQVEGIIEAANGLLPSYAGDKERLICDRRDEVIHAWRQLQCSTEQRKIHLLDAADVHRFFAMVRELRMWMETMRTEMATKEKPRDVSGIDLLMNNHRSLKAEIDAREENFSICLSLGRTLLNRRHPREEEVREKCIQLVTERIQLIDQWTERWETLQLLLEVYQFARDAEVAEAWLMAQEPYLASKDLGETLDETLALLKKHLAFERAAATQEERFIALQKLTTLELKARERTPETEAARRAEKERRIAEAIREFQPPPTLPTVPVTEAEQVTL---DERTREIVGQVPSTPKRARDSKDSGRPPRDFEGLLTRKHEWQSGGKKAPSRSWHDLYFVLSASQGTLSAYKEQRLAKEKPGELYRHETPVNLAGASAAPAFNYTKRRFVFRLKL-ANGGETLFQARSDESMHEWVQAINAVVASLPAEQVESTSGAGGRAATLPSGAQPEPQPGSSSA 2317          
BLAST of Spectrin beta chain vs. Ensembl Cavefish
Match: ENSAMXT00000030945.1 (spectrin beta chain, non-erythrocytic 1-like [Source:NCBI gene;Acc:103033421])

HSP 1 Score: 1848.94 bits (4788), Expect = 0.000e+0
Identity = 1009/2290 (44.06%), Postives = 1509/2290 (65.90%), Query Frame = 1
Query:  154 KLYERFRIKALAGEREKVQKKTFTKWINSHLNKLKQSIDDLYNXXXXXXXXXXXXXXXXXXXXPYPTKGKMRIHCLENVDKSLNFLIEQRVHLENMGAHDIVDGNARLTLGLIWTIILRFQIQDIVVEEDDTSEKRQAKDALLLWCQMKTAGYPNTNVRNFSTCWRDGLAFNAIIHRHRPDLLEYSALSRSNPNENLEQAIRIAEEKLGIPRLLDPEDVSVENPDEKSIMTYVVTFYHFFSKMKADSVHSKRVGKILSQSMETEEMMVHYDKLTSNLLEWINQTIELLNDRTFANSLSGVQQQLAAFNTYRVTEKPPKFQEKGNLEMLLFSIQSQMRANNQMPYLPIEGKLISDINNAWNKLDKAEHARELALRDELIRQEKLEQLALRFDRKAGMREAWLTENQRLITQDNFGQDLSAVEAAGKKHEAIKTDILAYEERVNSVTLVTSELENECYHDVERVLCRRDNVIRLWEKLLDMLAVRKLRLDACYKVQKLFQDIKHLLDLINDLKARLKTEDIGRHLMGVEDLIHKHSLLEIDIRMVGTKIEGIMSDAQPFINSEFGLGSGDFQPADPNEVILRTVNLKEEYDNLLELSRNRKDNLSASKVMWEFLWGVADEEQWMKEKIQLMLNPDLGHDLSSVHRLISKHKVIEEDVRNHSNYLQNVIQGGQQLILDKNPGAEKVADXXXXXXXXXXXXXXXXXXRRSKLEQSLAYFHCLADCGEVEIWIIEQVKLVKIDETSINEESIITDIHKHEQLSKSIEDYESNINSLDEQVKKLSEGDLELVTIEEKVSNIKSQYAILIELTNQKQNKLTDTLSLFRVLRKADTVKTWIDEKEKLLMSLIPTDELEELEVFRHRFDGFEKEMNIQADQVEFVNTLAEKLSDMDHPQIADVVNKRFELNKLWNSLADLVEARREQLQTSYEFNQYLLECKQTGEWIREKSRLVESTDELGDDLAGIMQLQRRMGGMQRDMDAIRAKLEHLDEEMDTLIAKRPNXXXXXXXXXXXXXXFWAELGDMLADRDDRLSESSELQRFLQDLDHIHIWLSKMQTTVASEDLPKDLADAEKSLVQHEQLKEEIDSYQDEFIRLLDYGRRITEDKTDAQYMFLSQRLNALEEGWQELCQMWENRXXXXXXXXXXXVFLRDAIQSEVLLAQEENFLSKEDIPISIENSQNLLRKHEGFLTTLQANHDHTIAVIEFGRNLVERGHFCSDKINLRVKSILXXXXXXXXXXXXAYEKLKDQVLYQELSQDIDDLSKWIQEKMIIATDESFREEKNIARRYNRHRAFDEEIQANKDRLCQAIDYAMQIVEERPQLADMIYPQIDSLNQQWEELEQTTFLKGEKMIEANREAIFEEGTMDVMTWLXXXXXXXXXXXXXXXXXXXXXXKLKKVEEADNEMEIKRKQIQDLKMHAAKLKEEQPEKAFGIEQKHLILEHRFTQLQMPXXXXXXXXXXXXXXXXFLRNLDDQKAWVDDKLLLAESTNFGNNLLTVQQLLRRHRYLATEVNNHKPQLEYLKEEGAVLIEEVSPMQREKFVAG----LQELESLWNRLEHSIDLRQQRLKESEATQTFLFDAEEAESWLWEQELFLLSEERGIRDQEAAINVIKKHDARQKTIEDYGEEITKLGTRSRLLIEKDHPQADRIALAQSHVDKVYAGLRDLCLEKKQRLSEIQKLNHLYREIVDLENWIYERTLVASSHDLGVDFEHCCLLRERFDEFFHETHLLGKDRVKAANDLCASLISQCHADSAEIAQWHDRINDSWAELQELMQTRIQLLRTAWEFYKYLSSCQDVLDRICEKIASIPTDVSKDSQSVAIQQRKHATFLSDAQALEGQVQWVVDEANHLLPSYAGQKEWHICERRDDVLATWNQLNMQAERRRHQLEDAADLQRFFSMVRELLQWMDLVALQINEKTRPKDVSGVELLINDHRSIKAEIAAREESMSICVNLGRTLLHRGRVGVDEVRAALINLITRKYSLEDMWEERWDYLQLILEVYQFARDASVAEAWILAQEPYLANKTLGETLDETLSLLKKHINFEKTVMSQEERFEALEKLTTMEI------------RAKEITKESILLKDKHKQER-----IENAIKIFQPPPSPELVHESPKVSISEEDEEGKSHQHKISVISKEAAEMCQSSET-KTDIRGILIRKHEWEYKNRKALNRSWHEFLVVLSIEKNKLLVYKDEKHYNEKPQDTYHKDSGLDLNDLVAAPASDYLKRPFVFRIKITSTGAEYLFQAKDEEDMLRWVNSINENSQKDLKSETT-APGKSSTLPACTS 6954
            +L+ER RIKALA ERE VQKKTFTKW+NSHL ++   I DLY DL+DG+ML+ LLE+LSGE+LP PTKG+MRIHCLENVDK+L FL EQRVHLENMG+HDIVDGN RLTLGLIWTIILRFQIQDI VE +D  EK+ AKDALLLWCQMKTAGYPN N+ NF+T WRDG+AFNA+IH+HRPDL+++  L +SN + NL+ A  +AE+ LG+ +LLDPED+SVE+PDEKSI+TYVVT+YH+FSKMKA  V  KR+GK+L  ++ETE+M+  Y+ L S+LLEWI QTI +LN+R FANSL GVQQQL AFNTYR  EKPPKF EKGNLE+LLF+IQS+MRANNQ  Y+P EGKLISDIN AW +L+KAEH RELALR ELIRQEKLEQLA RFDRKA MRE WL+ENQRL++QDNFG DL AVEAA KKHEAI+TDI AYEERV  V  V  ELE E YHD++R+  R+DNV+RLW+ LL++L  R+ RL+    +Q++FQ++ +++D ++++K  L ++D G+HL+GVEDL+ KH+L+E DI +   +++ + S+AQ F +   G     ++P DP  +  R  +++  Y  L +L+  R+  L  S+ +W+F W +A+EE W++EK Q++ + D G DL++V RL+SKHK +E++    +  LQ  +Q G++L+   + GA+K+   + +++  W  L  L   RR++L+ + A     AD  +++ W+++ +++V   +   +E S  + + KH+ +++ I  Y   +++L EQ + L E       +  +++ I+ +Y  + ELT  ++  L D L+L+++L +AD  + WI EKE+ L S+   ++LE+LEV +HRFD  E EMN QA +V  VN +A +L    HP   ++  ++ +LN  W+   DLV+ ++E L ++     Y LEC +T  WIREK++++EST +LG+DLAG+M LQR++ GM+RD+ AI  KL  L +E D L  +  +    I+     ++D W E+   L  R++ L E+S+LQ+FL++LD    WLS+ QT VASED P  LA+AEK L QHE +K EI +Y++++ ++ D G  +T+ +TDAQ+MFL QRL AL+ GW EL +MWENRQ LLSQS + Q+FLRD  Q+E  L  +E  L+  ++  ++E ++  ++K E F+TT+ AN +   AV+E GR LV  G+  +++I  +V SI ERR+ N+  ++E   KLKD    Q   QD  +LS WI EKM+ A D S+ E +N+  ++ +H+AF  E+Q+NK+ L +       +VEE+P+   ++  +++ L + WEELE TT  K + + +AN+  +F +   D+  WL  +   I   +   +  +   + LKK +  ++++E+++K++++L+  A  L +E  + +  ++ +   +E +F Q+Q P+K ++  L+  + I QF R+++D+  WV++++ LA ST+ GNNL TVQ L+++++ L  E+  H+P+ + + E     ++E SP+      AG    L++L+ +W  ++  ++ R  RL+E+   Q + FDA EAE+W+ EQEL+++SEE+  +D+++++ ++KKH   ++ +EDY E + +L   SR L+   HP+++RI++ QS VDK+YAGL+DL  E++ +L E  +L  L RE+ DLE WI ER +VA SH+LG D+EH  +L+ERF EF  +T  +G++RV A N +   LI+  HAD+A IA+W D +N++WA+L EL+ TR Q+L  ++E +K+    ++VL RI +K   +P ++ +D  +V   QR H TF  D QAL  QV+ + ++A  L  +YAG K   I  R  +VL  W  L    + RR +L D +D  RFFSMVR+L+ WM+ V   I+ + +P+DVS VELL+N+H+ IKAEI AR +S + C+ LG+ LL R     +E++  L+ L  ++  + D WE+RW++L+L+LEV+QF+RDA VAEAW+L QEPYL+++ +G+ +DE   L+K+H  FEK+  + EERF ALE+LTTME+            + +   +E+   ++   Q+R      +N +   Q  P            ++E          +    S+ A    ++ +T    I G L RKHEWE  N+KA NRSWH    V  I   ++  YKD K  ++     YH +  + L D     A DY KR  VF++K+ S G EYLFQAKD+E+M  W+ +I+  +  ++ S +T A G++ TLPA  S
Sbjct:   38 RLFERSRIKALADEREAVQKKTFTKWVNSHLARVSCRITDLYMDLRDGRMLIKLLEVLSGEKLPKPTKGRMRIHCLENVDKALQFLKEQRVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKEKKSAKDALLLWCQMKTAGYPNVNIHNFTTSWRDGMAFNALIHKHRPDLIDFDKLKKSNAHYNLQNAFNLAEQHLGLTKLLDPEDISVEHPDEKSIITYVVTYYHYFSKMKALKVEGKRIGKVLDNAIETEKMIEKYESLASDLLEWIEQTIIILNNRKFANSLVGVQQQLQAFNTYRTVEKPPKFTEKGNLEVLLFTIQSKMRANNQKVYMPREGKLISDINKAWERLEKAEHERELALRTELIRQEKLEQLARRFDRKAAMRETWLSENQRLVSQDNFGFDLQAVEAATKKHEAIETDIAAYEERVQVVVAVAGELEAENYHDIKRITARKDNVLRLWDYLLELLRARRQRLELNLGLQRVFQEMLYIMDWMDEMKMLLLSQDYGKHLLGVEDLLQKHALVEADIAIQADRVKSVNSNAQKFADDSEG-----YKPCDPQVIRDRVAHMEFCYQELTQLAAERRGRLEESRRLWKFFWEMAEEEGWIREKEQILSSEDCGKDLTAVVRLLSKHKALEDERSGRAGRLQQTVQQGEELVAAGHFGADKIRQRISDVQEQWASLERLFSARRTRLQDACALHQFQADADDMDAWMLDVLRIVSSADVGHDEFSAQSLVKKHKDVAEEISSYRPVLDALHEQARTLPEEQARAGEVSGRLAGIEERYKEVAELTRLRKQALQDALALYKMLSEADACELWIVEKEQWLNSMEIPEKLEDLEVIQHRFDSLEPEMNSQASRVAVVNQIARQLIHSGHPSEKEIKGQQDKLNTRWSQFRDLVDRKKEALNSTLGVQNYYLECNETKSWIREKTKVIESTQDLGNDLAGVMALQRKLTGMERDLVAIEDKLGDLGKEADRLSEEHGDKASGIKGRLGEIKDVWEEMKGTLRTREESLGEASKLQQFLRELDDFQAWLSRTQTAVASEDKPNTLAEAEKLLAQHEGIKNEIRNYEEDYQKMRDMGEMVTQGQTDAQHMFLRQRLQALDTGWNELQKMWENRQKLLSQSHAYQLFLRDTKQAEAFLNNQEYVLAHTEMADTLEGAEAAIKKQEDFMTTMDANEEKINAVVETGRRLVSDGNISAERIQEKVDSIDERRKKNRGAASELLTKLKDNRDLQRFLQDCQELSLWISEKMLTAKDMSYDEARNLHSKWLKHQAFMAELQSNKEWLDKIQKAGSALVEEKPETEAVVQGKMEMLKKTWEELESTTQTKAQCLFDANKAELFTQSCADLDKWLSGLEGQIHSDDFGKDLTSVNIL-LKKQQMLESQVEVRQKEVEELRSQAQALSQE-GKGSDEVDGRRRGVEVKFQQVQEPLKKRRSNLMASREIHQFNRDVEDEILWVEERMALATSTDHGNNLQTVQLLIKKNQTLQKEIQGHQPRYDDIFERSVRTLQEESPVS-----AGIRLRLEDLQRIWKLIQEEVEKRHGRLEEAHRAQQYYFDAAEAEAWMSEQELYMMSEEKA-KDEQSSVAMLKKHQILEQAVEDYAETVHQLSKTSRALVAAGHPESERISMRQSQVDKLYAGLKDLSEERRGKLDERSRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFREFARDTGNIGQERVDAVNKMADDLINSGHADAATIAEWKDGLNEAWADLLELIDTRTQILAASYELHKFYHDAKEVLGRILDKHKKLPDELGRDQNTVETLQRMHTTFEHDIQALGTQVKQLQEDAVRLQSAYAGDKADDIQRREGEVLEAWRSLLEACDGRRVRLLDTSDKFRFFSMVRDLMLWMEDVIRLIDAQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTTCIELGKALLARKHYASEEIKEKLLQLTDKRKEMIDKWEDRWEWLRLVLEVHQFSRDAGVAEAWLLGQEPYLSSREMGQNVDEVEKLIKRHEAFEKSAATWEERFSALERLTTMELLEVRRMQEEEEKKRQPPPEEAPPAEEPSPQQREGEQVSQNGLPTEQDSPREAAGGSDVVNGVAETSPSSSPTGSRKGKASQAATLPTKAQDTPPAQIEGFLNRKHEWEGHNKKASNRSWHNVYCV--INNQEMGFYKDSKSASQGI--PYHSEIPISLKDSTCEIALDYKKRKHVFKLKL-SDGNEYLFQAKDDEEMNSWIQAISCATPSEISSHSTPASGRAHTLPASAS 2309          
BLAST of Spectrin beta chain vs. Ensembl Cavefish
Match: ENSAMXT00000009444.2 (spectrin beta chain, non-erythrocytic 1-like [Source:NCBI gene;Acc:103033421])

HSP 1 Score: 1835.85 bits (4754), Expect = 0.000e+0
Identity = 1003/2284 (43.91%), Postives = 1501/2284 (65.72%), Query Frame = 1
Query:  172 RIKALAGEREKVQKKTFTKWINSHLNKLKQSIDDLYNXXXXXXXXXXXXXXXXXXXXPYPTKGKMRIHCLENVDKSLNFLIEQRVHLENMGAHDIVDGNARLTLGLIWTIILRFQIQDIVVEEDDTSEKRQAKDALLLWCQMKTAGYPNTNVRNFSTCWRDGLAFNAIIHRHRPDLLEYSALSRSNPNENLEQAIRIAEEKLGIPRLLDPEDVSVENPDEKSIMTYVVTFYHFFSKMKADSVHSKRVGKILSQSMETEEMMVHYDKLTSNLLEWINQTIELLNDRTFANSLSGVQQQLAAFNTYRVTEKPPKFQEKGNLEMLLFSIQSQMRANNQMPYLPIEGKLISDINNAWNKLDKAEHARELALRDELIRQEKLEQLALRFDRKAGMREAWLTENQRLITQDNFGQDLSAVEAAGKKHEAIKTDILAYEERVNSVTLVTSELENECYHDVERVLCRRDNVIRLWEKLLDMLAVRKLRLDACYKVQKLFQDIKHLLDLINDLKARLKTEDIGRHLMGVEDLIHKHSLLEIDIRMVGTKIEGIMSDAQPFINSEFGLGSGDFQPADPNEVILRTVNLKEEYDNLLELSRNRKDNLSASKVMWEFLWGVADEEQWMKEKIQLMLNPDLGHDLSSVHRLISKHKVIEEDVRNHSNYLQNVIQGGQQLILDKNPGAEKVADXXXXXXXXXXXXXXXXXXRRSKLEQSLAYFHCLADCGEVEIWIIEQVKLVKIDETSINEESIITDIHKHEQLSKSIEDYESNINSLDEQVKKLSEGDLELVTIEEKVSNIKSQYAILIELTNQKQNKLTDTLSLFRVLRKADTVKTWIDEKEKLLMSLIPTDELEELEVFRHRFDGFEKEMNIQADQVEFVNTLAEKLSDMDHPQIADVVNKRFELNKLWNSLADLVEARREQLQTSYEFNQYLLECKQTGEWIREKSRLVESTDELGDDLAGIMQLQRRMGGMQRDMDAIRAKLEHLDEEMDTLIAKRPNXXXXXXXXXXXXXXFWAELGDMLADRDDRLSESSELQRFLQDLDHIHIWLSKMQTTVASEDLPKDLADAEKSLVQHEQLKEEIDSYQDEFIRLLDYGRRITEDKTDAQYMFLSQRLNALEEGWQELCQMWENRXXXXXXXXXXXVFLRDAIQSEVLLAQEENFLSKEDIPISIENSQNLLRKHEGFLTTLQANHDHTIAVIEFGRNLVERGHFCSDKINLRVKSILXXXXXXXXXXXXAYEKLKDQVLYQELSQDIDDLSKWIQEKMIIATDESFREEKNIARRYNRHRAFDEEIQANKDRLCQAIDYAMQIVEERPQLADMIYPQIDSLNQQWEELEQTTFLKGEKMIEANREAIFEEGTMDVMTWLXXXXXXXXXXXXXXXXXXXXXXKLKKVEEADNEMEIKRKQIQDLKMHAAKLKEEQPEKAFGIEQKHLILEHRFTQLQMPXXXXXXXXXXXXXXXXFLRNLDDQKAWVDDKLLLAESTNFGNNLLTVQQLLRRHRYLATEVNNHKPQLEYLKEEGAVLIEEVSPMQREKFVAG----LQELESLWNRLEHSIDLRQQRLKESEATQTFLFDAEEAESWLWEQELFLLSEERGIRDQEAAINVIKKHDARQKTIEDYGEEITKLGTRSRLLIEKDHPQADRIALAQSHVDKVYAGLRDLCLEKKQRLSEIQKLNHLYREIVDLENWIYERTLVASSHDLGVDFEHCCLLRERFDEFFHETHLLGKDRVKAANDLCASLISQCHADSAEIAQWHDRINDSWAELQELMQTRIQLLRTAWEFYKYLSSCQDVLDRICEKIASIPTDVSKDSQSVAIQQRKHATFLSDAQALEGQVQWVVDEANHLLPSYAGQKEWHICERRDDVLATWNQLNMQAERRRHQLEDAADLQRFFSMVRELLQWMDLVALQINEKTRPKDVSGVELLINDHRSIKAEIAAREESMSICVNLGRTLLHRGRVGVDEVRAALINLITRKYSLEDMWEERWDYLQLILEVYQFARDASVAEAWILAQEPYLANKTLGETLDETLSLLKKHINFEKTVMSQEERFEALEKLTTMEI------------RAKEITKESILLKDKHKQER-----IENAIKIFQPPPSPELVHESPKVSISEEDEEGKSHQHKISVISKEAAEMCQSSET-KTDIRGILIRKHEWEYKNRKALNRSWHEFLVVLSIEKNKLLVYKDEKHYNEKPQDTYHKDSGLDLNDLVAAPASDYLKRPFVFRIKITSTGAEYLFQAKDEEDMLRWVNSINENSQKDLKSETT-APGKSSTLPACTS 6954
            R K L  ERE VQKKTFTKW+NSHL ++   I DLY DL+DG+ML+ LLE+LSGE+LP PTKG+MRIHCLENVDK+L FL EQRVHLENMG+HDIVDGN RLTLGLIWTIILRFQIQDI VE +D  EK+ AKDALLLWCQMKTAGYPN N+ NF+T WRDG+AFNA+IH+HRPDL+++  L +SN + NL+ A  +AE+ LG+ +LLDPED+SVE+PDEKSI+TYVVT+YH+FSKMKA  V  KR+GK+L  ++ETE+M+  Y+ L S+LLEWI QTI +LN+R FANSL GVQQQL AFNTYR  EKPPKF EKGNLE+LLF+IQS+MRANNQ  Y+P EGKLISDIN AW +L+KAEH RELALR ELIRQEKLEQLA RFDRKA MRE WL+ENQRL++QDNFG DL AVEAA KKHEAI+TDI AYEERV  V  V  ELE E YHD++R+  R+DNV+RLW+ LL++L  R+ RL+    +Q++FQ++ +++D ++++K  L ++D G+HL+GVEDL+ KH+L+E DI +   +++ + S+AQ F +   G     ++P DP  +  R  +++  Y  L +L+  R+  L  S+ +W+F W +A+EE W++EK Q++ + D G DL++V RL+SKHK +E++    +  LQ  +Q G++L+   + GA+K+   + +++  W  L  L   RR++L+ + A     AD  +++ W+++ +++V   +   +E S  + + KH+ +++ I  Y   +++L EQ + L E       +  +++ I+ +Y  + ELT  ++  L D L+L+++L +AD  + WI EKE+ L S+   ++LE+LEV +HRFD  E EMN QA +V  VN +A +L    HP   ++  ++ +LN  W+   DLV+ ++E L ++     Y LEC +T  WIREK++++EST +LG+DLAG+M LQR++ GM+RD+ AI  KL  L +E D L  +  +    I+     ++D W E+   L  R++ L E+S+LQ+FL++LD    WLS+ QT VASED P  LA+AEK L QHE +K EI +Y++++ ++ D G  +T+ +TDAQ+MFL QRL AL+ GW EL +MWENRQ LLSQS + Q+FLRD  Q+E  L  +E  L+  ++  ++E ++  ++K E F+TT+ AN +   AV+E GR LV  G+  +++I  +V SI ERR+ N+  ++E   KLKD    Q   QD  +LS WI EKM+ A D S+ E +N+  ++ +H+AF  E+Q+NK+ L +       +VEE+P+   ++  +++ L + WEELE TT  K + + +AN+  +F +   D+  WL  +   I   +   +  +   + LKK +  ++++E+++K++++L+  A  L +E  + +  ++ +   +E +F Q+Q P+K ++  L+  + I QF R+++D+  WV++++ LA ST+ GNNL TVQ L+++++ L  E+  H+P+ + + E     ++E SP+      AG    L++L+ +W  ++  ++ R  RL+E+   Q + FDA EAE+W+ EQEL+++SEE+  +D+++++ ++KKH   ++ +EDY E + +L   SR L+   HP+++RI++ QS VDK+YAGL+DL  E++ +L E  +L  L RE+ DLE WI ER +VA SH+LG D+EH  +L+ERF EF  +T  +G++RV A N +   LI+  HAD+A IA+W D +N++WA+L EL+ TR Q+L  ++E +K+    ++VL RI +K   +P ++ +D  +V   QR H TF  D QAL  QV+ + ++A  L  +YAG K   I  R  +VL  W  L    + RR +L D +D  RFFSMVR+L+ WM+ V   I+ + +P+DVS VELL+N+H+ IKAEI AR +S + C+ LG+ LL R     +E++  L+ L  ++  + D WE+RW++L+L+LEV+QF+RDA VAEAW+L QEPYL+++ +G+ +DE   L+K+H  FEK+  + EERF ALE+LTTME+            + +   +E+   ++   Q+R      +N +   Q  P            ++E          +    S+ A    ++ +T    I G L RKHEWE  N+KA NRSWH    V  I   ++  YKD K  ++     YH +  + L D     A DY KR  VF++K+ S G EYLFQAKD+E+M  W+ +I+  +  ++ S +T A G++ TLPA  S
Sbjct:   69 RFKQLQDEREAVQKKTFTKWVNSHLARVSCRITDLYMDLRDGRMLIKLLEVLSGEKLPKPTKGRMRIHCLENVDKALQFLKEQRVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKEKKSAKDALLLWCQMKTAGYPNVNIHNFTTSWRDGMAFNALIHKHRPDLIDFDKLKKSNAHYNLQNAFNLAEQHLGLTKLLDPEDISVEHPDEKSIITYVVTYYHYFSKMKALKVEGKRIGKVLDNAIETEKMIEKYESLASDLLEWIEQTIIILNNRKFANSLVGVQQQLQAFNTYRTVEKPPKFTEKGNLEVLLFTIQSKMRANNQKVYMPREGKLISDINKAWERLEKAEHERELALRTELIRQEKLEQLARRFDRKAAMRETWLSENQRLVSQDNFGFDLQAVEAATKKHEAIETDIAAYEERVQVVVAVAGELEAENYHDIKRITARKDNVLRLWDYLLELLRARRQRLELNLGLQRVFQEMLYIMDWMDEMKMLLLSQDYGKHLLGVEDLLQKHALVEADIAIQADRVKSVNSNAQKFADDSEG-----YKPCDPQVIRDRVAHMEFCYQELTQLAAERRGRLEESRRLWKFFWEMAEEEGWIREKEQILSSEDCGKDLTAVVRLLSKHKALEDERSGRAGRLQQTVQQGEELVAAGHFGADKIRQRISDVQEQWASLERLFSARRTRLQDACALHQFQADADDMDAWMLDVLRIVSSADVGHDEFSAQSLVKKHKDVAEEISSYRPVLDALHEQARTLPEEQARAGEVSGRLAGIEERYKEVAELTRLRKQALQDALALYKMLSEADACELWIVEKEQWLNSMEIPEKLEDLEVIQHRFDSLEPEMNSQASRVAVVNQIARQLIHSGHPSEKEIKGQQDKLNTRWSQFRDLVDRKKEALNSTLGVQNYYLECNETKSWIREKTKVIESTQDLGNDLAGVMALQRKLTGMERDLVAIEDKLGDLGKEADRLSEEHGDKASGIKGRLGEIKDVWEEMKGTLRTREESLGEASKLQQFLRELDDFQAWLSRTQTAVASEDKPNTLAEAEKLLAQHEGIKNEIRNYEEDYQKMRDMGEMVTQGQTDAQHMFLRQRLQALDTGWNELQKMWENRQKLLSQSHAYQLFLRDTKQAEAFLNNQEYVLAHTEMADTLEGAEAAIKKQEDFMTTMDANEEKINAVVETGRRLVSDGNISAERIQEKVDSIDERRKKNRGAASELLTKLKDNRDLQRFLQDCQELSLWISEKMLTAKDMSYDEARNLHSKWLKHQAFMAELQSNKEWLDKIQKAGSALVEEKPETEAVVQGKMEMLKKTWEELESTTQTKAQCLFDANKAELFTQSCADLDKWLSGLEGQIHSDDFGKDLTSVNIL-LKKQQMLESQVEVRQKEVEELRSQAQALSQE-GKGSDEVDGRRRGVEVKFQQVQEPLKKRRSNLMASREIHQFNRDVEDEILWVEERMALATSTDHGNNLQTVQLLIKKNQTLQKEIQGHQPRYDDIFERSVRTLQEESPVS-----AGIRLRLEDLQRIWKLIQEEVEKRHGRLEEAHRAQQYYFDAAEAEAWMSEQELYMMSEEKA-KDEQSSVAMLKKHQILEQAVEDYAETVHQLSKTSRALVAAGHPESERISMRQSQVDKLYAGLKDLSEERRGKLDERSRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFREFARDTGNIGQERVDAVNKMADDLINSGHADAATIAEWKDGLNEAWADLLELIDTRTQILAASYELHKFYHDAKEVLGRILDKHKKLPDELGRDQNTVETLQRMHTTFEHDIQALGTQVKQLQEDAVRLQSAYAGDKADDIQRREGEVLEAWRSLLEACDGRRVRLLDTSDKFRFFSMVRDLMLWMEDVIRLIDAQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTTCIELGKALLARKHYASEEIKEKLLQLTDKRKEMIDKWEDRWEWLRLVLEVHQFSRDAGVAEAWLLGQEPYLSSREMGQNVDEVEKLIKRHEAFEKSAATWEERFSALERLTTMELLEVRRMQEEEEKKRQPPPEEAPPAEEPSPQQREGEQVSQNGLPTEQDSPREAAGGSDVVNGVAETSPSSSPTGSRKGKASQAATLPTKAQDTPPAQIEGFLNRKHEWEGHNKKASNRSWHNVYCV--INNQEMGFYKDSKSASQGI--PYHSEIPISLKDSTCEIALDYKKRKHVFKLKL-SDGNEYLFQAKDDEEMNSWIQAISCATPSEISSHSTPASGRAHTLPASAS 2334          
BLAST of Spectrin beta chain vs. Ensembl Cavefish
Match: SPTBN1 (spectrin beta, non-erythrocytic 1 [Source:HGNC Symbol;Acc:HGNC:11275])

HSP 1 Score: 1756.5 bits (4548), Expect = 0.000e+0
Identity = 926/2055 (45.06%), Postives = 1394/2055 (67.83%), Query Frame = 1
Query:  154 KLYERFRIKALAGEREKVQKKTFTKWINSHLNKLKQSIDDLYNXXXXXXXXXXXXXXXXXXXXPYPTKGKMRIHCLENVDKSLNFLIEQRVHLENMGAHDIVDGNARLTLGLIWTIILRFQIQDIVVEEDDTSEKRQAKDALLLWCQMKTAGYPNTNVRNFSTCWRDGLAFNAIIHRHRPDLLEYSALSRSNPNENLEQAIRIAEEKLGIPRLLDPEDVSVENPDEKSIMTYVVTFYHFFSKMKADSVHSKRVGKILSQSMETEEMMVHYDKLTSNLLEWINQTIELLNDRTFANSLSGVQQQLAAFNTYRVTEKPPKFQEKGNLEMLLFSIQSQMRANNQMPYLPIEGKLISDINNAWNKLDKAEHARELALRDELIRQEKLEQLALRFDRKAGMREAWLTENQRLITQDNFGQDLSAVEAAGKKHEAIKTDILAYEERVNSVTLVTSELENECYHDVERVLCRRDNVIRLWEKLLDMLAVRKLRLDACYKVQKLFQDIKHLLDLINDLKARLKTEDIGRHLMGVEDLIHKHSLLEIDIRMVGTKIEGIMSDAQPFINSEFGLGSGDFQPADPNEVILRTVNLKEEYDNLLELSRNRKDNLSASKVMWEFLWGVADEEQWMKEKIQLMLNPDLGHDLSSVHRLISKHKVIEEDVRNHSNYLQNVIQGGQQLILDKNPGAEKVADXXXXXXXXXXXXXXXXXXRRSKLEQSLAYFHCLADCGEVEIWIIEQVKLVKIDETSINEESIITDIHKHEQLSKSIEDYESNINSLDEQVKKLSEGDLELVTIEEKVSNIKSQYAILIELTNQKQNKLTDTLSLFRVLRKADTVKTWIDEKEKLLMSLIPTDELEELEVFRHRFDGFEKEMNIQADQVEFVNTLAEKLSDMDHPQIADVVNKRFELNKLWNSLADLVEARREQLQTSYEFNQYLLECKQTGEWIREKSRLVESTDELGDDLAGIMQLQRRMGGMQRDMDAIRAKLEHLDEEMDTLIAKRPNXXXXXXXXXXXXXXFWAELGDMLADRDDRLSESSELQRFLQDLDHIHIWLSKMQTTVASEDLPKDLADAEKSLVQHEQLKEEIDSYQDEFIRLLDYGRRITEDKTDAQYMFLSQRLNALEEGWQELCQMWENRXXXXXXXXXXXVFLRDAIQSEVLLAQEENFLSKEDIPISIENSQNLLRKHEGFLTTLQANHDHTIAVIEFGRNLVERGHFCSDKINLRVKSILXXXXXXXXXXXXAYEKLKDQVLYQELSQDIDDLSKWIQEKMIIATDESFREEKNIARRYNRHRAFDEEIQANKDRLCQAIDYAMQIVEERPQLADMIYPQIDSLNQQWEELEQTTFLKGEKMIEANREAIFEEGTMDVMTWLXXXXXXXXXXXXXXXXXXXXXXKLKKVEEADNEMEIKRKQIQDLKMHAAKLKEEQPEKAFGIEQKHLILEHRFTQLQMPXXXXXXXXXXXXXXXXFLRNLDDQKAWVDDKLLLAESTNFGNNLLTVQQLLRRHRYLATEVNNHKPQLEYLKEEGAVLIEEVSPMQREKFVAGLQELESLWNRLEHSIDLRQQRLKESEATQTFLFDAEEAESWLWEQELFLLSEERGIRDQEAAINVIKKHDARQKTIEDYGEEITKLGTRSRLLIEKDHPQADRIALAQSHVDKVYAGLRDLCLEKKQRLSEIQKLNHLYREIVDLENWIYERTLVASSHDLGVDFEHCCLLRERFDEFFHETHLLGKDRVKAANDLCASLISQCHADSAEIAQWHDRINDSWAELQELMQTRIQLLRTAWEFYKYLSSCQDVLDRICEKIASIPTDVSKDSQSVAIQQRKHATFLSDAQALEGQVQWVVDEANHLLPSYAGQKEWHICERRDDVLATWNQLNMQAERRRHQLEDAADLQRFFSMVRELLQWMDLVALQINEKTRPKDVSGVELLINDHRSIKAEIAAREESMSICVNLGRTLLHRGRVGVDEVRAALINLITRKYSLEDMWEERWDYLQLILEVYQFARDASVAEAWILAQEPYLANKTLGETLDETLSLLKKHINFEKTVMSQEERFEALEKLTTMEI 6318
            +L+ER RIKALA ERE VQKKTFTKW+NSHL ++   I DLY DL+DG+ML+ LLE+LSGE+LP PTKG+MRIHCLENVDK+L FL EQRVHLENMG+HDIVDGN RLTLGLIWTIILRFQIQDI VE +D  EKR AKDALLLWCQMKTAGYPN N+ NF+T WRDG+AFNA+IH+HRPDL+++  L +SN + NL+ A  +AE+ LG+ +LLDPED+SV++PDEKS++TYVVT+YH+FSKMKA  V  KR+GK+L  ++ETE+M+  Y+ L S+LLEWI QTI +LN+R FANSL GVQQQL AFNTYR  EKPPKF EKGNLE+LLF+IQS+MRANNQ  Y+P EGKLISDIN AW +L+KAEH RELALR+ELIRQEKLEQLA RFDRKA MRE WL+ENQRL++QDNFG DL AVEAA KKHEAI+TDI AYEERV +V  V  ELE E YHD++R+  R+DNV+RLWE LL++L  R+ RL+    +Q++FQ++ +++D ++++K  L ++D G+HL+GVEDL+ KH+L+E DI +   ++  + S+AQ F   + G     ++P DP  +  R  +L+  Y  L +L+  R+  L  S+ +W+F W +A+EE W++EK Q++ + D+G DL+   RL+S+H+ +E+++     +LQ+ ++ G  +    + G  ++ + + E++  W  L +L   R+++LE++       AD  +V+ W ++ +++V   +   +E S    +  H+  +  +  Y   I++L EQ + L     E   +  +++ I+ +Y  + ELT  ++  L D L+L+++  +AD  + WI EKE+ L S+   ++LE+LEV +HRF+  E EMN QA +V  VN +A +L    HP   D+  ++ +LN  W+   DLV+ ++E L ++     Y L+C +T  WIREK++++EST ELG+DL G+M LQR++ GM+RD+ AI AKL  L  E + L  + P   + I      ++  W E+ D L +R+  L E+S+LQ+FL++LD    WLS+ QT +ASED+P  LA+AEK L QHE +K EI +Y++++ ++ D G  +T+ +TDAQYMFL QRL AL+ GW EL +MWENRQ LLSQS + Q+FLRD  Q+E  L  +E  L+  ++P ++E ++  ++K E F+TT+ AN +   +V+E GR L   G+  +D+I  R  SI ER + N+  + E   +LKD    Q+  QD  +LS W  EKM+ A D S+ E +N+  ++ +H+AF  E+Q+NK+ L +     MQ+V E+P+   ++  ++ +L +QW+ELE TT  K + + +AN+  +F +   D+  WL  +   I   +   +  +   + LKK +  +N++E++++++++L+  A  L++E  +    ++ +  ++E +F ++  P+  +K  L+  + I QF R+++D+  WV++++ +A ST+ G+NL TVQ L+++++ L  E+  H+P+ + + E    +++E SP   E   A L +L++LW+ +    + R +RL+E+   Q + FDA EAE+W+ EQEL+++SEE+  +D+++++ ++KKH   ++ +EDY E + +L   SR L+  +HP+++RI + QS VDK+YAGL+DL  E++ +L E  +L  L RE+ DLE WI ER +VA SH+LG D+EH  +L+ERF EF  +T  +G++RV + N +   LI+  H D+A +A+W D +N++WA+L EL+ TR Q+L  ++E +K+    +++L RI +K   +P ++ +D  +V   QR H TF  D QAL  QV+ + ++A  L  +YAG K   I  R  +VL  W  L    E RR +L D  D  RFFSMVR+L+ WM+ V   I  + +P+DVS VELL+N+H+ IKAEI AR +S + C+ LG++LL R     +E++  L+ L  ++  + D WE+RW++L+LILEV+QF+RDA VAEAW+L QEPYL+++ +G+++D+   L+K+H  FEK+  + EERF ALE+LTTME+
Sbjct:   37 RLFERSRIKALADEREAVQKKTFTKWVNSHLARVSCRITDLYMDLRDGRMLIKLLEVLSGERLPKPTKGRMRIHCLENVDKALQFLKEQRVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKEKRSAKDALLLWCQMKTAGYPNVNIHNFTTSWRDGMAFNALIHKHRPDLIDFDKLKKSNAHYNLQNAFNLAEQHLGLTKLLDPEDISVDHPDEKSVITYVVTYYHYFSKMKALKVEGKRIGKVLDNAIETEKMIEKYESLASDLLEWIEQTIIILNNRKFANSLVGVQQQLQAFNTYRTVEKPPKFTEKGNLEVLLFTIQSKMRANNQKVYMPREGKLISDINKAWERLEKAEHERELALRNELIRQEKLEQLARRFDRKAAMRETWLSENQRLVSQDNFGFDLQAVEAATKKHEAIETDIAAYEERVQAVVSVARELEAENYHDIKRITARKDNVLRLWEYLLELLKARRQRLEMNLGLQRVFQEMLYIMDWMDEMKMLLLSQDYGKHLLGVEDLLQKHALVEADIGIQADRVRNVNSNAQKFAIDDDG-----YKPCDPQVIRDRVAHLEFCYQELTQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEQILSSDDVGKDLTGAVRLLSQHRALEDEMSGRGGHLQHTVREGLAMADAGHFGETRIRERVAEVQAQWAALEQLAAVRKARLEEACGLHQFQADADDVDAWTLDALRIVSSGDVGHDEFSTQALVKTHKDAAAEVASYRPVIDALHEQSRALPPELAESADVSGRLAGIEERYKEVAELTRLRKQALQDALALYKMFSEADACEVWIVEKEQWLNSMEIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLMHSGHPSEKDIKAQQDKLNTRWSQFRDLVDQKKESLNSALGVQNYHLDCNETKSWIREKTKVIESTQELGNDLTGVMALQRKLTGMERDLAAIEAKLGDLKGEAERLAGEHPEQAKAITGRLAEIDSVWEEMKDTLRNREASLGEASKLQQFLRELDDFQSWLSRTQTAIASEDMPNTLAEAEKLLAQHEGIKNEIHNYEEDYQKMRDMGEMVTQGQTDAQYMFLRQRLQALDTGWNELHKMWENRQNLLSQSHAYQLFLRDTKQAEAFLNNQEYVLAHTEMPTTLEGAEAAIKKQEDFMTTMDANEEKINSVVEAGRRLASDGNINTDRIQERAASIDERHKKNREAAVELLMRLKDNRDLQKFLQDCQELSLWTNEKMLTAQDMSYDEARNLHSKWLKHQAFMAELQSNKEWLDKIEKEGMQLVAEKPETEAIVKEKLSALQKQWQELESTTQTKAQCLFDANKAELFTQSCADLDKWLGGLEGQIQSDDYGKDLTSVNIL-LKKQQMLENQVEVRKREVEELQSQAHVLRQEGKDTD-EVDGRREVVEKKFQEMLDPLMKRKNFLMASREIHQFNRDVEDEILWVEERMPIATSTDHGHNLQTVQLLIKKNQTLQKEIQGHQPRCDDIFERSQSILKEDSP-SVEAIKARLSDLQTLWDLIIQETEKRHERLEEAHKAQQYYFDAAEAEAWMSEQELYMMSEEKA-KDEQSSVTMLKKHQILEQAVEDYAETVHQLSKTSRGLVAANHPESERIGMRQSQVDKLYAGLKDLSEERRGKLDERFRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFREFARDTGNIGQERVDSVNRMADELINAGHTDAATVAEWKDGLNEAWADLLELIDTRTQILAASYELHKFYHDAKEILSRILDKHKMLPEELGRDQNTVETLQRMHTTFEHDIQALGTQVRQLQEDAVRLQSAYAGDKADDIQRRETEVLDAWRNLLEACEGRRARLLDTGDKFRFFSMVRDLMLWMEDVIRLIEAQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTACIELGKSLLARKHYASEEIKDKLLQLTDKRKEMIDKWEDRWEWLRLILEVHQFSRDAGVAEAWLLGQEPYLSSREMGQSVDDVEKLIKRHEAFEKSAATWEERFSALERLTTMEL 2082          
BLAST of Spectrin beta chain vs. Ensembl Cavefish
Match: sptbn2 (spectrin beta chain, non-erythrocytic 1-like [Source:NCBI gene;Acc:103032213])

HSP 1 Score: 1711.81 bits (4432), Expect = 0.000e+0
Identity = 971/2298 (42.25%), Postives = 1426/2298 (62.05%), Query Frame = 1
Query:  154 KLYERFRIKALAGEREKVQKKTFTKWINSHLNKLKQSIDDLYNXXXXXXXXXXXXXXXXXXXXPYPTKGKMRIHCLENVDKSLNFLIEQRVHLENMGAHDIVDGNARLTLGLIWTIILRFQIQDIVVEEDDTSEKRQAKDALLLWCQMKTAGYPNTNVRNFSTCWRDGLAFNAIIHRHRPDLLEYSALSRSNPNENLEQAIRIAEEKLGIPRLLDPEDVSVENPDEKSIMTYVVTFYHFFSKMKADSVHSKRVGKILSQSMETEEMMVHYDKLTSNLLEWINQTIELLNDRTFANSLSGVQQQLAAFNTYRVTEKPPKFQEKGNLEMLLFSIQSQMRANNQMPYLPIEGKLISDINNAWNKLDKAEHARELALRDELIRQEKLEQLALRFDRKAGMREAWLTENQRLITQDNFGQDLSAVEAAGKKHEAIKTDILAYEERVNSVTLVTSELENECYHDVERVLCRRDNVIRLWEKLLDMLAVRKLRLDACYKVQKLFQDIKHLLDLINDLKARLKTEDIGRHLMGVEDLIHKHSLLEIDIRMVGTKIEGIMSDAQPFINSEFGLGSGDFQPADPNEVILRTVNLKEEYDNLLELSRNRKDNLSASKVMWEFLWGVADEEQWMKEKIQLMLNPDLGHDLSSVHRLISKHKVIEEDVRNHSNYLQNVIQGGQQLILDKNPGAEKVADXXXXXXXXXXXXXXXXXXRRSKLEQSLAYFHCLADCGEVEIWIIEQVKLVKIDETSINEESIITDIHKHEQLSKSIEDYESNINSLDEQVKKLSEGDLELVTIEEKVSNIKSQYAILIELTNQKQNKLTDTLSLFRVLRKADTVKTWIDEKEKLLMSLIPTDELEELEVFRHRFDGFEKEMNIQADQVEFVNTLAEKLSDMDHPQIADVVNKRFELNKLWNSLADLVEARREQLQTSYEFNQYLLECKQTGEWIREKSRLVESTDELGDDLAGIMQLQRRMGGMQRDMDAIRAKLEHLDEEMDTLIAKRPNXXXXXXXXXXXXXXFWAELGDMLADRDDRLSESSELQRFLQDLDHIHIWLSKMQTTVASEDLPKDLADAEKSLVQHEQLKEEIDSYQDEFIRLLDYGRRITEDKTDAQYMFLSQRLNALEEGWQELCQMWENRXXXXXXXXXXXVFLRDAIQSEVLLAQEENFLSKEDIPISIENSQNLLRKHEGFLTTLQANHDHTIAVIEFGRNLVERGHFCSDKINLRVKSILXXXXXXXXXXXXAYEKLKDQVLYQELSQDIDDLSKWIQEKMIIATDESFREEKNIARRYNRHRAFDEEIQANKDRLCQAIDYAMQIVEERPQLADMIYPQIDSLNQQWEELEQTTFLKGEKMIEANREAIFEEGTMDVMTWLXXXXXXXXXXXXXXXXXXXXXXKLKKVEEADNEMEIKRKQIQDLKMHAAKLKEEQPEKAFGIEQKHLILEHRFTQLQMPXXXXXXXXXXXXXXXXFLRNLDDQKAWVDDKLLLAESTNFGNNLLTVQQLLRRHRYLATEVNNHKPQLEYLKEEGAVLIEEVSPMQREKFVAGLQELESLWNRLEHSIDLRQQRLKESEATQTFLFDAEEAESWLWEQELFLLSEERGIRDQEAAINVIKKHDARQKTIEDYGEEITKLGTRSRLLIEKDHPQADRIALAQSHVDKVYAGLRDLCLEKKQRLSEIQKLNHLYREIVDLENWIYERTLVASSHDLGVDFEHCCLLRERFDEFFHETHLLGKDRVKAANDLCASLISQCHADSAEIAQWHDRINDSWAELQELMQTRIQLLRTAWEFYKYLSSCQDVLDRICEKIASIP-TDVSKDSQSVAIQQRKHATFLSDAQALEGQVQWVVDEANHLLPSYAGQKEWHICERRDDVLATWNQLNMQAERRRHQLEDAADLQRFFSMVRELLQWMDLVALQINEKTRPKDVSGVELLINDHRSIKAEIAAREESMSICVNLGRTLLHRGRVGVDEVRAALINLITRKYSLEDMWEERWDYLQLILEVYQFARDASVAEAWILAQEPYLANKTLGETLDETLSLLKKHINFEKTVMSQEERFEALEKLTTMEIRAKEITKE---------------SILLKDKHKQERIENAI--KIFQPPPSPELVHESPKVSISEEDEE--GKSHQHKISVISKE--AAEMCQSSETKTD-IRGILIRKHEWEYKNRKALNRSWHEFLVVLSIEKNKLLVYKDEKHY-NEKPQDTYHKDSGLDLNDLVAAPASDYLKRPFVFRIKITSTGAEYLFQAKDEEDMLRWVNSINENSQKDLKSETTAPGKSSTLPACTSDPHVPST 6975
            +L+ER RIKALA ERE VQKKTFTKW+NSHL ++   I DLY DL+DG+ML+ LLE+LSGEQLP PTKG+MRIHCLENVDK+L FL EQ+VHLENMG+HDIVDGN RLTLGLIWTIILRFQIQDI VE +D  EK+ AKDALLLWCQMKTAGYPN NV NF+T WRDGLAFNAI+H+HR DL+E+  L RSN + NL+ A  +AE++LG+ +LLDPEDV+V+ PDEKSI+TYV T+YH+FSKMKA +V  KR+GK+L  ++E ++++  Y+ L S LL+WI QTI  LNDR  ANSLS VQ QL AFNTYR  EKPPKF EKGNLE+LLF+IQS+MRANNQ  Y+P EGKLISDIN AW +L+KAEH RELALR+ELIRQEKLE LA RFDRKA MRE WL+ENQRL++QDNFG DL AVEAA +KHEAI+TDI AY ERV +V  V  ELE E YH+V R+L R+DNV+RLWE L ++L  R+ RL     +Q+L +++++++D + D+K RL+++D G+HL  VEDL+ KH+L+E DI     ++ G+ + A+ F   E       ++P +P  V  +   L + YD L  L+  R+  L  S+ +W+FLW + +E  W++E+ Q++ + D G DLSS   L+SKH+   +++      L N I  G+QL+ + + GA +V + +K++   W+ L E ++ R   L++S+A      D  ++E WI+E ++ V   E   +E S  T   K  ++ + I+ + S I+SL EQ + L     +   +E ++  I+ +Y  L  L++ ++  L   L+L+R+  +A   + WI EKE+ L ++    +LE+LEV + RF+  E EMN    ++  VN ++E+L   D+     +   + +LN  W+    + + R++ L+++     Y LEC +   W++EK++++EST  LG+DLAG+M LQR++ GM+RD++AI+ KL  L  E + L ++ P     IR     +++ W EL   +  R++ L E+S+LQ FL+DLD    WLS+ QT VASED P  LA+AE+ L QHE +K E+D+Y++++ ++   G  +T+ +TDAQYMFL+QRL AL+ GW EL +MWE+R  LL+Q+   Q FLRDA Q+E  L  +E  LS  ++P S++ +   ++KHE FLTT++A+ +    V+E GR LV  G+  +DKI  +  SI ER + NK+ +N+   KLKD    Q   QD  +L+ WI EKM+ A D S+ E +N+  ++ +H+AF  E+ +NKD L +       +V E+P+L + +   +  L +QWEELE TT  K + + +ANR  +F +    + +WL+ I   +   +   +  +   + LKK +  +++ME++ K++Q L+  A  L +E       ++ +   +   FTQLQ P+  ++ QL+  K   QF R+L+D+  WV +++ LA ST+ G +L +VQ L+++++ L  E+  H+P+++ ++  G  +  E    +R      L EL   W+R     D R  RL E+   Q F  DA EAE+W+ EQEL ++SEE+  +D+++A+ ++KKH   ++ +EDY + I +L   SRL++  +HP+++RI L Q+ VDK+YAGL+DL  E++ RL E  +L  L RE+ DLE WI ER +VA SH+LG D+EH  +LR++F EF  +T  +G++RV A N     LI   H ++A +A+W D +N++WA+L ELM TR Q+L  ++E +++    ++ L R+ EK  ++   ++ +D  +V    R+H  +  D  AL GQV  V D+A  L  +YAG+K   I      V   W  L    + RR  L D  +  RFF+MVR+L+ WMD + LQI     P+DVS   L+I +H+ IKAEI  R  S + C ++G +LL+      DE+R  L  L  ++  ++  W+++ D+LQ++LEV QF RDASVAE+W+  QEP +    LG  +DE  SL+K+H  FEK     E+RF  LEKLTT+E    +  KE                ++  +   +     ++         S   VH     S   E E   G      +   S+   +A +    +  T+ + G+L RKHE E   +KA NRSW     VL   K  L  YKD K   N  P   YH +  + LN+     A DY KR  VF++++   G E+LFQAKDE +M  W+ SI+ +       + +  G+     A T  P  PS+
Sbjct:   41 RLFERSRIKALADEREAVQKKTFTKWVNSHLGRVTCRIGDLYTDLRDGRMLIRLLEVLSGEQLPKPTKGRMRIHCLENVDKALQFLKEQKVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKEKKSAKDALLLWCQMKTAGYPNVNVHNFTTSWRDGLAFNAIVHKHRSDLIEFDTLKRSNAHYNLQNAFNVAEKELGLTKLLDPEDVNVDQPDEKSIITYVATYYHYFSKMKALAVEGKRIGKVLDYAIEADQLIEKYETLASELLQWIEQTIVTLNDRQLANSLSAVQNQLQAFNTYRTVEKPPKFTEKGNLEVLLFTIQSKMRANNQKVYMPREGKLISDINKAWERLEKAEHERELALRNELIRQEKLEMLAARFDRKAAMRETWLSENQRLVSQDNFGFDLGAVEAATRKHEAIETDIGAYGERVAAVESVARELEAEAYHEVRRILARKDNVLRLWEYLKELLTARRERLTTHRDLQRLLEEMRYIMDWMGDMKGRLQSQDSGKHLHDVEDLLQKHTLVEADISAQAERVRGVQAAAKRFTTDEM-----PYKPCEPALVEEKVSLLGKTYDELGHLAGERRVKLEDSRRLWQFLWELGEEAAWIREQEQILSSGDSGRDLSSALHLLSKHEAFRDEMAARYGPLSNSIASGEQLVQEGHFGAPEVTERIKDIRAQWSHLEEASKLREQLLKESVALHQFQTDANDMEAWILETLRQVSSQEVGHDEFSTQTLARKQREVEEEIQSHRSLIDSLHEQAETLPAAYAQSPEVEGRLPAIEQRYEELETLSSARRQALEGALALYRMFSEAGACQLWIGEKEQWLHNMEIPSKLEDLEVVQQRFETLEPEMNNLGSRITDVNQVSEQLLKSDNRNKEQINQTQDQLNNRWSEFKRVADERKQALESALNIQNYHLECNEIQSWMKEKTKVIESTQSLGNDLAGVMALQRKLTGMERDLEAIQGKLGGLRSEAEKLASEHPEQAGEIRARLEEIQEVWEELRSTMKRREESLGEASKLQGFLRDLDDFQAWLSRTQTAVASEDTPTSLAEAERLLAQHEAIKNEVDNYREDYEKMRATGAEVTQGQTDAQYMFLAQRLQALDTGWHELRRMWESRHCLLAQAFDFQTFLRDAKQAEGFLNSQEYVLSHTEMPNSLQGAVEAIKKHEDFLTTMEASEEKINGVVESGRRLVSDGNANADKIQEKADSIQERHQKNKQTANDLLTKLKDNRELQHFLQDGQELTLWINEKMLTAQDMSYDEARNLHSKWQKHQAFMAELASNKDWLDKIDKEGQALVVEKPELEETVSETLQGLQKQWEELENTTQTKAQCLFDANRAELFTQSCSALDSWLQNISSLLQSDDFGKDLTSVNIL-LKKHQMLEHQMEVREKEVQSLQSQALALAQEDA-GVMEVDGQQRRVADSFTQLQEPLNQRRQQLLASKEAHQFNRDLEDEILWVKERMPLATSTDHGKDLPSVQLLIKKNQTLQKEIQGHQPRIDDIQAHGRSMDGE----RRADLDGRLSELGEEWSRFISETDKRHSRLAEANRAQQFYTDAAEAEAWMGEQELHMMSEEKA-KDEQSALVMVKKHQILEQALEDYAQTIHQLANSSRLMVNSEHPESERITLRQAQVDKLYAGLKDLAEERRGRLQERLRLTQLKREVDDLEQWIAEREVVAGSHELGQDYEHVTMLRDKFREFARDTSAIGQERVDAVNAQADELIESGHPENASVAEWKDGLNEAWADLLELMDTRTQMLAASYELHRFHQDAREALGRVKEKKEALAGAELGRDLNTVQHLHRQHTAYEHDVHALSGQVTQVQDDAARLQKAYAGEKAEDIHRHERAVTEAWEGLLAATQSRRLLLLDTVEKFRFFNMVRDLMLWMDGINLQIQSHDSPRDVSSAGLVIANHQDIKAEIETRAGSFTACTDMGNSLLNNNHYASDEIREKLEQLKAKRDEIKQKWQDKMDHLQIVLEVLQFGRDASVAESWLAGQEPLVRAAELGSNVDEVESLIKRHEAFEKLAAGWEDRFVLLEKLTTLEEHEIQRLKEEEERARRPPTPPPAEEVVQSEAEHESAARTSLDQTTLNQSVSVNGVHSDQDTSQGSESESVNGPGRDSGLDTASRHDPSATLPGRVDPSTEAMEGMLCRKHEMESHAKKAANRSWQNVYCVL--RKGSLGFYKDNKSASNGIP---YHGEVPISLNEATCEVAHDYKKRKNVFKLRL-GDGKEFLFQAKDEAEMSSWIRSIHSSMPSSGPGDRSPGGQRGLSRAMTMPPISPSS 2320          
BLAST of Spectrin beta chain vs. Ensembl Cavefish
Match: sptbn2 (spectrin beta chain, non-erythrocytic 1-like [Source:NCBI gene;Acc:103032213])

HSP 1 Score: 1709.89 bits (4427), Expect = 0.000e+0
Identity = 969/2303 (42.08%), Postives = 1428/2303 (62.01%), Query Frame = 1
Query:  154 KLYERFRIKALAGEREKVQKKTFTKWINSHLNKLKQSIDDLYNXXXXXXXXXXXXXXXXXXXXPYPTKGKMRIHCLENVDKSLNFLIEQRVHLENMGAHDIVDGNARLTLGLIWTIILRFQIQDIVVEEDDTSEKRQAKDALLLWCQMKTAGYPNTNVRNFSTCWRDGLAFNAIIHRHRPDLLEYSALSRSNPNENLEQAIRIAEEKLGIPRLLDPEDVSVENPDEKSIMTYVVTFYHFFSKMKADSVHSKRVGKILSQSMETEEMMVHYDKLTSNLLEWINQTIELLNDRTFANSLSGVQQQLAAFNTYRVTEKPPKFQEKGNLEMLLFSIQSQMRANNQMPYLPIEGKLISDINNAWNKLDKAEHARELALRDELIRQEKLEQLALRFDRKAGMREAWLTENQRLITQDNFGQDLSAVEAAGKKHEAIKTDILAYEERVNSVTLVTSELENECYHDVERVLCRRDNVIRLWEKLLDMLAVRKLRLDACYKVQKLFQDIKHLLDLINDLKARLKTEDIGRHLMGVEDLIHKHSLLEIDIRMVGTKIEGIMSDAQPFINSEFGLGSGDFQPADPNEVILRTVNLKEEYDNLLELSRNRKDNLSASKVMWEFLWGVADEEQWMKEKIQLMLNPDLGHDLSSVHRLISKHKVIEEDVRNHSNYLQNVIQGGQQLILDKNPGAEKVADXXXXXXXXXXXXXXXXXXRRSKLEQSLAYFHCLADCGEVEIWIIEQVKLVKIDETSINEESIITDIHKHEQLSKSIEDYESNINSLDEQVKKLSEGDLELVTIEEKVSNIKSQYAILIELTNQKQNKLTDTLSLFRVLRKADTVKTWIDEKEKLLMSLIPTDELEELEVFRHRFDGFEKEMNIQADQVEFVNTLAEKLSDMDHPQIADVVNKRFELNKLWNSLADLVEARREQLQTSYEFNQYLLECKQTGEWIREKSRLVESTDELGDDLAGIMQLQRRMGGMQRDMDAIRAKLEHLDEEMDTLIAKRPNXXXXXXXXXXXXXXFWAELGDMLADRDDRLSESSELQRFLQDLDHIHIWLSKMQTTVASEDLPKDLADAEKSLVQHEQLKEEIDSYQDEFIRLLDYGRRITEDKTDAQYMFLSQRLNALEEGWQELCQMWENRXXXXXXXXXXXVFLRDAIQSEVLLAQEENFLSKEDIPISIENSQNLLRKHEGFLTTLQANHDHTIAVIEFGRNLVERGHFCSDKINLRVKSILXXXXXXXXXXXXAYEKLKDQVLYQELSQDIDDLSKWIQEKMIIATDESFREEKNIARRYNRHRAFDEEIQANKDRLCQAIDYAMQIVEERPQLADMIYPQIDSLNQQWEELEQTTFLKGEKMIEANREAIFEEGTMDVMTWLXXXXXXXXXXXXXXXXXXXXXXKLKKVEEADNEMEIKRKQIQDLKMHAAKLKEEQPEKAFGIEQKHLILEHRFTQLQMPXXXXXXXXXXXXXXXXFLRNLDDQKAWVDDKLLLAESTNFGNNLLTVQQLLRRHRYLATEVNNHKPQLEYLKEEGAVLIEEVSPMQREKFVAGLQELESLWNRLEHSIDLRQQRLKESEATQTFLFDAEEAESWLWEQELFLLSEERGIRDQEAAINVIKKHDARQKTIEDYGEEITKLGTRSRLLIEKDHPQADRIALAQSHVDKVYAGLRDLCLEKKQRLSEIQKLNHLYREIVDLENWIYERTLVASSHDLGVDFEHCCLLRERFDEFFHETHLLGKDRVKAANDLCASLISQCHADSAEIAQWHDRINDSWAELQELMQTRIQLLRTAWEFYKYLSSCQDVLDRICEKIASIP-TDVSKDSQSVAIQQRKHATFLSDAQALEGQVQWVVDEANHLLPSYAGQKEWHICERRDDVLATWNQLNMQAERRRHQLEDAADLQRFFSMVRELLQWMDLVALQINEKTRPKDVSGVELLINDHRSIKAEIAAREESMSICVNLGRTLLHRGRVGVDEVRAALINLITRKYSLEDMWEERWDYLQLILEVYQFARDASVAEAWILAQEPYLANKTLGETLDETLSLLKKHINFEKTVMSQEERFEALEKLTTMEIRAKEITKES----------------ILLKDKHK--------QERIENAIKIFQPPPSPELVHESPKVSISEEDEEGKSHQHKISVISKE--AAEMCQSSETKTD-IRGILIRKHEWEYKNRKALNRSWHEFLVVLSIEKNKLLVYKDEKHY-NEKPQDTYHKDSGLDLNDLVAAPASDYLKRPFVFRIKITSTGAEYLFQAKDEEDMLRWVNSINENSQKDLKSETTAPGKSSTLPACTSDPHVPST 6975
            +L+ER RIKALA ERE VQKKTFTKW+NSHL ++   I DLY DL+DG+ML+ LLE+LSGEQLP PTKG+MRIHCLENVDK+L FL EQ+VHLENMG+HDIVDGN RLTLGLIWTIILRFQIQDI VE +D  EK+ AKDALLLWCQMKTAGYPN NV NF+T WRDGLAFNAI+H+HR DL+E+  L RSN + NL+ A  +AE++LG+ +LLDPEDV+V+ PDEKSI+TYV T+YH+FSKMKA +V  KR+GK+L  ++E ++++  Y+ L S LL+WI QTI  LNDR  ANSLS VQ QL AFNTYR  EKPPKF EKGNLE+LLF+IQS+MRANNQ  Y+P EGKLISDIN AW +L+KAEH RELALR+ELIRQEKLE LA RFDRKA MRE WL+ENQRL++QDNFG DL AVEAA +KHEAI+TDI AY ERV +V  V  ELE E YH+V R+L R+DNV+RLWE L ++L  R+ RL     +Q+L +++++++D + D+K RL+++D G+HL  VEDL+ KH+L+E DI     ++ G+ + A+ F   E       ++P +P  V  +   L + YD L  L+  R+  L  S+ +W+FLW + +E  W++E+ Q++ + D G DLSS   L+SKH+   +++      L N I  G+QL+ + + GA +V + +K++   W+ L E ++ R   L++S+A      D  ++E WI+E ++ V   E   +E S  T   K  ++ + I+ + S I+SL EQ + L     +   +E ++  I+ +Y  L  L++ ++  L   L+L+R+  +A   + WI EKE+ L ++    +LE+LEV + RF+  E EMN    ++  VN ++E+L   D+     +   + +LN  W+    + + R++ L+++     Y LEC +   W++EK++++EST  LG+DLAG+M LQR++ GM+RD++AI+ KL  L  E + L ++ P     IR     +++ W EL   +  R++ L E+S+LQ FL+DLD    WLS+ QT VASED P  LA+AE+ L QHE +K E+D+Y++++ ++   G  +T+ +TDAQYMFL+QRL AL+ GW EL +MWE+R  LL+Q+   Q FLRDA Q+E  L  +E  LS  ++P S++ +   ++KHE FLTT++A+ +    V+E GR LV  G+  +DKI  +  SI ER + NK+ +N+   KLKD    Q   QD  +L+ WI EKM+ A D S+ E +N+  ++ +H+AF  E+ +NKD L +       +V E+P+L + +   +  L +QWEELE TT  K + + +ANR  +F +    + +WL+ I   +   +   +  +   + LKK +  +++ME++ K++Q L+  A  L +E       ++ +   +   FTQLQ P+  ++ QL+  K   QF R+L+D+  WV +++ LA ST+ G +L +VQ L+++++ L  E+  H+P+++ ++  G  +  E    +R      L EL   W+R     D R  RL E+   Q F  DA EAE+W+ EQEL ++SEE+  +D+++A+ ++KKH   ++ +EDY + I +L   SRL++  +HP+++RI L Q+ VDK+YAGL+DL  E++ RL E  +L  L RE+ DLE WI ER +VA SH+LG D+EH  +LR++F EF  +T  +G++RV A N     LI   H ++A +A+W D +N++WA+L ELM TR Q+L  ++E +++    ++ L R+ EK  ++   ++ +D  +V    R+H  +  D  AL GQV  V D+A  L  +YAG+K   I      V   W  L    + RR  L D  +  RFF+MVR+L+ WMD + LQI     P+DVS   L+I +H+ IKAEI  R  S + C ++G +LL+      DE+R  L  L  ++  ++  W+++ D+LQ++LEV QF RDASVAE+W+  QEP +    LG  +DE  SL+K+H  FEK     E+RF  LEKLTT+E    +  KE                 +  + +H+        Q  +  ++ +       +     P+     E   G      +   S+   +A +    +  T+ + G+L RKHE E   +KA NRSW     VL   K  L  YKD K   N  P   YH +  + LN+     A DY KR  VF++++   G E+LFQAKDE +M  W+ SI+ +       + +  G+     A T  P  PS+
Sbjct:   41 RLFERSRIKALADEREAVQKKTFTKWVNSHLGRVTCRIGDLYTDLRDGRMLIRLLEVLSGEQLPKPTKGRMRIHCLENVDKALQFLKEQKVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKEKKSAKDALLLWCQMKTAGYPNVNVHNFTTSWRDGLAFNAIVHKHRSDLIEFDTLKRSNAHYNLQNAFNVAEKELGLTKLLDPEDVNVDQPDEKSIITYVATYYHYFSKMKALAVEGKRIGKVLDYAIEADQLIEKYETLASELLQWIEQTIVTLNDRQLANSLSAVQNQLQAFNTYRTVEKPPKFTEKGNLEVLLFTIQSKMRANNQKVYMPREGKLISDINKAWERLEKAEHERELALRNELIRQEKLEMLAARFDRKAAMRETWLSENQRLVSQDNFGFDLGAVEAATRKHEAIETDIGAYGERVAAVESVARELEAEAYHEVRRILARKDNVLRLWEYLKELLTARRERLTTHRDLQRLLEEMRYIMDWMGDMKGRLQSQDSGKHLHDVEDLLQKHTLVEADISAQAERVRGVQAAAKRFTTDEM-----PYKPCEPALVEEKVSLLGKTYDELGHLAGERRVKLEDSRRLWQFLWELGEEAAWIREQEQILSSGDSGRDLSSALHLLSKHEAFRDEMAARYGPLSNSIASGEQLVQEGHFGAPEVTERIKDIRAQWSHLEEASKLREQLLKESVALHQFQTDANDMEAWILETLRQVSSQEVGHDEFSTQTLARKQREVEEEIQSHRSLIDSLHEQAETLPAAYAQSPEVEGRLPAIEQRYEELETLSSARRQALEGALALYRMFSEAGACQLWIGEKEQWLHNMEIPSKLEDLEVVQQRFETLEPEMNNLGSRITDVNQVSEQLLKSDNRNKEQINQTQDQLNNRWSEFKRVADERKQALESALNIQNYHLECNEIQSWMKEKTKVIESTQSLGNDLAGVMALQRKLTGMERDLEAIQGKLGGLRSEAEKLASEHPEQAGEIRARLEEIQEVWEELRSTMKRREESLGEASKLQGFLRDLDDFQAWLSRTQTAVASEDTPTSLAEAERLLAQHEAIKNEVDNYREDYEKMRATGAEVTQGQTDAQYMFLAQRLQALDTGWHELRRMWESRHCLLAQAFDFQTFLRDAKQAEGFLNSQEYVLSHTEMPNSLQGAVEAIKKHEDFLTTMEASEEKINGVVESGRRLVSDGNANADKIQEKADSIQERHQKNKQTANDLLTKLKDNRELQHFLQDGQELTLWINEKMLTAQDMSYDEARNLHSKWQKHQAFMAELASNKDWLDKIDKEGQALVVEKPELEETVSETLQGLQKQWEELENTTQTKAQCLFDANRAELFTQSCSALDSWLQNISSLLQSDDFGKDLTSVNIL-LKKHQMLEHQMEVREKEVQSLQSQALALAQEDA-GVMEVDGQQRRVADSFTQLQEPLNQRRQQLLASKEAHQFNRDLEDEILWVKERMPLATSTDHGKDLPSVQLLIKKNQTLQKEIQGHQPRIDDIQAHGRSMDGE----RRADLDGRLSELGEEWSRFISETDKRHSRLAEANRAQQFYTDAAEAEAWMGEQELHMMSEEKA-KDEQSALVMVKKHQILEQALEDYAQTIHQLANSSRLMVNSEHPESERITLRQAQVDKLYAGLKDLAEERRGRLQERLRLTQLKREVDDLEQWIAEREVVAGSHELGQDYEHVTMLRDKFREFARDTSAIGQERVDAVNAQADELIESGHPENASVAEWKDGLNEAWADLLELMDTRTQMLAASYELHRFHQDAREALGRVKEKKEALAGAELGRDLNTVQHLHRQHTAYEHDVHALSGQVTQVQDDAARLQKAYAGEKAEDIHRHERAVTEAWEGLLAATQSRRLLLLDTVEKFRFFNMVRDLMLWMDGINLQIQSHDSPRDVSSAGLVIANHQDIKAEIETRAGSFTACTDMGNSLLNNNHYASDEIREKLEQLKAKRDEIKQKWQDKMDHLQIVLEVLQFGRDASVAESWLAGQEPLVRAAELGSNVDEVESLIKRHEAFEKLAAGWEDRFVLLEKLTTLEEHEIQRLKEEEERARRPPTPPPAEEVVQSEAEHESAARTSLDQTTLNQSVSVNGVHSDQDTSQYRPEKGSESESVNGPGRDSGLDTASRHDPSATLPGRVDPSTEAMEGMLCRKHEMESHAKKAANRSWQNVYCVL--RKGSLGFYKDNKSASNGIP---YHGEVPISLNEATCEVAHDYKKRKNVFKLRL-GDGKEFLFQAKDEAEMSSWIRSIHSSMPSSGPGDRSPGGQRGLSRAMTMPPISPSS 2325          
BLAST of Spectrin beta chain vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008111.1 (pep scaffold:Pmarinus_7.0:GL478136:8967:48859:1 gene:ENSPMAG00000007298.1 transcript:ENSPMAT00000008111.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 1788.47 bits (4631), Expect = 0.000e+0
Identity = 999/2309 (43.27%), Postives = 1500/2309 (64.96%), Query Frame = 1
Query:  154 KLYERFRIKALAGEREKVQKKTFTKWINSHLNKLKQSIDDLYNXXXXXXXXXXXXXXXXXXXXPYPTKGKMRIHCLENVDKSLNFLIEQRVHLENMGAHDIVDGNARLTLGLIWTIILRFQIQDIVVEEDDTSEKRQAKDALLLWCQMKTAGYPNTNVRNFSTCWRDGLAFNAIIHRHRPDLLEYSALSRSNPNENLEQAIRIAEEKLGIPRLLDPEDVSVENPDEKSIMTYVVTFYHFFSKMKADSVHSKRVGKILSQSMETEEMMVHYDKLTSNLLEWINQTIELLNDRTFANSLSGVQQQLAAFNTYRVTEKPPKFQEKGNLEMLLFSIQSQMRANNQMPYLPIEGKLISDINNAWNKLDKAEHARELALRDELIRQEKLEQLALRFDRKAGMREAWLTENQRLITQDNFGQDLSAVEAAGKKHEAIKTDILAYEERVNSVTLVTSELENECYHDVERVLCRRDNVIRLWEKLLDMLAVRKLRLDACYKVQKLFQDIKHLLDLINDLKARLKTEDIGRHLMGVEDLIHKHSLLEIDIRMVGTKIEGIMSDAQPFINSEFGLGSGDFQPADPNEVILRTVNLKEEYDNLLELSRNRKDNLSASKVMWEFLWGVADEEQWMKEKIQLMLNPDLGHDLSSVHRLISKHKVIEEDVRNHSNYLQNVIQGGQQLILDKNPGAEKVADXXXXXXXXXXXXXXXXXXRRSKLEQSLAYFHCLADCGEVEIWIIEQVKLVKIDETSINEESIITDIHKHEQLSKSIEDYESNINSLDEQVKKLSEGDLELVTIEEKVSNIKSQYAILIELTNQKQNKLTDTLSLFRVLRKADTVKTWIDEKEKLLMSLIPTDELEELEVFRHRFDGFEKEMNIQADQVEFVNTLAEKLSDMDHPQIADVVNKRFELNKLWNSLADLVEARREQLQTSYEFNQYLLECKQTGEWIREKSRLVESTDELGDDLAGIMQLQRRMGGMQRDMDAIRAKLEHLDEEMDTLIAKRPNXXXXXXXXXXXXXXFWAELGDMLADRDDRLSESSELQRFLQDLDHIHIWLSKMQTTVASEDLPKDLADAEKSLVQHEQLKEEIDSYQDEFIRLLDYGRRITEDKTDAQYMFLSQRLNALEEGWQELCQMWENRXXXXXXXXXXXVFLRDAIQSEVLLAQEENFLSKEDIPISIENSQNLLRKHEGFLTTLQANHDHTIAVIEFGRNLVERGHFCSDKINLRVKSILXXXXXXXXXXXXAYEKLKDQVLYQELSQDIDDLSKWIQEKMIIATDESFREEKNIARRYNRHRAFDEEIQANKDRLCQAIDYAMQIVEERPQLADMIYPQIDSLNQQWEELEQTTFLKGEKMIEANREAIFEEGTMDVMTWLXXXXXXXXXXXXXXXXXXXXXXKLKKVEEADNEMEIKRKQIQDLKMHAAKLKEEQPEKAFGIEQKHLILEHRFTQLQMPXXXXXXXXXXXXXXXXFLRNLDDQKAWVDDKLLLAESTNFGNNLLTVQQLLRRHRYLATEVNNHKPQLEYLKEEGAVLIEEVSPMQREKFVAGLQELESLWNRLEHSIDLRQQRLKESEATQTFLFDAEEAESWLWEQELFLLSEERGIRDQEAAINVIKKHDARQKTIEDYGEEITKLGTRSRLLIEKDHPQADRIALAQSHVDKVYAGLRDLCLEKKQRLSEIQKLNHLYREIVDLENWIYERTLVASSHDLGVDFEHCCLLRERFDEFFHETHLLGKDRVKAANDLCASLISQCHADSAEIAQWHDRINDSWAELQELMQTRIQLLRTAWEFYKYLSSCQDVLDRICEKIASIPTDVSKDSQSVAIQQRKHATFLSDAQALEGQVQWVVDEANHLLPSYAGQKEWHICERRDDVLATWNQLNMQAERRRHQLEDAADLQRFFSMVRELLQWMDLVALQINEKTRPKDVSGVELLINDHRSIKAEIAAREESMSICVNLGRTLLHRGRVGVDEVRAALINLITRKYSLEDMWEERWDYLQLILEVYQFARDASVAEAWILAQEPYLANKTLGETLDETLSLLKKHINFEKTVMSQEERFEALEKLTTMEI--------RAKEITKESIL---LKDKHK-------------QERIENAIKIFQPPPSPELVHESPKVSISEEDE-----------EGKSHQHKISVI-SKEAAEMCQSSETKTDIR--GILIRKHEWEYKNRKALN--RSWHEFLVVLSIEKNKLLVYKDEKHYNEKPQDTYHKDSGLDLNDLVAAPASDYLKRPFVFRIKITSTGAEYLFQAKDEEDMLRWVNSIN-----ENSQKDLKSETTAPGKSSTLPA 6945
            +L+ER RIKALA ERE VQKKTFTKW+NSHL ++   I DLY DL+DG+ML+ LLE+LSGE+LP PT+GKMRIHCLENVDK+L FL EQ+VHLENMG+HDIVDGN RL LGLIWTIILRFQIQDI VE +D  E+R AKDALLLWCQMKTAGY N N+ NF+T WRDGLAFNAI+H+HRPDL+E+  L +SN + NL+ A  IAE+KLG+ +LLDPED+SV+ PDEKSI+TYVVT+YH+FSKMKA +V  KR+GK+L  ++ET++M+  Y+ L S LLEWI QTI +LN+R FANSL+GVQQQL AF+TYR  EKP KF EKGNLE+LLF+IQS+MRANNQ  Y P EGKL+++IN AW +L+KAEH RELALR+ELIRQEKLEQLA RFDRKA +RE WL+ENQRL+TQDNFG DL AVEAA KKHEAI+ DI AYEERV +V  V  ELE E YH+V RV  RRDNV+RLWE L ++LA R+ RL+A   +Q++FQ++ H++D ++++K RL ++D G+HL+GVEDL+ KH+L+E DI +   +++ + + AQ F + +       ++P D + V  R  +L+E Y  L  L+  R+  L  S+ +W F W +A+ E W++EK  L+ + D+G DL+ V RL+ +H+ +E+++   S  L+  ++ G+++    + GA+ +   + E+ +LW  L +L   R+ +L+ + + +   AD  ++E+W+ + +++V  DE   +E S  +   KH+ +++ I  Y   +++L EQ + L +       + +++  ++ +Y  L+EL+  ++ +L D L+L+++  +A+  + WIDEK + L ++   ++LE+LEV +HRF+GFE EMN QA ++  VN LA +L    HP   D+  K+  LN +W+   +LV+ ++E L ++     + LEC +T  WIREK++++EST ELG+DLAG+M LQR++ GM+RD+ AI+ KL  L  E + L +  P  E+ I      +   W  L + L +R++ L E+S+LQ+FL+DLD    WLSK QT +ASED+P  L +AEK L QHE +K EID+YQD++ R+ D G  +T D++D QYMFL QRL AL+ GW EL +MWENR  LLSQS   Q FL+DA Q++  L+ +E  L   ++P ++E+++  ++ HE  +TT+  N +  +  +E GR L+   +  +DKI  +V SI ER + N+  + +   +LKD    Q   QD  +L+ WI EKM+ A D S+ E +N+  ++ +H+AF  E+ +NK+ L +  +   Q++ E+P+   M+  ++  L++ W+ELE TT LK +++ +ANR  +F +   D+  W+  I   I   +   +  +   + +KK +  +N+ME+++K++++L+  A  L +E   +   ++ + L +E+RF Q+  P++ ++ +L+  K + Q++R+L+D+  WV++++ LA S + GNNL TVQ L+++++ L  E+  H+P++E ++E G  LI   S +  E     L++L +LW  +      R  RL+ES   Q + FD  EAE+W+ EQEL+++++E+  +D+++A+ ++KKH   ++++E+Y + I +L   SR L+   HP+++RI L QS  DK+YAGL+DL  E++ RL E  KL  L RE+ DLE WI ER +VA SH+LG D+EH  +L ERF EF  +T  +G++RV + N +  +LI   H+DSA +A W D +N++WA+L EL+ TR Q+L  ++E +++    ++VL RI EK   +P ++ +D  +V   QRKH TF +D QAL  QV+ + ++A  L  SYAG+K   I  R ++V+  W  L    E R+ +L D  +  RFFS+VR+L+ WM+    QIN + +P+DVS VELL+N+H+ IKAEI  R ++ +  + LG++LL R     DE++  L  L  ++  +   WEER  +L+LILEV+QFARDA VAEAW+LAQEP++  + +GE++DE   LLK+H  FEK+V + +ERF  LEK TT+E+        +  E  K+  L   L +K +             QE  +N I   Q  P        P V+ + E+E              S + K   + S+  + +   +E  +  R  G L+RKHEWE  N+KA +  RSWH    VL     +   YKD K+ N    +TYH +  ++L + V   ASDY K+  V R+K+   G +YL QAKD+E+M  W++SI       +S       + AP +S T+P+
Sbjct:   41 RLFERSRIKALADEREAVQKKTFTKWVNSHLARVSCRITDLYTDLRDGRMLIKLLEVLSGEKLPKPTRGKMRIHCLENVDKALQFLKEQKVHLENMGSHDIVDGNHRLILGLIWTIILRFQIQDISVETEDNKERRSAKDALLLWCQMKTAGYQNVNIHNFTTSWRDGLAFNAIVHKHRPDLIEFDKLKKSNAHHNLQNAFNIAEQKLGLTKLLDPEDISVDQPDEKSIITYVVTYYHYFSKMKALAVEGKRIGKVLESAIETDQMIDKYETLASELLEWIEQTIIILNNRKFANSLTGVQQQLQAFSTYRTVEKPNKFTEKGNLEVLLFTIQSKMRANNQKVYTPREGKLVNEINKAWERLEKAEHERELALRNELIRQEKLEQLARRFDRKAALRETWLSENQRLVTQDNFGVDLPAVEAATKKHEAIEADIAAYEERVQAVVDVARELEAEDYHEVRRVCSRRDNVLRLWEYLQELLAARRHRLEANLALQRVFQEMLHIVDWMDEMKVRLLSQDYGKHLLGVEDLLQKHALVEADITVQADRVKAVNAAAQRFSSEDDA-----YKPCDSHVVSERATHLEERYAELCSLAAERRSKLEESRKLWRFFWEMAELEGWVREKEPLLSSGDVGKDLTGVLRLLGQHRAVEDELNGRSADLKQTVREGEEMADAGHFGADDIRARVAEMHVLWASLEDLAAQRKRRLQVAESLYQFQADADDIEVWMEDTLRIVSSDEMGHDEFSTQSLNKKHKDVTEEISSYRPVLDALHEQAQGLPDEVTVSAGVPDRLEALEQRYRELVELSRVRKQRLQDALALYKMYSEAEACELWIDEKSQWLNAMDVPEKLEDLEVIQHRFEGFEPEMNSQASRIAVVNQLARQLMHAGHPSEQDIKAKQDHLNSVWSDFRELVDQKKEALSSALSIQNFHLECNETKAWIREKTKVIESTQELGNDLAGVMALQRKLSGMERDLAAIQTKLADLQGEAERLASMHPEQEDAILGRLAEINQVWDNLKETLQNREESLGEASKLQQFLRDLDDFQTWLSKAQTAIASEDMPNTLPEAEKLLAQHEAIKNEIDNYQDDYQRMRDMGEVVTRDQSDPQYMFLHQRLQALDTGWNELNKMWENRHSLLSQSHGFQAFLKDARQADGFLSNQEYVLGHVEMPATLESAEEAIKNHEDVMTTMDTNDEKIVGALETGRRLLTEDNTYADKIQEKVDSIDERHKKNRMTAEDVLARLKDNRDLQRFLQDCQELTLWINEKMLTAQDMSYDEARNLHTKWQKHQAFMAELASNKEWLEKIDEEGQQLMVEKPETEPMVKEKLSELHELWDELENTTQLKAQRLFDANRAELFTQSCADLDKWVNQIESQISSDDHGNDLTSVNIL-IKKQQMLENQMEVRKKEVEELQSQATVLCQEGKGRD-EVDSQRLTVENRFEQVLAPLQQRRDKLLASKEVHQYIRDLEDEILWVEERMPLAASRDHGNNLQTVQLLIKKNQNLQKEIQGHEPRIEDIRERGEDLIARGS-VDPEAIHERLEDLRALWATMIVEAKDRHIRLEESLKAQQYYFDVAEAEAWMSEQELYMIADEKA-KDEQSAVAMLKKHQILEQSVENYSDVIHQLSETSRNLVTSRHPESERIGLRQSQADKLYAGLKDLAEERRGRLEERHKLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLSERFAEFARDTATIGQERVDSVNRIADALIEAGHSDSASVADWKDGLNEAWADLLELIDTRTQMLAASYELHRFNHDAREVLSRINEKQMQLPEELGRDQNTVESLQRKHTTFENDIQALGVQVKVLQEDAERLRGSYAGEKVEDIERREEEVVTAWKGLLDACEARKLRLADTGEKFRFFSLVRDLMLWMENTIRQINAQEKPRDVSSVELLMNNHQGIKAEIDTRNDNFTTVIELGKSLLARQHYATDEIKEKLGQLTDKRKEMVSKWEERAHWLKLILEVHQFARDAGVAEAWLLAQEPHITTQEVGESVDEVEQLLKRHEAFEKSVSTWDERFNVLEKHTTLELLELRKQQEKEDEERKQQKLQAELDEKKREEHHIAEQQRIQSQEVTQNGISSDQESPRQGSNMLDPSVNGNGENEADGARKLTPEPSPSSDRRKPQTLHSQSVSTLPGKAEEASAFRKEGFLLRKHEWESHNKKASSSVRSWHTLYCVL--HNQEFGFYKDSKNMN--TGNTYHNEIPVNLANAVCDVASDYKKKKHVLRLKLPD-GNDYLLQAKDDEEMANWIHSIKAAASSRDSSSPSSQGSQAPMRSKTMPS 2335          
BLAST of Spectrin beta chain vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001834.1 (pep scaffold:Pmarinus_7.0:GL482425:158920:175005:1 gene:ENSPMAG00000001663.1 transcript:ENSPMAT00000001834.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 1043.11 bits (2696), Expect = 0.000e+0
Identity = 543/1160 (46.81%), Postives = 751/1160 (64.74%), Query Frame = 1
Query:  343 PYPTKGKMRIHCLENVDKSLNFLIEQRVHLENMGAHDIVDGNARLTLGLIWTIILRFQIQDIVVEEDDTSEKRQAKDALLLWCQMKTAGYPNTNVRNFSTCWRDGLAFNAIIHRHRPDLLEYSALSRSNPNENLEQAIRIAEEKLGIPRLLDPE-DVSVENPDEKSIMTYVVTFYHFFSKMKADSVHSKRVGKILSQSMETEEMMVHYDKLTSNLLEWINQTIELLNDRTFANSLSGVQQQLAAFNTYRVTEKPPKFQEKGNLEMLLFSIQSQMRANNQMPYLPIEGKLISDINNAWNKLDKAEHARELALRDELIRQEKLEQLALRFDRKAGMREAWLTENQRLITQDNFGQDLSAVEAAGKKHEAIKTDILAYEERVNSVTLVTSELENECYHDVERVLCRRDNVIRLWEKLLDMLAVRKLRLDACYKVQKLFQDIKHLLDLINDLKARLKTEDIGRHLMGVEDLIHKHSLLEIDIRMVGTKIEGIMSDAQPFINSEFGLGSGDFQPADPNEVILRTVNLKEEYDNLLELSRNRKDNLSASKVMWEFLWGVADEEQWMKEKIQLMLNPDLGHDLSSVHRLISKHKVIEEDVRNHSNYLQNVIQGGQQLILDKNPGAEKVADXXXXXXXXXXXXXXXXXXRRSKLEQSLAYFHCLADCGEVEIWIIEQVKLVKIDETSINEE-SIITDIHKHEQLSKSIEDYESNINSLDEQVKKLSEGDLELVTIEEKVSNIKSQYAILIELTNQKQNKLTDTLSLFRVLRKADTVKTWIDEKEKLLMSLIPTDELEELEVFRHRFDGFEKEMNIQADQVEFVNTLAEKLSDMDHPQIADVVNKRFELNKLWNSLADLVEARREQLQTSYEFNQYLLECKQTGEWIREKSRLVESTDELGDDLAGIMQLQRRMGGMQRDMDAIRAKLEHLDEEMDTLIAKRPNXXXXXXXXXXXXXXFWAELGDMLADRDDRLSESSELQRFLQDLDHIHIWLSKMQTTVASEDLPKDLADAEKSLVQHEQLKEEIDSYQDEFIRLLDYGRRITEDKTDAQYMFLSQRLNALEEGWQELCQMWENRXXXXXXXXXXXVFLRDAIQSEVLLAQEENFLSKEDIPISIENSQNLLRKHEGFLTTLQANHDHTIAVIEFGRNLVERGHFCSDKINLRVKSI 3816
            P PT+GKMRIHCLENVDK+L FL EQ+VHLENMG+HDIVDGN RL LGLIWTIILRFQIQDI V+ +D+ E R AKDALLLWCQMKTAGYPN NV NF+T WRDGLAFNA+IH+HRPDL+++  L +SN   NL+ A   AE+ LG+ +LLDPE DVSV+ PDEKSI+TYVV+FYH+FSKMKA +V  KR+GK+L  ++E + M+  Y+ L S LLEWI +TI  LN R F NSL GVQQQL AF++YR  EKPPKF EKGNLE+LLF+IQS+MRANNQ  Y P EGKL+++IN AW +L+KAEH RELALRDELIRQEKLEQLA RFDRKA MRE WL ENQRL+ QDNFG DL+AVEAA KKHEAI+TD+ AYE RV +V  V  ELE E YH+V RV+ RRD V++LW +L ++LA R+ RL+    +Q+ F ++ +    ++++K RL +++ G+HL+GVEDL+ KH+L+E D+     +++ + + A  F     G     ++P DP     R   L+  Y  L  L   R+  L  ++ +  FLW   + E W+++   L+ + D GHDL++V RL+++H+  E+++      LQ  ++ G++   +    A+       EL+ LW  L      R  +L  S A    L+D  +VE W  +   LV       N+E S      KH  + + IE Y   I+SL EQ   L     E   + E++  ++  Y  L  L  ++  +L D L+L+ +  +      W+DEK + L +L   ++LE+LEV +HRF+  E EMN  A +V  VN LA +L   +H    D+  K+  LN  W+   +L E+++E LQ       + LEC +T  WIREK+RL+EST  LG+DLAG+M LQR++ GM+RD+ AI  K+  L  E + L    P     +R +     D W  L   L  R+D L E+S+LQ+FLQD+D    WLSK Q  VASED+P  L +AEK L QHE +K EI +Y ++  R+ + G  +T D++D Q++FL QRL AL  GW EL  MW+NR+ LL+   +   F RDA Q++ +L+ +E  LS+ ++P ++++++  ++KHE   T+++AN +   +V++ GR LV  G+F +DKI  ++ SI
Sbjct:    1 PKPTRGKMRIHCLENVDKALQFLKEQKVHLENMGSHDIVDGNHRLILGLIWTIILRFQIQDISVQTEDSKETRSAKDALLLWCQMKTAGYPNVNVHNFTTSWRDGLAFNAVIHKHRPDLVDFEKLKKSNAQHNLQHAFNAAEQHLGVTKLLDPEADVSVDQPDEKSIITYVVSFYHYFSKMKALAVEGKRIGKVLDSAIEADRMVERYESLASELLEWIGRTITALNSRDFPNSLVGVQQQLHAFSSYRTVEKPPKFTEKGNLEVLLFTIQSKMRANNQKVYTPREGKLVAEINRAWERLEKAEHGRELALRDELIRQEKLEQLARRFDRKAAMRETWLAENQRLVMQDNFGADLAAVEAATKKHEAIETDMAAYEGRVRAVEGVARELEAERYHEVARVVRRRDGVLQLWRRLQELLAARRTRLEMTLALQRAFHEMLYTGAWMDEMKLRLLSQECGKHLLGVEDLLQKHALVEADVAAQADRVKAVNAAALRFAEEVDG-----YRPCDPEVASERAGQLEASYAELCALCAARRARLEEARALHLFLWEAEEVEAWVRQVEPLLASEDAGHDLAAVLRLLARHRAFEDELSGRRAQLQQTLRLGEEEKREAERDAQAARARSAELDKLWASLELAASRRAERLRASEALHQLLSDSADVEAWARDASLLVAAGGDVGNDEFSTQALARKHRDVVEEIEGY--RIDSLQEQAAALPASLAEPAGVRERLRRLEEAYGELAALAAERGRRLQDALALYTIHSETAACLLWLDEKSQWLDALDIPEKLEDLEVVQHRFESLEPEMNGLASRVAVVNQLARQLLGSEHASEDDIKAKQDLLNARWSEFRELAESKKEALQAQLTLQSFQLECHETQAWIREKTRLIESTQGLGNDLAGVMALQRKLSGMERDLAAIEVKVGDLQGEAERLAQHHPERAGAVRGQLADTADVWGALRGTLRAREDSLGEASKLQKFLQDVDDFQAWLSKTQKAVASEDVPSTLPEAEKLLAQHEAIKNEISNYSEDHRRMREMGEEVTRDQSDPQHVFLRQRLQALHTGWAELHSMWDNRRALLAACHAYLAFARDARQADGVLSNQEYALSRVEMPATLQSAEAAIKKHEELTTSMEANDEKVGSVLDTGRKLVGEGNFNADKIQEKMDSI 1153          

HSP 2 Score: 120.168 bits (300), Expect = 3.675e-27
Identity = 150/594 (25.25%), Postives = 245/594 (41.25%), Query Frame = 1
Query: 4531 FLRNLDDQKAWVDDKLLLAESTNFGNNLLTVQQLLRRHRYLATEVNNHKPQLEYLKEEGAVLIEEVSPMQREKFVAGLQ--ELESLWNRLEHSIDLRQQRLKESEATQTFLFDAEEAESWLWEQELFLLSEERGIRDQEAAINVIKKHDARQKTIEDYGEEITKLGTRSRLLIEK-DHPQADRIALAQSHVDKVYAGLRDLCLEKKQRLSEIQKLNHLYREIVDLENWIYERTLVASSHDLGVDFEHCCLLRERFDEFFHETHLLGKDRVKAANDLCASLISQCHADSAEIAQWHDRINDSWAELQELMQTRIQLLRTAWEFYKYLSSCQDVLDRICEKIASIPT--DVSKDSQSVAIQQRKHATFLSDAQALEGQVQWVVDEANHLL---PSYAGQKEWHICERRDDVLATWNQLNMQAERRRHQLEDAADLQRFFSMVRELLQWMDLVALQINEKTRPKDVSGVELLINDHRSIKAEIAAREESMSICVNLGRTLLHRGRVGVDEV--RAALINLITRKYSLEDMWEERWDYLQLILEVYQFARDASVAEAWILAQEPYLANKTLGETLDETLSLLKKHINFEKTVMSQEER 6282
            FL   ++ +AWV     L  S + G++L  V +LL RHR    E++  + QL+     G    EE    +R+   A  +  EL+ LW  LE +   R +RL+ SEA    L D+ + E+W  +  L + +      D+ +   + +KH    + IE Y   I  L  ++  L      P   R  L    +++ Y  L  L  E+ +RL +   L  ++ E      W+ E++    + D+    E   +++ RF+    E + L   RV   N L   L+   HA   +I    D +N  W+E +EL +++ + L+       +   C +    I EK   I +   +  D   V   QRK +    D  A+E +V  +  EA  L    P  AG     + +  D     W  L      R   L +A+ LQ+F   V +   W+      +  +  P  +   E L+  H +IK EI+   E       +G  +  R +     V  R  L  L T    L  MW+ R   L        FARDA  A+  +  QE  L+   +  TL    + +KKH     ++ + +E+
Sbjct:  544 FLWEAEEVEAWVRQVEPLLASEDAGHDLAAVLRLLARHRAFEDELSGRRAQLQQTLRLGE---EEKREAERDAQAARARSAELDKLWASLELAASRRAERLRASEALHQLLSDSADVEAWARDASLLVAAGGDVGNDEFSTQALARKHRDVVEEIEGY--RIDSLQEQAAALPASLAEPAGVRERL--RRLEEAYGELAALAAERGRRLQDALALYTIHSETAACLLWLDEKSQWLDALDIPEKLEDLEVVQHRFESLEPEMNGLA-SRVAVVNQLARQLLGSEHASEDDIKAKQDLLNARWSEFRELAESKKEALQAQLTLQSFQLECHETQAWIREKTRLIESTQGLGNDLAGVMALQRKLSGMERDLAAIEVKVGDLQGEAERLAQHHPERAGAVRGQLADTAD----VWGALRGTLRAREDSLGEASKLQKFLQDVDDFQAWLSKTQKAVASEDVPSTLPEAEKLLAQHEAIKNEISNYSEDHRRMREMGEEVT-RDQSDPQHVFLRQRLQALHTGWAELHSMWDNRRALLAACHAYLAFARDARQADGVLSNQEYALSRVEMPATLQSAEAAIKKHEELTTSMEANDEK 1124          

HSP 3 Score: 113.62 bits (283), Expect = 3.646e-25
Identity = 190/838 (22.67%), Postives = 356/838 (42.48%), Query Frame = 1
Query: 2614 RVLRKADTVKTWIDEKEKLLMSLIPTDELEELEVFRHRFDGFEKEMNIQADQVEFVNTLAEKLSDMDHPQIADVVNKRFELNKLWNSLADLVEARREQLQTSYEFNQYLLECKQTGEWIRE-KSRLVESTDELGDDLAGIMQLQRRMGGMQRDM-------DAIRAKLEHLDEEMDTLIAKRPNXXXXXXXXXXXXXXFWAELGDMLADRDDRLSESSELQRFLQDLDHIHIWLSKMQTTVASEDLPKDLADAEKSLVQHEQLKEEIDSYQDEFIRLLDYGRRITEDKTDAQYMFLSQRLNA--LEEGWQELCQMWENRXXXXXXXXXXXVFLRDAIQSEVLLAQEENFL--SKEDIPISIENSQNLLRKHEGFLTTLQANHDHTIA--VIEFGRNLVERGHFCSDKINLRVKSILXXXXXXXXXXXXAYEKLKDQVLYQELSQDIDDLSKWIQEKM----IIATDESFREEKNIARRYNRHRAFDEEIQANKDRLCQAIDYAMQIVEERPQLADMIYPQIDSLNQQWEELEQTTFLKGEKMIEANREAIFEEGTMDVMTWLXXXXXXXXXXXXXXXXXXXXXXKLKKVEEADNEMEIKRKQIQDLKMHAAKLKEEQPEKAFGIEQKHLILEHRFTQLQMPXXXXXXXXXXXXXXXXFLRNLDDQKAWVDDKLLLAESTNFGNNLLTVQQLLRRHRYLATEVNNHKPQLEYLKEEGAVLIEEVSPMQREKFVAGLQELESLWNRLEHSIDLRQQRLKESEATQTFLFDAEEAESWLWEQELFLLSEERGIRDQEAAINVIKKHDARQKTIEDYGEEITKLGTRSRLLIEKDHPQADRI 5073
            R  RKA   +TW+ E ++L+M      +L  +E    + +  E +M     +V  V  +A +L    + ++A VV +R  + +LW  L +L+ ARR +L+ +    +   E   TG W+ E K RL+  + E G  L G+  L ++   ++ D+        A+ A      EE+D     RP D E+  E    LE  +AEL  + A R  RL E+  L  FL + + +  W+ +++  +ASED   DLA   + L +H   ++E+   + +  + L  G    E+K +A+    + R  +  L++ W  L      R   L  S +L   L D+   E   A++ + L  +  D+     ++Q L RKH   +  ++     ++         +L E        +  R++ + E        + E   +L+D +    +  +      W+ EK      +   E   + + +  R+    + + E+     R+      A Q++       D I  + D LN +W E  +    K E +        F+    +   W+      I  T+     L  V    +K+   + ++     ++ DL+  A +L +  PE+A  +  +       +  L+  ++ ++  L +  ++Q+FL+++DD +AW+        S +  + L   ++LL +H  +  E++N+      ++E G  +  + S  Q       LQ L + W  L    D R+  L    A   F  DA +A+  L  QE + LS        ++A   IKKH+    ++E   E++  +    R L+ + +  AD+I
Sbjct:  327 RFDRKAAMRETWLAENQRLVMQDNFGADLAAVEAATKKHEAIETDMAAYEGRVRAVEGVARELEAERYHEVARVVRRRDGVLQLWRRLQELLAARRTRLEMTLALQRAFHEMLYTGAWMDEMKLRLL--SQECGKHLLGVEDLLQKHALVEADVAAQADRVKAVNAAALRFAEEVD---GYRPCDPEVASERAGQLEASYAELCALCAARRARLEEARALHLFLWEAEEVEAWVRQVEPLLASEDAGHDLAAVLRLLARHRAFEDELSGRRAQLQQTLRLGE---EEKREAERDAQAARARSAELDKLWASLELAASRRAERLRASEALHQLLSDSADVEAW-ARDASLLVAAGGDVGNDEFSTQALARKHRDVVEEIEGYRIDSLQEQAAALPASLAEPA-----GVRERLRRLEEAYGELAALAAERGRRLQDALALYTIHSETAACLLWLDEKSQWLDALDIPEKLEDLEVVQHRFE---SLEPEMNGLASRVAVVNQLARQLLGSEHASEDDIKAKQDLLNARWSEFRELAESKKEALQAQLTLQSFQLECHETQAWIREKTRLIESTQGLGNDLAGVMALQRKLSGMERDLAAIEVKVGDLQGEAERLAQHHPERAGAVRGQLADTADVWGALRGTLRAREDSLGEASKLQKFLQDVDDFQAWLSKTQKAVASEDVPSTLPEAEKLLAQHEAIKNEISNYSEDHRRMREMGEEVTRDQSDPQHVFLRQRLQALHTGWAELHSMWDNRRALLAACHAYLAFARDARQADGVLSNQE-YALSRVEMPATLQSAEAAIKKHEELTTSMEANDEKVGSVLDTGRKLVGEGNFNADKI 1146          

HSP 4 Score: 77.411 bits (189), Expect = 4.294e-14
Identity = 133/604 (22.02%), Postives = 254/604 (42.05%), Query Frame = 1
Query: 4531 FLRNLDDQKAWVDDKLLLAESTNFGNNLLTVQQLLRRHRYLATEVNNHKPQLEYL----KEEGAVLIEEVSPMQREKFVAGLQELESLWNRLEHSIDLRQQRLKESEATQTFLFDAEEAESWLWEQELFLLSEERGIRDQEAAINVIKKHDARQKTIEDYGEEITKLGTRS-RLLIEKD--HPQADRIALAQS-HVDKVYAGLRDLCLEKKQRLSEIQKLNHLYREIVDLENWIYERTLVASSHDLGVDFEHCCLLRERFDEF----------FHETHLLGKD-RVKAANDLCASLISQCHADSAEIAQWHDRINDSWAELQELMQTRIQLLRTAWEFYKYLSSCQDV--LDRICEKIASIPTDVSKDSQSVAIQQRKHATFLSDAQALEGQVQWVVDEANHLLPSYAGQKEWHICERRDDVLATWNQLNMQAERRRHQLEDAADLQRFFSMVRELLQWMDLVALQINEKTRPKDVSGVELLINDHRSIKAEIAAREESMSICVNLGRTLLHRGRVGVDEVRAALINLITRKYSLEDMWEERWDYLQLILEVYQFARDASVAEAWILAQEPYL-ANKTLGETLDETLSLLKKHINFEKTVMSQE 6276
            F R    ++ W+ +   L    NFG +L  V+   ++H  + T++  ++ ++  +    +E  A    EV+ + R +       +  LW RL+  +  R+ RL+ + A Q    +     +W+ E +L LLS+E G +      ++++KH   +  +    + +  +   + R   E D   P    +A  ++  ++  YA L  LC  ++ RL E + L+    E  ++E W+ +   + +S D G D      L  R   F            +T  LG++ + +A  D  A+      A SAE+    D++   WA L+     R + LR +   ++ LS   DV    R    + +   DV  D  S     RKH   + +   +EG     + E    LP+   +    + ER   +   + +L   A  R  +L+DA  L    S     L W+D  +  ++    P+ +  +E++ +   S++ E+      +++   L R LL       D+++A    L  R     ++ E + + LQ  L +  F  +    +AWI  +   + + + LG  L   ++L +K    E+ + + E
Sbjct:  328 FDRKAAMRETWLAENQRLVMQDNFGADLAAVEAATKKHEAIETDMAAYEGRVRAVEGVARELEAERYHEVARVVRRR-----DGVLQLWRRLQELLAARRTRLEMTLALQRAFHEMLYTGAWMDEMKLRLLSQECG-KHLLGVEDLLQKHALVEADVAAQADRVKAVNAAALRFAEEVDGYRPCDPEVASERAGQLEASYAELCALCAARRARLEEARALHLFLWEAEEVEAWVRQVEPLLASEDAGHDLAAVLRLLARHRAFEDELSGRRAQLQQTLRLGEEEKREAERDAQAA-----RARSAEL----DKL---WASLELAASRRAERLRASEALHQLLSDSADVEAWARDASLLVAAGGDVGNDEFSTQALARKHRDVVEE---IEGYRIDSLQEQAAALPASLAEPA-GVRERLRRLEEAYGELAALAAERGRRLQDALALYTIHSETAACLLWLDEKSQWLDALDIPEKLEDLEVVQHRFESLEPEMNGLASRVAVVNQLARQLLGSEHASEDDIKAKQDLLNARWSEFRELAESKKEALQAQLTLQSFQLECHETQAWIREKTRLIESTQGLGNDLAGVMALQRKLSGMERDLAAIE 909          

HSP 5 Score: 62.3882 bits (150), Expect = 1.517e-9
Identity = 82/309 (26.54%), Postives = 129/309 (41.75%), Query Frame = 1
Query: 5557 DVSKDSQSVAIQQRKHATFLSDAQALEGQVQWVVDEANHLLPSYAGQKEWH----ICERRDDVLATWNQLNMQAERRRHQLEDAADLQRFFSMVRELLQWMDLVALQINEKTRPKDVSGVELLINDHRSIKAEIAAREESMSICVNLGRTLLHRGRVGVDEVRAALINLIT-RKYSLEDMWEE-------RWDYLQLILEVYQFARDASVAEAWILAQEPYLANKTLGETLDETLSLLKKHINFEKTV------------MSQEERFEALEKLTTMEIRAKEITK--ESILLKDKHKQERIENAIKIFQ 6405
            +   D  +V    +KH    +D  A EG+V+ V   A  L       + +H    +  RRD VL  W +L      RR +LE    LQR F  +     WMD + L++  +   K + GVE L+  H  ++A++AA+ + +   VN       R    VD  R     + + R   LE  + E       R   L+    ++ F  +A   EAW+   EP LA++  G  L   L LL +H  FE  +            + +EE+ EA         R+ E+ K   S+ L    + ER+  +  + Q
Sbjct:  350 NFGADLAAVEAATKKHEAIETDMAAYEGRVRAVEGVARELEA-----ERYHEVARVVRRRDGVLQLWRRLQELLAARRTRLEMTLALQRAFHEMLYTGAWMDEMKLRLLSQECGKHLLGVEDLLQKHALVEADVAAQADRVK-AVNAAAL---RFAEEVDGYRPCDPEVASERAGQLEASYAELCALCAARRARLEEARALHLFLWEAEEVEAWVRQVEPLLASEDAGHDLAAVLRLLARHRAFEDELSGRRAQLQQTLRLGEEEKREAERDAQAARARSAELDKLWASLELAASRRAERLRASEALHQ 649          
BLAST of Spectrin beta chain vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004049.1 (pep scaffold:Pmarinus_7.0:GL476488:489896:554954:1 gene:ENSPMAG00000003699.1 transcript:ENSPMAT00000004049.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 952.199 bits (2460), Expect = 0.000e+0
Identity = 496/965 (51.40%), Postives = 687/965 (71.19%), Query Frame = 1
Query:  187 AGEREKVQKKTFTKWINSHLNKLKQSIDDLYNXXXXXXXXXXXXXXXXXXXXPYPTKGKMRIHCLENVDKSLNFLIEQRVHLENMGAHDIVDGNARLTLGLIWTIILRFQIQDIVVEEDDTSEKRQAKDALLLWCQMKTAGYPNTNVRNFSTCWRDGLAFNAIIHRHRPDLLEYSALSRSNPNENLEQAIRIAEEKLGIPRLLDPEDVSVENPDEKSIMTYVVTFYHFFSKMKADSVHSKRVGKILSQSMETEEMMVHYDKLTSNLLEWINQTIELLNDRTFANSLSGVQQQLAAFNTYRVTEKPPKFQEKGNLEMLLFSIQSQMRANNQMPYLPIEGKLISDINNAWNKLDKAEHARELALRDELIRQEKLEQLALRFDRKAGMREAWLTENQRLITQDNFGQDLSAVEAAGKKHEAIKTDILAYEERVNSVTLVTSELENECYHDVERVLCRRDNVIRLWEKLLDMLAVRKLRLDACYKVQKLFQDIKHLLDLINDLKARLKTEDIGRHLMGVEDLIHKHSLLEIDIRMVGTKIEGIMSDAQPFINSEFGLGSGDFQPADPNEVILRTVNLKEEYDNLLELSRNRKDNLSASKVMWEFLWGVADEEQWMKEKIQLMLNPDLGHDLSSVHRLISKHKVIEEDVRNHSNYLQNVIQGGQQLILDKNPGAEKVADXXXXXXXXXXXXXXXXXXRRSKLEQSLAYFHCLADCGEVEIWIIEQVKLVKIDETSINEESIITDIHKHEQLSKSIEDYESNINSLDEQVKKLSEGDLELVTIEEKVSNIKSQYAILIELTNQKQNKLTDTLSLFRVLRKADTVKTWIDEKEKLLMSLIPTDELEELEVFRHRFDGFEKEMNIQADQVEFVNTLAEKLSDMDHPQIADVVNKRFELNKLWNSLADLVEARREQLQTSYEFNQYLLECKQTGEWIREKSRLVESTDELGDDLAGIMQLQRRMGGMQRDMDAI 3081
            A ERE+VQKKTFTKW+NSHL+++   I DLY DL+DG+ML+ LLE+LSGE+LP PTKGKMRIHCLENV+K+L FL EQRVHLENMG+HDIVDGN RLTLGLIWTIILRFQIQDI VE +D+ E + AKDALLLWCQMKTAGYPN  V NF+T WRDGLAFNA+IH+HRPDL+++ AL  ++P  N++ A  +AE+KLG+ +LLD ED++VE+PDEKS++TYVVT+YH+FSKMKA +V  KR+GK+L  +MET++M+  YD L S+LL+WI QTI +LN+RTFANSL+GVQQQL AF++YR  EKP KF EKGNLE+LLF+IQS+MRANNQ  +LP EGKLIS+IN AW +L+KAEH RELALR+ELIRQEKLEQLA RFDRKA MRE+WLTENQ L+ QDNFG DL+AVEAA KKHEAI+TD+ AYEERV++V  V  EL+ E YHDV RV  RRDNV+RLW  L ++L  R+ RL+A   +Q+   ++ HLL  + +LK RL ++D G+HL+GV+DL+ KH+LLE D  ++ T++  + + A+ F  +  G     +Q  DP  V  R   L+   D LL ++  R+  L  S+ +W+ +  +++EE W++EK +++ + D G DL+S+ RL+SK + +E+++++    ++  +  G+ ++ +++  A+K+A+    L  LW+EL      R+ +LEQ+ A    LAD  + + W ++  +LV   +   +E S      KH  + + I +Y S I  L EQ   L +       + +++SN K QY  L++L  Q++ +L D L+LF++  +AD  + WIDEK+K L  L   ++LE+LEV +HRF+G E EM+ Q  ++  VN +AE L    HP    +  KR  LN  W+     V  ++E L ++     Y LEC++T  WI++K +LV ST +LG+DLAG+M LQR++ G++RD+ AI
Sbjct:    1 ADEREEVQKKTFTKWVNSHLSRVSCRIGDLYADLRDGRMLIKLLEVLSGERLPKPTKGKMRIHCLENVEKALQFLKEQRVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDSREVKSAKDALLLWCQMKTAGYPNVRVHNFTTSWRDGLAFNALIHKHRPDLIDFDALDPADPYGNMQTAFNVAEQKLGLTQLLDAEDIAVEHPDEKSVITYVVTYYHYFSKMKALAVEGKRIGKVLESAMETDQMIEKYDSLASDLLDWIEQTIAILNNRTFANSLTGVQQQLQAFSSYRTVEKPAKFTEKGNLEVLLFTIQSRMRANNQKVFLPGEGKLISEINKAWERLEKAEHERELALREELIRQEKLEQLARRFDRKAAMRESWLTENQCLVLQDNFGSDLAAVEAATKKHEAIETDMAAYEERVHAVLHVAQELQAENYHDVARVAARRDNVLRLWRYLQELLCGRRARLEANVALQRTLHEMLHLLHSMEELKGRLLSQDFGKHLLGVDDLLQKHALLEADAAVLATRVHNVTAAARKFAENSDG-----YQACDPQVVSARVAMLEGCLDELLRMAAERRAGLLESRRLWKLVGEISEEEAWIREKERILSSDDFGRDLTSIVRLLSKQRALEDELQHREQRVRQAVADGRGMVEERHFAADKIAERAGNLLSLWSELGRAAALRKLRLEQA-ASLQFLADADDADAWTMDHFRLVSSGDIGHDEFSTQALAKKHRDIVEEIGNYASAIRGLQEQADALPDEVARCGGVSDRMSNTKQQYGDLLQLAAQRKQQLDDALALFKLFSEADACELWIDEKQKWLDQLEIPEKLEDLEVVQHRFEGLEPEMSAQDSRIGVVNGVAEHLIRDGHPSETAIHAKRDNLNSRWDVFRKHVAQKKEALLSALSIQNYHLECRETNSWIQDKIKLVASTQDLGNDLAGVMALQRKLFGIERDLAAI 959          

HSP 2 Score: 52.373 bits (124), Expect = 1.473e-6
Identity = 139/654 (21.25%), Postives = 252/654 (38.53%), Query Frame = 1
Query: 4561 WVDDKLLLAESTNFGNNLLTVQQLLRRHRYLATEVNNHKPQLEYLKEEGAVLIEEVSPMQREK----FVAG----LQELESLWNRLEHSIDLRQQRLKESEATQTFL------FDAEEA--ESWLWEQELFLLSEERGIRDQEAAINVIKKHDARQKTIEDYGEEITKLGTRSRLLIEKDHPQADRIALAQSHVDKVYAGLRDLCLEKKQRLSEIQKLNHLYREIVDLENWIYERTLVASSHDLGVDFEHCCLLRERFDEFFHETHLLGKDRVKAANDL----CASLISQCHADSAEIAQWHDRINDSWAELQELMQTRIQLL---------------------RTAWEFYKYLSSCQDVLDRICEKIASIPTDVSKDSQSVAIQQRKHATFLSDAQALEGQVQWVVDEANHLLPS--YAGQKEWHICERRDDVLATWNQLNMQAERRRHQLEDAADLQRFFSMVRELLQW-MDLVALQINEKTRPKDVSGVELLINDHRSIKAEIAAREESMSICVNLGRTLLHRGRVGVDEVRAALINLITRKYSLEDMW----EERWDYLQL----------ILEVYQFARDASVAEAWILAQEPYLANKTLGETLDETLSLLKKHINFEKTVMSQEERFEALEKLTTMEIRAKEITKESI 6348
            W++  + +  +  F N+L  VQQ L   +  ++     KP     K    VL+  +    R      F+ G    + E+   W RLE +   R+  L+E    Q  L      FD + A  ESWL E +  +L +  G  D  A     KKH+A +  +  Y E +  +   ++ L  +++    R+A  + +V +++  L++L   ++ RL     L     E++ L + + E      S D G                    HLLG D +   + L     A L ++ H  +A   ++ +  +   A   +++  R+ +L                     R  W+    +S  ++   R  E+I S   D  +D  S+     K      + Q  E +V+  V +   ++    +A  K   I ER  ++L+ W++L   A  R+ +LE AA LQ F +   +   W MD   L ++      D    + L   HR I  EI     ++                G+ E   AL + + R   + D      ++  D LQL           L +++   +A   E WI  ++ +L    + E L++   +  +    E  + +Q+ R   +  +    IR    ++ +I
Sbjct:  269 WIEQTIAILNNRTFANSLTGVQQQL---QAFSSYRTVEKPAKFTEKGNLEVLLFTIQSRMRANNQKVFLPGEGKLISEINKAWERLEKAEHERELALREELIRQEKLEQLARRFDRKAAMRESWLTENQCLVLQDNFG-SDLAAVEAATKKHEAIETDMAAYEERVHAVLHVAQELQAENYHDVARVAARRDNVLRLWRYLQELLCGRRARLEANVALQRTLHEMLHLLHSMEELKGRLLSQDFG-------------------KHLLGVDDLLQKHALLEADAAVLATRVHNVTAAARKFAENSDGYQACDPQVVSARVAMLEGCLDELLRMAAERRAGLLESRRLWKLVGEISE-EEAWIREKERILS-SDDFGRDLTSIVRLLSKQRALEDELQHREQRVRQAVADGRGMVEERHFAADK---IAERAGNLLSLWSELGRAAALRKLRLEQAASLQ-FLADADDADAWTMDHFRL-VSSGDIGHDEFSTQALAKKHRDIVEEIGNYASAIR---------------GLQEQADALPDEVARCGGVSDRMSNTKQQYGDLLQLAAQRKQQLDDALALFKLFSEADACELWIDEKQKWLDQLEIPEKLEDLEVVQHRFEGLEPEMSAQDSRIGVVNGVAEHLIRDGHPSETAI 877          

HSP 3 Score: 51.6026 bits (122), Expect = 2.364e-6
Identity = 116/600 (19.33%), Postives = 246/600 (41.00%), Query Frame = 1
Query: 4531 FLRNLDDQKAWVDDKLLLAESTNFGNNLLTVQQLLRRHRYLATEVNNHKPQLEYLKEEGAVLIEEVSPMQREKF------VAGLQELESLWNRLEHSIDLRQQRLKESEATQTFLFDAEEAESWLWEQELFLLSEERGIRDQEAAINVIKKHDARQKTIEDYGEEITKLGTRSRLLIEKDH------PQ--ADRIALAQSHVDKVYAGLRDLCLEKKQRLSEIQKLNHLYREIVDLENWIYERTLVASSHDLGVDFEHCCLL----RERFDEFFHETHLLGKDRVKAANDLCASLISQCHADSAEIAQWHDRINDSWAELQELMQTRIQLLRTAWEFYKYLSSCQDVLDRICEKIASIPT-DVSKDSQSVAIQQRKHATFLSDAQALEGQVQWVVDEANHLLPSYAGQKEWHICERRDDVLATWNQLNMQAERRRHQLEDAADLQRFFSMVRELLQWMDLVALQINEKTRPKDVSGVELLINDHRSIKAEIAAREESMSICVNLGRTLLHRGRVGVDEVRAALINLITRKYSLEDMWEERWDYLQLILEVYQFARDASVAEAWILAQEPYLAN-KTLGETLDETLSLLKKHINFEKTVMS 6270
            F R    +++W+ +   L    NFG++L  V+   ++H  + T++  ++ ++         ++     +Q E +       A    +  LW  L+  +  R+ RL+ + A Q  L +       + E +  LLS++ G +      ++++KH   +         +  +   +R   E         PQ  + R+A+ +  +D++   LR +  E++  L E ++L  L  EI + E WI E+  + SS D G D      L    R   DE  H      + RV+ A      ++ + H  + +IA+    +   W+EL      R   L  A    ++L+   D      +    + + D+  D  S     +KH   + +       ++ + ++A+ L    A  +   + +R  +    +  L   A +R+ QL+DA  L + FS       W+D     +++   P+ +  +E++ +    ++ E++A++  + +   +   L+  G      + A   NL +R         ++ + L   L +  +  +     +WI  +   +A+ + LG  L   ++L +K    E+ + +
Sbjct:  379 FDRKAAMRESWLTENQCLVLQDNFGSDLAAVEAATKKHEAIETDMAAYEERVH-------AVLHVAQELQAENYHDVARVAARRDNVLRLWRYLQELLCGRRARLEANVALQRTLHEMLHLLHSMEELKGRLLSQDFG-KHLLGVDDLLQKHALLEADAAVLATRVHNVTAAARKFAENSDGYQACDPQVVSARVAMLEGCLDEL---LR-MAAERRAGLLESRRLWKLVGEISEEEAWIREKERILSSDDFGRDLTSIVRLLSKQRALEDELQHR-----EQRVRQAVADGRGMVEERHFAADKIAERAGNLLSLWSELGRAAALRKLRLEQAASL-QFLADADDADAWTMDHFRLVSSGDIGHDEFSTQALAKKHRDIVEEIGNYASAIRGLQEQADALPDEVA--RCGGVSDRMSNTKQQYGDLLQLAAQRKQQLDDALALFKLFSEADACELWIDEKQKWLDQLEIPEKLEDLEVVQHRFEGLEPEMSAQDSRIGVVNGVAEHLIRDGHPSETAIHAKRDNLNSRWDVFRKHVAQKKEALLSALSIQNYHLECRETNSWIQDKIKLVASTQDLGNDLAGVMALQRKLFGIERDLAA 958          

HSP 4 Score: 51.6026 bits (122), Expect = 2.847e-6
Identity = 73/310 (23.55%), Postives = 143/310 (46.13%), Query Frame = 1
Query: 3286 WLSKMQTTVASEDLPKDLADAEKSLVQHEQLKEEIDSYQDEFIRLLDYGRRITEDKTDAQYMFLSQRLNALEEGWQELCQMWENRXXXXXXXXXXXVFLRDAIQSEVLLAQEENFLSKEDIPISIENSQNLLRKH---EGFLTTLQAN-HDHTIAVIEFGRNLVERGHFCSDK--INLRVKSILXXXXXXXXXXXXAYEKLKDQVLYQELSQDIDDLSKWIQEK-MIIATDESFREEKNIARRYNRHRAFDEEIQANKDRLCQAIDYAMQIVEERPQLADMIYPQIDSLNQQWEELEQTTFLKGEKMIEA 4194
            WL++ Q  V  ++   DLA  E +  +HE ++ ++ +Y++    +L   + +  +         ++R N L   W+ L ++   R+  L  +++LQ  L + +     + + +  L  +D    +    +LL+KH   E     L    H+ T A  +F  N    G+   D   ++ RV  +    +   R + E    L +     +L  +I +   WI+EK  I+++D+  R+  +I R  ++ RA ++E+Q  + R+ QA+     +VEER   AD I  +  +L   W EL +   L+  ++ +A
Sbjct:  389 WLTENQCLVLQDNFGSDLAAVEAATKKHEAIETDMAAYEERVHAVLHVAQELQAENYHDVARVAARRDNVLRL-WRYLQELLCGRRARLEANVALQRTLHEMLHLLHSMEELKGRLLSQDFGKHLLGVDDLLQKHALLEADAAVLATRVHNVTAAARKFAEN--SDGYQACDPQVVSARVAMLEGCLDELLRMAAERRAGLLESRRLWKLVGEISEEEAWIREKERILSSDDFGRDLTSIVRLLSKQRALEDELQHREQRVRQAVADGRGMVEERHFAADKIAERAGNLLSLWSELGRAAALRKLRLEQA 695          

HSP 5 Score: 51.2174 bits (121), Expect = 3.486e-6
Identity = 67/310 (21.61%), Postives = 135/310 (43.55%), Query Frame = 1
Query: 2614 RVLRKADTVKTWIDEKEKLLMSLIPTDELEELEVFRHRFDGFEKEMNIQADQVEFVNTLAEKLSDMDHPQIADVVNKRFELNKLWNSLADLVEARREQLQTSYEFNQYLLECKQTGEWIRE-KSRLVESTDELGDDLAGIMQLQRRMGGMQRDMDAIRAKLEHLD-------EEMDTLIAKRPNXXXXXXXXXXXXXXFWAELGDMLADRDDRLSESSELQRFLQDLDHIHIWLSKMQTTVASEDLPKDLADAEKSLVQHEQLKEEIDSYQDEFIRLLDYGRRITEDKTDAQYMFLSQRLNALEEGWQEL 3519
            R  RKA   ++W+ E + L++      +L  +E    + +  E +M    ++V  V  +A++L   ++  +A V  +R  + +LW  L +L+  RR +L+ +    + L E       + E K RL+  + + G  L G+  L ++   ++ D   +  ++ ++        E  D   A  P              D   EL  M A+R   L ES  L + + ++     W+ + +  ++S+D  +DL    + L +   L++E+   +    + +  GR + E++  A    +++R   L   W EL
Sbjct:  378 RFDRKAAMRESWLTENQCLVLQDNFGSDLAAVEAATKKHEAIETDMAAYEERVHAVLHVAQELQAENYHDVARVAARRDNVLRLWRYLQELLCGRRARLEANVALQRTLHEMLHLLHSMEELKGRLL--SQDFGKHLLGVDDLLQKHALLEADAAVLATRVHNVTAAARKFAENSDGYQACDPQVVSARVAMLEGCLD---ELLRMAAERRAGLLESRRLWKLVGEISEEEAWIREKERILSSDDFGRDLTSIVRLLSKQRALEDELQHREQRVRQAVADGRGMVEERHFAADK-IAERAGNLLSLWSEL 681          
BLAST of Spectrin beta chain vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000684.1 (pep scaffold:Pmarinus_7.0:GL483163:49540:93186:-1 gene:ENSPMAG00000000623.1 transcript:ENSPMAT00000000684.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 377.096 bits (967), Expect = 7.869e-116
Identity = 211/485 (43.51%), Postives = 312/485 (64.33%), Query Frame = 1
Query:  214 KTFTKWINSHLNKLKQSIDDLYNXXXXXXXXXXXXXXXXXXXXPYPTKGKMRIHCLENVDKSLNFLIEQRVHLENMGAHDIVDGNARLTLGLIWTIILRFQIQDIVVEEDDTSEKRQAKDALLLWCQMKTAGYPNTNVRNFSTCWRDGLAFNAIIHRHRPDLLEYSALSRSNPNENLEQAIRIAEEKLGIPRLLDPED-VSVENPDEKSIMTYVVTFYHFFSKMKADSVHSKRVGKILSQSMETEEMMVHYDKLTSNLLEWINQTIELLNDRTFANSLSGVQQQLAAFNTYRVTEKPPKFQEKGNLEMLLFSIQSQMRANNQMPYLPIEGKLISDINNAWNKLDKAEHARELALRDELIRQEKLEQLALRFDRKAGMREAWLTENQRLITQDNF-GQDLSAVEAAGKKHEAIKTDILAYEERVNSVTLVTSELENECYHDVERVLCRRDNVIRLWEKLLDMLAVRKLRLDACYKVQKLFQDIKHL 1662
            +TFT W NSHL K    ID +  D +DG  L+LLLE++S E+LP P KGKMR+H + NV+K+L+F+  + V L ++GA +IVDGN ++TLG+IWTIILRF IQDI +E  +TS    AK+ LLLWCQ KTA Y N NV+NF T W+DGLAFNA+IHRHRPDL++Y  L + +P  NL  A  +AE+ L IP++LD ED V+   PDEK+IMTYV  +YH FS  +     + R+ K+L+ + E  ++     +    LLEWIN+TI +L DR   N++  +Q +L  F  YR   KPPK  +K  LE+   ++Q+++R  N+  ++P EGKL+SDI NAW+ L++AE   E  L +E+ R E+L+ LA +F +KA + ++W    Q+++ Q ++    L+ ++A  KKHEA ++D+ A+++RV  +  +  EL +  YHDV  V  +   +   W+ L +    RK   D+  + +K+ + I HL
Sbjct:    4 QTFTAWCNSHLRKAGTQIDSIDEDFRDGLKLMLLLEVISSERLPKPEKGKMRVHKINNVNKALDFIASKGVKLVSIGAEEIVDGNTKMTLGMIWTIILRFAIQDISIE--NTS----AKEGLLLWCQRKTAPYKNVNVQNFHTSWKDGLAFNALIHRHRPDLIDYDKLRKDDPIGNLNNAFEVAEKYLDIPKMLDAEDIVNTARPDEKAIMTYVSCYYHAFSGAQKAETAANRICKVLAVNHERVDLSCACVRARLQLLEWINRTIPVLEDRNTQNNMPAMQGKLEDFRDYRRVHKPPKAGDKCQLEINFNTLQTKLRLMNRPAFMPSEGKLVSDIGNAWSHLEQAEKGYEEWLLNEIRRLERLDHLAEKFRQKAKIHKSWTEGKQQMLQQKDYESVSLAELKALLKKHEAFESDLAAHQDRVEQIAAIAQELNDLNYHDVASVNTKCKEICDEWDDLGEWTQTRK---DSLSRTEKVLETIDHL 479          
BLAST of Spectrin beta chain vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009295.1 (pep scaffold:Pmarinus_7.0:GL479988:2885:20778:1 gene:ENSPMAG00000008383.1 transcript:ENSPMAT00000009295.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 378.252 bits (970), Expect = 4.571e-112
Identity = 209/484 (43.18%), Postives = 311/484 (64.26%), Query Frame = 1
Query:  217 TFTKWINSHLNKLKQSIDDLYNXXXXXXXXXXXXXXXXXXXXPYPTKGKMRIHCLENVDKSLNFLIEQRVHLENMGAHDIVDGNARLTLGLIWTIILRFQIQDIVVEEDDTSEKRQAKDALLLWCQMKTAGYPNTNVRNFSTCWRDGLAFNAIIHRHRPDLLEYSALSRSNPNENLEQAIRIAEEKLGIPRLLDPED-VSVENPDEKSIMTYVVTFYHFFSKMKADSVHSKRVGKILSQSMETEEMMVHYDKLTSNLLEWINQTIELLNDRTFANSLSGVQQQLAAFNTYRVTEKPPKFQEKGNLEMLLFSIQSQMRANNQMPYLPIEGKLISDINNAWNKLDKAEHARELALRDELIRQEKLEQLALRFDRKAGMREAWLTENQRLITQDNFGQ-DLSAVEAAGKKHEAIKTDILAYEERVNSVTLVTSELENECYHDVERVLCRRDNVIRLWEKLLDMLAVRKLRLDACYKVQKLFQDIKHL 1662
            TFT W NSHL K    I+++  D ++G  L+LLLE++SGE+L  P +GKMR+H + NV+K+L+F+  + V L ++GA +IVDGNA++TLG+IWTIILRF IQDI VEE        AK+ LLLWCQ KTA Y N NV+NF   W+DGLAFNA+IHRHRPDL++Y  L + +P  NL  A  +AE+ L IP++LD ED V    PDEK+IMTYV  +YH FS  +     + R+ K+L+ + E E++M  Y+ + S+LL+WI +T   L +R   N++  +Q +L  F  YR   KPPK QEK  LE+   ++Q+++R  N+  ++P EGK++SDI N W+ L++AE   E  L +E+ R E+L+ LA +F +KA + EAW    + ++ + ++    L+ ++A  +KHEA ++D+ A+++RV  +  +  EL    YHDV  V  R  ++   W+KL D+   RK   D   + +K+ + I  L
Sbjct:    1 TFTAWCNSHLRKAGTGIENIDEDFRNGLKLMLLLEVISGERLAKPERGKMRVHKISNVNKALDFIASKGVKLVSIGAEEIVDGNAKMTLGMIWTIILRFAIQDISVEE------TSAKEGLLLWCQRKTAPYKNVNVQNFHISWKDGLAFNALIHRHRPDLIDYEKLRKDDPITNLNNAFEVAEKYLDIPKMLDAEDIVGTARPDEKAIMTYVSCYYHAFSGAQKAETAANRICKVLAVNQENEKLMEDYEHMASDLLDWIRRT-PWLENRVPENTMQAMQGKLEGFRDYRRVHKPPKAQEKCQLEISFNTLQTKLRLMNRPAFMPSEGKMVSDIANGWSMLEQAEKGYEEWLLNEIRRLERLDHLAEKFRQKAKIHEAWTAGKEAMLEKRDYDSVSLTELKALLRKHEAFESDLAAHQDRVEQIAAIAQELNELDYHDVASVNARCQDICAEWDKLGDLTQRRK---DTLERTEKVLETIDQL 474          
BLAST of Spectrin beta chain vs. Ensembl Yeast
Match: SAC6 (Fimbrin, actin-bundling protein; cooperates with Scp1p in organization and maintenance of the actin cytoskeleton; phosphorylated by Cdc28p/Clb2p in metaphase on T103, to regulate conformation, and modulate actin filament binding affinity and actin cable dynamics; relocalizes from the plasma membrane to the cytoplasm upon DNA replication stress; human homologs PLS3 and LCP1 implicated in spinocerebellar ataxia type 2 (SCA2) can each complement yeast null mutant [Source:SGD;Acc:S000002536])

HSP 1 Score: 51.9878 bits (123), Expect = 9.951e-7
Identity = 48/159 (30.19%), Postives = 77/159 (48.43%), Query Frame = 1
Query:  367 RIHCLENVDKSLNFLIEQRVHLENMGAHDIVDGNARLTLGLIWTIILRFQIQDIVVEEDDTSEKRQAKDALLLWCQMK-TAGYPNTNVRNFSTCWRDGLAFNA-----IIHRHRPDLLEYSALSRSNPNE----NLEQAIRIAEEKLGIPRLLDPEDVS 813
            R   LEN + +++    +   L  +   DIVDGN  LTLGL+W  ++R  I  I ++   +S +  +   +L W Q + T G  N+ +R+F    +D    NA     +++   P  ++Y  ++  N  E    N   AI IA  KLG    L PED++
Sbjct:  472 RFKALENTNYAVDLGRAKGFSLVGIEGSDIVDGNKLLTLGLVWQ-LMRRNIS-ITMKTLSSSGRDMSDSQILKWAQDQVTKGGKNSTIRSF----KDQALSNAHFLLDVLNGIAPGYVDYDLVTPGNTEEERYANARLAISIA-RKLGALIWLVPEDIN 623          

HSP 2 Score: 51.6026 bits (122), Expect = 1.630e-6
Identity = 51/177 (28.81%), Postives = 80/177 (45.20%), Query Frame = 1
Query:  346 YPTKGKM--RIHCLENVDKSLNFLIEQRVHLENMGAHDIVDGNARLTLGLIWTIILRFQIQDI----------VVEEDDTSE---KRQAKDALLLWC--QMKTAGYPNTNVRNFSTCWRDGLAFNAIIHRHRPDLLEYSALSRSNPNENLEQAIRIAEEKLGIPRLLDPEDVSVENP 825
            +P KGK        EN +  +N        + N+ + DI++G   L LGLIW II R  +  I          ++E+D+T E   +   +  LL W    +K A + N  V NFS    DG  +  ++++  P L   + L  ++  E  EQ ++ A EKL   + L P  +   NP
Sbjct:  201 WPKKGKELNNFQASENANIVINSAKAIGCVVVNVHSEDIIEGREHLILGLIWQIIRRGLLSKIDIKLHPELYRLLEDDETLEQFLRLPPEQILLRWFNYHLKQANW-NRRVTNFSKDVSDGENYTILLNQLDPALCSKAPLQTTDLMERAEQVLQNA-EKLDCRKYLTPSSLVAGNP 375          
BLAST of Spectrin beta chain vs. Ensembl Nematostella
Match: EDO42431 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1C0])

HSP 1 Score: 1480.69 bits (3832), Expect = 0.000e+0
Identity = 844/2063 (40.91%), Postives = 1305/2063 (63.26%), Query Frame = 1
Query:  154 KLYERFRIKALAGEREKVQKKTFTKWINSHLNKLKQSIDDLYNXXXXXXXXXXXXXXXXXXXXPYPTKGKMRIHCLENVDKSLNFLIEQRVHLENMGAHDIVDGNARLTLGLIWTIILRFQIQDIVVEEDDTSEKRQAKDALLLWCQMKTAGYPNTNVRNFSTCWRDGLAFNAIIHRHRPDLLEYSALSRSNPNENLEQAIRIAEEKLGIPRLLDPEDVSVENPDEKSIMTYVVTFYHFFSKMKADSVHSKRVGKILSQSMETEEMMVHYDKLTSNLLEWINQTIELLNDRTFANSLSGVQQQLAAFNTYRVTEKPPKFQEKGNLEMLLFSIQSQMRANNQMPYLPIEGKLISDINNAWNKLDKAEHARELALRDELIRQEKLEQLALRFDRKAGMREAWLTENQRLITQDNFGQDLSAVEAAGKKHEAIKTDILAYEERVNSVTLVTSELENECYHDVERVLCRRDNVIRLWEKLLDMLAVRKLRLDACYKVQKLFQDIKHLLDLINDLKARLKTEDIGRHLMGVEDLIHKHSLLEIDIRMVGTKIEGIMSDAQPFINSEFGLGSGDFQPADPNEVILRTVNLKEEYDNLLELSRNRKDNLSASKVMWEFLWGVADEEQWMKEKIQLMLNPDLGHDLSSVHRLISKHKVIEEDVRNHSNYLQNVIQGGQQLILDKNPGAEKVADXXXXXXXXXXXXXXXXXXRRSKLEQSLAYFHCLADCGEVEIWIIEQVKLVKIDETSINEESIITDIHKHEQLSKSIEDYESNINSLDEQVKKLSEGDLELVTIEEKVSNIKSQYAILIELTNQKQNKLTDTLSLFRVLRKADTVKTWIDEKEKLLMSLIPTD---ELEELEVFRHRFDGFEKEMNIQADQVEFVNTLAEKLSDMDHPQIADVVNKRFELNKLWNSLADLVEARREQLQTSYEFNQYLLECKQTGEWIREKSRLVESTDELGD--DLAGIMQLQRRMGGMQRDMDAIRAKLEHLDEEMDTLIAKRPNXXXXX--XXXXXXXXXFWAELGDMLADRDDRLSESSELQRFLQDLDHIHIWLSKMQTTVASEDLPKDLADAEKSLVQHEQLKEEIDSYQDEFIRLLDYGRRITEDKTDAQYMFLSQRLNALEEGWQELCQMWENRXXXXXXXXXXXVFLRDAIQSEVLLAQEENFLSKEDIPISIENSQNLLRKHEGFLTTLQANHDHTIAVIEFGRNLVERGHFCSDKINLRVKSILXXXXXXXXXXXXAYEKLKDQVLYQELSQDIDDLSKWIQEKMIIATDESFREEKNIARRYNRHRAFDEEIQANKDRLCQAIDYAMQIVEERPQLADMIYPQIDSLNQQWEELEQTTFLKGEKMIEANREAIFEEGTMDVMTWLXXXXXXXXXXXXXXXXXXXXXXKLKKVEEADNEMEIKRKQIQDLKMHAAKLKEEQPEKAFGIEQKHLILEHRFTQLQMPXXXXXXXXXXXXXXXXFLRNLDDQKAWVDDKLLLAESTNFGNNLLTVQQLLRRHRYLATEVNNHKPQLEYLKEEGAVLIEEVSPMQREKFVAGLQELESLWNRLEHSIDLRQQRLKESEATQTFLFDAEEAESWLWEQELFLLSEERGIRDQEAAINVIKKHDARQKTIEDYGEEITKLGTRSRLLIEKDHPQADRIALAQSHVDKVYAGLRDLCLEKKQRLSEIQKLNHLYREIVDLENWIYERTLVASSHDLGVDFEHCCLLRERFDEFFHETHLLGKDRVKAANDLCASLISQCHADSAEIAQWHDRINDSWAELQELMQTRIQLLRTAWEFYKYLSSCQDVLDRICEKIASIPTDVSKDSQSVAIQQRKHATFLSDAQALEGQVQWVVDEANHLLPSYAGQKEWHICERRDDVLATWNQLNMQAERRRHQLEDAADLQRFFSMVRELLQWMDLVALQINEKTRPKDVSGVELLINDHRSIKAEIAAREESMSICVNLGRTLLHRGRVGVDEVRAALINLITRKYSLEDMWEERWDYLQLILEVYQFARDASVAEAWILAQEPYLANKTLGETLDETLSLLKKHINFEKTVMSQEERFEALEKLTTMEIR 6321
            +L+ER RIK LA ERE+VQKKTFTKWINSHL ++   +++LY+DL+DG+ L+LLLE+LSGE+LP P+KG+MRIH LENV+KSL FL +QRVHLEN+GAHDIVDGN ++TLGLIWTIILRFQIQDI +E  +T+EKR AKDALLLWCQ KT GY +  + NF+T WRDGLAFNAIIHRHRPDL+E+  L++++  +NLEQA  +AE +LGI  LLD EDV+V+ PDEKSI+TYV  +YH+F+KMK   V   R+GK++ +  E EE+++ Y+KL S+LLEWI   I  L +R FAN+L GVQQQ+  FN YR  EKPP+F EKGNLE+ LF + S++RAN+Q PY+P EG+ + DIN AW +L+K+EH RELALR+EL+RQE+LE LA +FDRK  MRE WL ENQRL+  DNFG DL+AVEAA KKHEAI+TDI+AYEERVN++  V  EL  E YHD ER+   +  +I+LWE LL ++  R++RL+ C ++Q++FQ++ +++D ++++K  L +ED G+HL+GVEDL+ KHSL+E DI     +++ + + A+ F++ E   G    +P D  ++      L+  Y+ LL+L+  R+  L  S  +  F     +EE W+ EK   + + D GHDL++   L++KH+ +E ++   +   + V + G++L+       + + + L  +   W++L +    R+ K++++L     +A+  ++  W     ++V  D+   +E S    + KH  + + I+ Y S + +   QV  L + D     + ++ + +  +Y+ L++    ++ KL D LSL ++ R+A  V+TWIDE+E  L + +  D   +LEE +V   RF+GF++E++    +V+ VN L   L +  H    ++      LN  W +L D    +R +L  +    Q+  +  +T  WI EKS L+ + +++ +  DLA +M LQRR+  +QRD+ A+  K   L+ +   L ++   + E    +E+  ++   W E+ D +  RD+ L+ES ELQRF+ DLD   IWL      VASED+P  L++AE+SL +HE +K+EID+++ +F +L++ G +  +D++D Q   L ++L+ L+ GW++L  +WENR+ LL Q+L+ Q+F+RDA Q E LL Q++ FLSKE++  ++E  Q L++KHE F   +    +    +I+F + L   GH+  DKI  + +++ ERR +N+++   A ++L+D +  Q+  QD +D+  W+ EK  +A++ES+R+  NI  +  +H AF+ E+QANK+RL Q  +    + +E+P+    I   +  L+Q+W EL + +  KG K+ +A R+  F  G   +  W++ +   II  E+  +  T   +  +K ++ + ++  K++++++L   AA + +        +++  +ILE ++  L+ P+  K  +L Q  +  QF R++DD++ W+++K  L +STN+GNNL  VQ+L ++H+ L  E++ H+   E +  +G  L+    P Q E      +ELE  W+ L+   D  + +L  S   + + FDA EAESW+ EQEL ++ +ERG +D+ +A  ++K+H+  +  I DY E + +LG  +  L+E +HP++++I + Q+ +DK+YAGL+DL  E++ +L E  KL  L RE+ DLE WI ++  VA S D+G D  HC LL E+F +F  +T  +G +RV + N +C  LI   H+D+A IA+W D IN+SWA+L EL++TR ++L  A E +KY    ++VL  I EK   +  ++ +D  SV   QR H +F +D   L  QV  + +EA  LL SYAG+K   I  + D+V+  W  LN++  +R  +L DA DL RF   V++ + WM+ +   I    + KDVSGVE+L++ H+S   EI  REES    + +G  LL +      E+R  +  L   K  +   W++RW++L LILEV QFARDA  AEAWI+AQE YL N+ LG  L E   LL+KH NFEK V +QEERF ALE+LT  E+R
Sbjct:    8 RLFERSRIKVLADERERVQKKTFTKWINSHLQRVGARVNELYHDLQDGRKLILLLEVLSGEKLPKPSKGRMRIHNLENVEKSLVFLKKQRVHLENVGAHDIVDGNQKITLGLIWTIILRFQIQDITIE-GETTEKRSAKDALLLWCQSKTVGYVHVTITNFTTSWRDGLAFNAIIHRHRPDLIEFEKLTKADAEQNLEQAFEVAETQLGITPLLDAEDVNVDFPDEKSILTYVAAYYHYFAKMKTVEVSGSRIGKVIERIKENEELIIDYEKLASDLLEWIEIKIIQLGEREFANTLLGVQQQMLEFNQYRTQEKPPRFVEKGNLEVQLFILTSKIRANHQKPYIPPEGRGMIDINRAWERLEKSEHERELALREELMRQERLEMLAAKFDRKYAMRETWLNENQRLVAVDNFGNDLAAVEAATKKHEAIETDIMAYEERVNAIVAVAEELHRENYHDSERIQVCKGRIIQLWELLLVLIKQRRVRLEKCMQLQRVFQEMINIIDWMDEIKIGLLSEDYGKHLLGVEDLLQKHSLVEADIAAQADRVKTVNAQAEAFLHVEDEEGKTQHKP-DEAQIRDHQAELEGAYNELLQLAAARRARLEESLKLQSFYRNADEEEMWVTEKDYFVQSTDYGHDLNTAMILLTKHEAVEREMTARNAQTKAVARNGEELLEAVPYATDTIQNRLDTIRSKWDKLHDNAAYRKKKIQENLKLQQFIAEYNDIMSWCDMMERIVANDDLGYDEHSAEVLVKKHHAVEEGIQGYASEVKAFHCQVDGLGDEDKSSPEVVDRCNTLDERYSALLQQAAARRQKLQDALSLHKLNREAYIVETWIDERENRLDTALTVDKGMDLEECQVIEQRFEGFQQELDANERRVQLVNELGGNLIEKGHINSDEIKETIDRLNTRWCNLRDTANQKRAKLDKALRLQQFYAQTLETKTWISEKSSLLITEEDVTNMKDLATVMVLQRRLNNIQRDLPALEDKCTSLENDAQQLCSEYEGEPEEEIVKEKITVVSSSWVEMKDNVKQRDEALAESGELQRFVIDLDDFQIWLRHTHNEVASEDIPNSLSEAERSLKEHEDIKDEIDTHEPDFQKLIEDGPKWAQDESDLQQQSLKEQLDQLQSGWKDLLVLWENRKRLLIQALNHQLFIRDAKQCEALLGQQDLFLSKEEVGATVEAVQELIKKHEEFSKRMDVQDEKINQMIQFAQRLANDGHYAQDKITEKAQNLHERRNANRQKLEAALQRLRDALQLQQFIQDAEDMYDWLNEKHQVASEESYRDLSNIQGKVMKHEAFEAELQANKERLDQISESGRDLADEKPENKPEIDELLQKLDQKWLELAEVSKHKGSKLKDAQRQEEFNAGVQTMQEWVKELETVIITQEKATDLTTATRL-YQKHKQLEKQINAKKERLKELDAQAADMVDAGHFDPNAVQETKIILEEKYECLEAPLAEKGAELDQAMQFFQFDRDVDDEETWINEKEPLLQSTNYGNNLFEVQKLQKKHQTLCAEIDIHQKHKERICNQGDELVLGYHP-QAEDIERRRKELEEKWDDLKKQSDAYKAQLDLSLQAKQYYFDAAEAESWMSEQELNMMGDERG-KDEASATEMLKRHETLEAAIADYAETVNELGETANGLVESNHPESEQIKIRQNQIDKLYAGLKDLAEERRGKLDETLKLYQLNREVDDLELWIADKEQVAGSQDIGQDLAHCELLIEKFRDFARDTTHIGTERVASTNGVCDQLIGTGHSDAATIAEWKDGINESWADLLELIETRTKMLEAALELHKYYHDAKEVLAMIQEKDNLMTEELGRDLNSVQQLQRTHQSFEADLAPLGHQVSGIQEEAGRLLGSYAGEKASEIQAKEDEVVQAWKNLNLRVRQRTDKLHDADDLYRFLIAVQDQMLWMNDMLKHILTYEKAKDVSGVEVLMDQHQSRHVEIEGREESFFGVIKMGEQLLAKSHYASAEIREKINMLHRHKDEMLLEWKKRWEHLGLILEVMQFARDAYTAEAWIMAQESYLRNENLGIDLAEVEKLLEKHGNFEKVVAAQEERFLALERLTQFELR 2065          
BLAST of Spectrin beta chain vs. Ensembl Nematostella
Match: EDO49576 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGP7])

HSP 1 Score: 551.592 bits (1420), Expect = 1.043e-172
Identity = 319/783 (40.74%), Postives = 497/783 (63.47%), Query Frame = 1
Query:  160 YERFRIKALAGEREKVQKKTFTKWINSHLNKLKQSIDDLYNXXXXXXXXXXXXXXXXXXXXPYPTKGKMRIHCLENVDKSLNFLIEQRVHLENMGAHDIVDGNARLTLGLIWTIILRFQIQDIVVEEDDTSEKRQAKDALLLWCQMKTAGYPNTNVRNFSTCWRDGLAFNAIIHRHRPDLLEYSALSRSNPNENLEQAIRIAEEKLGIPRLLDPEDVSVENPDEKSIMTYVVTFYHFFSKMKADSVHSKRVGKILSQSMETEEMMVHYDKLTSNLLEWINQTIELLNDRTFANSLSGVQQQLAAFNTYRVTEKPPKFQEKGNLEMLLFSIQSQMRANNQMPYLPIEGKLISDINNAWNKLDKAEHARELALRDELIRQEKLEQLALRFDRKAGMREAWLTENQRLITQDNFGQDLSAVEAAGKKHEAIKTDILAYEERVNSVTLVTSELENECYHDVERVLCRRDNVIRLWEKLLDMLAVRKLRLDACYKVQKLFQDIKHLLDLINDLKARLKTEDIGRHLMGVEDLIHKHSLLEIDIRMVGTKIEGIMSDAQPFINSEFGLGSGDFQPADPNEVI-LRTVNLKEEYDNLLELSRNRKDNLSASKVMWEFLWGVADEEQWMKEKIQLMLNPDLGHDLSSVHRLISKHKVIEEDVRNHSNYLQNVIQGGQQLILDKNPGAEKVADXXXXXXXXXXXXXXXXXXRRSKLE---QSLAYFHCLADCGEVEIWIIEQVKLVKIDETSINEESIITDIHKHEQLSKSIEDYESNINSLDEQVKKLSEG 2496
            +E+ RIK L  ER   QKKTFTKW+NS L+K    ++DL+ DL DGK+L+ LLEI+SGE++ +  +GK R+H ++NV+K+L FL ++ V LE++GA D+VDGN RL LGLIW IILRFQI DI  ++D + E++ AK+ALLLWCQ  T GYP  +++NFST WR+GLAFNA++H+HRPDL++Y+ L  S    NL  A  +A EKLGI RLLD EDV    PD++S+MTYV  +Y +F+K+K++    +R+ KI+   ME E+M   Y+ + S+LL WI+  I  L  R F  ++  VQ++L AF  +R  EKPPK+ E+ N+E  LF++Q++ +ANNQ P+ P EGKL+ DIN AW  ++ AEH R  ALR+ELIRQ+ LE++A +F RKA +RE+WL +  ++I  +  GQD + VEAA K+HEAI TD+ A EER   V  +  EL +E Y+  + +  R D ++  W+KL+  L  R+  L    ++  +F+D+      + D++A L++ED GRHL+ V++++ KHSL+E  I+    +   I + AQ F+ ++         P    EVI  R   L + +  L++L + R+  L  S  ++ F   V +E+ ++KE  +L  + ++G DL+S+ RL  +H+ +E ++    ++ + +I  GQ LI   + GA+++   +K+L+  W +L EL   RR +L+   QSL Y+   +D  + E W+ E++ +V  ++   +E+S ++ + +H  +   I+ +  +I  L EQ K + E 
Sbjct:    9 FEKDRIKTLKNERIFSQKKTFTKWVNSFLDKSGLHVNDLFEDLADGKILISLLEIISGEKIGFAARGKFRVHNIQNVNKALEFL-QKSVKLESIGAEDVVDGNERLILGLIWMIILRFQIADISYQDDMSKERKSAKEALLLWCQRMTRGYPGVDIQNFSTSWRNGLAFNALLHKHRPDLIDYATLRPSQHEANLNNAFTVAAEKLGITRLLDAEDVDCPRPDDRSVMTYVAAYYQYFAKLKSEETGGRRIAKIIGVIMEIEKMEKSYESMVSDLLHWISSKITELA-RPFEKNIFAVQRELGAFKHFRTVEKPPKYTERVNIEAHLFNLQTKRKANNQRPFAPPEGKLVKDINRAWQVMESAEHERAQALRNELIRQQMLEKMAEKFQRKADLRESWLDDMVQVIDDELLGQDAATVEAALKRHEAISTDVKAREERFQMVFNLAQELIDEDYYKADVIRKREDVIMVKWDKLVKKLEARRNTLTGFTQLVGVFRDMDSAHADMLDIEAGLRSEDYGRHLLDVQNMLDKHSLVESQIQSQHERTLAINTQAQSFVAAK--------HP--ETEVIKQRQRLLTQAFQALVQLGKERRARLEDSLELYTFFEDVEEEDIFIKETDKLAASKEVGRDLASLTRLQQRHEALEAEINGRFSHCEGIIAKGQALIDKGHFGAKEIKAKIKQLQANWIKLKELAGTRRERLKDAAQSLQYY---SDANDAESWMKEKMFVVCSEDYGRDEQSAVSLLQRHSHIEDEIKAFADDIAQLKEQSKLMGEA 776          

HSP 2 Score: 83.1889 bits (204), Expect = 9.012e-16
Identity = 65/290 (22.41%), Postives = 133/290 (45.86%), Query Frame = 1
Query: 3187 WAELGDMLADRDDRLSESSELQRFLQDLDHIHIWLSKMQTTVASEDLPKDLADAEKSLVQHEQLKEEIDSYQDEFIRLLDYGRRITEDKTDAQYMFLSQRLNALEEGWQELCQMWENRXXXXXXXXXXXVFLRDAIQSEVLLAQEENFLSKEDIPISIENSQNLLRKHEGFLTTLQANHDHTIAVIEFGRNLVERGHFCSDKINLRVKSILXXXXXXXXXXXXAYEKLKDQVLYQELSQDIDDLSKWIQEKMIIATDESF-REEKNIARRYNRHRAFDEEIQANKDRLCQ 4053
            W +L   L  R + L+  ++L    +D+D  H  +  ++  + SED  + L D +  L +H  ++ +I S  +  + +    +     K   +   + QR   L + +Q L Q+ + R+  L  SL L  F  D  + ++ + + +   + +++   + +   L ++HE     +     H   +I  G+ L+++GHF + +I  ++K +       K  +    E+LKD     +   D +D   W++EKM +   E + R+E++      RH   ++EI+A  D + Q
Sbjct:  477 WDKLVKKLEARRNTLTGFTQLVGVFRDMDSAHADMLDIEAGLRSEDYGRHLLDVQNMLDKHSLVESQIQSQHERTLAINTQAQSFVAAK-HPETEVIKQRQRLLTQAFQALVQLGKERRARLEDSLELYTFFEDVEEEDIFIKETDKLAASKEVGRDLASLTRLQQRHEALEAEINGRFSHCEGIIAKGQALIDKGHFGAKEIKAKIKQLQANWIKLKELAGTRRERLKDAAQSLQYYSDANDAESWMKEKMFVVCSEDYGRDEQSAVSLLQRHSHIEDEIKAFADDIAQ 765          

HSP 3 Score: 75.8702 bits (185), Expect = 1.814e-13
Identity = 81/367 (22.07%), Postives = 168/367 (45.78%), Query Frame = 1
Query: 4531 FLRNLDDQKAWVDDKLLLAESTNFGNNLLTVQQLLRRHRYLATEVNNHKPQLEYLKEEGAVLIEE----VSPMQREKFVAGLQELESLWNRLEHSIDLRQQRLKESEATQTFLFDAEEAESWLWEQELFLLSEERGIRDQEAAINVIKKHDARQKTIEDYGEEITKLGTRSRLLIEKDHPQADRIALAQSHVDKVYAGLRDLCLEKKQRLSEIQKLNHLYREIVDLENWIYERTLVASSHDLGVDFEHCCLLRERFDEFFHETHLLGKDRVKAANDLCA---SLISQCHADSAEIAQWHDRINDSWAELQELMQTRIQLLRTAWEFYKYLSSCQDVLDRICEKIASIPT-DVSKDSQSVAIQQRKHA 5607
            F R  D +++W+DD + + +    G +  TV+  L+RH  ++T+V   + + + +      LI+E       +++ + V  ++     W++L   ++ R+  L           D + A + + + E  L SE+ G R      N++ KH   +  I+   E    + T+++  +   HP+ + I   Q  + + +  L  L  E++ RL +  +L   + ++ + + +I E   +A+S ++G D      L++R +    E  + G  R      + A   +LI + H  + EI     ++  +W +L+EL  TR + L+ A +  +Y S   D    + EK+  + + D  +D QS     ++H+
Sbjct:  394 FQRKADLRESWLDDMVQVIDDELLGQDAATVEAALKRHEAISTDVKAREERFQMVFNLAQELIDEDYYKADVIRKREDVIMVK-----WDKLVKKLEARRNTLTGFTQLVGVFRDMDSAHADMLDIEAGLRSEDYG-RHLLDVQNMLDKHSLVESQIQSQHERTLAINTQAQSFVAAKHPETEVIKQRQRLLTQAFQALVQLGKERRARLEDSLELYTFFEDVEEEDIFIKETDKLAASKEVGRDLASLTRLQQRHEAL--EAEING--RFSHCEGIIAKGQALIDKGHFGAKEIKAKIKQLQANWIKLKELAGTRRERLKDAAQSLQYYSDANDAESWMKEKMFVVCSEDYGRDEQSAVSLLQRHS 750          

HSP 4 Score: 73.559 bits (179), Expect = 9.109e-13
Identity = 82/396 (20.71%), Postives = 182/396 (45.96%), Query Frame = 1
Query: 2263 RRSKLEQSLAYFHCLADCGEVEIWIIEQVKLVKIDETSINEESIITDIHKHEQLSKSIEDYESNINSLDEQVKKLSEGDL-ELVTIEEKVSNIKSQYAILIELTNQKQNKLTDTLSLFRVLRKADTVKTWIDEKEKLLMSLIPTDELEELEVFRHRFDGFEKEMNIQADQVEFVNTLAEKLSDMDHPQIADVVNKRFELNKLWNSLADLVEARREQLQTSYEFNQYLLECKQTGEWIREKSRLVESTDELGDDLAGIMQLQRRMGGMQRDMDAIRAKLEHLDEEMDTLIAKRPNXXXXXXXXXXXXXXFWAELGDMLADRDDRLSESSELQRFLQDLDHIHIWLSKMQTTVASEDLPKDLADAEKSLVQHEQLKEEIDSYQDEFIRLLDYGRRITE 3447
            R+  LE+    F   AD  E   W+ + V+++  +    +  ++   + +HE +S  ++  E     +    ++L + D  +   I ++   I  ++  L++    ++N LT    L  V R  D+    + + E  L S      L +++    +    E ++  Q ++   +NT A+      HP+   +  ++  L + + +L  L + RR +L+ S E   +  + ++   +I+E  +L  S  E+G DLA + +LQ+R   ++ +++   +  E +  +   LI K     + I+ +   L+  W +L ++   R +RL ++++  ++  D +    W+ +    V SED  +D   A   L +H  +++EI ++ D+  +L +  + + E
Sbjct:  383 RQQMLEKMAEKFQRKADLRES--WLDDMVQVIDDELLGQDAATVEAALKRHEAISTDVKAREERFQMVFNLAQELIDEDYYKADVIRKREDVIMVKWDKLVKKLEARRNTLTGFTQLVGVFRDMDSAHADMLDIEAGLRSEDYGRHLLDVQNMLDKHSLVESQIQSQHERTLAINTQAQSFVAAKHPETEVIKQRQRLLTQAFQALVQLGKERRARLEDSLELYTFFEDVEEEDIFIKETDKLAASK-EVGRDLASLTRLQQRHEALEAEINGRFSHCEGIIAKGQALIDKGHFGAKEIKAKIKQLQANWIKLKELAGTRRERLKDAAQSLQYYSDANDAESWMKEKMFVVCSEDYGRDEQSAVSLLQRHSHIEDEIKAFADDIAQLKEQSKLMGE 775          

HSP 5 Score: 66.2402 bits (160), Expect = 1.351e-10
Identity = 72/347 (20.75%), Postives = 151/347 (43.52%), Query Frame = 1
Query: 2008 EQWMKEKIQLMLNPDLGHDLSSVHRLISKHKVIEEDVRNHSNYLQNVIQGGQQLILDKNPGAEKVADXXXXXXXXXXXXXXXXXXRRSKLEQSLAYFHCLADCGEVEIWIIEQVKLVKIDETSINEESIITDIHKHEQLSKSIEDYESNINSLDEQVKK-LSEGDLELVTIEEKVSNIKSQYAILIELTNQKQNKLTDTLSLFRVLRKADTVKTWIDEKEKLLMSLIPTDELEELEVFRHRFDGFEKEMNIQADQVEFVNTLAEKLSDMDHPQIADVVNKRFELNKLWNSLADLVEARREQLQTSYEFNQYLLECKQTGEWIREKSRLVESTDELGDDLAGIMQLQR 3045
            E W+ + +Q++ +  LG D ++V   + +H+ I  DV+      Q V    Q+LI +    A+ +      + + W++L++  E RR+ L           D       +++    ++ ++   +   +   + KH  +   I+       +++ Q +  ++    E   I+++   +   +  L++L  +++ +L D+L L+      +    +I E +KL  S     +L  L   + R +  E E+N +    E +    + L D  H    ++  K  +L   W  L +L   RRE+L+ + +  QY  +      W++EK  +V S D   D+ + +  LQR
Sbjct:  402 ESWLDDMVQVIDDELLGQDAATVEAALKRHEAISTDVKAREERFQMVFNLAQELIDEDYYKADVIRKREDVIMVKWDKLVKKLEARRNTLTGFTQLVGVFRDMDSAHADMLDIEAGLRSEDYGRHLLDVQNMLDKHSLVESQIQSQHERTLAINTQAQSFVAAKHPETEVIKQRQRLLTQAFQALVQLGKERRARLEDSLELYTFFEDVEEEDIFIKETDKLAASKEVGRDLASLTRLQQRHEALEAEINGRFSHCEGIIAKGQALIDKGHFGAKEIKAKIKQLQANWIKLKELAGTRRERLKDAAQSLQYYSDANDAESWMKEKMFVVCSEDYGRDEQSAVSLLQR 748          

HSP 6 Score: 53.5286 bits (127), Expect = 1.323e-6
Identity = 48/196 (24.49%), Postives = 93/196 (47.45%), Query Frame = 1
Query: 5689 AGQKEWHICERRDDVLATWNQLNMQ-AERRRHQLEDAADLQRFFSMVRE---LLQWMDLVALQINEKTRPKDVSGVELLINDHRSIKAEIAAREESMSICVNLGRTLLHRGRVGVDEVRAALINLITRKYSLEDMWEERWDYLQLILEVYQFARDASVAEAWILAQEPYLANKTLGETLDETLSLLKKHINFEKTV 6264
            A   E  + ++R  +L    Q  +Q  + RR +LED+ +L  FF  V E    ++  D +A     K   +D++ +  L   H +++AEI  R       +  G+ L+ +G  G  E++A +  L      L+++   R + L+   +  Q+  DA+ AE+W+  +   + ++  G      +SLL++H + E  +
Sbjct:  564 AKHPETEVIKQRQRLLTQAFQALVQLGKERRARLEDSLELYTFFEDVEEEDIFIKETDKLAAS---KEVGRDLASLTRLQQRHEALEAEINGRFSHCEGIIAKGQALIDKGHFGAKEIKAKIKQLQANWIKLKELAGTRRERLKDAAQSLQYYSDANDAESWMKEKMFVVCSEDYGRDEQSAVSLLQRHSHIEDEI 756          
BLAST of Spectrin beta chain vs. Ensembl Nematostella
Match: ALPHA-ACTININ (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4X0])

HSP 1 Score: 387.497 bits (994), Expect = 1.675e-114
Identity = 216/486 (44.44%), Postives = 323/486 (66.46%), Query Frame = 1
Query:  199 EKVQKKTFTKWINSHLNKLKQSIDDLYNXXXXXXXXXXXXXXXXXXXXPYPTKGKMRIHCLENVDKSLNFLIEQRVHLENMGAHDIVDGNARLTLGLIWTIILRFQIQDIVVEEDDTSEKRQAKDALLLWCQMKTAGYPNTNVRNFSTCWRDGLAFNAIIHRHRPDLLEYSALSRSNPNENLEQAIRIAEEKLGIPRLLDPED-VSVENPDEKSIMTYVVTFYHFFSKMKADSVHSKRVGKILSQSMETEEMMVHYDKLTSNLLEWINQTIELLNDRTFANSLSGVQQQLAAFNTYRVTEKPPKFQEKGNLEMLLFSIQSQMRANNQMPYLPIEGKLISDINNAWNKLDKAEHARELALRDELIRQEKLEQLALRFDRKAGMREAWLTENQRLITQDNFGQ-DLSAVEAAGKKHEAIKTDILAYEERVNSVTLVTSELENECYHDVERVLCRRDNVIRLWEKLLDMLAVRKLRL-DACYKVQKLFQ 1647
            E+ QKKTFT W NSHL K  + I ++  DL+DG +LL LLEI+SGE+LP+P +GK+R H + NV+K+L+F+  + V L ++GA +IVDGN ++TLG+IWTIILRF IQDI +E+        AKD LLLWCQ KTA Y N +V+NF+T ++DGLAF A+IHRHRPDL++Y +L + +P  NL +A  +AE+ L IPR+LDPED V  E PDE+++MTYV ++YH F+  +     +KR+GK+L+ + + E MM  Y++L S+LL+WIN+T+  L  R    +L  +Q++L     YR  EKPPK +EKG LE    ++Q+++R +N+  YLP EGK+I+DIN+AW  L+ AE   E  L  E+ R E+L+ LA +F  K  + E+W      ++++D++    L+ + A  KKHEA ++D+ A+++RV+ +  +  EL    Y  ++ V  R  N+   W+ L ++   R  +L DA  ++Q L Q
Sbjct:   26 ERQQKKTFTAWCNSHLRKTGKQIGEIEEDLRDGVLLLQLLEIISGERLPHPERGKLRFHRIANVNKALDFVAGKGVKLVSVGAEEIVDGNLKMTLGMIWTIILRFAIQDIAIEDS------FAKDGLLLWCQRKTAPYKNVSVKNFTTSFKDGLAFCALIHRHRPDLIDYDSLRKEDPLYNLNKAFDVAEQYLDIPRMLDPEDMVETERPDERAVMTYVSSYYHAFTSSQQADTAAKRIGKVLNINRDNERMMEDYERLASDLLDWINKTMPWLTSRDTDGTLKDMQRKLDELRNYRKGEKPPKVEEKGQLETNFNTLQTKLRLSNRPAYLPSEGKMINDINDAWGGLEMAEKDFEDWLLMEMRRMERLDHLAEKFRHKCNIHESWTNGKDAVLSKDDYSDATLADINALMKKHEAFESDLAAHQDRVDQIVAIAQELNALEYSKIDEVNARCQNICDDWKDLGELTMHRLQKLEDAQQRLQSLDQ 505          
BLAST of Spectrin beta chain vs. Ensembl Nematostella
Match: EDO29101 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T4L2])

HSP 1 Score: 357.451 bits (916), Expect = 1.062e-110
Identity = 183/359 (50.97%), Postives = 259/359 (72.14%), Query Frame = 1
Query:  160 YERFRIKALAGEREKVQKKTFTKWINSHLNKLKQS--IDDLYNXXXXXXXXXXXXXXXXXXXXPYPTKGKMRIHCLENVDKSLNFLIEQRVHLENMGAHDIVDGNARLTLGLIWTIILRFQIQDIVVEEDDTSEKRQAKDALLLWCQMKTAGYPNTNVRNFSTCWRDGLAFNAIIHRHRPDLLEYSALSRSNPNENLEQAIRIAEEKLGIPRLLDPEDVSVENPDEKSIMTYVVTFYHFFSKMKADSVHSKRVGKILSQSMETEEMMVHYDKLTSNLLEWINQTIELLNDRTFANSLSGVQQQLAAFNTYRVTEKPPKFQEKGNLEMLLFSIQSQMRANNQMPYLPIEGKLISDINNAW 1230
            +E+ RIK L  ER   QKKTFTKW+NS L+K++    ++DL+ DL DGK+L+ LLEI+SGE++ +  +GK R+H ++NV+K+L FL ++ V LE++GA D+VDGN RL LGLIW IILRFQI DI  ++D + E++ AK+ALLLWCQ  T GYP+ +++NFST WR+GLAFNA++H+HRPDL++Y+ L  S    NL  A  +AEEKLGI RLLD EDV    PD++S+MTYV  +Y +F+K+K++    +R+ KI+   ME E+M   Y+ + S+LL WI+  I  L  R F  ++  VQ++L AF  +R  EKPPK+ E+ N+E  LF++Q++ +ANNQ P+ P EGKL+ DIN AW
Sbjct:    9 FEKDRIKTLKNERIFSQKKTFTKWVNSFLDKVRSGLHVNDLFEDLADGKILISLLEIISGEKIGFAARGKFRVHNIQNVNKALEFL-QKSVKLESIGAEDVVDGNERLILGLIWMIILRFQIADISYQDDMSKERKSAKEALLLWCQRMTRGYPDVDIQNFSTSWRNGLAFNALLHKHRPDLIDYATLRPSQHEANLNNAFTVAEEKLGITRLLDAEDVDCPRPDDRSVMTYVAAYYQYFAKLKSEETGGRRIAKIIGVIMEIEKMEKSYESMVSDLLHWISSKITELA-RPFEKNIFAVQRELGAFKHFRTVEKPPKYTERVNIEAHLFNLQTKRKANNQRPFAPPEGKLVKDINRAW 365          
BLAST of Spectrin beta chain vs. Ensembl Nematostella
Match: EDO49575 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGP6])

HSP 1 Score: 393.275 bits (1009), Expect = 1.006e-109
Identity = 325/1258 (25.83%), Postives = 605/1258 (48.09%), Query Frame = 1
Query: 2533 NIKSQYAILIELTNQKQNKLTDTLSLFRVLRKADTVKTWIDEKEKLLMSLIPTDELEELEVFRHRFDGFEKEMNIQADQVEFVNTLAEKLSDMDHPQIADVVNKRFELNKLWNSLADLVEARREQLQTSYEFNQYLLECKQTGEWIREKSRLVESTDELGDDLAGIMQLQRRMGGMQRDMDAIRAKLEHLDEEMDTLIAKRPNXXXXXXXXXXXXXXFWAELGDMLADRDDRLSESSELQRFLQDLDHIHIWLSKMQTTVASEDLPKDLADAEKSLVQHEQLKEEIDSYQDEFIRLLDYGRRITEDKTDAQYMFLSQRLNALEEGWQELCQMWENRXXXXXXXXXXXVFLRDAIQSEVLLAQEENFLSKEDIPISIENSQNLLRKHEGFLTTLQANHDHTIAVIEFGRNLVERGHFCSDKINLRVKSILXXXXXXXXXXXXAYEKLKDQVLYQELSQDIDDLSKWIQEKMIIATDESFREEKNIARRYNRHRAFDEEIQANKDRLCQAIDYAMQIVEERPQLADMIYPQIDSLNQQWEELEQTTFLKGEKMIEANREAIFEEGTMDVMTWLXXXXXXXXXXXXXXXXXXXXXXKLKKVEEADNEMEIKRKQIQDLKMHAAKLKEEQPEKAFGIEQKHLILEHRFTQLQMPXXXXXXXXXXXXXXXXFLRNLDDQKAWVDDKLLLAESTNFGNNLLTVQQLLRRHRYLATEVNNHKPQLEYLKEEGAVLIEEVSPMQREKFVAGLQELESLWNRLEHSIDLRQQRLKESEATQTFLFDAEEAESWLWEQELFLLSEERGIRDQEAAINVIKKHDARQKTIEDYGEEITKLGTRSRLLIEKDHPQADRIALAQSHVDKVYAGLRDLCLEKKQRLSEIQKLNHLYREIVDLENWIYERTLVASSHDLGVDFEHCCLLRERFDEFFHETHLLGKDRVKAANDLCASLISQCHADSAEIAQWHDRINDSWAELQELMQTRIQLLRTAWEFYKYLSSCQDVLDRICEKIASIP-TDVSKDSQSVAIQQRKHATFLSDAQALEGQVQWVVDEANHLLPSYAGQKEWHICERRDDVLATWNQLNMQAERRRHQLEDAADLQRFFSMVRELLQWMDLVALQINEKTRPKDVSGVELLINDHRSIKAEIAAREESMSICVNLGRTLLHRGRVGVDEVRAALINLITRKYSLEDMWEERWDYLQLILEVYQFARDASVAEAWILAQEPYLANKTLGETLDETLSLLKKHINFEKTVMSQEERFEALEKL 6303
             I + Y  LIE +  ++  L   +  +    + + +  W+  KE+   S+   + L+ ++  R + + F  E+  +  +V  +N LA++L    H   A V  KR E+N+ W  L  L     E L   +    +L  C++   WI+EK   +   +ELG D+  +    RR  G++RD+ A+  K+  L ++  +L+ + P     I+ +   +   WA L      R   L E+   Q FL D   +  W ++++ +  S + P+D+A A + + QHE+  +EI +  + F +L +YGR +    T  Q + + Q + AL+     L   W  R               D +   +            D+  S++  + LL+KHE F+ TL A  +   ++ +  + ++   H   D +  R +S++ RR++ K ++++  + L    + Q   +D D+   WI+EK  IA DESF++ KN+     RH+AF+ EI ANKD + +       ++  +   A  +  ++  LN+ W  L   T  KG K+ +A R+        DV  W+      + + +   +      +  KK +  ++++E+    I D+   A +L  +    +  I+     L+ R+  L      ++  L     + QF+ +++ +  WV + L  A S + G +L++VQ+L +RH     E+ NH+ +++ +   G  LI+       +K     +EL++LW+ L      R+QRL +S  +Q +L +A EA+SW+ ++     S++ G +D  +A  ++ +H A Q  +  +   I +L   +R L++  H  +++I+  Q  +++ + GL  L   +  RL+E +KL+   RE+ ++  ++ E+   A+S D G DFEH  +++ RF +F        ++  +  ++L   L+S+ H D+  I +  D     W  L++ ++ R + L +A E +++     +++ RI EK A+I   D+ +D  S  + QRKH  F  +   LE Q++ +  E+  L  +Y GQ    + +    VL+ W +L  +  R+R +L DA +  +  + VR+L+ W    +  I        VS  E ++ +     AE+ AREES +  +  G  ++  G    +E+   L  L++ +  L   W+ R + L     ++ F +DA   +++  +QE  L    LG ++DE   LLKKH N EK V+SQEE+  AL+ L
Sbjct:  537 TITNTYNRLIETSEMRRLSLQKAIKYYHFCHECEDMDLWMSNKERQFKSIESQNTLDAIQTVRQKLERFATEIATKCSRVSDINQLADELIQDGHAHSAAVKAKRKEINERWEKLQRLKVKEEENLAEKHGVELFLDVCEEMRSWIQEKDAAL-CKEELGKDIETVRAQLRRHQGIERDLAAVEDKVAKLQDQAKSLVVRHPRQARQIKAKEGEVISLWAILKSKANKRKGLLDEAYGQQGFLADARDLMSWSAELKESFISAEDPQDIASASELIQQHEEKFDEIQTRFERFDQLDEYGRNLL--ATSPQAVQVKQSMAALKAEKAALSSSWAKR--------------NDRLHQGL------------DLQSSVDEVEWLLKKHEDFVKTLTAQEEKVRSLADMAKTIIHARHQARDWVASRAESVINRRDNVKNQASDRQKALLTSQVLQNFIRDADEFGGWIKEKSQIAEDESFKDPKNLQGNLKRHKAFEAEITANKDGIDRINKAGKDLIRTKHFGAQKVKDKLKGLNEAWLNLVADTTEKGNKLQQAERQRQLNRAMEDVRIWMNETEAVLGLEDTGRDLAGVKFL-TKKHQLLESDIEMHATVIVDVADKAQELVSQGHFNSDTIKSDSENLQSRYRSLLCLTDKRRSVLEDAFALHQFIYDIEVEMTWVREHLQQASSGDLGTSLISVQRLQKRHLAFENELTNHQTRIDTVLSSGQDLIDSCYSAT-DKVEERCEELQNLWDELVDMAAQRKQRLHDSFLSQKYLSEANEADSWMNDKAGLAASQDYG-KDGASAETLLTRHKALQVDVAAFSTTIDELAEEARRLVQSSHFDSEKISSTQRDLEEQFCGLNTLVKTRHTRLTESKKLHEYRREVEEISAYVSEQLQTAASEDYGTDFEHLQVIQGRFGDFQRSVASYAEN-FRNVDNLAKMLVSEGHTDTVAIKEQQDITRSMWLHLEDQIRLRQKRLTSAEEIHRFNRDLNELISRIQEKDAAINLEDLGRDLASTQVLQRKHEVFECELVTLEKQIEELTVESARLQATYQGQTARSVEQHEKYVLSLWEELKRKTSRKRRKLHDAYEFYKLGNTVRDLISWCIETSRLIASDDPVHTVSDAERMMRELDEHHAEMDAREESFARVLETGEKMIEDGHFAEEEITDKLELLLSERERLYASWDTRKEELSEAYYLHVFLKDAKQVDSFTSSQEAVLLCAELGNSVDEVEFLLKKHENTEKLVLSQEEKLSALQVL 1761          

HSP 2 Score: 391.349 bits (1004), Expect = 4.469e-109
Identity = 403/1688 (23.87%), Postives = 798/1688 (47.27%), Query Frame = 1
Query: 1318 RFDRKAGMREAWLTENQRLITQDNFGQDLSAVEAAGKKHEAIKTDILAYEERVNSVTLVTSELENECYHDVERVLCRRDN-VIRLWEKLLDMLAVRKLRLDACYKVQKLFQDIKHLLDLINDLKARLKTEDIGRHLMGVEDLIHK----HSLLEIDIRMVGTKIEGIMSDAQPFINSEFGLGSGDFQPADPNEVILRTVNLKEEYDNLLELSRNRKDNLSASKVMWEFLWGVADEEQWMKEKIQLMLNPDLGHDLSSVHRLISKHKVIEEDVRNHSNYLQNVIQGGQQLILDKNPGAEKVADXXXXXXXXXXXXXXXXXXRRSKLEQSLAYFHCLADCGEVEIWIIEQVKLVKIDETSINEESIITDIHKHEQLSKSIEDYESNINSLDEQVKKL-SEGDLELVTIEEKVSNIKSQYAILIELTNQKQNKLTDTLSLFRVLRKADTVKTWIDEKEKLLMSLIPTDELEELEVFRHRFDGFEKEMNIQADQVEFVNTLAEKLSDMDHPQIADVVNKRFELNKLWNSLADLVEARREQLQTSYEFNQYLLECKQTGEWIREKSRLVESTDELGDDLAGIMQLQRRMGGMQRDMDAIRAKLEHLDEEMDTLIAKRPNXXXXXXXXXXXXXXFWAELGDMLADRDDRLSESSELQRFLQDLDHIHIWLSKMQTTVASEDLPKDLADAEKSLVQHEQLKEEIDSYQDEFIRLLDYGRRITEDKTDAQYMFLSQRLNALEEGWQELCQMWENRXXXXXXXXXXXVFLRDAIQSEVLLAQEENFLSKEDIPISIENSQNLLRKHEGFLTTLQANHDHTIAVIEFGRNLVERGHFCSDKINLRVKSILXXXXXXXXXXXXAYEKLKDQVLYQELSQDIDDLSKWIQEKMIIATDESFREEKNIARRYNRHRAFDEEIQANKDRLCQAIDYAMQIVEERPQLADMIYPQIDSLNQQWEELEQTTFLKGEKMIEANREAIFEEGTMDVMTWLXXXXXXXXXXXXXXXXXXXXXXKLKKVEEADNEMEIKRKQIQDLKMHAAKLKEEQPE--KAFG--IEQKHLI----------LEHRFTQLQMPXXXXXXXXXXXXXXXXFLRNLDDQKAWVDDKLLLAESTNFGNNLLTVQQLLRRHRYLATEVNNHKPQLEYLKEEGAVLIEEVSPMQREKFVAGLQELESLWNRLEHSIDLRQQRLKESEATQTFLFDAEEAESWLWEQELFLLSEERGIRDQEAAINVIKKHDARQKTIEDYGEEITKLGTRSRLLIEKDHPQADRIALAQSHVDKVYAGLRDLCLEKKQRLSEIQKLNHLYREIVDLENWIYERTLVASSHDLGVDFEHCCLLRERFDEFFHETHLLGKDRVKAANDLCASLISQCHADSAEIAQWHDRINDSWAELQELMQTRIQLLRTAWEFYKYLSSCQDVLDRICEKIAS--IPTDVSKDSQSVAIQQRKHATFLSDAQALEGQVQWVVDEANHLLPSYAGQKEWHICERRDDVLATWNQLNMQAERRRHQLEDAADLQRFFSMVRELLQWMDLVALQINEKTRPKDVSGVELLINDHRSIKAEIAAREESMSICVNLGRTLLHRGRVGVDEVRAALINLITRKYSLEDMWEE-------RWDYLQLILEVYQFARDASVAEAWILAQEPYLANKTLGETLDETLSLLKKHINFEKTVMSQEERFEAL 6294
            RF+R      + + E    I  ++ G+DL++ +   +KHE  + +++  E+++  +T+ ++ L+        R + + +  V+ LWE+L    + ++ +L   Y+  KL   ++ L+    +    + ++D    +   E ++ +    H+  E+D R          S A+     E  +  G F      E+  +   L  E + L      RK+ LS +  +  FL      + +   +  ++L  +LG+ +  V  L+ KH+  E+ V +    L  +   G++LI +++  ++ + + L  +     +L    + RR KL+ S        D  E E WI+E+++    DE+  +  ++ + + KH+     +  +E  I+S+ ++ ++L S G      +E ++  +  Q+  L+E +  K  KL +     +  ++ D   + I +KE +++S     + E     + +   F++++ + A +VE +N LAEKL    H     +  ++  L + WN L D    RR++L  + E + +   C+     I EK+  V+++ E+G DL  +  L R+   ++R++  I  K+E L+ E   L+  +P+    ++ ++  + + W  L D+   R   L  +  LQ FL D   +  W++ + T ++S +L  ++ DAE  L  HE+ K ++++  D +   + +G  + E +       + Q ++ L     EL Q+W++R+ +L QS  LQ+FL DA ++E  +  ++      +   S++N ++LL+ H  F  +L    ++  ++    +  ++  H+ ++ I  +   IL++ E+ K+ +     KL +  L  +  +D  +L  W+ EK+ IA + S+RE  N+ ++  +H+ F+ E+ A+K  L         ++   P   + +  ++  L   W  L   +  K +++ EA ++  FE   +++  W+E +  ++   +             K +   +N +    K+ Q L+M  A+ ++   E  K  G  +  +H +          +  RF QL  P   ++++L     + QFL +   +  W+ DK  +A+S ++G NLL VQ L+++   L +E+N+H+  ++ L E G  L+      +R+   A  Q L  LW  L  +   R ++L+ S AT  +     E ++W+ E+   + S + G RD+ +A  +++KHDA Q  ++    +I  L +    L +    +  ++   Q  +++ Y  LRD+  ++ +RL +  +L +  RE  +L  W+ E+  + SS D G D EH  +L ++F E F    +   +R+    +    L+   H DS  I Q  + I + W  L+E   TR++ L  A + + +  S  ++   I EKI +  +  + + D + V   QRKH  F  D QAL  +V  V+ +A+ L       K   I E+++ V   W +L   A  ++  L  +  LQ F    R+L+ W++  + Q+ E+T     + VE LI  ++ ++ EI +R  S+    +    LL  G    +++R        +   + D W+        R   LQ   E+ +F R+A   EAW+ A+E  L ++ +G++L+    LLKK   FEK +++Q E+F +L
Sbjct: 1490 RFNRDLNELISRIQEKDAAINLEDLGRDLASTQVLQRKHEVFECELVTLEKQIEELTVESARLQATYQGQTARSVEQHEKYVLSLWEELKRKTSRKRRKLHDAYEFYKLGNTVRDLISWCIETSRLIASDDPVHTVSDAERMMRELDEHHA--EMDARE--------ESFARVLETGEKMIEDGHFAE---EEITDKLELLLSERERLYASWDTRKEELSEAYYLHVFLKDAKQVDSFTSSQEAVLLCAELGNSVDEVEFLLKKHENTEKLVLSQEEKLSALQVLGKELIDNQHNQSDMIRNRLSGVCDRREKLKAELDKRREKLQNSHKIMQFYQDVVESESWIMEKLQ-TATDESFKDPINLESKLQKHQAFESELTAHERAIDSVRDKGEQLISCGHFAASEVEVRIEALYIQWEELLEASATKGRKLQEARDHQQFNQEVDIADSCITDKETIVLSSDYGRDFEHCVRLQRKMKEFDQDLAVDAARVEAINVLAEKLIGQGHAGSVRIQQRQNALTERWNRLQDKASERRQKLAEACEIHAFNRNCRDVSSMINEKA-AVQTSGEVGRDLPAVEALIRKHDDVERELTVIEGKMEELEGEAYRLVRSQPHMARAVQAKQADIIEQWERLNDLFDQRKVILEANRLLQIFLVDYRDLMSWMNDLGTRMSSGELADNVRDAEAMLGLHEERKGQMNARMDSYNATVAFGMSLVE-QGHVSADVIKQNVDDLVLENTELQQLWQSRKLMLQQSTDLQMFLADAEKAENWIKNKQMVAQSIESRESLDNVESLLKSHINFEKSLSTYEENIRSLESSAKQFLQVKHYHAEAIRSKYLEILDKWEALKKLAASRSGKLGESKLLFQFLRDAKELESWMNEKLQIAAEASYREATNLQQKLQKHQTFEAEVSAHKSELDAITQTGQSLMRNSPSCQETVESRLKDLADLWSLLGDLSDNKAQRLKEAIQKQTFERNVIELQAWIEEVENALASEDYG-----------KDMRSVNNLI----KRHQSLQMDIARYEDRVSELLKQAGEFVAAEHFLKDEIADRAADVAERFEQLVEPATERELRLQDSLALHQFLADTQVEVDWIKDKEPIAKSEDYGRNLLGVQSLMKKMEGLESEINSHELLVQALLETGEQLVLRGHYAERD-IGAKSQMLLELWEELRINAQTRNEKLQASLATHQYYDQVFEMDAWVSEKLSLVSSTDYG-RDETSAETLLRKHDALQLELDANESKIRDLRSIYSELSDAGDTEFSKLEKIQDELEERYTHLRDVARDRHRRLLDSSRLFNFLREADELGAWVEEKEAIVSSDDCGRDLEHVEMLMQKF-EVFTRDLVSSGERIAKLTEHAQMLLDDEHTDSEMIEQRAEVICERWDGLKERTSTRLEELDRARDLHAFRRSVDEIHAWIQEKIDALGVAENGAPDLRHVQALQRKHQGFQRDLQALGEKVDLVLRDADDLSAKVPAHKHELIMEKQE-VQKAWKKLQQLASSKQSHLLQSEGLQAFLDDYRDLMSWIETTSAQVAEETLGSTFADVETLIAQNQELQTEIDSRANSVEEFQSRADQLLGSGNPSAEDIR-------NKSSHVRDTWDRLGASLRTRTQQLQHNKEIQRFKREADQLEAWLNAREHDLLSEDVGDSLEAVEELLKKQDEFEKMLLTQGEKFNSL 3135          

HSP 3 Score: 327.02 bits (837), Expect = 1.792e-89
Identity = 389/1680 (23.15%), Postives = 769/1680 (45.77%), Query Frame = 1
Query: 1306 QLALRFDRKAGMREAWLTENQRLITQDNFGQDLSAVEAAGKKHEAIKTDILAYEERVNSVTLVTSELENECYHDVERVLCRRDNVIRLWEKLLDMLAVRKLRLDACYKVQKLFQDIKHLLDLINDLKARLKTEDIGRHLMGVEDLIHKHSLLEIDIRMVGTKIEGIMSDAQPFINSEFGLGSGDFQPADPNEVILRTVNLKEEYDNLLELSRNRKDNLSASKVMWEFLWGVADEEQWMKEKIQLMLNPDLGHDLSSVHRLISKHKVIEEDVRNHSNYLQNVIQGGQQLILDKNPGAEKVADXXXXXXXXXXXXXXXXXXRRSKLEQSLAYFHCLADCGEVEIWIIEQVKLVKIDETSINEESIITDIHKHEQLSKSIEDYESNINSLDEQVKKL---SEGDLELVTIEEKVSNIKSQYAILIELTNQKQNKLTDTLSLFRVLRKADTVKTWIDEKEKLLMSLIPTDELEELEVFRHRFDGFEKEMNIQADQVEFVNTLAEKLSDMDHPQIADVVNKRFELNKLWNSLADLVEARREQLQTSYEFNQYLLECKQTGEWIREKSRLVESTDELGDDLAGIMQLQRRMGGMQRDMDAIRAKLEHLDEEMDTLIAK-RPNXXXXXXXXXXXXXXFWAELGDMLADRDDRLSESSELQRFLQDLDHIHIWLSKMQTTVASEDLPKDLADAEKSLVQHEQLKEEIDSYQDEFIRLLDYGRRITEDK-------TDAQYMFLSQRLNALEEGWQELCQMWENRXXXXXXXXXXXVFLRDAIQSEVLLAQEENFLSKEDIPISIENSQNLLRKHEGFLTTLQANHDHTIAVIEFGRNLVERGHFCSDKINLRVKSILXXXXXXXXXXXXAYEKLKDQVLYQELSQDIDDLSKWIQEKMIIATDESFREEKNIARRYNRHRAFDEEIQANKDRLCQAIDYAMQIVEERPQLADMIYPQIDSLNQQWEELEQTTFLKGEKMIEANREAIFEEGTMDVMTWLXXXXXXXXXXXXXXXXXXXXXXKLKKVEEADNEMEIKRKQIQDLKMHAAKLKEEQPEKAFGIEQKHLILEHRFTQLQMPXXXXXXXXXXXXXXXXFLRNLDDQKAWVDDKLLLAESTNFGNNLLTVQQLLRRHRYLATEVNNHKPQLEYLKEEGAVLIEEVSPMQREKFVAGLQELESLWNRLEHSIDLRQQRLKESEATQTFLFDAEEAESWLWEQELFLLSEERG--IRDQEAAINVIKKHDARQKTIEDYGEEITKLGTRSRLLIEKDHPQADRIALAQSHVDKVY---AGLRDLCLEKKQRLSEIQKLNHLYREIVDLENWIYERTLVASSHDLGVDFEHC-CLLRERFDEFFHETHLLGKDRVKAANDLCASLISQCHADSAEIAQWHDRINDSWAELQELMQTRIQLLRTAWEFYKYLSSCQDVLDRICEKIASIPTDVSKDSQSVAIQQRKHATFLSDAQALEGQVQWVVDEANHLLPSYAGQKEWHICERRDDVLATWNQLNMQAERRRHQLEDAADLQRFFSMVRELLQWMDLVALQINEKTRPKDVSGVELLINDHRSIKAEIAAREESMSICVNLGRTLLHRGRVGVDEVRAALINLITRKYSLEDMWEERWDYLQLILEVYQFARDASVAEAWILAQEPYLANKTLGETLDETLSLLKKHINFEKTVMSQEERFEAL 6294
            Q+   F R A     W+ E  ++   ++F +D   ++   K+H+A + +I A ++ ++ +     +L    +   ++V  +   +   W  L+     +  +L    + ++L + ++ +   +N+ +A L  ED GR L GV+ L  KH LLE DI M  T I  +   AQ  ++       G F   + + +   + NL+  Y +LL L+  R+  L  +  + +F++ +  E  W++E +Q   + DLG  L SV RL  +H   E ++ NH   +  V+  GQ LI       +KV +  +EL+ LW+EL+++   R+ +L  S      L++  E + W+ ++  L    +   +  S  T + +H+ L   +  + + I+ L E+ ++L   S  D E ++  ++  +++ Q+  L  L   +  +LT++  L    R+ + +  ++ E+ +   S     + E L+V + RF  F++ +   A+    V+ LA+ L    H     +  ++     +W  L D +  R+++L ++ E +++  +  +    I+EK   + + ++LG DLA    LQR+    + ++  +  ++E L  E   L A  +      + +    +   W EL    + +  +L ++ E  +    +  +  W  +    +AS+D    ++DAE+ + + ++   E+D+ ++ F R+L+ G ++ ED        TD   + LS+R        + L   W+ R+  LS++  L VFL+DA Q +   + +E  L   ++  S++  + LL+KHE     + +  +   A+   G+ L++  H  SD I  R+  + +RRE  K   ++  EKL++     +  QD+ +   WI EK+  ATDESF++  N+  +  +H+AF+ E+ A++  +    D   Q++      A  +  +I++L  QWEEL + +  KG K+ EA     F +  +D+     T  E+I+++ +            +K++E D ++ +   +++ + + A KL  +    +  I+Q+   L  R+ +LQ     ++ +L +   I  F RN  D  + +++K  +  S   G +L  V+ L+R+H  +  E+   + ++E L+ E   L+     M R    A   ++   W RL    D R+  L+ +   Q FL D  +  SW+ +    + S E    +RD EA + + ++   +     D        G     L+E+ H  AD I   + +VD +      L+ L   +K  L +   L     +    ENWI  + +VA S +     ++   LL+   +  F ++    ++ +++        +   H  +  I   +  I D W  L++L  +R   L  +   +++L   +++   + EK+        +++ ++  + +KH TF ++  A + ++  +      L+ +    +E  +  R  D+   W+ L   ++ +  +L++A   Q F   V EL  W++ V   +  +   KD+  V  LI  H+S++ +IA  E+ +S  +      +       DE+     ++  R   L +   ER   LQ  L ++QF  D  V   WI  +EP   ++  G  L    SL+KK    E  + S E   +AL
Sbjct:  957 QVLQNFIRDADEFGGWIKEKSQIAEDESF-KDPKNLQGNLKRHKAFEAEITANKDGIDRINKAGKDLIRTKHFGAQKVKDKLKGLNEAWLNLVADTTEKGNKLQQAERQRQLNRAMEDVRIWMNETEAVLGLEDTGRDLAGVKFLTKKHQLLESDIEMHATVIVDVADKAQELVSQ------GHF---NSDTIKSDSENLQSRYRSLLCLTDKRRSVLEDAFALHQFIYDIEVEMTWVREHLQQASSGDLGTSLISVQRLQKRHLAFENELTNHQTRIDTVLSSGQDLIDSCYSATDKVEERCEELQNLWDELVDMAAQRKQRLHDSFLSQKYLSEANEADSWMNDKAGLAASQDYGKDGASAETLLTRHKALQVDVAAFSTTIDELAEEARRLVQSSHFDSEKISSTQR--DLEEQFCGLNTLVKTRHTRLTESKKLHEYRREVEEISAYVSEQLQTAASEDYGTDFEHLQVIQGRFGDFQRSVASYAENFRNVDNLAKMLVSEGHTDTVAIKEQQDITRSMWLHLEDQIRLRQKRLTSAEEIHRFNRDLNELISRIQEKDAAI-NLEDLGRDLASTQVLQRKHEVFECELVTLEKQIEELTVESARLQATYQGQTARSVEQHEKYVLSLWEELKRKTSRKRRKLHDAYEFYKLGNTVRDLISWCIETSRLIASDDPVHTVSDAERMMRELDEHHAEMDAREESFARVLETGEKMIEDGHFAEEEITDKLELLLSER--------ERLYASWDTRKEELSEAYYLHVFLKDAKQVDSFTSSQEAVLLCAELGNSVDEVEFLLKKHENTEKLVLSQEEKLSALQVLGKELIDNQHNQSDMIRNRLSGVCDRREKLKAELDKRREKLQNSHKIMQFYQDVVESESWIMEKLQTATDESFKDPINLESKLQKHQAFESELTAHERAIDSVRDKGEQLISCGHFAASEVEVRIEALYIQWEELLEASATKGRKLQEARDHQQFNQ-EVDIADSCITDKETIVLSSDYGRDFEHCVRLQRKMKEFDQDLAVDAARVEAINVLAEKLIGQGHAGSVRIQQRQNALTERWNRLQDKASERRQKLAEACEIHAFNRNCRDVSSMINEKAAVQTSGEVGRDLPAVEALIRKHDDVERELTVIEGKMEELEGEAYRLVRSQPHMAR-AVQAKQADIIEQWERLNDLFDQRKVILEANRLLQIFLVDYRDLMSWMNDLGTRMSSGELADNVRDAEAMLGLHEERKGQMNARMDSYNATVAFGMS---LVEQGHVSADVI---KQNVDDLVLENTELQQLWQSRKLMLQQSTDLQMFLADAEKAENWIKNKQMVAQSIESRESLDNVESLLKSHIN--FEKSLSTYEENIRSLESSAKQFLQVKHYHAEAIRSKYLEILDKWEALKKLAASRSGKLGESKLLFQFLRDAKELESWMNEKLQIAAEASYREATNLQQKLQKHQTFEAEVSAHKSELDAITQTGQSLMRNSPSCQE-TVESRLKDLADLWSLLGDLSDNKAQRLKEAIQKQTFERNVIELQAWIEEVENALASEDYGKDMRSVNNLIKRHQSLQMDIARYEDRVSELLKQAGEFVAAEHFLKDEIADRAADVAERFEQLVEPATERELRLQDSLALHQFLADTQVEVDWIKDKEPIAKSEDYGRNLLGVQSLMKKMEGLESEINSHELLVQAL 2604          

HSP 4 Score: 223.016 bits (567), Expect = 6.810e-58
Identity = 209/832 (25.12%), Postives = 395/832 (47.48%), Query Frame = 1
Query: 1237 LDKAEHARELALRDELIRQEKL--EQLALRFDRKAGMREAWLTENQRLITQDNFGQDLSAVEAAGKKHEAIKTDILAYEERVNSVTLVTSELENECYHDVERVLCRRDNVIRLWEKLLDMLAVRKLRLDACYKVQKLFQDIKHLLDLINDLKARLKTEDIGRHLMGVEDLIHKHSLLEIDIRMVGTKIEGIMSDAQPFINSEFGLGSGDFQPADPNEVILRTVNLKEEYDNLLELSRNRKDNLSASKVMWEFLWGVADEEQWMKEKIQLMLNPDLGHDLSSVHRLISKHKVIEEDVRNHSNYLQNVIQGGQQLILDKNPGAEKVADXXXXXXXXXXXXXXXXXXRRSKLEQSLAYFHCLADCGEVEIWIIEQVKLVKIDETSINEESIITDIHKHEQLSKSIEDYESNINSLDEQVKKLSE-GDLELVTIEEKVSNIKSQYAILIELTNQKQNKLTDTLSLFRVLRKADTVKTWIDEKEKLLMSLIPTDELEELEVFRHRFDGFEKEMNIQADQVEFVNTLAEKLSDMDHPQIADVVNKRFE-LNKLWNSLADLVEARREQLQTSYEFNQYLLECKQTGEWIREKSRLVESTDELGDDLAGIMQLQRRMGGMQRDMDAIRAKLEHLDEEMDTLIAKRPNXXXXXXXXXXXXXXFWAELGDMLADRDDRLSESSELQRFLQDLDHIHIWLSKMQTTVASEDLPKDLADAEKSLVQHEQLKEEIDS-------YQDEFIRLLDYGRRITEDKTDAQYMFLSQRLNALEEGWQELCQMWENRXXXXXXXXXXXVFLRDAIQSEVLLAQEENFLSKEDIPISIENSQNLLRKHEGF 3699
            LDK E  ++LA      R  KL   +L  +F R A   E+W+ E  ++  + ++ ++ + ++   +KH+  + ++ A++  ++++T     L        E V  R  ++  LW  L D+   +  RL    + Q   +++  L   I +++  L +ED G+ +  V +LI +H  L++DI     ++  ++  A  F+ +E  L          +E+  R  ++ E ++ L+E +  R+  L  S  + +FL     E  W+K+K  +  + D G +L  V  L+ K + +E ++ +H   +Q +++ G+QL+L  +     +    + L  LW EL    + R  KL+ SLA         E++ W+ E++ LV   +   +E S  T + KH+ L   ++  ES I  L     +LS+ GD E   +E+    ++ +Y  L ++   +  +L D+  LF  LR+AD +  W++EKE ++ S     +LE +E+   +F+ F +++    +++  +   A+ L D +H   ++++ +R E + + W+ L +    R E+L  + + + +     +   WI+EK   +   +    DL  +  LQR+  G QRD+ A+  K++ +  + D L AK P  +  +  E+  ++  W +L  + + +   L +S  LQ FL D   +  W+      VA E L    AD E  + Q+++L+ EIDS       +Q    +LL  G    ED        +  + + + + W  L      R   L  +  +Q F R+A Q E  L   E+ L  ED+  S+E  + LL+K + F
Sbjct: 2313 LDKWEALKKLAAS----RSGKLGESKLLFQFLRDAKELESWMNEKLQIAAEASY-REATNLQQKLQKHQTFEAEVSAHKSELDAITQTGQSLMRNSPSCQETVESRLKDLADLWSLLGDLSDNKAQRLKEAIQKQTFERNVIELQAWIEEVENALASEDYGKDMRSVNNLIKRHQSLQMDIARYEDRVSELLKQAGEFVAAEHFL---------KDEIADRAADVAERFEQLVEPATERELRLQDSLALHQFLADTQVEVDWIKDKEPIAKSEDYGRNLLGVQSLMKKMEGLESEINSHELLVQALLETGEQLVLRGHYAERDIGAKSQMLLELWEELRINAQTRNEKLQASLATHQYYDQVFEMDAWVSEKLSLVSSTDYGRDETSAETLLRKHDALQLELDANESKIRDLRSIYSELSDAGDTEFSKLEKIQDELEERYTHLRDVARDRHRRLLDSSRLFNFLREADELGAWVEEKEAIVSSDDCGRDLEHVEMLMQKFEVFTRDLVSSGERIAKLTEHAQMLLDDEHTD-SEMIEQRAEVICERWDGLKERTSTRLEELDRARDLHAFRRSVDEIHAWIQEKIDALGVAENGAPDLRHVQALQRKHQGFQRDLQALGEKVDLVLRDADDLSAKVPAHKHELIMEKQEVQKAWKKLQQLASSKQSHLLQSEGLQAFLDDYRDLMSWIETTSAQVAEETLGSTFADVETLIAQNQELQTEIDSRANSVEEFQSRADQLLGSGNPSAED--------IRNKSSHVRDTWDRLGASLRTRTQQLQHNKEIQRFKREADQLEAWLNAREHDLLSEDVGDSLEAVEELLKKQDEF 3121          

HSP 5 Score: 192.2 bits (487), Expect = 1.482e-48
Identity = 355/1699 (20.89%), Postives = 720/1699 (42.38%), Query Frame = 1
Query: 1351 WLTENQRLITQDNFGQDLSAVEAAGKKHEAIKTDILAYEERVNSVTLVTSELENECYHDVERVLCRRDNVIRLWEKLLDMLAVRKLRLDACYKVQKLFQDIKHLLDLINDLKARLKTEDIGRHLMGVEDLIHKHSLLEIDIRMVGTKIEGIMSDAQPFINSEFGLGSGDFQPADPNEVILRTVNLKEEYDNLLELSRNRKDNLSASKVMWEFLWGVADEEQWMKEKIQLMLNPDLGHDLSSVHRLISKHKVIEEDVRNHSNYLQNVIQGGQQLILDKNPGAEKVADXXXXXXXXXXXXXXXXXXRRSKLEQSLAYFHCLADCGEVEIWIIEQVKLVKIDETSINEESIITDIHKHEQLSKSIEDYESNINSLDEQVKKLSEGDLELV---------TIEEKVSNIKSQYAILIELTNQKQNKLTDTLSLFRVLRKADTVKTWIDEKEKLLMSLIPTDELEELEVFRHRFDGFEKEMNIQADQVEFVNTLAEKLSDMDH---PQIAD----VVNKRFELNKLWNSLADLVEARREQLQTSYEFNQYLLECKQTGEWIREKSRLVESTDELGDDLAGIMQLQRRMGGMQRDMDAIRAKLEHLDEEMDTLIAKRPNXXXXXXXXXXXXXXFWAELGDMLADRDDRLSESSELQRFLQDLDHIHIW-LSKMQTTVASEDLPKDLADAEKSLVQHEQLKEEIDSYQDEFIRLLDYGRRITEDKTDAQYMFLSQ---RLNALEEGWQELCQMWENRXXXXXXXXXXXVFLRDAIQSEVLLAQEENFLSKEDIPISIENSQNLLRKHEGFLTTLQANHDHTIAVIEFGRNLVERGHFCSDKINLRVKSILXXXXXXXXXXXXAYEKLKDQVLYQELSQDIDDLSKWIQEKMIIATD-ESFREEKNIARRYNRHRAFDEEIQANKDRLCQAIDYAMQIVEERPQLADMIYPQIDSLNQQWEELEQTTFLKGEKMIEANR-EAIFEEGTMDVMTWLXXXXXXXXXXXXXXXXXXXXXXKLKKVEEADN----EMEIKRKQIQDLKMHAAKLKEEQPEKAFG---IEQKH------------LILEHRFTQLQMPXXXXXXXXXXXXXXXXFLRNLDDQKAWVDDKLLLAESTNFGNNLLTVQQLLRRHRYLATEVNNHKPQLEYLKEEGAVLIEEVSPMQREKFVAGLQELESLWNRLEHSIDLRQQRLKESEATQTFLFDAEEAESWLWEQELFLLSEERGIRDQEAAINVIKKHDARQKTIEDYGEEITKLGTRSRLLIEKDHPQADRIALAQSHVDKVYAGLRDLCLEKKQRLSEIQKLNHLYREIVDLENWIYERTLVASSHDLGVDFEHCCLLRERFDEFFHETHLLGKDRVKAANDLCASLISQCHADSAEIAQWHDRINDSWAELQELMQTRIQLLRTAWEFYKYLSSCQDVLDRICEK--IASIPTDVSKDSQSVAIQQRKHATFLSDAQALEGQVQWVVDEANHLL--PSYAGQKEWHICERRDDVLATWNQLNMQAERRRHQLEDAADLQRFFSMVRELLQWMDLVALQINEKTRPKDVSGVELLINDHRSIKAEIAAREESMSICVNLGRTLLHRGRVGVDEVRAALINLITRKYSLEDMWEERWDYLQLILEVYQFARDASVAEAWILAQEPYLANKTLGETLDETLSLLKKHINFEKTVMSQEERFEALEKLTTM 6312
            W+ E+ +  +  + G  L +V+   K+H A + ++  ++ R+++V     +L + CY   ++V  R + +  LW++L+DM A RK RL   +  QK   +       +ND      ++D G+     E L+ +H  L++D+    T I+ +  +A+  + S            D  ++     +L+E++  L  L + R   L+ SK + E+   V +   ++ E++Q   + D G D   +  +  +    +  V +++   +NV    + L+ + +     + +       +W  L +    R+ +L  +        D  E+       +  ++  + +IN E +  D+   + L +  E +E  + +L++Q+++L+     L          ++E+    + S +  L   T++K+ KL D    +++      + +W  E  +L+ S  P   + + E      D    EM+ + +    V    EK+ +  H    +I D    ++++R  L   W++       R+E+L  +Y  + +L + KQ   +   +  ++    ELG+ +  +  L ++    ++ + +   KL  L      LI  + N  ++IR     + D   +L   L  R ++L  S ++ +F QD+     W + K+QT  A+++  KD  + E  L +H+  + E+ +++    R +D  R   E      +   S+   R+ AL   W+EL +    +   L ++   Q F ++   ++  +  +E  +   D     E+   L RK + F   L  +     A+      L+ +GH  S +I  R  ++ ER    + +++E  +KL +       +++  D+S  I EK  + T  E  R+   +     +H   + E+   + ++ +    A ++V  +P +A  +  +   + +QWE L    F + + ++EANR   IF     D+M+W+                  D+  ++   E ADN    E  +   + +  +M+ A++       AFG   +EQ H            L+LE+  T+LQ   +++K+ L Q   +Q FL + +  + W+ +K ++A+S     +L  V+ LL+ H      ++ ++  +  L E  A    +V     E   +   E+   W  L+     R  +L ES+    FL DA+E ESW+ E+    ++ E   R+       ++KH   +  +  +  E+  +    + L+       + +      +  +++ L DL   K QRL E  +     R +++L+ WI E     +S D G D      L +R      +     +DRV          ++  H    EIA     + + + +L E    R   L+ +   +++L+  Q  +D I +K  IA    D  ++   V    +K     S+  + E  VQ +++    L+    YA   E  I  +   +L  W +L + A+ R  +L+ +    +++  V E+  W+      ++     +D +  E L+  H +++ E+ A E  +    ++   L   G     ++      L  R   L D+  +R   L     ++ F R+A    AW+  +E  +++   G  L+    L++K   F + ++S  ER   L +   M
Sbjct: 1183 WVREHLQQASSGDLGTSLISVQRLQKRHLAFENELTNHQTRIDTVLSSGQDLIDSCYSATDKVEERCEELQNLWDELVDMAAQRKQRLHDSFLSQKYLSEANEADSWMNDKAGLAASQDYGKDGASAETLLTRHKALQVDVAAFSTTIDELAEEARRLVQSSH---------FDSEKISSTQRDLEEQFCGLNTLVKTRHTRLTESKKLHEYRREVEEISAYVSEQLQTAASEDYGTDFEHLQVIQGRFGDFQRSVASYAENFRNVDNLAKMLVSEGHTDTVAIKEQQDITRSMWLHLEDQIRLRQKRLTSAEEIHRFNRDLNEL-------ISRIQEKDAAINLEDLGRDLASTQVLQRKHEVFECELVTLEKQIEELTVESARLQATYQGQTARSVEQHEKYVLSLWEELKRKTSRKRRKLHDAYEFYKLGNTVRDLISWCIETSRLIASDDPVHTVSDAERMMRELDEHHAEMDAREESFARVLETGEKMIEDGHFAEEEITDKLELLLSERERLYASWDT-------RKEELSEAYYLHVFLKDAKQVDSFTSSQEAVLLCA-ELGNSVDEVEFLLKKHENTEKLVLSQEEKLSALQVLGKELIDNQHNQSDMIRNRLSGVCDRREKLKAELDKRREKLQNSHKIMQFYQDVVESESWIMEKLQT--ATDESFKDPINLESKLQKHQAFESELTAHE----RAIDSVRDKGEQLISCGHFAASEVEVRIEALYIQWEELLEASATKGRKLQEARDHQQFNQEVDIADSCITDKETIVLSSDYGRDFEHCVRLQRKMKEFDQDLAVDAARVEAINVLAEKLIGQGHAGSVRIQQRQNALTERWNRLQDKASERRQKLAEACEIHAFNRNCRDVSSMINEKAAVQTSGEVGRDLPAVEALIRKHDDVERELTVIEGKMEELEGEAYRLVRSQPHMARAVQAKQADIIEQWERL-NDLFDQRKVILEANRLLQIFLVDYRDLMSWM-----------------NDLGTRMSSGELADNVRDAEAMLGLHEERKGQMN-ARMDSYNATVAFGMSLVEQGHVSADVIKQNVDDLVLEN--TELQQLWQSRKLMLQQSTDLQMFLADAEKAENWIKNKQMVAQSIESRESLDNVESLLKSHINFEKSLSTYEENIRSL-ESSAKQFLQVKHYHAEAIRSKYLEILDKWEALKKLAASRSGKLGESKLLFQFLRDAKELESWMNEK--LQIAAEASYREATNLQQKLQKHQTFEAEVSAHKSELDAITQTGQSLMRNSPSCQETVESRLKDLADLWSLLGDLSDNKAQRLKEAIQKQTFERNVIELQAWIEEVENALASEDYGKDMRSVNNLIKRHQSLQMDIARY-EDRVSELLKQAGEFVAAEHFLKDEIADRAADVAERFEQLVEPATERELRLQDSLALHQFLADTQVEVDWIKDKEPIAK-SEDYGRNLLGVQSLMKKMEGLESEINSHELLVQALLETGEQLVLRGHYA---ERDIGAKSQMLLELWEELRINAQTRNEKLQASLATHQYYDQVFEMDAWVSEKLSLVSSTDYGRDETSAETLLRKHDALQLELDANESKIRDLRSIYSELSDAGDTEFSKLEKIQDELEERYTHLRDVARDRHRRLLDSSRLFNFLREADELGAWVEEKEAIVSSDDCGRDLEHVEMLMQKFEVFTRDLVSSGERIAKLTEHAQM 2822          

HSP 6 Score: 174.096 bits (440), Expect = 4.119e-43
Identity = 253/1241 (20.39%), Postives = 558/1241 (44.96%), Query Frame = 1
Query: 1318 RFDRKAGMREAWLTENQRLITQDNFGQDLSAVEAAGKKHEAIKTDILAYEERVNSVTLVTSELENECYHDVERVLCRRDNVIRLWEKLLDMLAVRKLRLDACYKVQKLFQDIKHLLDLINDLKARLKTEDIGRHLMGVEDLIHKHSLLEIDIRMVGTKIEGIMSDAQPFINSEFGLGSGDFQPADPNEVILRTVNLKEEYDNLLELSRNRKDNLSASKVMWEFLWGVADEEQWMKEKIQLMLNPDLGHDLSSVHRLISKHKVIEEDVRNHSNYLQNVIQGGQQLILDKNPGAEKVADXXXXXXXXXXXXXXXXXXRRSKLEQSLAYFHCLADCGEVEIWIIEQVKLVKIDETSINEESIITDIHKHEQLSKSIEDYESNINSLDEQVKK-LSEGDLELVTIEEKVSNIKSQYAILIELTNQKQNKLTDTLSLFRVLRKADTVKTWIDEKEKLLMSLIPTDELEELEVFRHRFDGFEKEMNIQADQVEFVNTLAEKLSDMDHPQIADVVNKRF-ELNKLWNSLADLVEARREQLQTSYEFNQYLLECKQTGEWIREKSRLVESTDELGDDLAGIMQLQRRMGGMQRDMDAIRAKLEHLDEEMDTLIAKRPNXXXXXXXXXXXXXXFWAELGDMLADRDDRLSESSELQRFLQDLDHIHIWLSKMQTTVASEDLPKDLADAEKSLVQHEQLKEEIDSYQDEFIRLLDYGRRITEDKTDAQYMFLSQRLNALEEGWQELCQMWENRXXXXXXXXXXXVFLRDAIQSEVLLAQEENFLSKEDIPISIENSQNLLRKHEGFLTTLQANHDHTIAVIEFGRNLVERGHFCSDKINLRVKSILXXXXXXXXXXXXAYEKLKDQVLYQELSQDIDDLSKWIQEK-MIIATDESFREEKNIARRYNRHRAFDEEIQANKDRLCQAIDYAMQIVEERPQLADMIYPQIDSLNQQWEELEQTTFLKGEKMIEANREAIFEEGTMDVMTWLXXXXXXXXXXXXXXXXXXXXXXKLKKVEEADNEMEIKRKQIQDLKMHAAKLKEEQPEKAFGIEQKHLILEHRFTQLQMPXXXXXXXXXXXXXXXXFLRNLDDQKAWVDDKLLLAESTNFGNNLLTVQQLLRRHRYLATEVNNHKPQLEYLKEEGAVLIEEVSPMQREKFVAGLQELESLWNRLEHSIDLRQQRLKESEATQTFLFDAEEAESWLWEQELFLLSEERGIRDQEAAINVIKKHDARQKTIEDYGEEITKLGTRS 5031
            +F+++  + ++ +T+ + ++   ++G+D        +K +    D+     RV ++ ++  +L  + +    R+  R++ +   W +L D  + R+ +L    ++    ++ + +  +IN+  A   + ++GR L  VE LI KH  +E ++ ++  K+E +  +A   + S         QP     V  +  ++ E+++ L +L   RK  L A++++  FL    D   WM +    M + +L  ++     ++  H+  +  +    +     +  G  L+   +  A+ +  N+ +L L   EL +L ++R+  L+QS      LAD  + E WI  +  + +  E+  + +++ + +  H    KS+  YE NI SL+   K+ L         I  K   I  ++  L +L   +  KL ++  LF+ LR A  +++W++EK ++        E   L+    +   FE E++    +++ +    + L   + P   + V  R  +L  LW+ L DL + + ++L+ + +   +     +   WI E    + S D  G D+  +  L +R   +Q D+     ++  L ++    +A     ++ I +    + + + +L +   +R+ RL +S  L +FL D      W+   +    SED  ++L   +  + + E L+ EI+S++     LL+ G ++      A+   +  +   L E W+EL    + R   L  SL+   +     + +  ++++ + +S  D      +++ LLRKH+     L AN      +      L + G     K+      + ER    +  + + + +L D        ++ D+L  W++EK  I+++D+  R+ +++     +   F  ++ ++ +R+ +  ++A  ++++    ++MI  + + + ++W+ L++ T  + E++  A     F     ++  W++   +++ V E     L  V    +K +    +++   +++  +   A  L  + P     +  +   ++  + +LQ    +K+  L+Q + +Q FL +  D  +W++           G+    V+ L+ +++ L TE+++    +E  +     L+   +P   E        +   W+RL  S+  R Q+L+ ++  Q F  +A++ E+WL  +E  LLSE+ G    EA   ++KK D  +K +   GE+   L   S
Sbjct: 1914 QFNQEVDIADSCITDKETIVLSSDYGRDFEHCVRLQRKMKEFDQDLAVDAARVEAINVLAEKLIGQGHAGSVRIQQRQNALTERWNRLQDKASERRQKLAEACEIHAFNRNCRDVSSMINEKAAVQTSGEVGRDLPAVEALIRKHDDVERELTVIEGKMEELEGEAYRLVRS---------QPHMARAVQAKQADIIEQWERLNDLFDQRKVILEANRLLQIFLVDYRDLMSWMNDLGTRMSSGELADNVRDAEAMLGLHEERKGQMNARMDSYNATVAFGMSLVEQGHVSADVIKQNVDDLVLENTELQQLWQSRKLMLQQSTDLQMFLADAEKAENWIKNKQMVAQSIESRESLDNVESLLKSHINFEKSLSTYEENIRSLESSAKQFLQVKHYHAEAIRSKYLEILDKWEALKKLAASRSGKLGESKLLFQFLRDAKELESWMNEKLQIAAE-ASYREATNLQQKLQKHQTFEAEVSAHKSELDAITQTGQSLM-RNSPSCQETVESRLKDLADLWSLLGDLSDNKAQRLKEAIQKQTFERNVIELQAWIEEVENALASED-YGKDMRSVNNLIKRHQSLQMDIARYEDRVSELLKQAGEFVAAEHFLKDEIADRAADVAERFEQLVEPATERELRLQDSLALHQFLADTQVEVDWIKDKEPIAKSEDYGRNLLGVQSLMKKMEGLESEINSHELLVQALLETGEQLVLRGHYAERD-IGAKSQMLLELWEELRINAQTRNEKLQASLATHQYYDQVFEMDAWVSEKLSLVSSTDYGRDETSAETLLRKHDALQLELDANESKIRDLRSIYSELSDAGDTEFSKLEKIQDELEERYTHLRDVARDRHRRLLDSSRLFNFLREADELGAWVEEKEAIVSSDDCGRDLEHVEMLMQKFEVFTRDLVSSGERIAKLTEHAQMLLDDEHTDSEMIEQRAEVICERWDGLKERTSTRLEELDRARDLHAFRRSVDEIHAWIQEKIDALGVAENGAPDLRHVQALQRKHQGFQRDLQALGEKVDLVLRDADDLSAKVPAHKHELIMEKQEVQKAWKKLQQLASSKQSHLLQSEGLQAFLDDYRDLMSWIETTSAQVAEETLGSTFADVETLIAQNQELQTEIDSRANSVEEFQSRADQLLGSGNP-SAEDIRNKSSHVRDTWDRLGASLRTRTQQLQHNKEIQRFKREADQLEAWLNAREHDLLSEDVG-DSLEAVEELLKKQDEFEKMLLTQGEKFNSLTNTS 3139          

HSP 7 Score: 172.555 bits (436), Expect = 1.313e-42
Identity = 158/595 (26.55%), Postives = 275/595 (46.22%), Query Frame = 1
Query: 4576 LLLAESTNFGNNLLTVQQLLRRHRYLATEVNNHKPQLEYLKEEGAVLIEEV---SPMQREKFVAGLQELESLWNRLEHSIDLRQQRLKESEATQTFLFDAEEAESWLWEQELFLLSEERGIRDQEAAINVIKKHDARQKTIEDYGEEITKLGTRSRLLIEKDHPQADRIALAQSHVDKVYAGLRDLCLEKKQRLSEIQKLNHLYREIVDLENWIYERTLVASSHDLGVDFEHCCLLRERFDEFFHETHLLGKDRVKAANDLCASLISQCHADSAEIAQWHDRINDSWAELQELMQTRIQLLRTAWEFYKYLSSCQDVLDRICEKIA-SIPTDVSKDSQSVAIQQRKHATFLSDAQALEGQVQWVVDEANHLLPSYAGQKEWHICERRDDVLATWNQLNMQAERRRHQLEDAADLQRFFSMVRELLQWMDLVALQINEKTRPKDVSGVELLINDHRSIKAEIAAREESMSICVNLGRTLLHRGRVGVDEVRAALINLITRKYSLEDMWEERWDYLQLILEVYQFARDASVAEAWILAQEPYLANKTLGETLDETLSLLKKHINFEKTVMSQEERFEALEKLTTMEIRAKEITKESI 6348
            LL AE    GN++  V+ LL++H      V + + +L  L+  G  LI+     S M R +        E    +L+  +D R+++L+ S     F  D  E+ESW+ E+     + +   +D     + ++KH A +  +  +   I  +  +   LI   H  A  + +    +   +  L +    K ++L E +      +E+   ++ I ++  +  S D G DFEHC  L+ +  EF  +   +   RV+A N L   LI Q HA S  I Q  + + + W  LQ+    R Q L  A E + +  +C+DV   I EK A     +V +D  +V    RKH     +   +EG+++ +  EA  L+ S        +  ++ D++  W +LN   ++R+  LE    LQ F    R+L+ WM+ +  +++      +V   E ++  H   K ++ AR +S +  V  G +L+ +G V  D ++  + +L+     L+ +W+ R   LQ   ++  F  DA  AE WI  ++    +    E+LD   SLLK HINFEK++ + EE   +LE      ++ K    E+I
Sbjct: 1722 LLCAE---LGNSVDEVEFLLKKHENTEKLVLSQEEKLSALQVLGKELIDNQHNQSDMIRNRLSGVCDRRE----KLKAELDKRREKLQNSHKIMQFYQDVVESESWIMEK--LQTATDESFKDPINLESKLQKHQAFESELTAHERAIDSVRDKGEQLISCGHFAASEVEVRIEALYIQWEELLEASATKGRKLQEARDHQQFNQEVDIADSCITDKETIVLSSDYGRDFEHCVRLQRKMKEFDQDL-AVDAARVEAINVLAEKLIGQGHAGSVRIQQRQNALTERWNRLQDKASERRQKLAEACEIHAFNRNCRDVSSMINEKAAVQTSGEVGRDLPAVEALIRKHDDVERELTVIEGKMEELEGEAYRLVRSQPHMAR-AVQAKQADIIEQWERLNDLFDQRKVILEANRLLQIFLVDYRDLMSWMNDLGTRMSSGELADNVRDAEAMLGLHEERKGQMNARMDSYNATVAFGMSLVEQGHVSADVIKQNVDDLVLENTELQQLWQSRKLMLQQSTDLQMFLADAEKAENWIKNKQMVAQSIESRESLDNVESLLKSHINFEKSLSTYEENIRSLESSAKQFLQVKHYHAEAI 2305          

HSP 8 Score: 162.54 bits (410), Expect = 1.447e-39
Identity = 339/1725 (19.65%), Postives = 730/1725 (42.32%), Query Frame = 1
Query: 1348 AWLTENQRLITQDNFGQDLSAVEAAGKKHEAIKTDILAYEERVNSVTLVTSELENECYHDVERVLCRRDNVIRLWEKLLDMLAVRKLRLDACYKVQKLFQDIKHLLDLINDLKARLKTEDIGRHLMGVEDLIHKHSLLEIDIRMVGTKIEGIMSDAQPFINSE-FGLGSGDFQPADPNEVILRTVNLKEEYDNLLELSRNRKDNLSASKVMWEFLWGVADEEQWMKEKIQLMLNPDLGHDLSSVHRLISKHKVIEEDVRNHSNYLQNVIQGGQQLILDKNPGAEKVADXXXXXXXXXXXXXXXXXXRRSKLEQSLAYFHCLADCGEVEI-WIIEQVKLVKIDETSINEESIITDIHKHEQLSKSIEDYESNINSLDEQVKKLSEGDLELV-TIEEKVSNIKSQYAILIELTNQKQNKLTDTLSLFRVLRKADTVKTWIDEKEKLLMSLIPTDELEELEVFRHRFDGFEKEMNIQADQVEFVNTLAEKLSDMDHPQIADVVNKRFELNKLWNSLADLVEARREQLQTSYEFNQYLLECKQTGEWIREKSRLVESTDELGDDLAGIMQLQRRMGGMQRDMDAIRAKLEHLDEEMDTLIAKRPNXXXXXXXXXXXXXXFWAELGDMLADRDDRLSESSELQRFLQDLDHIHIWLSKMQTTVASEDLPKDLADAEKSLVQHEQLKEEIDSYQDEFIRLLDYGRRITEDKTDAQYMFLSQRLNALEEGWQELCQMWEN------RXXXXXXXXXXXVFLRDAIQSEVLLAQEENFLSKEDIPI-SIENSQNLLRKHEGFLTTLQANHDHTIAVIEFGRNLVERGHFCSDKINLRVKSILXXXXXXXXXXXXAYEKLKDQVLYQELSQDIDDLSKWI-QEKMIIATDESFREEKNIARRYNRHRAFDEEIQANKDRLCQAIDYAMQIVEERPQLADMIYPQIDSLNQQWEELEQTTFLKGEKMIEANREAIFEEGTMDVMTWLXXXXXXXXXXXXXXXXXXXXXXKLKKVEEADNEMEIKRKQIQDLKMHAAKLKEEQPEKAFGIEQKHLILEHRFTQLQMPXXXXXXXXXXXXXXXXFLRNLDDQKAWVDDKLLLAESTNFGNNLLTVQQLLRRHRYLATEVNNHKPQLEYLKEEGAVLIEEVSPMQREKFVAGLQELESL---WNRLEHSIDLRQQRLKESEATQTFLFDAEEAESWLWEQELFLLSEERGIRDQEAAINVIKKHDARQK---TIEDYGEEITKLGTRSRLLIEKDHPQADRIALAQSHVDKVYAGLRDLCLEKKQRLSEIQKLNHLYREIVDLENWIYERTLVASSHD-----------LGVDFEHCCLLRERFDEFFHETHLLGKDRVKAANDLCASLISQCHADSAEIAQWHDRINDSWAELQELMQTRIQLLRTAWEFYKYLSSCQDVLDRICEKIASIPTDVSKDS-QSVAIQQRKHATFLSDAQALEGQVQWVVDEANHLLPSYAGQKEWH---ICERRDDVLATWNQLNMQAERRRHQLEDAADLQRFFSMVRELLQWMDLVALQINEKTRPKDVSGVELLINDHRSIKAEIAAREESMSICVNLGRTLLHRGRVGVDEVRAALINLITRKYSLEDMWEERWDYLQLILEVYQFARDASVAEAWILAQEPYLANKTLGETLDETLSLLKKHINFEKTVMSQEERFEALEKLTTMEIRAKEITKESILLKDKHKQERIENAIKIFQPPPSPEL 6426
            +W   N RL    +    +  VE   KKHE     + A EE+V S+  +   + +  +   + V  R ++VI   + + +  + R+  L     +Q   +D       I + K+++  ++  +    ++  + +H   E +I      I+ I    +  I ++ FG            +V  +   L E + NL+  +  + + L  ++   +    + D   WM E   ++   D G DL+ V  L  KH+++E D+  H+  + +V    Q+L+   +  ++ +  + + L+  +  L+ LT+ RRS LE + A    + D  EVE+ W+ E ++     +   +  S+     +H      + ++++ I+++    + L +        +EE+   +++ +  L+++  Q++ +L D+    + L +A+   +W+++K  L  S     +    E    R    + ++   +  ++ +   A +L    H     + + + +L + +  L  LV+ R  +L  S + ++Y  E ++   ++ E+ +   S D  G D   +  +Q R G  QR + +      ++D     L+++   D   I+E++ I    W  L D +  R  RL+ + E+ RF +DL+ +   + +    +  EDL +DLA  +    +HE        ++ E + L      +T +    Q  +  Q   ++E+  + +  +WE       R+            L + ++  +    E + L   D P+ ++ +++ ++R+ +     + A  +    V+E G  ++E GHF  ++I  +++ +L  RE      +   E+L +        +D   +  +   ++ ++   E       +     +H   ++ + + +++L        ++++ +   +DMI  ++  +  + E+L+     + EK+  +++   F +  ++  +W+  + +    T+E  +   ++  KL+K +  ++E+    + I  ++    +L       A  +E +   L  ++ +L      K  +L + +  QQF + +D   + + DK  +  S+++G +     +L R+ +    ++     ++E +     VL E++        V   Q   +L   WNRL+     R+Q+L E+     F  +  +  S + E+     S E G RD  A   +I+KHD  ++    IE   EE+   G   RL+  + H  A  +   Q+ + + +  L DL  ++K  L   + L     +  DL +W+ +     SS +           LG+  E    +  R D +             A      SL+ Q H  +  I Q  D +     ELQ+L Q+R  +L+ + +   +L+  +   + I  K     +  S++S  +V    + H  F       E  ++ +   A   L      K +H   I  +  ++L  W  L   A  R  +L ++  L +F    +EL  WM+   LQI  +   ++ + ++  +  H++ +AE++A +  +      G++L+       + V + L +L      L D+ + +   L+  ++   F R+    +AWI   E  LA++  G+ +    +L+K+H + +  +   E+R   L K     + A+   K+ I  +     ER E   ++ +P    EL
Sbjct:  865 SWAKRNDRLHQGLDLQSSVDEVEWLLKKHEDFVKTLTAQEEKVRSLADMAKTIIHARHQARDWVASRAESVINRRDNVKNQASDRQKALLTSQVLQNFIRDADEFGGWIKE-KSQIAEDESFKDPKNLQGNLKRHKAFEAEITANKDGIDRINKAGKDLIRTKHFG----------AQKVKDKLKGLNEAWLNLVADTTEKGNKLQQAERQRQLNRAMEDVRIWMNETEAVLGLEDTGRDLAGVKFLTKKHQLLESDIEMHATVIVDVADKAQELVSQGHFNSDTIKSDSENLQSRYRSLLCLTDKRRSVLEDAFALHQFIYDI-EVEMTWVREHLQQASSGDLGTSLISVQRLQKRHLAFENELTNHQTRIDTVLSSGQDLIDSCYSATDKVEERCEELQNLWDELVDMAAQRKQRLHDSFLSQKYLSEANEADSWMNDKAGLAASQDYGKDGASAETLLTRHKALQVDVAAFSTTIDELAEEARRLVQSSHFDSEKISSTQRDLEEQFCGLNTLVKTRHTRLTESKKLHEYRREVEEISAYVSEQLQTAASED-YGTDFEHLQVIQGRFGDFQRSVASYAENFRNVDNLAKMLVSEGHTDTVAIKEQQDITRSMWLHLEDQIRLRQKRLTSAEEIHRFNRDLNELISRIQEKDAAINLEDLGRDLASTQVLQRKHE-------VFECELVTLEKQIEELTVESARLQATYQGQTARSVEQHEKYVLSLWEELKRKTSRKRRKLHDAYEFYKLGNTVRDLISWCIETSRLIASDDPVHTVSDAERMMRELDEHHAEMDAREESFARVLETGEKMIEDGHFAEEEITDKLELLLSERERLYASWDTRKEELSEAYYLHVFLKDAKQVDSFTSSQEAVLLCAELGNSVDEVEFLLKKHENTEKLVLSQEEKLSALQVLGKELIDNQHNQSDMIRNRLSGVCDRREKLKAELDKRREKLQNSHKIMQFYQDVVESESWI--MEKLQTATDESFKDPINLESKLQKHQAFESELTAHERAIDSVRDKGEQLISCGHFAASEVEVRIEALYIQWEELLEASATKGRKLQEARDHQQFNQEVDIADSCITDKETIVLSSDYGRDFEHCVRLQRKMKEFDQDLAVDAARVEAIN----VLAEKLIGQGHAGSVRIQQRQNALTERWNRLQDKASERRQKLAEACEIHAFNRNCRDVSSMINEKAAVQTSGEVG-RDLPAVEALIRKHDDVERELTVIEGKMEELE--GEAYRLVRSQPH-MARAVQAKQADIIEQWERLNDLFDQRKVILEANRLLQIFLVDYRDLMSWMNDLGTRMSSGELADNVRDAEAMLGLHEERKGQMNARMDSY------------NATVAFGMSLVEQGHVSADVIKQNVDDLVLENTELQQLWQSRKLMLQQSTDLQMFLADAEKAENWIKNKQMVAQSIESRESLDNVESLLKSHINFEKSLSTYEENIRSLESSAKQFLQV----KHYHAEAIRSKYLEILDKWEALKKLAASRSGKLGESKLLFQFLRDAKELESWMN-EKLQIAAEASYREATNLQQKLQKHQTFEAEVSAHKSELDAITQTGQSLMRNSPSCQETVESRLKDLADLWSLLGDLSDNKAQRLKEAIQKQTFERNVIELQAWIEEVENALASEDYGKDMRSVNNLIKRHQSLQMDIARYEDRVSELLKQAGEFVAAEHFLKDEIADRAADVAERFE---QLVEPATEREL 2539          

HSP 9 Score: 80.1073 bits (196), Expect = 1.548e-14
Identity = 132/649 (20.34%), Postives = 281/649 (43.30%), Query Frame = 1
Query: 2263 RRSKLEQSLAYFHCLADCGEVEIWIIEQVKLVKIDETSINEESIITDIHKHEQLSKSIEDYESNINSLDEQVKKL-SEGDLELVTIEEKVSNIKSQYAILIELTNQKQNKLTDTLSLFRVLRKADTVKTWIDEKEKLLMSLIPTDELEELEVFRHRFDGFEKEMNIQADQVEFVNTLAEKLSDMDHP-QIADVVNKRFELNKLWNSLADLVEARREQLQTSYEFNQYLLECKQTGEWIRE-KSRLVESTDELGDDLAGIMQLQRRMGGMQRDMDAIRAKLE---HLDEEMDTLIAKRPNXXXXXXXXXXXXXXFWAELGDMLADRDDRLSESSELQRFLQDLDHIHIWLSK-----MQTTVASEDLPKDLADAEKSLVQ-HEQLKEEIDSYQDEFIRLLDYGRRITEDKTDAQYMFLSQRLNALEEGWQELCQMWENRXXXXXXXXXXXVFLRDA------IQSEVLLAQEENFLSKEDIPISIENSQNLLRKHEGFLTTLQANHDHTIAVIEFGRNLVERGHFCSDKINLRVKSILXXXXXXXXXXXXAYEKLKDQVLYQELSQDIDDLSKWIQE-KMIIATDESFREEKNIARRYNRHRAFDEEIQANKDRLCQAIDYAMQIVEERPQLADMIYPQIDSLNQQWEEL 4152
            RR  L++++ Y+H   +C ++++W+  + +  K  E+    ++I T   K E+ +  I    S ++ +++   +L  +G      ++ K   I  ++  L  L  +++  L +   +   L   + +++WI EK+  L       ++E +     R  G E+++    D+V  +   A+ L  + HP Q   +  K  E+  LW  L      R+  L  +Y    +L + +    W  E K   + + D    D+A   +L   +   +   D I+ + E    LDE    L+A  P   ++ +    +  +  A L    A R+DRL +  +LQ  + +++    WL K     ++T  A E+  + LAD  K+++    Q ++ + S  +  I   D    +    +D Q   L+              Q+ +N             F+RDA      I+ +  +A++E+F          +N Q  L++H+ F   + AN D    + + G++L+   HF + K+  ++K + E   +    + E   KL+     ++L++ ++D+  W+ E + ++  +++ R+   +     +H+  + +I+ +   +    D A ++V +    +D I    ++L  ++  L
Sbjct:  552 RRLSLQKAIKYYHFCHECEDMDLWMSNKERQFKSIESQNTLDAIQTVRQKLERFATEIATKCSRVSDINQLADELIQDGHAHSAAVKAKRKEINERWEKLQRLKVKEEENLAEKHGVELFLDVCEEMRSWIQEKDAALCKEELGKDIETVRAQLRRHQGIERDLAAVEDKVAKLQDQAKSLV-VRHPRQARQIKAKEGEVISLWAILKSKANKRKGLLDEAYGQQGFLADARDLMSWSAELKESFISAEDP--QDIASASEL---IQQHEEKFDEIQTRFERFDQLDEYGRNLLATSPQAVQVKQSMAALKAEK-AALSSSWAKRNDRLHQGLDLQSSVDEVE----WLLKKHEDFVKTLTAQEEKVRSLADMAKTIIHARHQARDWVASRAESVINRRD---NVKNQASDRQKALLT-------------SQVLQN-------------FIRDADEFGGWIKEKSQIAEDESFKDP-------KNLQGNLKRHKAFEAEITANKDGIDRINKAGKDLIRTKHFGAQKVKDKLKGLNEAWLNLVADTTEKGNKLQQAERQRQLNRAMEDVRIWMNETEAVLGLEDTGRDLAGVKFLTKKHQLLESDIEMHATVIVDVADKAQELVSQGHFNSDTIKSDSENLQSRYRSL 1153          

HSP 10 Score: 69.3218 bits (168), Expect = 2.753e-11
Identity = 136/718 (18.94%), Postives = 308/718 (42.90%), Query Frame = 1
Query: 1903 LKEEYDNLLELSRNRKDNLSASKVMWEFLWGVADEEQWMKEKIQLMLNPDLGHDLSSVHRLISKHKVIEEDVRNHSNYLQNVIQGGQQLILDKNPGAEKVADXXXXXXXXXXXXXXXXXXRRSKLEQSLAYFHCLADCGEVEIWIIEQVKLVKIDETSINEESIITDIHKHEQLSKSIEDYESNINSLDEQVKKLSEGDLELVTIEEKVSNIKSQYAILIELTNQKQNKLTDTLSLFRVLRKADTVKTWIDEKEKLLMSLIPTDELEELEVFRHRFDGFEKEMNIQADQVEFVNTLAEKLSDMDHPQIADVVNKRFE--LNKLWNSLADLVEARREQLQTSYEFNQYLLECKQTGEWIREKSRLVESTDELGDDLAGIMQLQRRMGGMQRDMDAIRAKLEHLDEEMDTLIAKRPNXXXXXXXXXXXXXXFWAELGDMLADRDDRLSESSELQRFLQDLDHIHIWLSKMQTTVASEDLPKDLADAEKSLVQHEQLKEEIDSYQDEFIRLLDYGRRITEDKTDAQYMFLSQRLNA----LEEGWQELCQMWENRXXXXXXXXXXXVFLRDAIQSEVLLAQEE-NFLSKEDIPISIENSQNLLRKHEGFLTTLQANHDHTIAVIEFGRNLVERGHFCSDKINLRVKSILXXXXXXXXXXXXAYEKLKDQVLYQELSQDIDDLSKWIQEKMIIATDESFREEKNIARR-YNRHRAFDEEIQA 4032
            + E ++ L  L    ++NL+    +  FL    +   W++EK   +   +LG D+ +V   + +H+ IE D+    + +  +    + L++     A ++     E+  LW  L      R+  L+++      LAD  ++  W  E      + E+ I+ E    DI    +L +  E+    I +  E+  +L E    L+    +   +K   A L        +                   +W    ++L   L     ++E+E    + + F K +  Q ++V  +  +A+ +    H Q  D V  R E  +N+  N + +    R++ L TS     ++ +  + G WI+EKS++ E  DE   D   +    +R    + ++ A +  ++ +++    LI  +    + ++++   L + W  L     ++ ++L ++   ++  + ++ + IW+++ +  +  ED  +DLA  +    +H+ L+ +I+ +    + + D  + +      +Q  F S  + +    L+  ++ L  + + R+ +L  + +L  F+ D I+ E+   +E     S  D+  S+ + Q L ++H  F   L  +      V+  G++L++  +  +DK+  R + +    +     + +  ++L D  L Q+   + ++   W+ +K  +A  + + ++   A     RH+A   ++ A
Sbjct:  644 INERWEKLQRLKVKEEENLAEKHGVELFLDVCEEMRSWIQEKDAALCKEELGKDIETVRAQLRRHQGIERDLAAVEDKVAKLQDQAKSLVVRHPRQARQIKAKEGEVISLWAILKSKANKRKGLLDEAYGQQGFLADARDLMSWSAE------LKESFISAED-PQDIASASELIQQHEEKFDEIQTRFERFDQLDEYGRNLLATSPQAVQVKQSMAALKAEKAALSS-------------------SWAKRNDRLHQGLDLQSSVDEVEWLLKKHEDFVKTLTAQEEKVRSLADMAKTIIHARH-QARDWVASRAESVINRRDN-VKNQASDRQKALLTSQVLQNFIRDADEFGGWIKEKSQIAE--DESFKDPKNLQGNLKRHKAFEAEITANKDGIDRINKAGKDLIRTKHFGAQKVKDKLKGLNEAWLNLVADTTEKGNKLQQAERQRQLNRAMEDVRIWMNETEAVLGLEDTGRDLAGVKFLTKKHQLLESDIEMHATVIVDVADKAQELV-----SQGHFNSDTIKSDSENLQSRYRSLLCLTDKRRSVLEDAFALHQFIYD-IEVEMTWVREHLQQASSGDLGTSLISVQRLQKRHLAFENELTNHQTRIDTVLSSGQDLIDSCYSATDKVEERCEELQNLWDELVDMAAQRKQRLHDSFLSQKYLSEANEADSWMNDKAGLAASQDYGKDGASAETLLTRHKALQVDVAA 1325          

HSP 11 Score: 67.0106 bits (162), Expect = 1.108e-10
Identity = 64/213 (30.05%), Postives = 101/213 (47.42%), Query Frame = 1
Query: 3184 FWAELGDMLADRDDRLSESSELQRFLQDLDHIHIWLSKMQTTVASEDLPKDLADAEKSLVQHEQLKEEIDSYQDEFIRLLDYGRRITEDKTDAQYMFLSQRLNALEEGWQELCQMWENRXXXXXXXXXXXVFLRDAIQSEVLLAQEENFLSKEDIPI--------------SIENSQNL---LRKHEGFLTTLQANHDHT--IAVIEFGRNLV 3765
             WA L      R   L E+   Q FL D   +  W ++++ +  S + P+D+A A + + QHE+  +EI +  + F +L +YGR +    T  Q + + Q + AL+     L   W  R   L Q L LQ F+RDA   + + A +E FL+KED+                S ++ +NL   L++H+ F   + AN D    I  + FG  LV
Sbjct:  234 LWAGLKSKANKRKGLLDEAYGQQGFLVDARDLMSWSAELKESFISAEDPQDIASASELIQQHEEKFDEIQTRFERFDQLDEYGRNLL--ATSPQAVQVKQSMAALKAEKAALSSSWAKRNDRLHQGLDLQTFIRDAEHVDAVTASQETFLAKEDLGFGGWIKEKSQIAEDESFKDPKNLQGNLKRHKAFEAEITANKDGIDRINKLRFGSTLV 444          

HSP 12 Score: 55.0694 bits (131), Expect = 4.951e-7
Identity = 47/163 (28.83%), Postives = 81/163 (49.69%), Query Frame = 1
Query: 3622 ENFLSKEDIPISIENSQNLLRKHEGFLTTLQANHDHTIAVIEFGRNLVERGHFCSDKINLRVKSILXXXXXXXXXXXXAYEKLKDQVLYQEL--------SQDIDDLSK---------------WIQEKMIIATDESFREEKNIARRYNRHRAFDEEIQANKD 4041
            E+F+S ED P  I ++  L+++HE     +Q   +    + E+GRNL+      +    ++VK  +   ++ K   + ++ K  D+ L+Q L        ++ +D ++                WI+EK  IA DESF++ KN+     RH+AF+ EI ANKD
Sbjct:  274 ESFISAED-PQDIASASELIQQHEEKFDEIQTRFERFDQLDEYGRNLL-----ATSPQAVQVKQSMAALKAEKAALSSSWAKRNDR-LHQGLDLQTFIRDAEHVDAVTASQETFLAKEDLGFGGWIKEKSQIAEDESFKDPKNLQGNLKRHKAFEAEITANKD 429          
BLAST of Spectrin beta chain vs. Ensembl Medaka
Match: sptbn1 (spectrin beta chain, non-erythrocytic 1-like [Source:NCBI gene;Acc:101164035])

HSP 1 Score: 1763.81 bits (4567), Expect = 0.000e+0
Identity = 979/2287 (42.81%), Postives = 1476/2287 (64.54%), Query Frame = 1
Query:  172 RIKALAGEREKVQKKTFTKWINSHLNKLKQSIDDLYNXXXXXXXXXXXXXXXXXXXXPYPTKGKMRIHCLENVDKSLNFLIEQRVHLENMGAHDIVDGNARLTLGLIWTIILRFQIQDIVVEEDDTSEKRQAKDALLLWCQMKTAGYPNTNVRNFSTCWRDGLAFNAIIHRHRPDLLEYSALSRSNPNENLEQAIRIAEEKLGIPRLLDPEDVSVENPDEKSIMTYVVTFYHFFSKMKADSVHSKRVGKILSQSMETEEMMVHYDKLTSNLLEWINQTIELLNDRTFANSLSGVQQQLAAFNTYRVTEKPPKFQEKGNLEMLLFSIQSQMRANNQMPYLPIEGKLISDINNAWNKLDKAEHARELALRDELIRQEKLEQLALRFDRKAGMREAWLTENQRLITQDNFGQDLSAVEAAGKKHEAIKTDILAYEERVNSVTLVTSELENECYHDVERVLCRRDNVIRLWEKLLDMLAVRKLRLDACYKVQKLFQDIKHLLDLINDLKARLKTEDIGRHLMGVEDLIHKHSLLEIDIRMVGTKIEGIMSDAQPFINSEFGLGSGDFQPADPNEVILRTVNLKEEYDNLLELSRNRKDNLSASKVMWEFLWGVADEEQWMKEKIQLMLNPDLGHDLSSVHRLISKHKVIEEDVRNHSNYLQNVIQGGQQLILDKNPGAEKVADXXXXXXXXXXXXXXXXXXRRSKLEQSLAYFHCLADCGEVEIWIIEQVKLVKIDETSINEESIITDIHKHEQLSKSIEDYESNINSLDEQVKKLSEGDLELVTIEEKVSNIKSQYAILIELTNQKQNKLTDTLSLFRVLRKADTVKTWIDEKEKLLMSLIPTDELEELEVFRHRFDGFEKEMNIQADQVEFVNTLAEKLSDMDHPQIADVVNKRFELNKLWNSLADLVEARREQLQTSYEFNQYLLECKQTGEWIREKSRLVESTDELGDDLAGIMQLQRRMGGMQRDMDAIRAKLEHLDEEMDTLIAKRPNXXXXXXXXXXXXXXFWAELGDMLADRDDRLSESSELQRFLQDLDHIHIWLSKMQTTVASEDLPKDLADAEKSLVQHEQLKEEIDSYQDEFIRLLDYGRRITEDKTDAQYMFLSQRLNALEEGWQELCQMWENRXXXXXXXXXXXVFLRDAIQSEVLLAQEENFLSKEDIPISIENSQNLLRKHEGFLTTLQANHDHTIAVIEFGRNLVERGHFCSDKINLRVKSILXXXXXXXXXXXXAYEKLKDQVLYQELSQDIDDLSKWIQEKMIIATDESFREEKNIARRYNRHRAFDEEIQANKDRLCQAIDYAMQIVEERPQLADMIYPQIDSLNQQWEELEQTTFLKGEKMIEANREAIFEEGTMDVMTWLXXXXXXXXXXXXXXXXXXXXXXKLKKVEEADNEMEIKRKQIQDLKMHAAKLKEEQPEKAFGIEQKHLILEHRFTQLQMPXXXXXXXXXXXXXXXXFLRNLDDQKAWVDDKLLLAESTNFGNNLLTVQQLLRRHRYLATEVNNHKPQLEYLKEEGAVLIEEVSPMQREKFVAGLQELESLWNRLEHSIDLRQQRLKESEATQTFLFDAEEAESWLWEQELFLLSEERGIRDQEAAINVIKKHDARQKTIEDYGEEITKLGTRSRLLIEKDHPQADRIALAQSHVDKVYAGLRDLCLEKKQRLSEIQKLNHLYREIVDLENWIYERTLVASSHDLGVDFEHCCLLRERFDEFFHETHLLGKDRVKAANDLCASLISQCHADSAEIAQWHDRINDSWAELQELMQTRIQLLRTAWEFYKYLSSCQDVLDRICEKIASIPTDVSKDSQSVAIQQRKHATFLSDAQALEGQVQWVVDEANHLLPSYAGQKEWHICERRDDVLATWNQLNMQAERRRHQLEDAADLQRFFSMVRELLQWMDLVALQINEKTRPKDVSGVELLINDHRSIKAEIAAREESMSICVNLGRTLLHRGRVGVDEVRAALINLITRKYSLEDMWEERWDYLQLILEVYQFARDASVAEAWILAQEPYLANKTLGETLDETLSLLKKHINFEKTVMSQEERFEALEKLTT------------MEIRAKEITKESILLKDKHKQER---IENAIKIFQPPP-----SPELVHESPKVSISEEDEEGKSHQHKISVISKEAAEMCQSSETKTDIRGILIRKHEWEYKNRKALNRSWHEFLVVLSIEKNKLLVYKDEKHYNEKPQDTYHKDSGLDLNDLVAAPASDYLKRPFVFRIKITSTGAEYLFQAKDEEDMLRWVNSINENSQKDLKSE------TTAPGKSSTLPACTS 6954
            R K L  ERE VQKKTFTKW+NSHL+++   I DLY DL+DG+ML+ LLE+LSGE+LP PTKG+MRIHCLENVDK+L FL EQRVHLENMG+HDIVDGN RLTLGLIWTIILRFQIQDI VE +D  E+R AKDALLLWCQMKTAGYPN N++NF+T WRDG+AFNA+IH+HRPDL+++  L +SN + NL+ A  +AE+ LG+ RLLDPED+SV++PDEKS++TYVVT+YH+FSKMKA  V  KR+GK+L  ++ETE ++  Y+ L S LLEWI QTI +LN+R FANSL GVQQQL AFNTYR  EKPPKF EKGNLE+LLF+IQS+MRANNQ  Y+P EGKLISDIN AW +L+KAEH RELALR ELIRQEKLEQLA RFDRKA MRE WL+ENQRL++QDNFG DL AVEAA KKHEAI+TDI AYEERV +V  V+ ELE ECYHD++R+  R+DNV+RLWE LL++L  R+ RL+    +Q++FQ++ +++D ++++K  L ++D G+HL+GVEDL+ KH+L+E DI +   ++  +  +A     +++ +  G ++P DP  +  R  +L+  Y  L +L+  R+  L  S+ +W+F W +A+EE W++EK Q++ + + G DL+   RL+S+ + +E+++   + +LQ+ I  G+ ++   + G++K+ + + +L+  W EL +     R +LE++LA     AD  +V+ W ++ +++V   ET  NE S    + KH+  +  +  Y   I+SL EQ   L + + E  ++  +++ I+ +Y  + ELT  ++  L D L+  ++  +A+  + WI+EKE+ L +    ++LE+LEV +HRFD  E EMN QA +V  VN +  +L     P   D+  ++ +LN  W    DL++ ++E L ++     Y L+C +T  WI+EK++++EST ELG+DL G++ LQR++ GM+RD+ AI  KL  L  E   L  + P+  + I      +   W E+ + L  R++ L E+ +LQ+FL+DLD    WLS+ QT VASED+P  LA+AEK + QH+ +K EI +Y++++ ++ D G  +T  +TDAQYMFL QRL AL+ GW EL +MWENRQ LLSQS + Q+FLRD  Q+E  L  +E  L+  ++P ++E ++  ++K E F+TT+ AN D    V+E GR L   G+  ++KI  +V SI +R + N+  + E   +LKD    Q+  Q+  +LS WI EKM+ A D ++ E +N+  ++ +H+AF  E+Q+NK+ L +       +V E+P+   ++  ++ +L+  WEELE TT  K + + +AN+  +F +   D+  WL  +   I   +   +  +   + LKK +  +N++E++++++ +L+     L +E  +    ++ +   +E +F +L  P+++++  L+  +   QF R+++D+  W  +++ +A ST+ G+NL TVQ L+++++ L  E+  H+P+++ + E    L+ + +    E     L EL+ LW+RL      R  RL+E+   Q + FDA EAE+W+ EQEL+++SEE+  +D+++AI ++KKH   ++ +EDY E + +L   SR L+  +HP+++RI + QS VDK+YAGL+DL  E++ +L E  +L  L RE+ DLE WI ER +VA SH+LG D+EH  +L+ERF EF  +T  +G++RV   N L   LI+  H D+A +A+W D +N++WA+L EL+ TR Q+L  ++E +K+    +++L RI +K   +P ++ +D  +V   QR H +F  D QAL  QV+ + ++A  L  SYAG K   I  +  +VL  W  L    + RR +L D  +  RFFSMVR+LL WMD V   I  +  P+DVS VELL+N+H+ IKAEI AR +S S CV LG+ LL R      E++  L+ L  ++  + D WE+RW++L+LILEV+QF+RDA VAEAW+L QEPYL+++ +G+++DE   L+K+H  FEK+  + EERF ALE+LTT            ME R +  + E  L +++ +QE+   ++N +   +  P        LV+   + S  E          K +  S+ +    +S ++   + G+L RKHEWE  N+KA NRSWH    V+     ++  +KD K   +     YH    + L D     ASDY K+ +VF++++ + G EYLFQAKDEE+M  W+  I   +  +L         T   G++ TLPA  +
Sbjct:   15 RFKQLQDEREAVQKKTFTKWVNSHLSRVSCRITDLYLDLRDGRMLIKLLEVLSGERLPKPTKGRMRIHCLENVDKALQFLKEQRVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKERRSAKDALLLWCQMKTAGYPNVNIQNFTTSWRDGMAFNALIHKHRPDLIDFDKLKKSNAHYNLQNAFNLAEQHLGLTRLLDPEDISVDHPDEKSVITYVVTYYHYFSKMKALKVEGKRIGKVLDNAIETENLIEKYESLASALLEWIEQTIIILNNRKFANSLVGVQQQLQAFNTYRTVEKPPKFTEKGNLEVLLFTIQSKMRANNQKVYMPREGKLISDINKAWERLEKAEHERELALRMELIRQEKLEQLARRFDRKAAMRETWLSENQRLVSQDNFGLDLQAVEAATKKHEAIETDIAAYEERVQAVVAVSKELELECYHDIKRIAARKDNVLRLWEYLLELLKARRQRLEMNLGLQRVFQEMLYIMDWMDEMKMLLLSQDYGKHLLGVEDLLQKHALVEADIAIQADRVRAVSCNA-----NKYSVTDGGYKPCDPRVIQDRVAHLEFCYQELTQLAAERRARLEDSRRLWKFFWEMAEEEGWIREKEQILSSLEQGRDLTGAVRLLSQQRALEDEMSGRAGHLQHTITEGRAMVQVGHNGSDKILERIGDLQAQWAELEQHAAVTRRRLEEALALHQFQADADDVDAWTLDALRIVSSGETGHNEFSTQALVRKHKDAAAEVASYRPVIDSLHEQAATLPKEEAE--SVRGRLAGIEERYKEVAELTKLRKEALQDALARHKMFSEANACQVWIEEKEQWLNATEIPEKLEDLEVVQHRFDSLEPEMNNQASRVAVVNQIGRQLMHAGSPS-DDIKAQQDKLNNRWGLFRDLLDLKKESLNSALGVQNYHLDCNETKSWIKEKTKVIESTQELGNDLMGVLALQRKLTGMERDLVAIEDKLGDLRGEAQRLAEEHPDQAKAITGRLAEITAVWEEMKNTLKRREESLGEARKLQQFLRDLDDFQSWLSRTQTAVASEDMPNTLAEAEKLMAQHDGIKNEILNYEEDYQKMRDMGDMVTRGQTDAQYMFLQQRLQALDTGWNELHKMWENRQNLLSQSHAYQLFLRDTKQAEAFLNNQEYVLAHAEMPPTLEGAEAAIKKQEDFMTTMDANEDKINGVMEAGRRLASDGNINAEKIKEKVASIDDRHKKNREAAVELLMRLKDNRDLQKFLQECQELSLWISEKMLTAQDMTYDEARNLHSKWLKHQAFMAELQSNKEWLNKIEKDGTLLVSEKPETEVVVKEKLTALHSMWEELESTTQTKAQCLFDANKTELFTQSCTDLDKWLGGLEGQIQSEDYGKDLTSVNIL-LKKQQMLENQVEVRQREVVELQSQVKALGQEAKDTD-EVDGRRQGVEKKFQELLEPLRHRRNLLVASREGHQFNRDVEDEILWAQERMPVATSTDHGHNLQTVQLLMKKNQTLEKELQGHQPRIDDILERSQSLLRDQTSGT-EGIHRRLAELQELWDRLREEGRRRHARLQEAHKAQQYYFDAAEAEAWMSEQELYMMSEEKA-KDEQSAITMLKKHQIMEQAVEDYAEVVHQLSKTSRGLVANEHPESERIGMRQSQVDKLYAGLKDLSEERRGKLEERLRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFREFARDTGNIGQERVDGVNHLADELINAGHGDAATVAEWKDGLNEAWADLLELIDTRTQILAASFELHKFYHDGKEILARIADKQKKLPEEMGRDQNTVETLQRMHTSFERDVQALGAQVRQLQEDAVRLQSSYAGDKADDIQRKDGEVLEAWRILLEACDSRRSRLLDTGERFRFFSMVRDLLLWMDDVIRLIEAQENPRDVSSVELLMNNHQGIKAEIDARNDSFSTCVELGKALLARKHYAAAEIKEKLLQLTDKRKEMIDKWEDRWEWLRLILEVHQFSRDAGVAEAWLLGQEPYLSSREVGQSVDEVEKLIKRHEAFEKSAATWEERFSALERLTTLELLEVRRQQEEMERRRRPPSPEQ-LHQEEVQQEKSVVMQNGLPSDEDSPWTGLEGGGLVNGLVERSSMEPSPAPSPTMTKKNKHSQSSTLPLKSQDSPVQMEGLLHRKHEWEGHNKKASNRSWHNVYCVVC--HQEMSFFKDSKAAAQGA--AYHNQPPVSLKDATCDVASDYKKKKYVFKLRV-ADGNEYLFQAKDEEEMSSWIQVILNAAASELTDTQSSFPGTPVSGRAQTLPATIT 2283          
BLAST of Spectrin beta chain vs. Ensembl Medaka
Match: SPTBN1 (spectrin beta chain, non-erythrocytic 1 [Source:NCBI gene;Acc:101159770])

HSP 1 Score: 1757.65 bits (4551), Expect = 0.000e+0
Identity = 932/2054 (45.37%), Postives = 1402/2054 (68.26%), Query Frame = 1
Query:  154 KLYERFRIKALAGEREKVQKKTFTKWINSHLNKLKQSIDDLYNXXXXXXXXXXXXXXXXXXXXPYPTKGKMRIHCLENVDKSLNFLIEQRVHLENMGAHDIVDGNARLTLGLIWTIILRFQIQDIVVEEDDTSEKRQAKDALLLWCQMKTAGYPNTNVRNFSTCWRDGLAFNAIIHRHRPDLLEYSALSRSNPNENLEQAIRIAEEKLGIPRLLDPEDVSVENPDEKSIMTYVVTFYHFFSKMKADSVHSKRVGKILSQSMETEEMMVHYDKLTSNLLEWINQTIELLNDRTFANSLSGVQQQLAAFNTYRVTEKPPKFQEKGNLEMLLFSIQSQMRANNQMPYLPIEGKLISDINNAWNKLDKAEHARELALRDELIRQEKLEQLALRFDRKAGMREAWLTENQRLITQDNFGQDLSAVEAAGKKHEAIKTDILAYEERVNSVTLVTSELENECYHDVERVLCRRDNVIRLWEKLLDMLAVRKLRLDACYKVQKLFQDIKHLLDLINDLKARLKTEDIGRHLMGVEDLIHKHSLLEIDIRMVGTKIEGIMSDAQPFINSEFGLGSGDFQPADPNEVILRTVNLKEEYDNLLELSRNRKDNLSASKVMWEFLWGVADEEQWMKEKIQLMLNPDLGHDLSSVHRLISKHKVIEEDVRNHSNYLQNVIQGGQQLILDKNPGAEKVADXXXXXXXXXXXXXXXXXXRRSKLEQSLAYFHCLADCGEVEIWIIEQVKLVKIDETSINEESIITDIHKHEQLSKSIEDYESNINSLDEQVKKLSEGDLELVTIEEKVSNIKSQYAILIELTNQKQNKLTDTLSLFRVLRKADTVKTWIDEKEKLLMSLIPTDELEELEVFRHRFDGFEKEMNIQADQVEFVNTLAEKLSDMDHPQIADVVNKRFELNKLWNSLADLVEARREQLQTSYEFNQYLLECKQTGEWIREKSR-LVESTDELGDDLAGIMQLQRRMGGMQRDMDAIRAKLEHLDEEMDTLIAKRPNXXXXXXXXXXXXXXFWAELGDMLADRDDRLSESSELQRFLQDLDHIHIWLSKMQTTVASEDLPKDLADAEKSLVQHEQLKEEIDSYQDEFIRLLDYGRRITEDKTDAQYMFLSQRLNALEEGWQELCQMWENRXXXXXXXXXXXVFLRDAIQSEVLLAQEENFLSKEDIPISIENSQNLLRKHEGFLTTLQANHDHTIAVIEFGRNLVERGHFCSDKINLRVKSILXXXXXXXXXXXXAYEKLKDQVLYQELSQDIDDLSKWIQEKMIIATDESFREEKNIARRYNRHRAFDEEIQANKDRLCQAIDYAMQIVEERPQLADMIYPQIDSLNQQWEELEQTTFLKGEKMIEANREAIFEEGTMDVMTWLXXXXXXXXXXXXXXXXXXXXXXKLKKVEEADNEMEIKRKQIQDLKMHAAKLKEEQPEKAFGIEQKHLILEHRFTQLQMPXXXXXXXXXXXXXXXXFLRNLDDQKAWVDDKLLLAESTNFGNNLLTVQQLLRRHRYLATEVNNHKPQLEYLKEEGAVLIEEVSPMQREKFVAGLQELESLWNRLEHSIDLRQQRLKESEATQTFLFDAEEAESWLWEQELFLLSEERGIRDQEAAINVIKKHDARQKTIEDYGEEITKLGTRSRLLIEKDHPQADRIALAQSHVDKVYAGLRDLCLEKKQRLSEIQKLNHLYREIVDLENWIYERTLVASSHDLGVDFEHCCLLRERFDEFFHETHLLGKDRVKAANDLCASLISQCHADSAEIAQWHDRINDSWAELQELMQTRIQLLRTAWEFYKYLSSCQDVLDRICEKIASIPTDVSKDSQSVAIQQRKHATFLSDAQALEGQVQWVVDEANHLLPSYAGQKEWHICERRDDVLATWNQLNMQAERRRHQLEDAADLQRFFSMVRELLQWMDLVALQINEKTRPKDVSGVELLINDHRSIKAEIAAREESMSICVNLGRTLLHRGRVGVDEVRAALINLITRKYSLEDMWEERWDYLQLILEVYQFARDASVAEAWILAQEPYLANKTLGETLDETLSLLKKHINFEKTVMSQEERFEALEKLTTM 6312
            +L+ER RIKALA ERE VQKKTFTKW+NSHL+++   I DLY DL+DG+ML+ LLE+LSGE+LP PTKG+MRIHCLENVDK+L FL EQRVHLENMG+HDIVDGN RLTLGLIWTIILRFQIQDI VE +D  EK+ AKDALLLWCQMKTAGYPN N+ NF+T WRDG+AFNA+IH+HRPDL+++  L +SN + NL+ A  +AE+ LG+ +LLDPED+SV++PDEKSI+TYVVT+YH+FSKMKA  V  KR+GK+L  ++ETE+M+  Y+ L S+LLEWI QTI +LN+R FANSL GVQQQL AFNTYR  EKPPKF EKGNLE+LLF+IQS+MRANNQ  Y P EGKLISDIN AW +L+KAEH RELALR ELIRQEKLEQLA RFDRKA MRE WL+ENQRL++QDNFG DL AVEAA KKHEAI+TDI AYEERV +V  V  ELE E YHD++R+  R+DNV RLWE LL++L  R+ RL+    +Q++FQ++ +++D ++++K  L ++D G+HL+GVEDL+ KH+L+E DI +   ++  + S+AQ F +   G     ++P DP  +  R  +L+  Y  L++L+  R+  L  S+ +W+F W +A+EE W++EK Q++ + D G DL+   RL+S+HK  E+++   + +LQ  I+ G+ L+ D + GA+K+ + +++++  W  L  LT  R+S+L+++  +    AD  +++ W+++ +++V   +   +E S    + KH+ +++ I+ Y   I +L +Q + L         ++ +++ I+ +Y  + ELT  ++  L D L+L+++L +A   + WIDEKE+ L S+   ++LE+LEV +HRF+  E EMN QA +V  VN +A +L    HP   ++  ++ +LN  W+   DLV+ ++E L ++     Y LEC +T  WI+EK++ L+EST ELG+DLAG+M LQR++ GM+RD+ AI  K+  L +E + L ++ P   E I+     +   W E+ D L +R++ L E+S+LQ+FL+DLD    WLS+ QT +ASED+P  LA+AEK L QHE +K EI +Y++++ ++ D G  +T+ +TDAQ+MFL QRL AL+ GW EL +MWENRQ LLSQS + Q+FLRD  Q+E  L  +E  L+  ++P ++E ++  ++K E F+TT+ AN +    V++ GR LV  G+  S++I  +V SI +R + N++ +++   +LKD    Q+  QD  +L+ WI EKM+ A D ++ E +N+  ++ +H+AF  E+Q+NK+ L +       ++ E+P+   ++  ++ SL   WEELE TT  K + + +AN+  +F +   D+  WL  +   +   +   +  +   + LKK +  ++++E+++K++ +LK  +  L++E  + +  ++ + +I+E +F  LQ P+K ++ +L+  + I QF R+++D+  WV++++ LA ST+ G+NL TVQ L+++++ L  E+  H+P+ + + E    ++ E SP   E     L EL+SLW +++   + R  RL E+   Q + FDA EAE+W+ EQEL+++SEE+  +D+++A+ ++KKH   ++ +EDY + + +L + SR L+   HP ++RI + QS VDK+YAGL+DL  E++ +L E  +L  L RE+ DLE WI ER +VA SH+LG D+EH  +L+ERF EF  +T  +G++RV   N L   LI+  H D+A IA+W D +N++WA+L EL+ TR Q+L  ++E +K+    ++VL+RI +K   +P ++ +D  +V   QR H  F  D QAL  QV+ + D+A  L  +YAG K   I +R  +VL  W  L    E RR +L D  D  RFFSMVR+L+ WM+ V   I  + +P+DVS VELL+N+H+ IKAEI AR +S + C+ LG+ LL R     +E++  L+ L  ++  + D WE+RW++L+L+LEV+QF+RDA VAEAW+L QEPYL+++ +G+++DE   L+K+H  FEK+  + EERF ALE+LTT+
Sbjct:   38 RLFERSRIKALADEREAVQKKTFTKWVNSHLSRVSCRITDLYMDLRDGRMLIKLLEVLSGERLPKPTKGRMRIHCLENVDKALQFLKEQRVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKEKKSAKDALLLWCQMKTAGYPNVNIHNFTTSWRDGMAFNALIHKHRPDLIDFDKLKKSNAHYNLQNAFNLAEQHLGLTKLLDPEDISVDHPDEKSIITYVVTYYHYFSKMKALKVEGKRIGKVLDHAIETEKMIEKYESLASDLLEWIEQTIIILNNRKFANSLVGVQQQLQAFNTYRTVEKPPKFTEKGNLEVLLFTIQSKMRANNQKVYTPREGKLISDINKAWERLEKAEHERELALRTELIRQEKLEQLARRFDRKAAMRETWLSENQRLVSQDNFGFDLQAVEAATKKHEAIETDIAAYEERVQAVVSVAKELEAESYHDIKRITARKDNVNRLWEYLLELLKARRHRLEQNLGLQRVFQEMLYIMDWMDEMKMLLLSQDYGKHLLGVEDLLQKHALVEADIAIQADRVRNVNSNAQRFASDTEG-----YKPCDPQIIRDRVAHLEFCYQELIQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEQILSSEDYGKDLTGALRLLSQHKAFEDEMSGRAAHLQQTIKQGEDLVADNHFGADKIRERIRDIQEQWATLERLTAVRKSRLQEACNHHQFQADADDIDTWMLDVLRIVSSVDVGHDEFSTQALVKKHKDVAEEIDSYRPVIEALHDQSRTLPPEKANSEEVKSRLAGIEERYKEVAELTRLRKQALQDALALYKMLSEASACELWIDEKEQWLNSMDIPEKLEDLEVVQHRFESLEPEMNSQASRVAVVNQVARQLIHCGHPSEKEIKAQQDKLNTRWSQFRDLVDQKKESLVSALGVQNYHLECNETKSWIKEKNKVLIESTQELGNDLAGVMALQRKLTGMERDLVAIEDKMGDLGKEAERLASEHPEQSEAIKGRLAEITGVWQEMKDGLKNREESLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLAEAEKLLAQHENIKNEIRNYEEDYQKMRDMGEMVTQGQTDAQHMFLRQRLQALDTGWNELHKMWENRQNLLSQSHAYQLFLRDTKQAEAFLNNQEYVLAHTEMPTTLEAAEAAIKKQEDFMTTMDANEEKISNVVDTGRRLVADGNVSSERIQEKVDSIDQRHKKNRQAASDLLMRLKDNRDLQKFLQDCQELNLWINEKMLTAQDMTYDEARNLHSKWLKHQAFMAELQSNKEWLDKISKDGQTLMTEKPETEGVVKEKLASLKTMWEELESTTQTKAKCLFDANKAELFTQSCADLDKWLNGLEGQLQSDDFGKDLTSVNIL-LKKQQMLESQVEVRQKEVDELKGQSQALRQEGKD-SDEVDGQRIIVEKKFQTLQEPLKKRRDKLMASREIHQFNRDVEDEILWVEERMPLATSTDHGHNLQTVQLLIKKNQTLQKEIQGHQPRYDDIFERSQHVLREGSPTA-ELIRQRLAELQSLWEQIKKETEKRHTRLSEAHEAQQYYFDAAEAEAWMSEQELYMMSEEKA-KDEQSAVAMLKKHQILEQAVEDYADTVHQLSSTSRGLVAAGHPDSERIGMRQSQVDKLYAGLKDLSEERRGKLDERFRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFREFARDTGNIGQERVDGVNRLADELINSGHGDAATIAEWKDGLNEAWADLLELIDTRTQILAASYELHKFYHDAKEVLNRILDKHKKLPEELGRDQNTVEALQRMHTAFEHDIQALGTQVRQLQDDAVRLQSAYAGDKADDIQKREGEVLEAWKNLLAAVEGRRAKLVDTGDKFRFFSMVRDLMLWMEDVIRLIEAQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTTCIELGKALLARKHYASEEIKEKLLQLTDKRKEMIDKWEDRWEWLRLVLEVHQFSRDAGVAEAWLLGQEPYLSSREIGQSVDEVEKLIKRHEAFEKSAATWEERFSALERLTTV 2082          

HSP 2 Score: 88.1965 bits (217), Expect = 1.082e-16
Identity = 117/614 (19.06%), Postives = 264/614 (43.00%), Query Frame = 1
Query: 4546 DDQKAWVD--DKLLLAESTNFGNNLLTVQQLLRRHRYLATEVNNHKPQLEYLKEEGAVLIEEVSPMQREKFVAGLQELESLWNRLEHSIDLRQQRLKESEATQTFLFDAEEAESWLWEQELFLLSE---------ERGIRDQEAAINVIKKHDARQKTIEDYGEEITKLGTRSRLLIEKDHPQADRIALAQSHVDKVYAGLRDLCLEKKQRLSEIQKLNHLYREIVDLENWIYERTLVASSHDLGVDFEHCCLLRERFDEFFHETHLLGKDRVKAANDLCASLISQCHADSAEIAQWHDRINDSWAELQELMQTRIQLLRTAWEFYKYLSSCQDVLDRICEKIASIPTDVSKDSQSVAIQQRKHATFLSDAQALEGQVQWV--VDEANHLLPSYAGQKEWHICERRDDVLATWNQLNMQAERRRHQLEDAADLQRFFSMVRELLQWMDLVALQINEKTRPKDVSGVELLINDHRSIKAEIAAREESMSICVNLGRTLLHRGRVGVDEVRAALINLITRKYSLEDMWEERWDYLQLILEVYQFARDASVAEAWILAQEPYLANKTLGETLDETLSLLKKHINFEKTVMSQEERFEALEKLTTMEIRAKEITKESI 6348
            ++ K+W+   +K+L+  +   GN+L  V  L R+   +  ++   + ++  L +E   L  E  P Q E     L E+  +W  ++  +  R++ L E+   Q FL D ++ +SWL   +  + SE         E+ +   E   N I+ ++   + + D GE +T+  T ++ +  +   QA         +D  +  L  +   ++  LS+        R+    E ++  +  V +  ++    E      ++ ++F   T    ++++    D    L++  +  S  I +  D I+    + ++     +  L+   +  K+L  CQ++   I EK+ +       +++++  +  KH  F+++   L+   +W+  + +    L +   + E  + E+   +   W +L    + +   L DA   + F     +L +W++ +  Q+      KD++ V +L+   + +++++  R++ +       + L   G+   DEV    I +  +  +L++  ++R D L    E++QF RD      W+  + P   +   G  L     L+KK+   +K +   + R++ + + +   +R    T E I
Sbjct:  965 NETKSWIKEKNKVLIESTQELGNDLAGVMALQRKLTGMERDLVAIEDKMGDLGKEAERLASE-HPEQSEAIKGRLAEITGVWQEMKDGLKNREESLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLAEAEKLLAQHENIKNEIRNYEEDYQKMRDMGEMVTQGQTDAQHMFLRQRLQA---------LDTGWNELHKMWENRQNLLSQSHAYQLFLRDTKQAEAFLNNQEYVLAHTEMPTTLEAAEAAIKKQEDFM-TTMDANEEKISNVVDTGRRLVADGNVSSERIQEKVDSIDQRHKKNRQAASDLLMRLKDNRDLQKFLQDCQELNLWINEKMLTAQDMTYDEARNLHSKWLKHQAFMAE---LQSNKEWLDKISKDGQTLMTEKPETEGVVKEKLASLKTMWEELESTTQTKAKCLFDANKAELFTQSCADLDKWLNGLEGQLQSDDFGKDLTSVNILLKKQQMLESQVEVRQKEVDELKGQSQALRQEGK-DSDEVDGQRIIVEKKFQTLQEPLKKRRDKLMASREIHQFNRDVEDEILWVEERMPLATSTDHGHNLQTVQLLIKKNQTLQKEIQGHQPRYDDIFERSQHVLREGSPTAELI 1563          
BLAST of Spectrin beta chain vs. Ensembl Medaka
Match: sptbn2 (spectrin beta chain, non-erythrocytic 1 [Source:NCBI gene;Acc:101155789])

HSP 1 Score: 1707.58 bits (4421), Expect = 0.000e+0
Identity = 972/2292 (42.41%), Postives = 1436/2292 (62.65%), Query Frame = 1
Query:  154 KLYERFRIKALAGEREKVQKKTFTKWINSHLNKLKQSIDDLYNXXXXXXXXXXXXXXXXXXXXPYPTKGKMRIHCLENVDKSLNFLIEQRVHLENMGAHDIVDGNARLTLGLIWTIILRFQIQDIVVEEDDTSEKRQAKDALLLWCQMKTAGYPNTNVRNFSTCWRDGLAFNAIIHRHRPDLLEYSALSRSNPNENLEQAIRIAEEKLGIPRLLDPEDVSVENPDEKSIMTYVVTFYHFFSKMKADSVHSKRVGKILSQSMETEEMMVHYDKLTSNLLEWINQTIELLNDRTFANSLSGVQQQLAAFNTYRVTEKPPKFQEKGNLEMLLFSIQSQMRANNQMPYLPIEGKLISDINNAWNKLDKAEHARELALRDELIRQEKLEQLALRFDRKAGMREAWLTENQRLITQDNFGQDLSAVEAAGKKHEAIKTDILAYEERVNSVTLVTSELENECYHDVERVLCRRDNVIRLWEKLLDMLAVRKLRLDACYKVQKLFQDIKHLLDLINDLKARLKTEDIGRHLMGVEDLIHKHSLLEIDIRMVGTKIEGIMSDAQPFINSEFGLGSGDFQPADPNEVILRTVNLKEEYDNLLELSRNRKDNLSASKVMWEFLWGVADEEQWMKEKIQLMLNPDLGHDLSSVHRLISKHKVIEEDVRNHSNYLQNVIQGGQQLILDKNPGAEKVADXXXXXXXXXXXXXXXXXXRRSKLEQSLAYFHCLADCGEVEIWIIEQVKLVKIDETSINEESIITDIHKHEQLSKSIEDYESNINSLDEQVKKLSEGDLELVTIEEKVSNIKSQYAILIELTNQKQNKLTDTLSLFRVLRKADTVKTWIDEKEKLLMSL-IPTDELEELEVFRHRFDGFEKEMNIQADQVEFVNTLAEKLSDMDHPQIADVVNKRFELNKLWNSLADLVEARREQLQTSYEFNQYLLECKQTGEWIREKSRLVESTDELGDDLAGIMQLQRRMGGMQRDMDAIRAKLEHLDEEMDTLIAKRPNXXXXXXXXXXXXXXFWAELGDMLADRDDRLSESSELQRFLQDLDHIHIWLSKMQTTVASEDLPKDLADAEKSLVQHEQLKEEIDSYQDEFIRLLDYGRRITEDKTDAQYMFLSQRLNALEEGWQELCQMWENRXXXXXXXXXXXVFLRDAIQSEVLLAQEENFLSKEDIPISIENSQNLLRKHEGFLTTLQANHDHTIAVIEFGRNLVERGHFCSDKINLRVKSILXXXXXXXXXXXXAYEKLKDQVLYQELSQDIDDLSKWIQEKMIIATDESFREEKNIARRYNRHRAFDEEIQANKDRLCQAIDYAMQIVEERPQLADMIYPQIDSLNQQWEELEQTTFLKGEKMIEANREAIFEEGTMDVMTWLXXXXXXXXXXXXXXXXXXXXXXKLKKVEEADNEMEIKRKQIQDLKMHAAKLKEEQPEKAFGIEQKHLILEHRFTQLQMPXXXXXXXXXXXXXXXXFLRNLDDQKAWVDDKLLLAESTNFGNNLLTVQQLLRRHRYLATEVNNHKPQLEYLKEEGAVLIEEVSPMQREKFVAGLQELESLWNRLEHSIDLRQQRLKESEATQTFLFDAEEAESWLWEQELFLLSEERGIRDQEAAINVIKKHDARQKTIEDYGEEITKLGTRSRLLIEKDHPQADRIALAQSHVDKVYAGLRDLCLEKKQRLSEIQKLNHLYREIVDLENWIYERTLVASSHDLGVDFEHCCLLRERFDEFFHETHLLGKDRVKAANDLCASLISQCHADSAEIAQWHDRINDSWAELQELMQTRIQLLRTAWEFYKYLSSCQDVLDRICEKIASIPTDVSKDSQSVAIQQRKHATFLSDAQALEGQVQWVVDEANHLLPSYAGQKEWHICERRDDVLATWNQLNMQAERRRHQLEDAADLQRFFSMVRELLQWMDLVALQINEKTRPKDVSGVELLINDHRSIKAEIAAREESMSICVNLGRTLLHRGRVGVDEVRAALINLITRKYSLEDMWEERWDYLQLILEVYQFARDASVAEAWILAQEPYLANKTLGETLDETLSLLKKHINFEKTVMSQEERFEALEKLTTMEIRAKEITKESILLKDKHKQERIENAIKIFQPPPSPELVHE--SPKVSISEEDEEGKSHQHKISVISKE---AAEMCQSSETKTD----------IRGILIRKHEWEYKNRKALNRSWHEFLVVLSIEKNKLLVYKDEKHYNEKPQDTYHKDSGLDLNDLVAAPASDYLKRPFVFRIKITSTGAEYLFQAKDEEDMLRWVNSINENSQKDLKSETT-APGKSSTLP-ACTSDPHVPST 6975
            +L+ER RIKALA ERE VQKKTFTKW+NSHL+++   I DLY DL+DG+ML+ LLE+LSGEQLP PTKG+MRIHCLENVDK+L FL EQ+VHLENMG+HDIVDGN RLTLGLIWTIILRFQIQDI VE +D  EK+ AKDALLLWCQMKTAGYPN N+ NF+T WRDGLAFNAI+H+HRPD++E+  L RSN + NL+ A  +AE++LG+ +LLDPEDV+V+ PDEKSI+TYV T+YH+FSKMKA +V  KR+GK+L  ++E ++++  Y+ L S LL+WI QTI  LNDR  ANSL+ VQ QL AFN+YR  EKPPKF EKGNLE+LLF+IQS+MRANNQ  Y+P EGKLISDIN AW +L+KAEH RELALR+ELIRQEKLE LA RFDRKA MRE WL+ENQRL++QDNFG DL AVEAA +KHEAI+TDI AY ERV +V  V  ELE E YHDV R+L RRDNV+RLWE L ++LA R+ RL A   +Q+LFQ+++++ D + D + RL+++D G+HL  V DL+ KH+L+E DI     +I+G+ + A+PF + E       ++P +P  V  +   L + Y+ L +L+  R++ L  S+ +W+FLW + +E  W++E+ Q++ + D G DL+S   L+SKH+   +++      L N I  G+ LI + + GA +V +    ++ +  +   L E R   L++++A      D  ++E WI+E ++ +   E   +E S  T   K  ++ + I+ +   IN+L EQ + L +  +    ++ ++  I+  Y  L  L+  ++  L   LSL+++  +AD    W++EKE+ L  + IPT +LE+LEV + RF+  E EMN    +V  VN +AE L D D+ +   +   R +LN  W     L   +++ L+++     Y LEC +   W++EK++++EST  LG+DLAG+M LQR++ GM+RD++AI+ KL+ L  E   L ++ P+  E I+     +++ W EL   +  R++ L E+S+LQ FL+DL+    WLS+ QT VASED+P  L +AE  L QHE +K E+D+Y++++ ++   G  +T+ +TDAQ+MFL+QRL AL+ GW EL +MWENR  LL+Q    Q F+RDA Q+E  L  +E  L   ++P +++ ++  +RKHE FLTT +A+ +   +V++ GR L+   +  SDKI  +V SI ER   NK  + E   KLKD    Q   QD  +L+ WI EKM+ A D S+ E +N+  ++ +H+AF  E+ +NKD L +       +V E+P+L  ++   ++ L  QWEE+E TT  K + + +ANR  +F +    + +WL  I   +   +   +  +   + LKK +  +++ME++ K++Q L+  A  L +E       I+ +   +   F+ LQ P++ +K +L+  K   QF R+L+D+  WV +++ LA ST  G +L TVQ L+++++ L  E+  H+P+++ + + G     +V   ++      L EL  LW++L    D R  RL E+   Q F  DA EAE+W+ EQEL ++SEE+  +D+++A+ ++KKH   ++T+EDY + I +L   SRL++  +HP+++RI L Q+ VDK+YAGL+DL  E++ RL E  +L  L RE+ DLE WI ER +VA SH+LG D+EH  +LR++F EF  +T  +G++RV   N L   LI   H ++A +A+W D +N++WA+L EL+ TR Q+L  ++E +++     +VL R+ EK  ++P D+ +D  +V    R+H T  +D QAL  QV  V D+A  L  +YAG+K   I      V + W  L    + RR  L+D  +  RF + VR+L+ WMD V LQI+    P+DVS  EL+I +H+ IK+EI  R +S +  +++G  L+++     DE++  L  L  R+  +   W+++ +YLQ++LEV QF RDASVAE+W+  QEP +    LG  +DE  SLLK+H  FEK   + EERF  LE+LTT+E +  +  +E                 +  + PP+P  V E    K      D EG S    ++   ++   A+   ++S T             + G+L RK E E  N+KA  RSWH   V  +++K  L  +KD K  +     TYH +    L + V   A DY KR  VF+++    G EYLFQAKDE +M  W+ SI    ++ + + +  +PG    L  A T  P  PST
Sbjct:   41 RLFERSRIKALADEREAVQKKTFTKWVNSHLSRVTCRIGDLYTDLRDGRMLIRLLEVLSGEQLPKPTKGRMRIHCLENVDKALQFLKEQKVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKEKKSAKDALLLWCQMKTAGYPNVNIHNFTTSWRDGLAFNAIVHKHRPDVIEFDNLKRSNAHYNLQNAFNVAEKELGLTKLLDPEDVNVDQPDEKSIITYVATYYHYFSKMKALAVEGKRIGKVLDYAIEADQLIDKYETLASELLQWIEQTIGTLNDRQLANSLNAVQNQLQAFNSYRTVEKPPKFTEKGNLEVLLFTIQSKMRANNQKVYVPKEGKLISDINKAWERLEKAEHERELALRNELIRQEKLEMLAARFDRKAAMRETWLSENQRLVSQDNFGTDLGAVEAATRKHEAIETDINAYLERVVAVEDVAKELEAEGYHDVRRILARRDNVLRLWEYLKELLAARRERLTAHRDLQRLFQEMRYITDWMKDEQGRLQSQDTGKHLHDVLDLLQKHNLVEADISAQAERIKGVQAAAKPFSSYEQA-----YKPCEPGLVGEKVERLGQAYEELGQLASARRERLEDSRRLWQFLWDLGEEAAWIREQEQILASGDCGRDLTSALHLLSKHEAFRDEMAARFMPLNNSIAAGEALINEGHFGASEVTE---RIQDIRAQWAHLEELREQSLKEAVALHQFQTDANDMEAWIMETLRQLSSQELGHDEFSTQTLARKQREIDEEIQSHRPLINTLHEQAQALPQAYVSHPQVDGRLPAIEQSYKELESLSATRRQALDGALSLYQMFSEADACLLWVEEKEQWLDGMEIPT-KLEDLEVVQQRFESLEPEMNNLGARVTHVNDVAEFLLDSDNCRKDQIHQTRDQLNNRWAEFEQLAGQKKQALESALNIQNYHLECNEIKSWMKEKTKVIESTQSLGNDLAGVMALQRKLTGMERDLEAIQGKLDDLKSEAGKLASEHPDQAEEIQGRLAEIQEVWEELNATMKRREESLGEASKLQGFLRDLNDFQSWLSRTQTAVASEDIPTSLPEAENLLTQHESIKNELDNYKEDYEKMRAVGEEVTQGQTDAQHMFLAQRLQALDTGWHELRRMWENRHSLLAQGFDFQGFMRDAKQAEAFLNSQEYVLHHTEMPTNLQAAEEAIRKHEDFLTTTEASEEKINSVVDSGRRLINDSNANSDKIQEKVDSIQERHNKNKEMAKELLTKLKDNRELQHFLQDGQELTLWINEKMLTAQDMSYDEARNLHSKWQKHQAFMAELASNKDWLDKIDKEGQALVAEKPELKPVVQQILEDLQHQWEEVEGTTRTKAQCLFDANRAELFTQSCSALGSWLNNIESQLHSDDYGKDLTSVNIL-LKKQQMLEHQMEVREKEVQSLQAQALALSQEDA-GLTEIDGQQRQVTDNFSNLQQPLRLRKQKLLASKEAHQFNRDLEDEILWVTERMPLATSTEHGKDLSTVQLLIKKNQTLQKEIQGHQPRIDDILKRGETQ-SQVDGERQALLEERLAELRDLWDQLISETDNRNTRLLEARRAQQFYADAAEAEAWMGEQELHMMSEEKA-KDEQSALVMVKKHQILEQTLEDYAQTIHQLANSSRLMVTNEHPESERITLRQAQVDKLYAGLKDLAEERRGRLQERLRLTQLKREVDDLEQWIAEREMVAGSHELGQDYEHVSMLRDKFREFARDTSTIGQERVDGVNALADDLIESGHPENASVAEWKDGLNEAWADLLELIDTRTQMLGASYELHRFHQDAMEVLGRVKEKREALPADLGRDLNTVKHLHRQHQTLENDIQALSWQVNQVQDDAARLQKAYAGEKADDIHRSEHAVSSAWEALQEACQSRRLLLQDTVEKFRFLNAVRDLMLWMDGVNLQIDAHDSPRDVSSAELVIGNHQDIKSEIDTRADSFTASIDMGNALINKSHYAADEIQEKLAQLQERRDEINKKWQDKMNYLQIVLEVLQFGRDASVAESWLAGQEPLVRAAELGTNVDEVESLLKRHEAFEKLATAWEERFVQLERLTTLEEQELQRRREE---------------EERARRPPTPPQVEEVTQSKAETQAHDSEG-SESESVNGPGRDSGLASSRLEASATLPGRGGADSDAECVEGMLCRKQEMESHNKKAATRSWHN--VYCTLKKGGLHFFKDNKSVSSGI--TYHGEMPFSLEEAVCEVALDYKKRKHVFKLR-NENGKEYLFQAKDEAEMNSWIQSI----RRFITTRSQDSPGAPRALSRAMTMPPISPST 2294          
BLAST of Spectrin beta chain vs. Ensembl Medaka
Match: sptbn2 (spectrin beta chain, non-erythrocytic 1 [Source:NCBI gene;Acc:101155789])

HSP 1 Score: 1694.09 bits (4386), Expect = 0.000e+0
Identity = 961/2258 (42.56%), Postives = 1415/2258 (62.67%), Query Frame = 1
Query:  154 KLYERFRIKALAGEREKVQKKTFTKWINSHLNKLKQSIDDLYNXXXXXXXXXXXXXXXXXXXXPYPTKGKMRIHCLENVDKSLNFLIEQRVHLENMGAHDIVDGNARLTLGLIWTIILRFQIQDIVVEEDDTSEKRQAKDALLLWCQMKTAGYPNTNVRNFSTCWRDGLAFNAIIHRHRPDLLEYSALSRSNPNENLEQAIRIAEEKLGIPRLLDPEDVSVENPDEKSIMTYVVTFYHFFSKMKADSVHSKRVGKILSQSMETEEMMVHYDKLTSNLLEWINQTIELLNDRTFANSLSGVQQQLAAFNTYRVTEKPPKFQEKGNLEMLLFSIQSQMRANNQMPYLPIEGKLISDINNAWNKLDKAEHARELALRDELIRQEKLEQLALRFDRKAGMREAWLTENQRLITQDNFGQDLSAVEAAGKKHEAIKTDILAYEERVNSVTLVTSELENECYHDVERVLCRRDNVIRLWEKLLDMLAVRKLRLDACYKVQKLFQDIKHLLDLINDLKARLKTEDIGRHLMGVEDLIHKHSLLEIDIRMVGTKIEGIMSDAQPFINSEFGLGSGDFQPADPNEVILRTVNLKEEYDNLLELSRNRKDNLSASKVMWEFLWGVADEEQWMKEKIQLMLNPDLGHDLSSVHRLISKHKVIEEDVRNHSNYLQNVIQGGQQLILDKNPGAEKVADXXXXXXXXXXXXXXXXXXRRSKLEQSLAYFHCLADCGEVEIWIIEQVKLVKIDETSINEESIITDIHKHEQLSKSIEDYESNINSLDEQVKKLSEGDLELVTIEEKVSNIKSQYAILIELTNQKQNKLTDTLSLFRVLRKADTVKTWIDEKEKLLMSL-IPTDELEELEVFRHRFDGFEKEMNIQADQVEFVNTLAEKLSDMDHPQIADVVNKRFELNKLWNSLADLVEARREQLQTSYEFNQYLLECKQTGEWIREKSRLVESTDELGDDLAGIMQLQRRMGGMQRDMDAIRAKLEHLDEEMDTLIAKRPNXXXXXXXXXXXXXXFWAELGDMLADRDDRLSESSELQRFLQDLDHIHIWLSKMQTTVASEDLPKDLADAEKSLVQHEQLKEEIDSYQDEFIRLLDYGRRITEDKTDAQYMFLSQRLNALEEGWQELCQMWENRXXXXXXXXXXXVFLRDAIQSEVLLAQEENFLSKEDIPISIENSQNLLRKHEGFLTTLQANHDHTIAVIEFGRNLVERGHFCSDKINLRVKSILXXXXXXXXXXXXAYEKLKDQVLYQELSQDIDDLSKWIQEKMIIATDESFREEKNIARRYNRHRAFDEEIQANKDRLCQAIDYAMQIVEERPQLADMIYPQIDSLNQQWEELEQTTFLKGEKMIEANREAIFEEGTMDVMTWLXXXXXXXXXXXXXXXXXXXXXXKLKKVEEADNEMEIKRKQIQDLKMHAAKLKEEQPEKAFGIEQKHLILEHRFTQLQMPXXXXXXXXXXXXXXXXFLRNLDDQKAWVDDKLLLAESTNFGNNLLTVQQLLRRHRYLATEVNNHKPQLEYLKEEGAVLIEEVSPMQREKFVAGLQELESLWNRLEHSIDLRQQRLKESEATQTFLFDAEEAESWLWEQELFLLSEERGIRDQEAAINVIKKHDARQKTIEDYGEEITKLGTRSRLLIEKDHPQADRIALAQSHVDKVYAGLRDLCLEKKQRLSEIQKLNHLYREIVDLENWIYERTLVASSHDLGVDFEHCCLLRERFDEFFHETHLLGKDRVKAANDLCASLISQCHADSAEIAQWHDRINDSWAELQELMQTRIQLLRTAWEFYKYLSSCQDVLDRICEKIASIPTDVSKDSQSVAIQQRKHATFLSDAQALEGQVQWVVDEANHLLPSYAGQKEWHICERRDDVLATWNQLNMQAERRRHQLEDAADLQRFFSMVRELLQWMDLVALQINEKTRPKDVSGVELLINDHRSIKAEIAAREESMSICVNLGRTLLHRGRVGVDEVRAALINLITRKYSLEDMWEERWDYLQLILEVYQFARDASVAEAWILAQEPYLANKTLGETLDETLSLLKKHINFEKTVMSQEERFEALEKLTTMEI--------------------RAKEITKESILLKDKHKQERIENAIKIFQPPPSPELVHESPKVSISEEDEE--GKSHQHKISVISKEA-AEMCQSSETKTD---IRGILIRKHEWEYKNRKALNRSWHEFLVVLSIEKNKLLVYKDEKHYNEKPQDTYHKDSGLDLNDLVAAPASDYLKRPFVFRIKITSTGAEYLFQAKDE 6846
            +L+ER RIKALA ERE VQKKTFTKW+NSHL+++   I DLY DL+DG+ML+ LLE+LSGEQLP PTKG+MRIHCLENVDK+L FL EQ+VHLENMG+HDIVDGN RLTLGLIWTIILRFQIQDI VE +D  EK+ AKDALLLWCQMKTAGYPN N+ NF+T WRDGLAFNAI+H+HRPD++E+  L RSN + NL+ A  +AE++LG+ +LLDPEDV+V+ PDEKSI+TYV T+YH+FSKMKA +V  KR+GK+L  ++E ++++  Y+ L S LL+WI QTI  LNDR  ANSL+ VQ QL AFN+YR  EKPPKF EKGNLE+LLF+IQS+MRANNQ  Y+P EGKLISDIN AW +L+KAEH RELALR+ELIRQEKLE LA RFDRKA MRE WL+ENQRL++QDNFG DL AVEAA +KHEAI+TDI AY ERV +V  V  ELE E YHDV R+L RRDNV+RLWE L ++LA R+ RL A   +Q+LFQ+++++ D + D + RL+++D G+HL  V DL+ KH+L+E DI     +I+G+ + A+PF + E       ++P +P  V  +   L + Y+ L +L+  R++ L  S+ +W+FLW + +E  W++E+ Q++ + D G DL+S   L+SKH+   +++      L N I  G+ LI + + GA +V + ++++   W  L E T+ R   L++++A      D  ++E WI+E ++ +   E   +E S  T   K  ++ + I+ +   IN+L EQ + L +  +    ++ ++  I+  Y  L  L+  ++  L   LSL+++  +AD    W++EKE+ L  + IPT +LE+LEV + RF+  E EMN    +V  VN +AE L D D+ +   +   R +LN  W     L   +++ L+++     Y LEC +   W++EK++++EST  LG+DLAG+M LQR++ GM+RD++AI+ KL+ L  E   L ++ P+  E I+     +++ W EL   +  R++ L E+S+LQ FL+DL+    WLS+ QT VASED+P  L +AE  L QHE +K E+D+Y++++ ++   G  +T+ +TDAQ+MFL+QRL AL+ GW EL +MWENR  LL+Q    Q F+RDA Q+E  L  +E  L   ++P +++ ++  +RKHE FLTT +A+ +   +V++ GR L+   +  SDKI  +V SI ER   NK  + E   KLKD    Q   QD  +L+ WI EKM+ A D S+ E +N+  ++ +H+AF  E+ +NKD L +       +V E+P+L  ++   ++ L  QWEE+E TT  K + + +ANR  +F +    + +WL  I   +   +   +  +   + LKK +  +++ME++ K++Q L+  A  L +E       I+ +   +   F+ LQ P++ +K +L+  K   QF R+L+D+  WV +++ LA ST  G +L TVQ L+++++ L  E+  H+P+++ + + G     +V   ++      L EL  LW++L    D R  RL E+   Q F  DA EAE+W+ EQEL ++SEE+  +D+++A+ ++KKH   ++T+EDY + I +L   SRL++  +HP+++RI L Q+ VDK+YAGL+DL  E++ RL E  +L  L RE+ DLE WI ER +VA SH+LG D+EH  +LR++F EF  +T  +G++RV   N L   LI   H ++A +A+W D +N++WA+L EL+ TR Q+L  ++E +++     +VL R+ EK  ++P D+ +D  +V    R+H T  +D QAL  QV  V D+A  L  +YAG+K   I      V + W  L    + RR  L+D  +  RF + VR+L+ WMD V LQI+    P+DVS  EL+I +H+ IK+EI  R +S +  +++G  L+++     DE++  L  L  R+  +   W+++ +YLQ++LEV QF RDASVAE+W+  QEP +    LG  +DE  SLLK+H  FEK   + EERF  LE+LTT+E                     + +E+T+     +    + R            S   VH     S   E E   G      ++    EA A +       +D   + G+L RK E E  N+KA  RSWH   V  +++K  L  +KD K  +     TYH +    L + V   A DY KR  VF+++    G EYLFQAKDE
Sbjct:   41 RLFERSRIKALADEREAVQKKTFTKWVNSHLSRVTCRIGDLYTDLRDGRMLIRLLEVLSGEQLPKPTKGRMRIHCLENVDKALQFLKEQKVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKEKKSAKDALLLWCQMKTAGYPNVNIHNFTTSWRDGLAFNAIVHKHRPDVIEFDNLKRSNAHYNLQNAFNVAEKELGLTKLLDPEDVNVDQPDEKSIITYVATYYHYFSKMKALAVEGKRIGKVLDYAIEADQLIDKYETLASELLQWIEQTIGTLNDRQLANSLNAVQNQLQAFNSYRTVEKPPKFTEKGNLEVLLFTIQSKMRANNQKVYVPKEGKLISDINKAWERLEKAEHERELALRNELIRQEKLEMLAARFDRKAAMRETWLSENQRLVSQDNFGTDLGAVEAATRKHEAIETDINAYLERVVAVEDVAKELEAEGYHDVRRILARRDNVLRLWEYLKELLAARRERLTAHRDLQRLFQEMRYITDWMKDEQGRLQSQDTGKHLHDVLDLLQKHNLVEADISAQAERIKGVQAAAKPFSSYEQA-----YKPCEPGLVGEKVERLGQAYEELGQLASARRERLEDSRRLWQFLWDLGEEAAWIREQEQILASGDCGRDLTSALHLLSKHEAFRDEMAARFMPLNNSIAAGEALINEGHFGASEVTERIQDIRAQWAHLEETTKLREQSLKEAVALHQFQTDANDMEAWIMETLRQLSSQELGHDEFSTQTLARKQREIDEEIQSHRPLINTLHEQAQALPQAYVSHPQVDGRLPAIEQSYKELESLSATRRQALDGALSLYQMFSEADACLLWVEEKEQWLDGMEIPT-KLEDLEVVQQRFESLEPEMNNLGARVTHVNDVAEFLLDSDNCRKDQIHQTRDQLNNRWAEFEQLAGQKKQALESALNIQNYHLECNEIKSWMKEKTKVIESTQSLGNDLAGVMALQRKLTGMERDLEAIQGKLDDLKSEAGKLASEHPDQAEEIQGRLAEIQEVWEELNATMKRREESLGEASKLQGFLRDLNDFQSWLSRTQTAVASEDIPTSLPEAENLLTQHESIKNELDNYKEDYEKMRAVGEEVTQGQTDAQHMFLAQRLQALDTGWHELRRMWENRHSLLAQGFDFQGFMRDAKQAEAFLNSQEYVLHHTEMPTNLQAAEEAIRKHEDFLTTTEASEEKINSVVDSGRRLINDSNANSDKIQEKVDSIQERHNKNKEMAKELLTKLKDNRELQHFLQDGQELTLWINEKMLTAQDMSYDEARNLHSKWQKHQAFMAELASNKDWLDKIDKEGQALVAEKPELKPVVQQILEDLQHQWEEVEGTTRTKAQCLFDANRAELFTQSCSALGSWLNNIESQLHSDDYGKDLTSVNIL-LKKQQMLEHQMEVREKEVQSLQAQALALSQEDA-GLTEIDGQQRQVTDNFSNLQQPLRLRKQKLLASKEAHQFNRDLEDEILWVTERMPLATSTEHGKDLSTVQLLIKKNQTLQKEIQGHQPRIDDILKRGETQ-SQVDGERQALLEERLAELRDLWDQLISETDNRNTRLLEARRAQQFYADAAEAEAWMGEQELHMMSEEKA-KDEQSALVMVKKHQILEQTLEDYAQTIHQLANSSRLMVTNEHPESERITLRQAQVDKLYAGLKDLAEERRGRLQERLRLTQLKREVDDLEQWIAEREMVAGSHELGQDYEHVSMLRDKFREFARDTSTIGQERVDGVNALADDLIESGHPENASVAEWKDGLNEAWADLLELIDTRTQMLGASYELHRFHQDAMEVLGRVKEKREALPADLGRDLNTVKHLHRQHQTLENDIQALSWQVNQVQDDAARLQKAYAGEKADDIHRSEHAVSSAWEALQEACQSRRLLLQDTVEKFRFLNAVRDLMLWMDGVNLQIDAHDSPRDVSSAELVIGNHQDIKSEIDTRADSFTASIDMGNALINKSHYAADEIQEKLAQLQERRDEINKKWQDKMNYLQIVLEVLQFGRDASVAESWLAGQEPLVRAAELGTNVDEVESLLKRHEAFEKLATAWEERFVQLERLTTLEEQELQRRREEEERARRPPTPPQVEEVTQSKAETQAHDSEARTSLDQTTLNQDVSVNGVHSDNDTSQGSESESVNGPGRDSGLASSRLEASATLPGRGGADSDAECVEGMLCRKQEMESHNKKAATRSWHN--VYCTLKKGGLHFFKDNKSVSSGI--TYHGEMPFSLEEAVCEVALDYKKRKHVFKLR-NENGKEYLFQAKDE 2283          
BLAST of Spectrin beta chain vs. Ensembl Medaka
Match: sptbn2 (spectrin beta chain, non-erythrocytic 1 [Source:NCBI gene;Acc:101155789])

HSP 1 Score: 1649.41 bits (4270), Expect = 0.000e+0
Identity = 905/2053 (44.08%), Postives = 1335/2053 (65.03%), Query Frame = 1
Query:  154 KLYERFRIKALAGEREKVQKKTFTKWINSHLNKLKQSIDDLYNXXXXXXXXXXXXXXXXXXXXPYPTKGKMRIHCLENVDKSLNFLIEQRVHLENMGAHDIVDGNARLTLGLIWTIILRFQIQDIVVEEDDTSEKRQAKDALLLWCQMKTAGYPNTNVRNFSTCWRDGLAFNAIIHRHRPDLLEYSALSRSNPNENLEQAIRIAEEKLGIPRLLDPEDVSVENPDEKSIMTYVVTFYHFFSKMKADSVHSKRVGKILSQSMETEEMMVHYDKLTSNLLEWINQTIELLNDRTFANSLSGVQQQLAAFNTYRVTEKPPKFQEKGNLEMLLFSIQSQMRANNQMPYLPIEGKLISDINNAWNKLDKAEHARELALRDELIRQEKLEQLALRFDRKAGMREAWLTENQRLITQDNFGQDLSAVEAAGKKHEAIKTDILAYEERVNSVTLVTSELENECYHDVERVLCRRDNVIRLWEKLLDMLAVRKLRLDACYKVQKLFQDIKHLLDLINDLKARLKTEDIGRHLMGVEDLIHKHSLLEIDIRMVGTKIEGIMSDAQPFINSEFGLGSGDFQPADPNEVILRTVNLKEEYDNLLELSRNRKDNLSASKVMWEFLWGVADEEQWMKEKIQLMLNPDLGHDLSSVHRLISKHKVIEEDVRNHSNYLQNVIQGGQQLILDKNPGAEKVADXXXXXXXXXXXXXXXXXXRRSKLEQSLAYFHCLADCGEVEIWIIEQVKLVKIDETSINEESIITDIHKHEQLSKSIEDYESNINSLDEQVKKLSEGDLELVTIEEKVSNIKSQYAILIELTNQKQNKLTDTLSLFRVLRKADTVKTWIDEKEKLLMSL-IPTDELEELEVFRHRFDGFEKEMNIQADQVEFVNTLAEKLSDMDHPQIADVVNKRFELNKLWNSLADLVEARREQLQTSYEFNQYLLECKQTGEWIREKSRLVESTDELGDDLAGIMQLQRRMGGMQRDMDAIRAKLEHLDEEMDTLIAKRPNXXXXXXXXXXXXXXFWAELGDMLADRDDRLSESSELQRFLQDLDHIHIWLSKMQTTVASEDLPKDLADAEKSLVQHEQLKEEIDSYQDEFIRLLDYGRRITEDKTDAQYMFLSQRLNALEEGWQELCQMWENRXXXXXXXXXXXVFLRDAIQSEVLLAQEENFLSKEDIPISIENSQNLLRKHEGFLTTLQANHDHTIAVIEFGRNLVERGHFCSDKINLRVKSILXXXXXXXXXXXXAYEKLKDQVLYQELSQDIDDLSKWIQEKMIIATDESFREEKNIARRYNRHRAFDEEIQANKDRLCQAIDYAMQIVEERPQLADMIYPQIDSLNQQWEELEQTTFLKGEKMIEANREAIFEEGTMDVMTWLXXXXXXXXXXXXXXXXXXXXXXKLKKVEEADNEMEIKRKQIQDLKMHAAKLKEEQPEKAFGIEQKHLILEHRFTQLQMPXXXXXXXXXXXXXXXXFLRNLDDQKAWVDDKLLLAESTNFGNNLLTVQQLLRRHRYLATEVNNHKPQLEYLKEEGAVLIEEVSPMQREKFVAGLQELESLWNRLEHSIDLRQQRLKESEATQTFLFDAEEAESWLWEQELFLLSEERGIRDQEAAINVIKKHDARQKTIEDYGEEITKLGTRSRLLIEKDHPQADRIALAQSHVDKVYAGLRDLCLEKKQRLSEIQKLNHLYREIVDLENWIYERTLVASSHDLGVDFEHCCLLRERFDEFFHETHLLGKDRVKAANDLCASLISQCHADSAEIAQWHDRINDSWAELQELMQTRIQLLRTAWEFYKYLSSCQDVLDRICEKIASIPTDVSKDSQSVAIQQRKHATFLSDAQALEGQVQWVVDEANHLLPSYAGQKEWHICERRDDVLATWNQLNMQAERRRHQLEDAADLQRFFSMVRELLQWMDLVALQINEKTRPKDVSGVELLINDHRSIKAEIAAREESMSICVNLGRTLLHRGRVGVDEVRAALINLITRKYSLEDMWEERWDYLQLILEVYQFARDASVAEAWILAQEPYLANKTLGETLDETLSLLKKHINFEKTVMSQEERFEALEKLTT 6309
            +L+ER RIKALA ERE VQKKTFTKW+NSHL+++   I DLY DL+DG+ML+ LLE+LSGEQLP PTKG+MRIHCLENVDK+L FL EQ+VHLENMG+HDIVDGN RLTLGLIWTIILRFQIQDI VE +D  EK+ AKDALLLWCQMKTAGYPN N+ NF+T WRDGLAFNAI+H+HRPD++E+  L RSN + NL+ A  +AE++LG+ +LLDPEDV+V+ PDEKSI+TYV T+YH+FSKMKA +V  KR+GK+L  ++E ++++  Y+ L S LL+WI QTI  LNDR  ANSL+ VQ QL AFN+YR  EKPPKF EKGNLE+LLF+IQS+MRANNQ  Y+P EGKLISDIN AW +L+KAEH RELALR+ELIRQEKLE LA RFDRKA MRE WL+ENQRL++QDNFG DL AVEAA +KHEAI+TDI AY ERV +V  V  ELE E YHDV R+L RRDNV+RLWE L ++LA R+ RL A   +Q+LFQ+++++ D + D + RL+++D G+HL  V DL+ KH+L+E DI     +I+G+ + A+PF + E       ++P +P  V  +   L + Y+ L +L+  R++ L  S+ +W+FLW + +E  W++E+ Q++ + D G DL+S   L+SKH+   +++      L N I  G+ LI + + GA +V + ++++   W  L E T+ R   L++++A      D  ++E WI+E ++ +   E   +E S  T   K  ++ + I+ +   IN+L EQ + L +  +    ++ ++  I+  Y  L  L+  ++  L   LSL+++  +AD    W++EKE+ L  + IPT +LE+LEV + RF+  E EMN    +V  VN +AE L D D+ +   +   R +LN  W     L   +++ L+++     Y LEC +   W++EK++++EST  LG+DLAG+M LQR++ GM+RD++AI+ KL+ L  E   L ++ P+  E I+     +++ W EL   +  R++ L E+S+LQ FL+DL+    WLS+ QT VASED+P  L +AE  L QHE +K E+D+Y++++ ++   G  +T+ +TDAQ+MFL+QRL AL+ GW EL +MWENR  LL+Q    Q F+RDA Q+E  L  +E  L   ++P +++ ++  +RKHE FLTT +A+ +   +V++ GR L+   +  SDKI  +V SI ER   NK  + E   KLKD    Q   QD  +L+ WI EKM+ A D S+ E +N+  ++ +H+AF  E+ +NKD L +       +V E+P+L  ++   ++ L  QWEE+E TT  K + + +ANR  +F +    + +WL  I   +   +   +  +   + LKK +  +++ME++ K++Q L+  A  L +E       I+ +   +   F+ LQ P++ +K +L+  K   QF R+L+D+  WV +++ LA ST  G +L TVQ L+++++ L  E+  H+P+++ + + G     +V   ++      L EL  LW++L    D R  RL E+   Q F  DA EAE+W+ EQEL ++SEE+  +D+++A+ ++KKH   ++T+EDY + I +L   SRL++  +HP+++RI L Q+ VDK+YAGL+DL  E++ RL E  +L  L RE+ DLE WI ER +VA SH+LG D+EH  +LR++F EF  +T  +G++RV   N L   LI   H ++A +A+W D +N++WA+L EL+ TR Q+L  ++E +++     +VL R+ EK  ++P D+ +D  +V    R+H T  +D QAL  QV  V D+A  L  +YAG+K   I      V + W  L    + RR  L+D  +  RF + VR+L+ WMD V LQI+    P+DVS  EL+I +H+ IK+EI  R +S +  +++G  L+++     DE++  L  L  R+  +   W+++ +YLQ++LEV QF RDASVAE+W+  QEP +    LG  +DE  SLLK+H  FEK   + EERF  LE+LTT
Sbjct:   41 RLFERSRIKALADEREAVQKKTFTKWVNSHLSRVTCRIGDLYTDLRDGRMLIRLLEVLSGEQLPKPTKGRMRIHCLENVDKALQFLKEQKVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKEKKSAKDALLLWCQMKTAGYPNVNIHNFTTSWRDGLAFNAIVHKHRPDVIEFDNLKRSNAHYNLQNAFNVAEKELGLTKLLDPEDVNVDQPDEKSIITYVATYYHYFSKMKALAVEGKRIGKVLDYAIEADQLIDKYETLASELLQWIEQTIGTLNDRQLANSLNAVQNQLQAFNSYRTVEKPPKFTEKGNLEVLLFTIQSKMRANNQKVYVPKEGKLISDINKAWERLEKAEHERELALRNELIRQEKLEMLAARFDRKAAMRETWLSENQRLVSQDNFGTDLGAVEAATRKHEAIETDINAYLERVVAVEDVAKELEAEGYHDVRRILARRDNVLRLWEYLKELLAARRERLTAHRDLQRLFQEMRYITDWMKDEQGRLQSQDTGKHLHDVLDLLQKHNLVEADISAQAERIKGVQAAAKPFSSYEQA-----YKPCEPGLVGEKVERLGQAYEELGQLASARRERLEDSRRLWQFLWDLGEEAAWIREQEQILASGDCGRDLTSALHLLSKHEAFRDEMAARFMPLNNSIAAGEALINEGHFGASEVTERIQDIRAQWAHLEETTKLREQSLKEAVALHQFQTDANDMEAWIMETLRQLSSQELGHDEFSTQTLARKQREIDEEIQSHRPLINTLHEQAQALPQAYVSHPQVDGRLPAIEQSYKELESLSATRRQALDGALSLYQMFSEADACLLWVEEKEQWLDGMEIPT-KLEDLEVVQQRFESLEPEMNNLGARVTHVNDVAEFLLDSDNCRKDQIHQTRDQLNNRWAEFEQLAGQKKQALESALNIQNYHLECNEIKSWMKEKTKVIESTQSLGNDLAGVMALQRKLTGMERDLEAIQGKLDDLKSEAGKLASEHPDQAEEIQGRLAEIQEVWEELNATMKRREESLGEASKLQGFLRDLNDFQSWLSRTQTAVASEDIPTSLPEAENLLTQHESIKNELDNYKEDYEKMRAVGEEVTQGQTDAQHMFLAQRLQALDTGWHELRRMWENRHSLLAQGFDFQGFMRDAKQAEAFLNSQEYVLHHTEMPTNLQAAEEAIRKHEDFLTTTEASEEKINSVVDSGRRLINDSNANSDKIQEKVDSIQERHNKNKEMAKELLTKLKDNRELQHFLQDGQELTLWINEKMLTAQDMSYDEARNLHSKWQKHQAFMAELASNKDWLDKIDKEGQALVAEKPELKPVVQQILEDLQHQWEEVEGTTRTKAQCLFDANRAELFTQSCSALGSWLNNIESQLHSDDYGKDLTSVNIL-LKKQQMLEHQMEVREKEVQSLQAQALALSQEDA-GLTEIDGQQRQVTDNFSNLQQPLRLRKQKLLASKEAHQFNRDLEDEILWVTERMPLATSTEHGKDLSTVQLLIKKNQTLQKEIQGHQPRIDDILKRGETQ-SQVDGERQALLEERLAELRDLWDQLISETDNRNTRLLEARRAQQFYADAAEAEAWMGEQELHMMSEEKA-KDEQSALVMVKKHQILEQTLEDYAQTIHQLANSSRLMVTNEHPESERITLRQAQVDKLYAGLKDLAEERRGRLQERLRLTQLKREVDDLEQWIAEREMVAGSHELGQDYEHVSMLRDKFREFARDTSTIGQERVDGVNALADDLIESGHPENASVAEWKDGLNEAWADLLELIDTRTQMLGASYELHRFHQDAMEVLGRVKEKREALPADLGRDLNTVKHLHRQHQTLENDIQALSWQVNQVQDDAARLQKAYAGEKADDIHRSEHAVSSAWEALQEACQSRRLLLQDTVEKFRFLNAVRDLMLWMDGVNLQIDAHDSPRDVSSAELVIGNHQDIKSEIDTRADSFTASIDMGNALINKSHYAADEIQEKLAQLQERRDEINKKWQDKMNYLQIVLEVLQFGRDASVAESWLAGQEPLVRAAELGTNVDEVESLLKRHEAFEKLATAWEERFVQLERLTT 2083          

HSP 2 Score: 83.9593 bits (206), Expect = 2.294e-15
Identity = 65/196 (33.16%), Postives = 93/196 (47.45%), Query Frame = 1
Query: 6394 KIFQPPPSPELVHESPKVSISEEDEEGKSHQHKISVISKEAAEMCQSSETKTDIRGILIRKHEWEYKNRKALNRSWHEFLVVLSIEKNKLLVYKDEKHYNEKPQDTYHKDSGLDLNDLVAAPASDYLKRPFVFRIKITSTGAEYLFQAKDEEDMLRWVNSINENSQKDLKSETT-APGKSSTLP-ACTSDPHVPST 6975
            ++F+P   PE   ES  V+    D    S + + S            +E    + G+L RK E E  N+KA  RSWH   V  +++K  L  +KD K  +     TYH +    L + V   A DY KR  VF+++    G EYLFQAKDE +M  W+ SI    ++ + + +  +PG    L  A T  P  PST
Sbjct: 2167 RVFKPK-QPERGSESESVNGPGRDSGLASSRLEASATLPGRGGADSDAEC---VEGMLCRKQEMESHNKKAATRSWHN--VYCTLKKGGLHFFKDNKSVSSGI--TYHGEMPFSLEEAVCEVALDYKKRKHVFKLR-NENGKEYLFQAKDEAEMNSWIQSI----RRFITTRSQDSPGAPRALSRAMTMPPISPST 2349          
BLAST of Spectrin beta chain vs. Planmine SMEST
Match: SMESG000066485.1 (SMESG000066485.1)

HSP 1 Score: 4398.19 bits (11406), Expect = 0.000e+0
Identity = 2303/2310 (99.70%), Postives = 2306/2310 (99.83%), Query Frame = 1
Query:   52 MADVAYTLPWSXXXXXXXXXXXXXXXXXXXXXXXKLYERFRIKALAGEREKVQKKTFTKWINSHLNKLKQSIDDLYNXXXXXXXXXXXXXXXXXXXXPYPTKGKMRIHCLENVDKSLNFLIEQRVHLENMGAHDIVDGNARLTLGLIWTIILRFQIQDIVVEEDDTSEKRQAKDALLLWCQMKTAGYPNTNVRNFSTCWRDGLAFNAIIHRHRPDLLEYSALSRSNPNENLEQAIRIAEEKLGIPRLLDPEDVSVENPDEKSIMTYVVTFYHFFSKMKADSVHSKRVGKILSQSMETEEMMVHYDKLTSNLLEWINQTIELLNDRTFANSLSGVQQQLAAFNTYRVTEKPPKFQEKGNLEMLLFSIQSQMRANNQMPYLPIEGKLISDINNAWNKLDKAEHARELALRDELIRQEKLEQLALRFDRKAGMREAWLTENQRLITQDNFGQDLSAVEAAGKKHEAIKTDILAYEERVNSVTLVTSELENECYHDVERVLCRRDNVIRLWEKLLDMLAVRKLRLDACYKVQKLFQDIKHLLDLINDLKARLKTEDIGRHLMGVEDLIHKHSLLEIDIRMVGTKIEGIMSDAQPFINSEFGLGSGDFQPADPNEVILRTVNLKEEYDNLLELSRNRKDNLSASKVMWEFLWGVADEEQWMKEKIQLMLNPDLGHDLSSVHRLISKHKVIEEDVRNHSNYLQNVIQGGQQLILDKNPGAEKVADXXXXXXXXXXXXXXXXXXRRSKLEQSLAYFHCLADCGEVEIWIIEQVKLVKIDETSINEESIITDIHKHEQLSKSIEDYESNINSLDEQVKKLSEGDLELVTIEEKVSNIKSQYAILIELTNQKQNKLTDTLSLFRVLRKADTVKTWIDEKEKLLMSLIPTDELEELEVFRHRFDGFEKEMNIQADQVEFVNTLAEKLSDMDHPQIADVVNKRFELNKLWNSLADLVEARREQLQTSYEFNQYLLECKQTGEWIREKSRLVESTDELGDDLAGIMQLQRRMGGMQRDMDAIRAKLEHLDEEMDTLIAKRPNXXXXXXXXXXXXXXFWAELGDMLADRDDRLSESSELQRFLQDLDHIHIWLSKMQTTVASEDLPKDLADAEKSLVQHEQLKEEIDSYQDEFIRLLDYGRRITEDKTDAQYMFLSQRLNALEEGWQELCQMWENRXXXXXXXXXXXVFLRDAIQSEVLLAQEENFLSKEDIPISIENSQNLLRKHEGFLTTLQANHDHTIAVIEFGRNLVERGHFCSDKINLRVKSILXXXXXXXXXXXXAYEKLKDQVLYQELSQDIDDLSKWIQEKMIIATDESFREEKNIARRYNRHRAFDEEIQANKDRLCQAIDYAMQIVEERPQLADMIYPQIDSLNQQWEELEQTTFLKGEKMIEANREAIFEEGTMDVMTWLXXXXXXXXXXXXXXXXXXXXXXKLKKVEEADNEMEIKRKQIQDLKMHAAKLKEEQPEKAFGIEQKHLILEHRFTQLQMPXXXXXXXXXXXXXXXXFLRNLDDQKAWVDDKLLLAESTNFGNNLLTVQQLLRRHRYLATEVNNHKPQLEYLKEEGAVLIEEVSPMQREKFVAGLQELESLWNRLEHSIDLRQQRLKESEATQTFLFDAEEAESWLWEQELFLLSEERGIRDQEAAINVIKKHDARQKTIEDYGEEITKLGTRSRLLIEKDHPQADRIALAQSHVDKVYAGLRDLCLEKKQRLSEIQKLNHLYREIVDLENWIYERTLVASSHDLGVDFEHCCLLRERFDEFFHETHLLGKDRVKAANDLCASLISQCHADSAEIAQWHDRINDSWAELQELMQTRIQLLRTAWEFYKYLSSCQDVLDRICEKIASIPTDVSKDSQSVAIQQRKHATFLSDAQALEGQVQWVVDEANHLLPSYAGQKEWHICERRDDVLATWNQLNMQAERRRHQLEDAADLQRFFSMVRELLQWMDLVALQINEKTRPKDVSGVELLINDHRSIKAEIAAREESMSICVNLGRTLLHRGRVGVDEVRAALINLITRKYSLEDMWEERWDYLQLILEVYQFARDASVAEAWILAQEPYLANKTLGETLDETLSLLKKHINFEKTVMSQEERFEALEKLTTMEIRAKEITKESILLKDKHKQERIENAIKIFQPPPSPELVHESPKVSISEEDEEGKSHQHKISVISKEAAEMCQSSETKTDIRGILIRKHEWEYKNRKALNRSWHEFLVVLSIEKNKLLVYKDEKHYNEKPQDTYHKDSGLDLNDLVAAPASDYLKRPFVFRIKITSTGAEYLFQAKDEEDMLRWVNSINENSQKDLKSETTAPGKSSTLPACTSDPHVPSTQA 6981
            MADVAYTLPWSNGTGDTNGNITTDDEWDTEDSTSKLYERFRIKALAGERE VQKKTFTKWINSHLNKLKQSIDDLYNDLKDGKMLLLLLEILSGEQLPYPTKGKMRIHCLENVDKSLNFLIEQRVHLENMGAHDIVDGNARLTLGLIWTIILRFQIQDIVVEEDDTSEKRQAKDALLLWCQMKTAGYPNTNVRNFSTCWRDGLAFNAIIHRHRPDLLEYSALSRSNPNENLEQAIRIAEEKLGIPRLLDPEDVSVENPDEKSIMTYVVTFYHFFSKMKADSVHSKRVGKILSQSMETEEMMVHYDKLTSNLLEWINQTIELLNDRTFANSLSGVQQQLAAFNTYRVTEKPPKFQEKGNLEMLLFSIQSQMRANNQ+PYLPIEGKLISDINNAWNKLDKAEHARELALRDELIRQEKLEQLALRFDRKAGMREAWLTENQRLITQDNFGQDLSAVEAAGKKHEAIKTDILAYEERVNSVTLVTSELENECYHDVERVLCRRDNVIRLWEKLLDMLAVRKLRLDACYKVQKLFQDIKHLLD+INDLKARLKTEDIGRHLMGVEDLIHKHSLLEIDIRMVGTKIEGIMSDAQPFINSEFGL SGDFQPADPNEVILRTVNLKEEYDNLLELSRNRKDNLSASKVMWEFLWGVADEEQWMKEKIQLMLNPDLGHDLSSVHRLISKHKVIEEDVRNHSNYLQNVIQ GQQLILDKNPGAEKVADNLKELELLWNELIELTENRRSKLEQSLAYFHCLADCGEVEIWIIEQVKLVKIDETSINEESIITDIHKHEQLSKSIEDYESNINSLDEQVKKLSEGDLELVTIEEKVSNIKSQYAIL ELTNQKQNKLTDTLSLFRVLRKADTVKTWIDEKEKLLMSLIPTDELEELEVFRHRFDGFEKEMNIQADQVEFVNTLAEKLSDMDHPQIADVVNKRFELNKLWNSLADLVEARREQLQTSYEFNQYLLECKQTGEWIREKSRLVESTDELGDDLAGIMQLQRRMGGMQRDMDAIRAKLEHLDEEMDTLIAKRPNDEELIREERMILEDFWAELGDMLADRDDRLSESSELQRFLQDLDHIHIWLSKMQTTVASEDLPKDLADAEKSLVQHEQLKEEIDSYQDEFIRLLDYGRRITEDKTDAQYMFLSQRLNALEEGWQELCQMWENRQGLLSQSLSLQVFLRDAIQSEVLLAQEENFLSKEDIPISIENSQNLLRKHEGFLTTLQANHDHTIAVIEFGRNLVERGHFCSDKINLRVKSILERRESNKRRSNEAYEKLKDQVLYQELSQDIDDLSKWIQEKMIIATDESFREEKNIARRYNRHRAFDEEIQANKDRLCQAIDYAMQIVEERPQLADMIYPQIDSLNQQWEELEQTTFLKGEKMIEANREAIFEEGTMDVMTWLETIGESIIVTEEEVETLTDVNVKLKKVEEADNEMEIKRKQIQDLKMHAAKLKEEQPEKAFGIEQKHLILEHRFTQLQMPIKNKKIQLIQRKRIQQFLRNLDDQKAWVDDKLLLAESTNFGNNLLTVQQLLRRHRYLATEVNNHKPQLEYLKEEGAVLIEEVSPMQREKFVAGLQELESLWNRLEHSIDLRQQRLKESEATQTFLFDAEEAESWLWEQELFLLSEERGIRDQEAAINVIKKHDARQKTIEDYGEEITKLGTRSRLLIEKDHPQADRIALAQSHVDKVYAGLRDLCLEKKQRLSEIQKLNHLYREIVDLENWIYERTLVASSHDLGVDFEHCCLLRERFDEFFHETHLLGKDRVKAANDLCASLISQCHADSAEIAQWHDRINDSWAELQELMQTRIQLLRTAWEFYKYLSSCQDVLDRICEKIASIPTDVSKDSQSVAIQQRKHATFLSDAQALEGQVQWVVDEANHLLPSYAGQKEWHICERRDDVLATWNQLNMQAERRRHQLEDAADLQRFFSMVRELLQWMDLVALQINEKTRPKDVSGVELLINDHRSIKAEIAAREESMSICVNLGRTLLHRGRVGVDEVRAALINLITRKYSLEDMWEERWDYLQLILEVYQFARDASVAEAWILAQEPYLANKTLGETLDETLSLLKKHINFEKTVMSQEERF+ALEKLTTMEIRAKEITKESILLKDKHKQERIENAIKIFQPPPSPELVHESPKVSISEEDEEGKSHQHKISVISKEAAEMCQSSETKTDIRGILIRKHEWEYKNRKALNRSWHEFLVVLSIEKNKLLVYKDEKHYNEKPQDTYHKDSGLDLNDLVAAPASDYLKRPFVFRIKITSTGAEYLFQAKDEEDMLRWVNSINENSQKDLKSETTAPGKSSTLPACTSDPHVPSTQA
Sbjct:    1 MADVAYTLPWSNGTGDTNGNITTDDEWDTEDSTSKLYERFRIKALAGERENVQKKTFTKWINSHLNKLKQSIDDLYNDLKDGKMLLLLLEILSGEQLPYPTKGKMRIHCLENVDKSLNFLIEQRVHLENMGAHDIVDGNARLTLGLIWTIILRFQIQDIVVEEDDTSEKRQAKDALLLWCQMKTAGYPNTNVRNFSTCWRDGLAFNAIIHRHRPDLLEYSALSRSNPNENLEQAIRIAEEKLGIPRLLDPEDVSVENPDEKSIMTYVVTFYHFFSKMKADSVHSKRVGKILSQSMETEEMMVHYDKLTSNLLEWINQTIELLNDRTFANSLSGVQQQLAAFNTYRVTEKPPKFQEKGNLEMLLFSIQSQMRANNQVPYLPIEGKLISDINNAWNKLDKAEHARELALRDELIRQEKLEQLALRFDRKAGMREAWLTENQRLITQDNFGQDLSAVEAAGKKHEAIKTDILAYEERVNSVTLVTSELENECYHDVERVLCRRDNVIRLWEKLLDMLAVRKLRLDACYKVQKLFQDIKHLLDIINDLKARLKTEDIGRHLMGVEDLIHKHSLLEIDIRMVGTKIEGIMSDAQPFINSEFGLDSGDFQPADPNEVILRTVNLKEEYDNLLELSRNRKDNLSASKVMWEFLWGVADEEQWMKEKIQLMLNPDLGHDLSSVHRLISKHKVIEEDVRNHSNYLQNVIQAGQQLILDKNPGAEKVADNLKELELLWNELIELTENRRSKLEQSLAYFHCLADCGEVEIWIIEQVKLVKIDETSINEESIITDIHKHEQLSKSIEDYESNINSLDEQVKKLSEGDLELVTIEEKVSNIKSQYAILFELTNQKQNKLTDTLSLFRVLRKADTVKTWIDEKEKLLMSLIPTDELEELEVFRHRFDGFEKEMNIQADQVEFVNTLAEKLSDMDHPQIADVVNKRFELNKLWNSLADLVEARREQLQTSYEFNQYLLECKQTGEWIREKSRLVESTDELGDDLAGIMQLQRRMGGMQRDMDAIRAKLEHLDEEMDTLIAKRPNDEELIREERMILEDFWAELGDMLADRDDRLSESSELQRFLQDLDHIHIWLSKMQTTVASEDLPKDLADAEKSLVQHEQLKEEIDSYQDEFIRLLDYGRRITEDKTDAQYMFLSQRLNALEEGWQELCQMWENRQGLLSQSLSLQVFLRDAIQSEVLLAQEENFLSKEDIPISIENSQNLLRKHEGFLTTLQANHDHTIAVIEFGRNLVERGHFCSDKINLRVKSILERRESNKRRSNEAYEKLKDQVLYQELSQDIDDLSKWIQEKMIIATDESFREEKNIARRYNRHRAFDEEIQANKDRLCQAIDYAMQIVEERPQLADMIYPQIDSLNQQWEELEQTTFLKGEKMIEANREAIFEEGTMDVMTWLETIGESIIVTEEEVETLTDVNVKLKKVEEADNEMEIKRKQIQDLKMHAAKLKEEQPEKAFGIEQKHLILEHRFTQLQMPIKNKKIQLIQRKRIQQFLRNLDDQKAWVDDKLLLAESTNFGNNLLTVQQLLRRHRYLATEVNNHKPQLEYLKEEGAVLIEEVSPMQREKFVAGLQELESLWNRLEHSIDLRQQRLKESEATQTFLFDAEEAESWLWEQELFLLSEERGIRDQEAAINVIKKHDARQKTIEDYGEEITKLGTRSRLLIEKDHPQADRIALAQSHVDKVYAGLRDLCLEKKQRLSEIQKLNHLYREIVDLENWIYERTLVASSHDLGVDFEHCCLLRERFDEFFHETHLLGKDRVKAANDLCASLISQCHADSAEIAQWHDRINDSWAELQELMQTRIQLLRTAWEFYKYLSSCQDVLDRICEKIASIPTDVSKDSQSVAIQQRKHATFLSDAQALEGQVQWVVDEANHLLPSYAGQKEWHICERRDDVLATWNQLNMQAERRRHQLEDAADLQRFFSMVRELLQWMDLVALQINEKTRPKDVSGVELLINDHRSIKAEIAAREESMSICVNLGRTLLHRGRVGVDEVRAALINLITRKYSLEDMWEERWDYLQLILEVYQFARDASVAEAWILAQEPYLANKTLGETLDETLSLLKKHINFEKTVMSQEERFQALEKLTTMEIRAKEITKESILLKDKHKQERIENAIKIFQPPPSPELVHESPKVSISEEDEEGKSHQHKISVISKEAAEMCQSSETKTDIRGILIRKHEWEYKNRKALNRSWHEFLVVLSIEKNKLLVYKDEKHYNEKPQDTYHKDSGLDLNDLVAAPASDYLKRPFVFRIKITSTGAEYLFQAKDEEDMLRWVNSINENSQKDLKSETTAPGKSSTLPACTSDPHVPSTQA 2310          
BLAST of Spectrin beta chain vs. Planmine SMEST
Match: SMESG000035098.1 (SMESG000035098.1)

HSP 1 Score: 2186.76 bits (5665), Expect = 0.000e+0
Identity = 1168/2275 (51.34%), Postives = 1637/2275 (71.96%), Query Frame = 1
Query:  154 KLYERFRIKALAGEREKVQKKTFTKWINSHLNKLKQSIDDLYNXXXXXXXXXXXXXXXXXXXXPYPTKGKMRIHCLENVDKSLNFLIEQRVHLENMGAHDIVDGNARLTLGLIWTIILRFQIQDIVVEEDDTSEKRQAKDALLLWCQMKTAGYPNTNVRNFSTCWRDGLAFNAIIHRHRPDLLEYSALSRSNPNENLEQAIRIAEEKLGIPRLLDPEDVSVENPDEKSIMTYVVTFYHFFSKMKADSVHSKRVGKILSQSMETEEMMVHYDKLTSNLLEWINQTIELLNDRTFANSLSGVQQQLAAFNTYRVTEKPPKFQEKGNLEMLLFSIQSQMRANNQMPYLPIEGKLISDINNAWNKLDKAEHARELALRDELIRQEKLEQLALRFDRKAGMREAWLTENQRLITQDNFGQDLSAVEAAGKKHEAIKTDILAYEERVNSVTLVTSELENECYHDVERVLCRRDNVIRLWEKLLDMLAVRKLRLDACYKVQKLFQDIKHLLDLINDLKARLKTEDIGRHLMGVEDLIHKHSLLEIDIRMVGTKIEGIMSDAQPFINSEFGLGSGDFQPADPNEVILRTVNLKEEYDNLLELSRNRKDNLSASKVMWEFLWGVADEEQWMKEKIQLMLNPDLGHDLSSVHRLISKHKVIEEDVRNHSNYLQNVIQGGQQLILDKNPGAEKVADXXXXXXXXXXXXXXXXXXRRSKLEQSLAYFHCLADCGEVEIWIIEQVKLVKIDETSINEESIITDIHKHEQLSKSIEDYESNINSLDEQVKKLSE-GDLELVTIEEKVSNIKSQYAILIELTNQKQNKLTDTLSLFRVLRKADTVKTWIDEKEKLLMSLIPTDELEELEVFRHRFDGFEKEMNIQADQVEFVNTLAEKLSDMDHPQIADVVNKRFELNKLWNSLADLVEARREQLQTSYEFNQYLLECKQTGEWIREKSRLVESTDELGDDLAGIMQLQRRMGGMQRDMDAIRAKLEHLDEEMDTLIAKRPNXXXXXXXXXXXXXXFWAELGDMLADRDDRLSESSELQRFLQDLDHIHIWLSKMQTTVASEDLPKDLADAEKSLVQHEQLKEEIDSYQDEFIRLLDYGRRITEDKTDAQYMFLSQRLNALEEGWQELCQMWENRXXXXXXXXXXXVFLRDAIQSEVLLAQEENFLSKEDIPISIENSQNLLRKHEGFLTTLQANHDHTIAVIEFGRNLVERGHFCSDKINLRVKSILXXXXXXXXXXXXAYEKLKDQVLYQELSQDIDDLSKWIQEKMIIATDESFREEKNIARRYNRHRAFDEEIQANKDRLCQAIDYAMQIVEERPQLADMIYPQIDSLNQQWEELEQTTFLKGEKMIEANREAIFEEGTMDVMTWLXXXXXXXXXXXXXXXXX---XXXXXKLKKVEEADNEMEIKRKQIQDLKMHAAKLKEEQPEKAFGIEQKHLILEHRFTQLQMPXXXXXXXXXXXXXXXXFLRNLDDQKAWVDDKLLLAESTN-FGNNLLTVQQLLRRHRYLATEVNNHKPQLEYLKEEGAVLIEEVSPMQREKFVAGLQELESLWNRLEHSIDLRQQRLKESEATQTFLFDAEEAESWLWEQELFLLSEERGIRDQEAAINVIKKHDARQKTIEDYGEEITKLGTRSRLLIEKDHPQADRIALAQSHVDKVYAGLRDLCLEKKQRLSEIQKLNHLYREIVDLENWIYERTLVASSHDLGVDFEHCCLLRERFDEFFHETHLLGKDRVKAANDLCASLISQCHADSAEIAQWHDRINDSWAELQELMQTRIQLLRTAWEFYKYLSSCQDVLDRICEKIASIPTDVSKDSQSVAIQQRKHATFLSDAQALEGQVQWVVDEANHLLPSYAGQKEWHICERRDDVLATWNQLNMQAERRRHQLEDAADLQRFFSMVRELLQWMDLVALQINEKTRPKDVSGVELLINDHRSIKAEIAAREESMSICVNLGRTLLHRGRVGVDEVRAALINLITRKYSLEDMWEERWDYLQLILEVYQFARDASVAEAWILAQEPYLANKTLGETLDETLSLLKKHINFEKTVMSQEERFEALEKLTTMEIRAKEITKESILLKDKHKQERIENAIKIFQPPPSPELVHESP----KVSISEEDEEGKSHQHKISV-ISKEAAEMCQSSE--TKTDIRGILIRKHEWEYKNRKALNRSWHEFLVVLSIEKNKLLVYKDEKHYNEKPQDTYHKDSGLDLNDLVAAPASDYLKRPFVFRIKITSTGAEYLFQAKDEEDMLRWVNSINENSQKDLKSETTAPGKSSTLP 6942
            KLYER RIKALA ERE VQKKTFTKW+NSHL K+ + +DDLY DL+DGK L+ LLEIL+ E+LP PT+GKMRIHCL NVDK++NFL++Q VHLEN+GAHDIVDG+ RLTLGL+WTIILRFQ+QDIV++E D ++ R AKDALLLWCQMKTAGY N N+RNF+T WRDGLAFNAIIH+H P+L+EY  L+++ P +NL  A  IAE++L IP+LLD ED++VE PDEKSIMTYVVT YH+F++MK ++V  KR+GK+L+Q++E+E+ +  YD L S+LLEWIN TI+LL++R FANSLSGVQQQLAAFNTYR++EKPPKF +KGNLEMLLF+I S+MRANNQ PY+P EGK+ISDIN AW KL+KAEH REL LR+ELIRQEKL+QL  RFDRK  MREAWL+ENQRL+TQDNFG DL+AVEAA KKHEAI+TDI AYEERVN+V  V  EL  E YHD+ER+  R+DNVI++W+ LL++L +R+ RL+   ++Q +FQ+I +LLD I+++  RLK+ED G+HL+GV+DL+ KH LLE DIR++  +   ++  A+ FI+ +F      ++PA+P+EV  R   LK+ Y  LLEL+  R + L  SK MW+F W + D+++W+KEK QLM +PDLGHDLSSV RL+ KHK +EE+VR     L+  +Q G++LI + N G +++ D +++++ +W +L++LT  RR +LE+SL ++  L DC + + W+I+Q+++VK ++           I  ++ L   +  +  +++ L  Q   +SE  + +   I  ++  + ++Y  LIEL+  +Q KL D +S++++   AD+VKTWI EKEKLL++L+P+DELEELEV RHRFD FE EM   A++V  VN L++ L   +HP   +++ K+ +LN  WN LAD+VE +++ ++TSY++NQ+L+E ++T  WI EK +L++STDELG+DL GIMQLQRR+GG+QRD+ AI AK++HLD+E D +  K+P    ++  ER  + + W EL  ML +RDD+L++SSELQRFLQDLDH  +WL + QT VASED+P +L +AEK L QH QLK+EI  Y  EF RL+ +GR++TE + DAQYMFL+QRL+ +EE W+ L +M ++R+ +L+QSL  Q F +DA Q +++L++ EN + K D+P S+E  +  +++H+       AN     +++E GRNLV   +F +DKI  +   I ERR + +R+S+E  E L  Q+  QE  Q+IDD+ +WI EKMIIA+D+S+R+ +N++ RY R +AF+EEI ANKD++ + I    +++++RPQ A++   +ID L QQW EL  T   K +K+ +ANRE IF E    +  W+  I   II TEE+ ET     ++N ++K  E+ D E+E KRK + D++ HA KLKE+ P++   IEQ    +  + TQ++ P+  ++  L++RKR++QFLR+++D+K W+++K+ L ++    G++LL VQQ +RR + L  EV+NH P+++ + E+G ++I E  P Q EKF   ++EL  LW++L+  +  R   L+++   Q +LFDA EAE+W+ EQEL+L+S E+  +D++ A N++KKH   +K IE+Y +EI  LG RS+ ++   HPQ+D +A  QS VDK+YAGLRDLC E++ RL E  KL HL +EIVDLE WI ER ++ASSH++G D+EHCCLLR+RF EF  ET+ +G  R+ AAN+LC SLI+Q HA+SAEIAQW DRIN+SWA+L EL++TRIQLL+ AW+ +K+LS CQD+LDRI EK   IP +V +D++SVA  QRKH  F  +   L  Q++  V+ ANHLLP YAGQKE  IC+RRD++L  W +L M +E R+  L DAADL RF SMVREL+ WM  +  Q++ K +PKDV+GV+LL+N+HRS+KAEI AREE+ SIC++LGRTLL+R     +++R   I ++T + +L D W ER+DYL LILEVYQFARDA+VAE+W++AQ  YL+ + LGE LDETL+LLKKHI FE+ VM+QEERFEAL+KLTT+E+RAK+ + ES   KD  +Q++I   IK FQPPP+P+L    P    + +I     +  +   K+S    +++A+   +S+        G L RKHEWE   +KA  RSWHE  VVL+     L  YKD+KH  EKP + YH +S L L+     PA+DY KR  VFR+K+ + G EYLFQAK E +M  W+  +N NS     S+T    +SSTLP
Sbjct:   37 KLYERSRIKALAEEREIVQKKTFTKWMNSHLAKVGEFVDDLYLDLRDGKKLIKLLEILACEKLPKPTRGKMRIHCLVNVDKAINFLLDQHVHLENVGAHDIVDGSPRLTLGLVWTIILRFQMQDIVLDEYDATDARSAKDALLLWCQMKTAGYNNVNIRNFTTSWRDGLAFNAIIHKHCPELIEYMKLAKAAPLQNLRNAFNIAEDELMIPKLLDAEDINVEQPDEKSIMTYVVTLYHYFNRMKTENVQCKRIGKVLNQAIESEDRITEYDNLASDLLEWINHTIQLLDERLFANSLSGVQQQLAAFNTYRISEKPPKFNDKGNLEMLLFTIHSEMRANNQKPYIPEEGKMISDINRAWEKLEKAEHERELCLREELIRQEKLDQLGSRFDRKTTMREAWLSENQRLVTQDNFGNDLAAVEAATKKHEAIETDIFAYEERVNAVMTVAEELAEENYHDIERINLRKDNVIKMWQDLLELLKMRRNRLELSKQMQNVFQEIIYLLDWIDEIGNRLKSEDCGKHLLGVDDLLQKHGLLEADIRVLEIRKNQVLEQAEVFIDCDFDENLQGYRPAEPSEVENRCQQLKDSYQALLELASYRHNALQESKKMWQFFWEMEDDKEWIKEKSQLMSSPDLGHDLSSVERLLRKHKALEEEVRIRQQALETGLQKGEELIENDNWGKDRIKDKIQKMKTIWAQLVDLTAERRQRLEESLEFYQLLTDCDDADAWMIDQLRIVKNEDVGTKLALTEALIKNNQDLMDELATFRQSLDQLRTQGTTISEYPETDASKIFNRLDTLDNRYDQLIELSKLRQQKLLDAMSMYKLFDVADSVKTWIIEKEKLLITLVPSDELEELEVIRHRFDCFESEMRANAEKVSKVNELSKDLVSDEHPNTENIIQKQDDLNINWNDLADMVEKKKQDIETSYKYNQFLIEAQETANWIIEKEKLIQSTDELGNDLEGIMQLQRRLGGLQRDLKAIEAKVDHLDKEADDIEEKKPEVGNIVEPERAKINELWTELKSMLKERDDKLNDSSELQRFLQDLDHFQMWLRRSQTAVASEDIPNNLQEAEKLLDQHNQLKQEIAVYHPEFERLIHFGRKVTEGQDDAQYMFLNQRLSGIEESWEGLEKMCDDREAVLNQSLQAQTFFKDAQQIDIVLSKLENAVLKSDLPTSVEAVEEAIKQHDNINNNAIANEVKIDSLLESGRNLVVDNNFNADKIQRKCDEIAERRSAIRRKSSERSELLAAQLELQEFYQEIDDVEEWIGEKMIIASDDSYRDLQNVSARYGRFKAFEEEIGANKDKIEKVIKAGQELMQQRPQFAEITQIKIDELAQQWNELNNTAQDKSKKIADANRETIFNETAKSMNEWITDISSQIITTEEDSETEIGLVEINEQMKDQEKKDKELENKRKMLADMETHAVKLKEQYPDREEEIEQMQQEVRVKLTQVEAPLAGRRENLLKRKRVRQFLRDIEDEKQWIEEKINLVQNNGKIGDSLLAVQQFIRRLKTLNNEVDNHHPRIQAVCEDGEIMISEGHP-QSEKFKIAMKELWELWDQLQMKLLERFAVLEDNLVAQQYLFDASEAEAWMGEQELYLMSPEKA-KDEQGANNLMKKHQHIEKMIENYADEIRNLGERSQEMMHSCHPQSDLVAQKQSKVDKMYAGLRDLCSERQFRLEENVKLFHLLKEIVDLETWIAERIVLASSHEMGSDYEHCCLLRDRFAEFAKETNAIGGGRICAANELCDSLINQGHAESAEIAQWKDRINESWADLLELIETRIQLLKAAWDLHKFLSDCQDLLDRITEKKLVIPDEVGRDAKSVATYQRKHQAFEQEVHRLGQQIESAVETANHLLPLYAGQKERMICDRRDELLHAWRELQMASEFRKVHLLDAADLHRFLSMVRELINWMFEIRQQMDSKDKPKDVAGVDLLVNNHRSLKAEIDAREENFSICLSLGRTLLNRRHPRENDIREKCIEVVTLRVNLIDQWAERYDYLHLILEVYQFARDAAVAESWLMAQCTYLSCQDLGENLDETLALLKKHIAFERAVMTQEERFEALKKLTTLELRAKDSSPESQRQKDIERQKKIAEMIKEFQPPPTPKLQKSEPILDSETAIESVSSQQVASSRKLSTEHDRDSADHPTTSKHPGSESHEGTLSRKHEWESTGKKASGRSWHELYVVLN--DGVLSAYKDQKHGKEKPSELYHHESPLQLSGARIGPATDYTKRVNVFRLKLVN-GGEYLFQAKSESEMNEWITKLN-NSASGADSDTAT--RSSTLP 2303          
BLAST of Spectrin beta chain vs. Planmine SMEST
Match: SMESG000081696.1 (SMESG000081696.1)

HSP 1 Score: 1623.6 bits (4203), Expect = 0.000e+0
Identity = 950/2308 (41.16%), Postives = 1471/2308 (63.73%), Query Frame = 1
Query:  157 LYERFRIKALAGEREKVQKKTFTKWINSHLNKLKQS--IDDLYNXXXXXXXXXXXXXXXXXXXXPYPTKGKMRIHCLENVDKSLNFLIEQRVHLENMGAHDIVDGNARLTLGLIWTIILRFQIQDIVVEEDDTSEKRQAKDALLLWCQMKTAGYPNTNVRNFSTCWRDGLAFNAIIHRHRPDLLEYSALSRSNPNENLEQAIRIAEEKLGIPRLLDPEDVSVENPDEKSIMTYVVTFYHFFSKMKADSVHSKRVGKILSQSMETEEMMVHYDKLTSNLLEWINQTIELLNDRTFANSLSGVQQQLAAFNTYRVTEKPPKFQEKGNLEMLLFSIQSQMRANNQMPYLPIEGKLISDINNAWNKLDKAEHARELALRDELIRQEKLEQLALRFDRKAGMREAWLTENQRLITQDNFGQDLSAVEAAGKKHEAIKTDILAYEERVNSVTLVTSELENECYHDVERVLCRRDNVIRLWEKLLDMLAVRKLRLDACYKVQKLFQDIKHLLDLINDLKARLKTEDIGRHLMGVEDLIHKHSLLEIDIRMVGTKIEGIMSDAQPFINSEFGLGSGDFQPA--DPNEVILRTVNLKEEYDNLLELSRNRKDNLSASKVMWEFLWGVADEEQWMKEKIQLMLNPDLGHDLSSVHRLISKHKVIEEDVRNHSNYLQNVIQG-GQQLILDKNPGAEKVADXX-XXXXXXXXXXXXXXXXRRSKLEQSLAYFHCLADCGEVEIWIIEQVKLVKIDETSINEESIITDIH--KHEQLSKSIEDYESNINSLDEQVKKLSEGDLELVTIEEKVSNIKSQYAILIELTNQKQNKLTDTLSLFRVLRKADTVKTWIDEKEKLLMSLIPTDELEELEVFRHRFDGFEKEMNIQADQVEFVNTLAEKLSDMDHPQIADVVNKRFELNKLWNSLADLVEARREQLQTSYEFNQYLLECKQTGEWIREKSRLVESTDELGDDLAGIMQLQRRMGGMQRDMDAIRAKLEHLDEEMDTLIAKRPNXXXXXXXXXXXXXXFWAELGDMLADRDDRLSESSELQRFLQDLDHIHIWLSKMQTTVASEDLPKDLADAEKSLVQHEQLKEEIDSYQDEFIRLLDYGRRITEDKTDAQYMFLSQRLNALEEGWQELCQMWENRXXXXXXXXXXXVFLRDAIQSEVLLAQEENFLSKEDIPISIENSQNLLRKHEGFLTTLQANHDHTIAVIEFGRNLVERGHFCSDKINLRVKSILXXXXXXXXXXXXAYEKLKDQVLYQELSQDIDDLSKWIQEKMIIATDESFREEKNIARRYNRHRAFDEEIQANKDRLCQAIDYAMQIVEERPQLADMIYPQIDSLNQQWEELEQTTFLKGEKMIEANREAIFEEGTMDVMTWLXXXXXXXXXXXXXXXXX--XXXXXKLKKVEEADNEMEIKRKQIQDLKMHAAKLKEEQPEKAFGIEQKHLILEHRFTQLQMPXXXXXXXXXXXXXXXXFLRNLDDQKAWVDDKLLLAESTNFGNNLLTVQQLLRRHRYLA---TEVNNHKPQLEYLKEEGAVLIEEVSPMQREKFVAGLQELESLWNRLEHSIDLRQQRLKESEATQTFLFDAEEAESWLWEQELFLLSEERGIRDQEAAINVIKKHDARQKTIEDYGEEITKLGTRSRLLIEKDHPQADRIALAQSHVDKVYAGLRDLCLEKKQRLSEIQKLNHLYREIVDLENWIYERTLVASSHDLGVDFEHCCLLRERFDEFFHETHLLGKDRVKAANDLCASLISQCHADSAEIAQWHDRINDSWAELQELMQTRIQLLRTAWEFYKYLSSCQDVLDRICEKIASIPTDVSKDSQSVAIQQRKHATFLSDAQALEGQVQWVVDEANHLLPSYAGQKEWHICERRDDVLATWNQLNMQAERRRHQLEDAADLQRFFSMVRELLQWMDLVALQINEKTRPKDVSGVELLINDHRSIKAEIAAREESMSICVNLGRTLLHRGRVGVDEVRAALINLITRKYSLEDMWEERWDYLQLILEVYQFARDASVAEAWILAQEPYLANKTLGETLDETLSLLKKHINFEKTVMSQEERFEALEKLTTMEIRAKEITKESILLKDKHKQERIENAIKIFQ-PPPSPELVHE------------------SPKVSISEEDEEGKSHQHKISVISKEAAEMCQSSETKTDIRGILIRKHEWEYKNRKALNRSWHEFLVVLSIEKNKLLVYKDEKHY-NEKPQDTYHKDSGLDLNDLVAAPASDYLKRPFVFRIKITSTGAEYLFQAKDEEDMLRWVNSINENSQKDLKSETTAPGKSSTLPACTSDPHVPSTQA 6981
            LYER RIKAL+ +RE VQKKTFTKW+NSHL K K+   +DDL+ DL+DGK LL LLEILSGE++P  TKGK+RIHC+ENV KS+NFL +Q V  EN+GAHDIVDGN  L LGLIWTIILRFQIQD  ++E D   KR +K++LLLWCQMKTAGY N N+RNF++ W+DGLAFNA++H+HRP++++Y  L+++NP ENL  A   AE + G+P+LLD  D+ V+ P+EKSIMTYV +     +K+K +    KR+G ++++++  E+++ +Y++L+  LLEWI   I+ + +     SL GV++QL  F+ YR+TEKPPKFQ++G LEM  F IQS++RA+N+  Y+P EGKLIS IN AW+ L+K+EH  EL L +ELIRQ+KLEQL   F+RKA MR+ WL EN  L+ Q  FG DL  + AA KKHEA++ DI A+EER+N++  +  +L++E Y+ +  V      ++ +W+KLLD L  R+ +LD C  +Q + Q+  +L+D + ++  RL++ D G+HL+GVE+L+ KH +L  DIR     +EG + D      +   L + DF  A  D + V ++   L   Y  L+ LS  R+D L+  KVMWE++  + ++++W+KE IQL  +PD GHDL SV RLI K + I  DV    + + + +     +   D +P  +++      E+  L + L +   NRR++L QS  +   LAD  + +  I+E+ +L   + + + ++  +T+ +  +HE+    +E+ E  I  L  +   L     +    +E    +K+ +  L++L N +++ L +    F +    +T++TWI  KEKLL++L+P++EL+EL V +HRFD FE +M I + +V   N ++  L +  HP++  +  K+  LN  WN LADL E ++++LQ + ++NQ++LE ++T  WI++K +L+E TD+L DDL GIMQLQRR+G +QRD+ AI AK+++L++E D L   +P DE  I  E   + + W EL  ML DRD RL+ S+ELQ+F +DLD   +WL K+Q  VA++D+PKDL +AE+    H ++KEEI  ++ E++RLL +GR+++  K D QY+  ++RLN LE  W  L +MW+++   L +S   Q F+RD++Q + +L Q+E+FLSK ++P + E ++   R+ E F  ++ +N     AV+ FG +L+   +  SDKI  + + I  R ++ + + +     L+D +L  E S D+  L +W+ EKMIIA+D S+R+ K+I+ RYNR + F+ E++AN++ + + I+   ++++E+P     I P++  L  QW EL  T   K +++ EANRE IF+E T  +M+W+  I   II TEE +E     ++N K+K  E+ D +++ KRK + D++ HA KLKE+ PE+    E     ++ + T+++ P+ +++  L+Q+KR+QQFLR+++D+K W+ +KL     T F     T+Q  L+R R L    TE++NH  ++  L  EG  +I    P   +KF   L EL  LW+ L  + +  QQ  +E+   Q +L +A E E W+ E+E  L+ E++  +D+  A+N ++KH+     I +YG  ++KL  +   ++  D P +  +A  Q  VDK+YA L ++CLEKK ++ ++ +  HLYR I  LE WI ER+ VA S+++G + EHC LLRERF EF  +T+ +G  RVK A+++C  LI+  H +S EIA+W DRIN++WA+L EL++TRIQLL+ A++F+K++S   ++LD I EKI  IP  V KD++SVA  QRKH  F ++ + LE  +   +  A+ LLP Y G+KE  I +R+ ++   W  L    E R + L DA+DL +F++MVREL+ WM  + +QIN   + +DV GVEL+I++HRS+KAEI +R+E+ SIC+ LGRTL++R     ++VR     ++ + +++ + W ER ++L++ILEVYQFAR+A+VAEAW++AQE  L     G+TL+ETL+LL+KH++ E+ +  Q +RFE L+KLT+ E   K +T E    K K +++R+E  I+ F  PPP+PE V +                  S + +++ +D      + ++   SKE  ++ ++  T     G L RKHEWE   +KA NR W+E  VV  IE +K+ VYK+ K+Y ++K Q TY  +  +DL   +++PA++Y KRP VFR++I + GAEYLF+A D+ +M +WV  INE    D     T+  K STLP   SD  +P T+A
Sbjct:   24 LYERSRIKALSEQREAVQKKTFTKWVNSHLMKSKEPYHVDDLFVDLQDGKALLKLLEILSGEKMPPITKGKLRIHCIENVTKSINFLNDQHVCFENLGAHDIVDGNPTLILGLIWTIILRFQIQDAAIDEKDG--KRTSKESLLLWCQMKTAGYNNVNIRNFTSSWKDGLAFNALLHKHRPEVVDYVTLTKANPVENLNFAFETAEREFGVPQLLDARDIIVDQPEEKSIMTYVGSLCLALNKVKRNEKQCKRLGNVINEAISAEKLINNYEELSEELLEWIKLKIDWMENEKLNESLPGVREQLGDFSNYRLTEKPPKFQDRGLLEMNFFEIQSKLRADNRKLYVPPEGKLISAINRAWDNLEKSEHRMELRLYEELIRQQKLEQLGNHFNRKAQMRKDWLIENDILVHQKIFGDDLVTIVAAIKKHEALEGDIFAHEERINALGYIADDLKSENYYKITEVEDCYFMIVEMWKKLLDDLQTRRDKLDRCRDIQMILQETDYLMDWMREITIRLQSRDFGKHLLGVENLLEKHKILLSDIR----NLEGRIDD------TSRKLQTADFDRAAIDQDYVDMKEKQLVNNYQELILLSEQREDELNCYKVMWEYIEDINNDKEWIKEIIQLFQSPDSGHDLRSVERLIRKFEQILSDVTVRKDLIVDKLDSIVHKTSNDPSPQRQEIIHREIDEINELLDNLDQAMRNRRNQLNQSHDFHQLLADIEDADAMILEERRL--FENSDVGDKLSLTEYYLKQHEEQMLQVEELEKLITELFGRKNDLELDSQQQNDADEACERMKNDFEDLVDLANTRKHLLLNNKDKFHLFSNFETIETWIIAKEKLLVTLVPSEELDELNVIKHRFDCFEDDMKIHSGKVSEANQISRDLINEQHPELEIISEKQNILNLDWNQLADLAEQKKKELQLAVDYNQFILESQETQSWIQDKMKLLEWTDDLKDDLEGIMQLQRRLGSLQRDVQAIEAKVKYLNKEADKLKVAKPADEATIDSEITAVNELWEELKIMLQDRDARLNSSNELQKFFKDLDSFDVWLKKVQIQVATQDIPKDLQEAERYCTNHLEVKEEILCWEPEYVRLLQFGRQVSHSKDDPQYLLFNERLNVLENEWNALEKMWKDKDVSLHESKDAQTFIRDSLQIDGILTQQESFLSKSELPNNYEATKATEREFEAFKNSVASNKPKIDAVVNFGESLLA-SNALSDKIRNKCEQIHSRCDAIQDKIDRRNSALQDHLLLLEFSDDVLALEEWMSEKMIIASDTSYRDTKDISTRYNRFKDFERELEANRESVDEVIEKGNKLIDEKPHFESEIEPKVVELENQWSELLNTATEKSKQLEEANREIIFDETTKSMMSWVTEISSQIITTEEIIEEYGLVELNEKMKDQEDKDKQLDQKRKMLSDIEQHAEKLKEQYPERGDEFELIQQEVKVKLTEIEAPLTDRRNILLQKKRVQQFLRDVEDEKEWIREKLEFI--TKFKIAPETLQVCLQRIRRLKTNNTEIDNHAGRITDLNNEGEEMIRNDFP-SSDKFNIALDELNKLWDDLITACEDCQQFFEENREVQEYLSEAIECEYWMSEREFDLMREDKA-KDEGGALNAMRKHEELISVINNYGSIVSKLADKYHHILNCDLPGSHLVAQKQERVDKMYADLLEMCLEKKLKIEDLIQFYHLYRSIQGLEEWIAERSQVACSNEIGSELEHCILLRERFSEFAIQTNEVGSSRVKDADEMCDKLIALGHQESPEIARWKDRINEAWADLLELIETRIQLLKAAYDFFKFMSDSSELLDLIHEKIRLIPEVVGKDAKSVATAQRKHNAFATEIERLEPLISNALGIADKLLPMYGGEKEQEITDRKIELQKLWFSLQKDYENRHNSLMDASDLYKFYAMVRELVNWMGEIEIQINADDKARDVCGVELIISNHRSLKAEIDSRDENRSICITLGRTLINRKHPKANDVRKKAKEVLIKHFNILENWRERQEFLEMILEVYQFAREAAVAEAWLIAQELQLNTDDFGDTLNETLNLLQKHLDLERNLAVQADRFETLKKLTSFEETQKSLTAEKKREKLKDREKRLELTIREFNTPPPTPEPVRKVEAIKQLSEDIIVPLQSRSVQSAVAIDDSAEAPPKQEVKEKSKENPKLIETKSTTEPKTGTLTRKHEWENSTKKAGNRKWYELYVV--IENSKMSVYKERKYYEDDKKQQTYKHEKPIDLIGAISSPATNYKKRPNVFRMRIQN-GAEYLFEAHDQAEMNQWVEKINEIGGVD-----TSLAKYSTLPNIKSDFEMPVTEA 2304          
BLAST of Spectrin beta chain vs. Planmine SMEST
Match: SMESG000081696.1 (SMESG000081696.1)

HSP 1 Score: 1623.22 bits (4202), Expect = 0.000e+0
Identity = 948/2308 (41.07%), Postives = 1469/2308 (63.65%), Query Frame = 1
Query:  157 LYERFRIKALAGEREKVQKKTFTKWINSHLNKLKQS--IDDLYNXXXXXXXXXXXXXXXXXXXXPYPTKGKMRIHCLENVDKSLNFLIEQRVHLENMGAHDIVDGNARLTLGLIWTIILRFQIQDIVVEEDDTSEKRQAKDALLLWCQMKTAGYPNTNVRNFSTCWRDGLAFNAIIHRHRPDLLEYSALSRSNPNENLEQAIRIAEEKLGIPRLLDPEDVSVENPDEKSIMTYVVTFYHFFSKMKADSVHSKRVGKILSQSMETEEMMVHYDKLTSNLLEWINQTIELLNDRTFANSLSGVQQQLAAFNTYRVTEKPPKFQEKGNLEMLLFSIQSQMRANNQMPYLPIEGKLISDINNAWNKLDKAEHARELALRDELIRQEKLEQLALRFDRKAGMREAWLTENQRLITQDNFGQDLSAVEAAGKKHEAIKTDILAYEERVNSVTLVTSELENECYHDVERVLCRRDNVIRLWEKLLDMLAVRKLRLDACYKVQKLFQDIKHLLDLINDLKARLKTEDIGRHLMGVEDLIHKHSLLEIDIRMVGTKIEGIMSDAQPFINSEFGLGSGDFQPA--DPNEVILRTVNLKEEYDNLLELSRNRKDNLSASKVMWEFLWGVADEEQWMKEKIQLMLNPDLGHDLSSVHRLISKHKVIEEDVRNHSNYLQNVIQG-GQQLILDKNPGAEKVADXXXXXXXX-XXXXXXXXXXRRSKLEQSLAYFHCLADCGEVEIWIIEQVKLVKIDETSINEESIITDIH--KHEQLSKSIEDYESNINSLDEQVKKLSEGDLELVTIEEKVSNIKSQYAILIELTNQKQNKLTDTLSLFRVLRKADTVKTWIDEKEKLLMSLIPTDELEELEVFRHRFDGFEKEMNIQADQVEFVNTLAEKLSDMDHPQIADVVNKRFELNKLWNSLADLVEARREQLQTSYEFNQYLLECKQTGEWIREKSRLVESTDELGDDLAGIMQLQRRMGGMQRDMDAIRAKLEHLDEEMDTLIAKRPNXXXXXXXXXXXXXXFWAELGDMLADRDDRLSESSELQRFLQDLDHIHIWLSKMQTTVASEDLPKDLADAEKSLVQHEQLKEEIDSYQDEFIRLLDYGRRITEDKTDAQYMFLSQRLNALEEGWQELCQMWENRXXXXXXXXXXXVFLRDAIQSEVLLAQEENFLSKEDIPISIENSQNLLRKHEGFLTTLQANHDHTIAVIEFGRNLVERGHFCSDKINLRVKSILXXXXXXXXXXXXAYEKLKDQVLYQELSQDIDDLSKWIQEKMIIATDESFREEKNIARRYNRHRAFDEEIQANKDRLCQAIDYAMQIVEERPQLADMIYPQIDSLNQQWEELEQTTFLKGEKMIEANREAIFEEGTMDVMTWLXXXXXXXXXXXXXXXXX--XXXXXKLKKVEEADNEMEIKRKQIQDLKMHAAKLKEEQPEKAFGIEQKHLILEHRFTQLQMPXXXXXXXXXXXXXXXXFLRNLDDQKAWVDDKLLLAESTNFGNNLLTVQQLLRRHRYLA---TEVNNHKPQLEYLKEEGAVLIEEVSPMQREKFVAGLQELESLWNRLEHSIDLRQQRLKESEATQTFLFDAEEAESWLWEQELFLLSEERGIRDQEAAINVIKKHDARQKTIEDYGEEITKLGTRSRLLIEKDHPQADRIALAQSHVDKVYAGLRDLCLEKKQRLSEIQKLNHLYREIVDLENWIYERTLVASSHDLGVDFEHCCLLRERFDEFFHETHLLGKDRVKAANDLCASLISQCHADSAEIAQWHDRINDSWAELQELMQTRIQLLRTAWEFYKYLSSCQDVLDRICEKIASIPTDVSKDSQSVAIQQRKHATFLSDAQALEGQVQWVVDEANHLLPSYAGQKEWHICERRDDVLATWNQLNMQAERRRHQLEDAADLQRFFSMVRELLQWMDLVALQINEKTRPKDVSGVELLINDHRSIKAEIAAREESMSICVNLGRTLLHRGRVGVDEVRAALINLITRKYSLEDMWEERWDYLQLILEVYQFARDASVAEAWILAQEPYLANKTLGETLDETLSLLKKHINFEKTVMSQEERFEALEKLTTMEIRAKEITKESILLKDKHKQERIENAIKIFQ-PPPSPELVHE------------------SPKVSISEEDEEGKSHQHKISVISKEAAEMCQSSETKTDIRGILIRKHEWEYKNRKALNRSWHEFLVVLSIEKNKLLVYKDEKHY-NEKPQDTYHKDSGLDLNDLVAAPASDYLKRPFVFRIKITSTGAEYLFQAKDEEDMLRWVNSINENSQKDLKSETTAPGKSSTLPACTSDPHVPSTQA 6981
            LYER RIKAL+ +RE VQKKTFTKW+NSHL K K+   +DDL+ DL+DGK LL LLEILSGE++P  TKGK+RIHC+ENV KS+NFL +Q V  EN+GAHDIVDGN  L LGLIWTIILRFQIQD  ++E D   KR +K++LLLWCQMKTAGY N N+RNF++ W+DGLAFNA++H+HRP++++Y  L+++NP ENL  A   AE + G+P+LLD  D+ V+ P+EKSIMTYV +     +K+K +    KR+G ++++++  E+++ +Y++L+  LLEWI   I+ + +     SL GV++QL  F+ YR+TEKPPKFQ++G LEM  F IQS++RA+N+  Y+P EGKLIS IN AW+ L+K+EH  EL L +ELIRQ+KLEQL   F+RKA MR+ WL EN  L+ Q  FG DL  + AA KKHEA++ DI A+EER+N++  +  +L++E Y+ +  V      ++ +W+KLLD L  R+ +LD C  +Q + Q+  +L+D + ++  RL++ D G+HL+GVE+L+ KH +L  DIR     +EG + D      +   L + DF  A  D + V ++   L   Y  L+ LS  R+D L+  KVMWE++  + ++++W+KE IQL  +PD GHDL SV RLI K + I  DV    + + + +     +   D +P  +++     +      + L +   NRR++L QS  +   LAD  + +  I+E+ +L   + + + ++  +T+ +  +HE+    +E+ E  I  L  +   L     +    +E    +K+ +  L++L N +++ L +    F +    +T++TWI  KEKLL++L+P++EL+EL V +HRFD FE +M I + +V   N ++  L +  HP++  +  K+  LN  WN LADL E ++++LQ + ++NQ++LE ++T  WI++K +L+E TD+L DDL GIMQLQRR+G +QRD+ AI AK+++L++E D L   +P DE  I  E   + + W EL  ML DRD RL+ S+ELQ+F +DLD   +WL K+Q  VA++D+PKDL +AE+    H ++KEEI  ++ E++RLL +GR+++  K D QY+  ++RLN LE  W  L +MW+++   L +S   Q F+RD++Q + +L Q+E+FLSK ++P + E ++   R+ E F  ++ +N     AV+ FG +L+   +  SDKI  + + I  R ++ + + +     L+D +L  E S D+  L +W+ EKMIIA+D S+R+ K+I+ RYNR + F+ E++AN++ + + I+   ++++E+P     I P++  L  QW EL  T   K +++ EANRE IF+E T  +M+W+  I   II TEE +E     ++N K+K  E+ D +++ KRK + D++ HA KLKE+ PE+    E     ++ + T+++ P+ +++  L+Q+KR+QQFLR+++D+K W+ +KL     T F     T+Q  L+R R L    TE++NH  ++  L  EG  +I    P   +KF   L EL  LW+ L  + +  QQ  +E+   Q +L +A E E W+ E+E  L+ E++  +D+  A+N ++KH+     I +YG  ++KL  +   ++  D P +  +A  Q  VDK+YA L ++CLEKK ++ ++ +  HLYR I  LE WI ER+ VA S+++G + EHC LLRERF EF  +T+ +G  RVK A+++C  LI+  H +S EIA+W DRIN++WA+L EL++TRIQLL+ A++F+K++S   ++LD I EKI  IP  V KD++SVA  QRKH  F ++ + LE  +   +  A+ LLP Y G+KE  I +R+ ++   W  L    E R + L DA+DL +F++MVREL+ WM  + +QIN   + +DV GVEL+I++HRS+KAEI +R+E+ SIC+ LGRTL++R     ++VR     ++ + +++ + W ER ++L++ILEVYQFAR+A+VAEAW++AQE  L     G+TL+ETL+LL+KH++ E+ +  Q +RFE L+KLT+ E   K +T E    K K +++R+E  I+ F  PPP+PE V +                  S + +++ +D      + ++   SKE  ++ ++  T     G L RKHEWE   +KA NR W+E  VV  IE +K+ VYK+ K+Y ++K Q TY  +  +DL   +++PA++Y KRP VFR++I + GAEYLF+A D+ +M +WV  INE    D     T+  K STLP   SD  +P T+A
Sbjct:   16 LYERSRIKALSEQREAVQKKTFTKWVNSHLMKSKEPYHVDDLFVDLQDGKALLKLLEILSGEKMPPITKGKLRIHCIENVTKSINFLNDQHVCFENLGAHDIVDGNPTLILGLIWTIILRFQIQDAAIDEKDG--KRTSKESLLLWCQMKTAGYNNVNIRNFTSSWKDGLAFNALLHKHRPEVVDYVTLTKANPVENLNFAFETAEREFGVPQLLDARDIIVDQPEEKSIMTYVGSLCLALNKVKRNEKQCKRLGNVINEAISAEKLINNYEELSEELLEWIKLKIDWMENEKLNESLPGVREQLGDFSNYRLTEKPPKFQDRGLLEMNFFEIQSKLRADNRKLYVPPEGKLISAINRAWDNLEKSEHRMELRLYEELIRQQKLEQLGNHFNRKAQMRKDWLIENDILVHQKIFGDDLVTIVAAIKKHEALEGDIFAHEERINALGYIADDLKSENYYKITEVEDCYFMIVEMWKKLLDDLQTRRDKLDRCRDIQMILQETDYLMDWMREITIRLQSRDFGKHLLGVENLLEKHKILLSDIR----NLEGRIDD------TSRKLQTADFDRAAIDQDYVDMKEKQLVNNYQELILLSEQREDELNCYKVMWEYIEDINNDKEWIKEIIQLFQSPDSGHDLRSVERLIRKFEQILSDVTVRKDLIVDKLDSIVHKTSNDPSPQRQEIIHREIDEINELLDNLDQAMRNRRNQLNQSHDFHQLLADIEDADAMILEERRL--FENSDVGDKLSLTEYYLKQHEEQMLQVEELEKLITELFGRKNDLELDSQQQNDADEACERMKNDFEDLVDLANTRKHLLLNNKDKFHLFSNFETIETWIIAKEKLLVTLVPSEELDELNVIKHRFDCFEDDMKIHSGKVSEANQISRDLINEQHPELEIISEKQNILNLDWNQLADLAEQKKKELQLAVDYNQFILESQETQSWIQDKMKLLEWTDDLKDDLEGIMQLQRRLGSLQRDVQAIEAKVKYLNKEADKLKVAKPADEATIDSEITAVNELWEELKIMLQDRDARLNSSNELQKFFKDLDSFDVWLKKVQIQVATQDIPKDLQEAERYCTNHLEVKEEILCWEPEYVRLLQFGRQVSHSKDDPQYLLFNERLNVLENEWNALEKMWKDKDVSLHESKDAQTFIRDSLQIDGILTQQESFLSKSELPNNYEATKATEREFEAFKNSVASNKPKIDAVVNFGESLLA-SNALSDKIRNKCEQIHSRCDAIQDKIDRRNSALQDHLLLLEFSDDVLALEEWMSEKMIIASDTSYRDTKDISTRYNRFKDFERELEANRESVDEVIEKGNKLIDEKPHFESEIEPKVVELENQWSELLNTATEKSKQLEEANREIIFDETTKSMMSWVTEISSQIITTEEIIEEYGLVELNEKMKDQEDKDKQLDQKRKMLSDIEQHAEKLKEQYPERGDEFELIQQEVKVKLTEIEAPLTDRRNILLQKKRVQQFLRDVEDEKEWIREKLEFI--TKFKIAPETLQVCLQRIRRLKTNNTEIDNHAGRITDLNNEGEEMIRNDFP-SSDKFNIALDELNKLWDDLITACEDCQQFFEENREVQEYLSEAIECEYWMSEREFDLMREDKA-KDEGGALNAMRKHEELISVINNYGSIVSKLADKYHHILNCDLPGSHLVAQKQERVDKMYADLLEMCLEKKLKIEDLIQFYHLYRSIQGLEEWIAERSQVACSNEIGSELEHCILLRERFSEFAIQTNEVGSSRVKDADEMCDKLIALGHQESPEIARWKDRINEAWADLLELIETRIQLLKAAYDFFKFMSDSSELLDLIHEKIRLIPEVVGKDAKSVATAQRKHNAFATEIERLEPLISNALGIADKLLPMYGGEKEQEITDRKIELQKLWFSLQKDYENRHNSLMDASDLYKFYAMVRELVNWMGEIEIQINADDKARDVCGVELIISNHRSLKAEIDSRDENRSICITLGRTLINRKHPKANDVRKKAKEVLIKHFNILENWRERQEFLEMILEVYQFAREAAVAEAWLIAQELQLNTDDFGDTLNETLNLLQKHLDLERNLAVQADRFETLKKLTSFEETQKSLTAEKKREKLKDREKRLELTIREFNTPPPTPEPVRKVEAIKQLSEDIIVPLQSRSVQSAVAIDDSAEAPPKQEVKEKSKENPKLIETKSTTEPKTGTLTRKHEWENSTKKAGNRKWYELYVV--IENSKMSVYKERKYYEDDKKQQTYKHEKPIDLIGAISSPATNYKKRPNVFRMRIQN-GAEYLFEAHDQAEMNQWVEKINEIGGVD-----TSLAKYSTLPNIKSDFEMPVTEA 2296          
BLAST of Spectrin beta chain vs. Planmine SMEST
Match: SMESG000039799.1 (SMESG000039799.1)

HSP 1 Score: 1295.8 bits (3352), Expect = 0.000e+0
Identity = 808/2094 (38.59%), Postives = 1258/2094 (60.08%), Query Frame = 1
Query:  154 KLYERFRIKALAGEREKVQKKTFTKWINSHLNKLKQSIDDLYNXXXXXXXXXXXXXXXXXXXXPYPTKGKMRIHCLENVDKSLNFLIEQRVHLENMGAHDIVDGNARLTLGLIWTIILRFQIQDIVVEEDDTSEKRQAKDALLLWCQMKTAGYPNTNVRNFSTCWRDGLAFNAIIHRHRPDLLEYSALSRSNPNENLEQAIRIAEEKLGIPRLLDPEDVSVENPDEKSIMTYVVTFYHFFSKMKADSVHSKRVGKILSQSMETEEMMVHYDKLTSNLLEWINQTIELLNDRTFANSLSGVQQQLAAFNTYRVTEKPPKFQEKGNLEMLLFSIQSQMRANNQMPYLPIEGKLISDINNAWNKLDKAEHARELALRDELIRQEKLEQLALRFDRKAGMREAWLTENQRLITQDNFGQDLSAVEAAGKKHEAIKTDILAYEERVNSVTLVTSELENECYHDVERVLCRRDNVIRLWEKLLDMLAVRKLRLDACYKVQKLFQDIKHLLDLINDLKARLKTEDIGRHLMGVEDLIHKHSLLEIDIRMVGTKIEGIMSDAQPFIN-------SEFGLGSGDFQPADPNEVILRTVNLKEEYDNLLELSRNRKDNLSASKVMWEFLWGVADEEQWMKEKIQLMLNPDLGHDLSSVHRLISKHKVIEEDVRNHSNYLQNVIQGGQQLILDKNP-GAEKVADXXXXXXXXXXXXXXXXXXRRSKLEQSLAYFHCLADCGEVEIWIIEQVKLVKI----DETSINEESIITDIHKHEQLSKSIEDYESNINSLDEQVKK-LSEGDLELVTIEEKVSNIKSQYAILIELTNQKQNKLTDTLSLFRVLRKADTVKTWIDEKEKLLMSLIPTDELEELEVFRHRFDGFEKEMNIQADQVEFVNTLAEKLSDMDHPQIADVVNKRFELNKLWNSLADLVEARREQLQTSYEFNQYLLECKQTGEWIREKSRLVESTDELGDDLAGIMQLQRRMGGMQRDMDAIRAKLEHLDEEMDTLIAKRPNXXXXXXXXXXXXXXFWAELGDMLADRDDRLSESSELQRFLQDLDHIHIWLSKMQTTVASEDLPKDLADAEKSLVQHEQLKEEIDSYQDEFIRLLDYGRRITEDKTDA-QYMFLSQRLNALEEGWQELCQMWENRXXXXXXXXXXXVFLRDAIQSEVLLAQEENFLSKEDIPISIEN----SQNLL------RKHEGFLTTLQANHDHTIAVIEFGRNLVERGHFCSDKINLRVKSILXXXXXXXXXXXXAYEKLKDQVLYQELSQDIDDLSKWIQEKMIIATDESFREEKNIARRYNRHRAFDEEIQANKDRLCQAIDYAMQIVEERPQLADMIYPQIDSLNQQWEELEQTTFLKGEKMIEANREAIFEEGTMDVMTWLXXXXXXXXXXXX---XXXXXXXXXXKLKKVEEADNEMEIKRKQIQDLKMHAAKLKEEQPEKAFGIEQKHLILEHRFTQLQMPXXXXXXXXXXXXXXXXFLRNLDDQKAWVDDKLLL----AESTNFGNNLLTVQQLLRRHRYLATEVNNHKPQLEYLKEEGAVLIEEVSPMQREKFVAGLQELESLWNRLEHSIDLRQQRLKESEATQTFLFDAEEAESWLWEQELFLLSEERGIRDQEAAINVIKKHDARQKTIEDYGEEITKLGTRSRLLIEKDHPQADRIALAQSHVDKVYAGLRDLCLEKKQRLSEIQKLNHLYREIVDLENWIYERTLVASSHDLGVDFEHCCLLRERFDEFFHETHLLGKDRVKAANDLCASLISQCHADSAEIAQWHDRINDSWAELQELMQTRIQLLRTAWEFYKYLSSCQDVLDRICEKIAS--IPTDVSKDSQSVAIQQRKHATFLSDAQALEGQVQWVVDEANHLLPSYAGQKEWHICERRDDVLATWNQLNMQAERRRHQLEDAADLQRFFSMVRELLQWMDLVALQINEKTRPKDVSGVELLINDHRSIKAEIAAREESMSICVNLGRTLLHRGRVGVDEVRAALINLITRKYSLEDMWEERWDYLQLILEVYQFARDASVAEAWILAQEPYLANKTLGETLDETLSLLKKHINFEKTVMSQEERFEALEKLTTMEIRAKEIT 6336
            K++ER RIKALA ERE VQKKTFTKWINS L  +   I+DLY DL+DGK LL LLE+LS E +P PT+G+MRIHCLENVDK L FL  Q+VHLEN+GAHDIVDGN RLTLGLIWTIILRFQ+QDI  +ED +   + AKDALLLWCQMKTAGYP+ N+RNF+  WR GL F A+IH+HRPDL+++S+ +R++   NL  A  IAE  LGIP LLDPEDV+V  PDE+S++TYV ++YH+F+ +KA SV +KR+ K+L+Q +E E+M+  Y  L S LLEWI  TI LLN R F+NS+ G+QQQ+  FN YR  EKP KF EK +LE+LLF+I+S    +    Y P E   +S IN+AW++L+ AE+ RE ALR EL+RQEKL  LA +F++KA +RE+W+T+N  L+ + + G +L  V AA KKHEAI+TDI AYEE +  +T ++  LE E Y+D+  ++  ++ V+ LW+KLL  L  R+  LD   +V  L  +   +  +I  + A+ + ++ G+HLM VE+L+  H L+E DIR +  ++E ++S+A  ++        S    G+        N  I       +++  LL+    RK+ L  S ++W+F+   + EEQW+KE + +M NPDLG+DLSSV RL+ KHKV E ++ +    L+N +  G+ L+ D +P G E +A    +++ LW  L++ TE+R+ KL + L Y+  ++DC + E WI E  +L  +    D+ S  E      I K++Q  + +E+Y  NI  +  Q +  L    ++  T+ +K+  I+ +Y  L+++ ++ Q KL D L+++R+L  +D+V++WI EK+K L + IP+D++EELEV +HRF+ FE E+  +A++V  VN L+E L    +P    +VN +  LN  WN +AD+V+++R++L + Y ++ + ++C+QT EWIREK +L+ES DELG+DL  +MQ QRR+  MQRD+ AI AK++HL  + D ++       + I  +  ++   W  L  ++ DRD  L+  +++ RF+Q LD  H WL +MQT +AS+++P+  ++AEK + ++   ++E+ + + +    +  G+   + + D  Q++ L  R+ ++ + W+ L  + E ++  L + L   +F  DA Q E +L  +E +L K DI   I N      NLL       ++E F+  + ++      V++ G+ L+   +   D++  + +++ ER + N   +     KLK+QVL  EL QDIDDL   + EK+ +  + S    K+      + +A ++EI A +  + +      Q   + P     I   +D+LN  W EL +    K + +   NRE +FEE T  +M WL+ I   I+  +E       +T +  +LKK++  + E+E K+K +++LK H+  LK++ P+KA   EQ    ++     L +P+++K     Q+   +QFL++ DD+  W+++K+ L    ++       LL  QQL  RH+ +  E+ N   +++ L +E   +I+E + ++R   V  + +L+     L   ++  Q  L    A Q FL D  E  SW+ E+EL L+      +D +    VI+K    +  I++Y  +I +       L     P+  +  +    V+  +  L+ +C EKK  +S        Y    ++E WI ERT +A S D G D + C LLR+RF  F  ET+ +G  +V  AN     LI   H  +  I+ W DRIN+ WA+L EL+ TRIQLL++AW+ +++    Q +L+ I EK +S  +  D+ KD +SV + QRK   F  D   L+  +   +  +N LLP Y   KE  + ++R +++  +  L    E R+    + AD   F SMVRELL W++ V +Q+  + +P+DVSG+ELL+ +HRS+K E+ ++EE+ SIC+NLGRTLL    +   E+++    +  ++  L   W    D+L L++EVYQ+ARDA+ AEAW+++QE YL N+ LG TLDETL+LLKK I F+K  M+QEE+FE L++LTTMEIR+K++ 
Sbjct:   38 KVFERSRIKALADERENVQKKTFTKWINSTLIHVTMKIEDLYVDLRDGKFLLALLELLSNEIVPKPTRGRMRIHCLENVDKCLGFLFNQKVHLENVGAHDIVDGNPRLTLGLIWTIILRFQVQDIQFDEDYSPVAKSAKDALLLWCQMKTAGYPSVNIRNFTNSWRTGLGFVALIHKHRPDLIDFSSCNRNDNINNLHLAFDIAENALGIPSLLDPEDVNVPLPDERSVITYVASYYHYFNSLKASSVLNKRLNKLLNQVLEDEQMIQLYQSLVSKLLEWIRNTIRLLNMRQFSNSIPGIQQQMNTFNLYRTGEKPSKFVEKVDLEVLLFTIKSNQFVSRLKVYNPPEEFSLSTINSAWDELNTAEYGRETALRKELMRQEKLRNLAQKFNKKAALRESWITDNMELLQKQSLGNNLPTVLAALKKHEAIETDIYAYEENLIGLTKISDNLEEEIYNDIISIINTKNKVLDLWKKLLQTLHERREHLDNYLQVYTLINEFCEVQAIITGITAKQRIDNYGKHLMEVEELLRSHELIESDIRSINQRLEKLISEANRYVQFCDQDFRSNINSGNKAMIKEKRNSTI-------KDFHELLDSLDKRKEILKHSHLVWQFIVDASLEEQWIKELVDIMNNPDLGYDLSSVDRLLRKHKVFELELSSKRISLENKLMEGKTLV-DISPVGQEFIAAKNNDIQNLWEALVDSTESRKIKLLEMLDYYQYVSDCDDAECWIDEFKRLFDLKFLGDKMSFTE----ILIRKNQQNMEIVENYRDNIEQIRNQAQSLLGYSIVDHQTVAKKLDRIEKKYQDLLDIAHKMQEKLLDALTVYRLLNDSDSVRSWITEKQKFLCNFIPSDDIEELEVLKHRFEVFESELTKRAEKVYHVNNLSENLVVNGNPNHQIIVNNQDNLNNSWNKMADIVDSKRDELLSKYHYSNFFMDCQQTIEWIREKIKLIESMDELGEDLESVMQRQRRINHMQRDICAIEAKIDHLVAQGDEILRHNLRSAKDIEHQLDLVHQEWEILQQLIRDRDSTLANKNDIHRFIQKLDDFHNWLGQMQTEMASQNIPESQSEAEKLINKYNSQRDEMAAMEQQLEEWMKIGKDFLKSEQDKDQFVRLQNRIESINQDWKILNDLSEEKEKRLEKYLKSLMFFEDARQIEKILNAQEKYLMK-DIQSLINNFNTSKSNLLSLNEIVNENEIFIDKMLSDEKLLAIVLKQGKTLILENNLYKDRMQNKCQNLDERWKKNTLAAQNRKNKLKEQVLLHELLQDIDDLDDSLLEKIQVLNEISMLNNKSTDSCLAQCKALEDEINAYRPIIEELNKRGKQTSADFPHFKKEIIDHLDNLNSTWAELSKALEEKLQNLAHFNREKLFEESTQSMMKWLKNIEGQIVADDEPDGSRSGITSITNQLKKLDSHNMELENKKKLLENLKDHSELLKQQNPDKASKYEQLETQVKVTMDGLSVPLESKLSIANQKIIAEQFLQDCDDEIDWMNEKIDLIRNRSKQMETICTLLQFQQLQMRHKSMKNEIRNRSVKVDSLIQEAQRMIDE-NHLKRALVVDTINQLKKTRENLNEEMEKFQNMLSNQLAVQEFLLDVSEVSSWISEKELDLMGLIINSKDDQLIRRVIRKEQNLEMEIKNYYPKIEEFKKSCVSL-----PEEYKGIVKD--VEDNFNSLKIICAEKKTEISLFVIYCDTYELYQNIEAWIVERTKIARSDDSGKDLDQCTLLRDRFAIFSSETNKIGSSKVNEANKRFDELIQGKHPFAHSISVWKDRINEIWADLLELIDTRIQLLKSAWDLHRWYCDSQFLLECIQEKKSSMEVVNDLGKDPKSVCLLQRKLKNFEKDLLKLDSDINNAITVSNTLLPLYCKDKEATLIKKRQELIDAFRSLRKILEDRKLNNLELADFHNFLSMVRELLHWIEEVTIQMEMRHKPRDVSGIELLLANHRSLKIEMDSKEENFSICLNLGRTLLRTKHIRSPEIKSKCKEITDKRDILFQKWFNVLDHLSLMVEVYQWARDAASAEAWVISQESYLNNENLGMTLDETLALLKKFILFQKANMNQEEKFEQLKRLTTMEIRSKKLN 2110          

HSP 2 Score: 128.642 bits (322), Expect = 4.539e-29
Identity = 71/211 (33.65%), Postives = 119/211 (56.40%), Query Frame = 1
Query: 6352 LKDKHKQERIENAIKIFQPPPSPELVHESPKVSISEEDEEGKSHQ--HKISVISKEAAEMCQSSETKTD------IRGILIRKHEWEYKNRKALNRSWHEFLVVLSIEKNKLLVYKDEKHYNEKPQDTYHKDSGLDLNDLVAAPASDYLKRPFVFRIKITSTGAEYLFQAKDEEDMLRWVNSINENSQ--KDLKSETTAPGKSSTLPACTS 6954
            +KD    +++ +   + +P P    +   P++  S+  +     +  H +SV +   +   + + T+T       ++G L RKH+WE +N+KA NR+WH   V+LS  ++++  +KDE+H+ EKP+  Y  +  L L ++VAAPA DYLKRP VFR++  + GAEYLFQ     DM RWV++IN  S+  + +    T P  + + P  +S
Sbjct: 2178 IKDTGYFQKVNSRQSMMRPFPQSSALSPVPQMKQSKRPQPSNMSKPVHNLSVSTDMLSASPKPATTRTIPPEEVLMKGPLYRKHQWENRNQKASNRTWHSLYVLLS--QSRMTFFKDERHFKEKPKQFYKHEMPLVLCEVVAAPAQDYLKRPCVFRVRFRN-GAEYLFQGSSVVDMTRWVDAINSASRPMRQVNPSNTNPSTTQSHPNLSS 2385          
The following BLAST results are available for this feature:
BLAST of Spectrin beta chain vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SPTBN10.000e+043.62spectrin beta, non-erythrocytic 1 [Source:HGNC Sym... [more]
SPTBN10.000e+043.58spectrin beta, non-erythrocytic 1 [Source:HGNC Sym... [more]
SPTBN10.000e+045.54spectrin beta, non-erythrocytic 1 [Source:HGNC Sym... [more]
SPTB0.000e+040.64spectrin beta, erythrocytic [Source:HGNC Symbol;Ac... [more]
SPTB0.000e+040.64spectrin beta, erythrocytic [Source:HGNC Symbol;Ac... [more]
back to top
BLAST of Spectrin beta chain vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc-700.000e+043.98Spectrin beta chain [Source:UniProtKB/TrEMBL;Acc:... [more]
unc-700.000e+044.16Spectrin beta chain [Source:UniProtKB/TrEMBL;Acc:... [more]
unc-700.000e+043.92Spectrin beta chain [Source:UniProtKB/TrEMBL;Acc:... [more]
unc-700.000e+043.95Spectrin beta chain [Source:UniProtKB/TrEMBL;Acc:... [more]
sma-12.922e-15240.00SMAll [Source:UniProtKB/TrEMBL;Acc:G5EFW3][more]
back to top
BLAST of Spectrin beta chain vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
beta-Spec0.000e+044.95gene:FBgn0250788 transcript:FBtr0334404[more]
beta-Spec0.000e+045.05gene:FBgn0250788 transcript:FBtr0074454[more]
beta-Spec1.034e-746.77gene:FBgn0250788 transcript:FBtr0334405[more]
kst1.059e-15741.45gene:FBgn0004167 transcript:FBtr0303857[more]
kst1.059e-15741.45gene:FBgn0004167 transcript:FBtr0073070[more]
back to top
BLAST of Spectrin beta chain vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sptbn10.000e+042.79spectrin, beta, non-erythrocytic 1 [Source:ZFIN;Ac... [more]
sptbn10.000e+044.63spectrin, beta, non-erythrocytic 1 [Source:ZFIN;Ac... [more]
sptbn22.044e-1644.10spectrin, beta, non-erythrocytic 2 [Source:ZFIN;Ac... [more]
sptb0.000e+040.84spectrin, beta, erythrocytic [Source:ZFIN;Acc:ZDB-... [more]
sptb0.000e+040.84spectrin, beta, erythrocytic [Source:ZFIN;Acc:ZDB-... [more]
back to top
BLAST of Spectrin beta chain vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SPTBN10.000e+043.21spectrin beta, non-erythrocytic 1 [Source:HGNC Sym... [more]
SPTBN10.000e+044.17spectrin beta, non-erythrocytic 1 [Source:HGNC Sym... [more]
SPTBN10.000e+044.10spectrin beta, non-erythrocytic 1 [Source:HGNC Sym... [more]
SPTBN10.000e+044.27spectrin beta, non-erythrocytic 1 [Source:HGNC Sym... [more]
SPTBN10.000e+043.07spectrin beta, non-erythrocytic 1 [Source:HGNC Sym... [more]
back to top
BLAST of Spectrin beta chain vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Sptbn16.152e-3945.70spectrin beta, non-erythrocytic 1 [Source:MGI Symb... [more]
Sptbn10.000e+045.54spectrin beta, non-erythrocytic 1 [Source:MGI Symb... [more]
Sptb0.000e+041.15spectrin beta, erythrocytic [Source:MGI Symbol;Acc... [more]
Sptbn21.564e-1342.52spectrin beta, non-erythrocytic 2 [Source:MGI Symb... [more]
Sptb3.954e-2542.79spectrin beta, erythrocytic [Source:MGI Symbol;Acc... [more]
back to top
BLAST of Spectrin beta chain vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q00963|SPTCB_DROME0.000e+045.05Spectrin beta chain OS=Drosophila melanogaster OX=... [more]
sp|Q01082|SPTB2_HUMAN0.000e+043.62Spectrin beta chain, non-erythrocytic 1 OS=Homo sa... [more]
sp|Q9QWN8|SPTN2_RAT2.969e-1142.51Spectrin beta chain, non-erythrocytic 2 OS=Rattus ... [more]
sp|O15020|SPTN2_HUMAN2.750e-1042.72Spectrin beta chain, non-erythrocytic 2 OS=Homo sa... [more]
sp|P11277|SPTB1_HUMAN2.610e-1742.44Spectrin beta chain, erythrocytic OS=Homo sapiens ... [more]
back to top
BLAST of Spectrin beta chain vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A075A6I10.000e+051.09Spectrin beta chain OS=Opisthorchis viverrini OX=6... [more]
A0A419PFY30.000e+051.01Spectrin beta chain OS=Clonorchis sinensis OX=7992... [more]
A0A4S2LQ900.000e+051.05Spectrin beta chain OS=Opisthorchis felineus OX=14... [more]
A0A4S2LQP20.000e+051.05Spectrin beta chain OS=Opisthorchis felineus OX=14... [more]
A0A1S8X3X00.000e+050.96Spectrin beta chain OS=Opisthorchis viverrini OX=6... [more]
back to top
BLAST of Spectrin beta chain vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000030945.10.000e+044.06spectrin beta chain, non-erythrocytic 1-like [Sour... [more]
ENSAMXT00000009444.20.000e+043.91spectrin beta chain, non-erythrocytic 1-like [Sour... [more]
SPTBN10.000e+045.06spectrin beta, non-erythrocytic 1 [Source:HGNC Sym... [more]
sptbn20.000e+042.25spectrin beta chain, non-erythrocytic 1-like [Sour... [more]
sptbn20.000e+042.08spectrin beta chain, non-erythrocytic 1-like [Sour... [more]
back to top
BLAST of Spectrin beta chain vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000008111.10.000e+043.27pep scaffold:Pmarinus_7.0:GL478136:8967:48859:1 ge... [more]
ENSPMAT00000001834.13.675e-2746.81pep scaffold:Pmarinus_7.0:GL482425:158920:175005:1... [more]
ENSPMAT00000004049.11.473e-651.40pep scaffold:Pmarinus_7.0:GL476488:489896:554954:1... [more]
ENSPMAT00000000684.17.869e-11643.51pep scaffold:Pmarinus_7.0:GL483163:49540:93186:-1 ... [more]
ENSPMAT00000009295.14.571e-11243.18pep scaffold:Pmarinus_7.0:GL479988:2885:20778:1 ge... [more]
back to top
BLAST of Spectrin beta chain vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
SAC69.951e-730.19Fimbrin, actin-bundling protein; cooperates with S... [more]
back to top
BLAST of Spectrin beta chain vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO424310.000e+040.91Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO495761.043e-17240.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
ALPHA-ACTININ1.675e-11444.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO291011.062e-11050.97Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO495751.006e-10925.83Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Spectrin beta chain vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sptbn10.000e+042.81spectrin beta chain, non-erythrocytic 1-like [Sour... [more]
SPTBN11.082e-1645.37spectrin beta chain, non-erythrocytic 1 [Source:NC... [more]
sptbn20.000e+042.41spectrin beta chain, non-erythrocytic 1 [Source:NC... [more]
sptbn20.000e+042.56spectrin beta chain, non-erythrocytic 1 [Source:NC... [more]
sptbn22.294e-1544.08spectrin beta chain, non-erythrocytic 1 [Source:NC... [more]
back to top
BLAST of Spectrin beta chain vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000066485.10.000e+099.70SMESG000066485.1[more]
SMESG000035098.10.000e+051.34SMESG000035098.1[more]
SMESG000081696.10.000e+041.16SMESG000081696.1[more]
SMESG000081696.10.000e+041.07SMESG000081696.1[more]
SMESG000039799.14.539e-2938.59SMESG000039799.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30028311 ID=SMED30028311|Name=Spectrin beta chain|organism=Schmidtea mediterranea sexual|type=transcript|length=7439bp
TCCGATCTTTGTAATAACAATTAATATCGTTCTTTGACTTTTAAGACAAT
AATGGCCGATGTTGCTTATACATTGCCGTGGAGTAATGGAACTGGGGACA
CTAATGGTAATATTACTACTGATGATGAATGGGATACCGAGGATAGTACC
TCGAAATTATATGAAAGATTTAGAATAAAAGCGTTAGCTGGTGAAAGAGA
AAAAGTTCAGAAAAAAACTTTTACGAAATGGATAAATTCTCATTTAAATA
AATTAAAACAGTCTATAGATGATTTATATAATGATCTTAAAGACGGAAAA
ATGTTATTGCTTTTACTGGAGATTTTATCTGGGGAACAGTTGCCGTATCC
AACAAAAGGAAAAATGAGAATACACTGTTTAGAAAATGTTGACAAGTCTT
TAAATTTTTTAATAGAACAGAGAGTTCATTTGGAAAATATGGGCGCACAC
GATATTGTGGATGGGAATGCCCGACTGACGCTTGGACTAATATGGACCAT
TATTCTCAGATTTCAAATTCAAGACATTGTCGTTGAAGAAGACGATACTT
CGGAAAAAAGACAAGCTAAAGACGCTCTTTTACTTTGGTGTCAAATGAAA
ACTGCAGGATATCCAAATACGAATGTCAGAAACTTTTCAACTTGTTGGCG
AGATGGGTTAGCCTTTAATGCCATTATCCATCGGCATCGACCTGATCTAC
TCGAATACTCTGCTTTATCTCGAAGTAATCCAAACGAAAATCTCGAGCAA
GCCATTAGAATTGCAGAAGAGAAACTTGGAATTCCTCGACTGCTGGATCC
CGAAGATGTCAGTGTGGAAAATCCCGACGAAAAGTCCATCATGACCTATG
TCGTTACTTTCTATCATTTCTTTTCCAAAATGAAAGCCGACTCGGTTCAT
TCGAAACGAGTTGGTAAAATACTGTCACAATCCATGGAGACTGAAGAAAT
GATGGTCCATTATGATAAATTGACATCAAATCTTTTAGAATGGATCAATC
AGACAATTGAGTTGCTAAACGATCGTACTTTTGCTAATAGTTTATCCGGT
GTACAACAACAACTGGCTGCCTTCAACACATACCGAGTGACAGAAAAACC
ACCTAAATTCCAAGAAAAAGGCAATCTGGAAATGCTTTTGTTCTCTATTC
AAAGTCAAATGAGAGCCAACAATCAAATGCCTTATTTGCCAATCGAAGGG
AAGTTAATCTCGGACATTAATAATGCTTGGAATAAATTAGACAAAGCTGA
ACATGCTAGAGAATTGGCTTTGCGAGACGAATTAATTCGACAAGAAAAAC
TCGAACAATTAGCATTGAGATTTGACAGAAAAGCTGGGATGAGAGAAGCC
TGGTTAACGGAAAATCAACGATTAATAACTCAAGATAATTTTGGTCAGGA
TTTATCGGCTGTCGAAGCTGCTGGAAAGAAACACGAAGCAATAAAAACCG
ATATTTTAGCATACGAAGAACGAGTTAACTCCGTGACTTTGGTAACTAGT
GAGCTGGAGAATGAATGCTATCACGACGTTGAAAGAGTTCTCTGCCGAAG
AGACAATGTTATTAGATTATGGGAAAAACTTTTGGATATGCTCGCAGTTA
GAAAATTGAGATTAGATGCTTGCTACAAAGTTCAAAAACTATTTCAAGAC
ATCAAGCACTTGCTTGACTTAATAAATGATTTGAAAGCTAGATTAAAAAC
TGAAGATATCGGTCGACATTTAATGGGTGTTGAAGATTTAATTCATAAGC
ATTCTCTTTTGGAAATAGATATCCGAATGGTTGGAACGAAAATTGAAGGG
ATTATGAGCGATGCACAGCCATTCATTAACAGTGAATTTGGACTCGGTTC
GGGGGATTTTCAACCGGCTGATCCCAATGAAGTCATTTTGCGAACAGTAA
ATTTAAAAGAAGAATATGACAATTTATTGGAGCTGTCAAGAAATCGAAAA
GACAACTTGAGTGCATCGAAAGTCATGTGGGAATTCTTATGGGGTGTCGC
TGATGAAGAACAATGGATGAAAGAGAAAATACAATTGATGTTGAATCCTG
ATCTCGGTCACGATTTGTCAAGTGTTCATAGGCTGATAAGCAAGCACAAA
GTCATTGAAGAGGATGTTAGAAATCATTCAAATTATCTTCAAAACGTTAT
CCAAGGAGGGCAGCAGTTAATTTTGGATAAAAACCCAGGAGCAGAAAAAG
TGGCGGACAATTTAAAAGAACTGGAACTTTTATGGAATGAGCTTATTGAA
CTCACGGAAAATCGCCGATCGAAACTTGAACAATCTCTTGCATATTTTCA
TTGTTTAGCTGACTGCGGTGAAGTTGAGATCTGGATTATTGAGCAAGTAA
AATTGGTGAAAATTGATGAAACGAGCATCAACGAAGAGTCAATAATAACC
GATATCCACAAACATGAGCAACTGTCAAAATCTATAGAAGATTACGAAAG
CAACATTAATTCACTTGATGAACAAGTGAAAAAATTATCCGAAGGTGACT
TGGAATTGGTGACAATTGAAGAAAAGGTCTCAAATATCAAAAGCCAATAC
GCAATTTTAATTGAACTAACCAATCAAAAGCAAAACAAACTCACAGACAC
GCTATCTCTATTCAGAGTTCTCCGAAAAGCGGACACAGTGAAAACTTGGA
TAGATGAAAAAGAAAAACTTCTAATGTCATTAATTCCAACAGATGAACTG
GAAGAACTTGAAGTGTTCCGGCATCGATTTGACGGTTTCGAGAAAGAAAT
GAATATCCAAGCCGATCAAGTGGAATTTGTGAACACATTAGCCGAGAAAC
TTTCCGATATGGATCATCCTCAAATTGCCGATGTCGTTAATAAACGGTTT
GAATTAAATAAATTATGGAATTCCCTAGCAGATTTAGTTGAAGCTCGTCG
AGAACAACTACAAACCTCATACGAATTCAATCAGTATCTGTTGGAGTGCA
AACAAACCGGTGAATGGATCCGTGAAAAATCAAGATTAGTAGAATCGACA
GACGAGTTAGGCGATGATCTTGCCGGAATCATGCAACTACAACGAAGAAT
GGGAGGAATGCAAAGAGACATGGACGCAATTCGAGCTAAATTGGAGCATT
TGGATGAAGAAATGGACACTTTAATTGCAAAACGACCTAACGATGAAGAA
TTAATTAGAGAAGAAAGAATGATATTGGAAGATTTTTGGGCTGAATTAGG
AGACATGCTGGCAGATCGAGATGATAGATTATCAGAATCATCAGAATTAC
AAAGATTTCTTCAGGATTTGGATCATATTCATATATGGCTCAGTAAGATG
CAAACTACCGTTGCTTCAGAAGATTTGCCGAAAGATTTAGCAGACGCCGA
AAAATCTTTGGTTCAACATGAACAGTTAAAAGAAGAAATAGATTCATACC
AAGACGAGTTTATTCGATTGCTTGATTATGGTCGTCGAATAACTGAGGAT
AAAACCGATGCGCAATACATGTTTTTAAGCCAGAGATTAAATGCTCTCGA
AGAAGGTTGGCAAGAGTTATGCCAAATGTGGGAAAACAGACAAGGACTTC
TTTCTCAAAGTCTTTCACTTCAAGTCTTTCTTCGAGATGCAATCCAATCG
GAAGTATTGTTAGCTCAAGAAGAAAATTTTCTCAGTAAAGAAGACATACC
AATATCCATTGAAAATTCCCAAAATCTTTTGCGTAAACACGAAGGATTTC
TAACAACTTTACAAGCCAATCACGATCACACAATAGCAGTCATTGAATTT
GGTCGGAATTTGGTAGAAAGAGGTCATTTTTGCAGCGACAAAATTAACTT
GAGAGTAAAATCTATTCTGGAACGACGAGAATCAAACAAACGAAGATCAA
ATGAAGCGTATGAGAAATTGAAAGATCAGGTTCTTTATCAAGAATTAAGT
CAAGACATTGACGATCTCAGTAAATGGATCCAAGAGAAAATGATTATAGC
AACTGATGAAAGTTTCAGAGAGGAAAAAAATATTGCTCGCCGATACAATA
GACACAGGGCTTTCGACGAGGAAATACAAGCTAATAAAGATAGGTTATGC
CAGGCTATTGATTATGCAATGCAAATAGTTGAAGAACGGCCACAACTTGC
AGATATGATTTATCCACAAATAGACTCATTGAATCAACAGTGGGAAGAAT
TAGAACAAACTACTTTTTTGAAAGGAGAAAAAATGATTGAAGCTAACAGA
GAAGCAATATTTGAAGAAGGAACAATGGATGTTATGACTTGGCTAGAGAC
CATTGGTGAGTCTATTATCGTAACCGAAGAAGAAGTTGAAACATTGACTG
ACGTAAATGTTAAACTGAAAAAGGTTGAAGAGGCAGACAATGAAATGGAA
ATAAAAAGAAAACAAATTCAAGATTTAAAAATGCACGCAGCGAAGCTTAA
AGAAGAGCAACCAGAAAAGGCATTTGGGATAGAACAAAAACACTTGATAC
TTGAACACAGATTCACACAGTTGCAAATGCCAATCAAAAATAAAAAAATT
CAACTTATTCAACGAAAAAGAATTCAACAATTTCTCAGAAATTTGGATGA
TCAAAAAGCTTGGGTTGATGATAAACTTTTGCTGGCAGAGTCGACAAATT
TTGGAAATAACCTACTAACGGTTCAGCAGCTTCTACGAAGGCATCGCTAT
CTGGCAACAGAAGTAAACAATCACAAGCCGCAATTGGAATATTTAAAAGA
AGAAGGTGCTGTGTTGATTGAAGAAGTTTCACCAATGCAAAGAGAAAAAT
TTGTTGCCGGTCTACAAGAATTAGAAAGTTTGTGGAATAGGTTAGAACAT
TCGATTGATCTTCGACAACAACGACTGAAAGAGAGTGAGGCAACGCAGAC
CTTTTTATTTGATGCAGAAGAAGCGGAATCTTGGCTTTGGGAACAGGAAT
TGTTTTTGTTATCTGAAGAACGTGGAATTAGAGATCAAGAAGCTGCAATA
AATGTGATCAAAAAGCACGATGCTCGTCAAAAAACCATTGAAGATTACGG
TGAAGAAATTACAAAACTTGGCACTAGGAGTCGCCTTTTAATTGAAAAAG
ATCATCCTCAAGCTGATAGAATAGCATTGGCTCAAAGCCATGTGGATAAA
GTTTACGCCGGGCTAAGAGACCTTTGCTTAGAAAAGAAGCAGCGCTTATC
AGAGATTCAGAAATTGAATCATCTTTACAGGGAAATTGTCGATTTAGAGA
ATTGGATCTATGAAAGGACACTAGTTGCTAGCAGTCATGATTTGGGAGTG
GATTTTGAACACTGTTGCCTACTGAGAGAAAGATTTGATGAATTTTTCCA
TGAGACCCATTTGCTTGGTAAAGATCGTGTTAAGGCTGCAAATGATTTAT
GCGCATCATTAATAAGCCAGTGCCATGCAGACAGTGCTGAAATTGCTCAA
TGGCATGATCGGATTAATGACAGTTGGGCAGAACTACAAGAGCTCATGCA
AACTAGAATACAATTATTGCGAACTGCCTGGGAATTTTATAAATATCTAT
CTAGTTGTCAGGATGTTTTAGACAGAATCTGTGAGAAAATTGCTAGCATT
CCGACAGATGTAAGCAAAGATTCACAGTCAGTTGCCATTCAACAACGTAA
GCATGCCACTTTTCTCAGTGATGCTCAAGCTTTAGAAGGCCAAGTTCAAT
GGGTAGTGGACGAAGCGAATCACTTATTGCCATCTTACGCGGGTCAGAAG
GAATGGCATATTTGCGAACGACGAGATGATGTACTGGCAACATGGAATCA
GTTAAATATGCAAGCTGAAAGGAGAAGGCATCAATTGGAGGATGCAGCTG
ATTTACAAAGATTCTTTTCTATGGTTAGAGAATTATTGCAATGGATGGAT
TTGGTGGCATTACAAATCAATGAAAAGACAAGACCAAAAGATGTTTCTGG
GGTAGAATTACTAATAAACGATCATCGGAGTATCAAAGCAGAAATAGCAG
CTCGGGAAGAAAGTATGAGCATTTGCGTTAATCTTGGTCGTACGCTGTTG
CATCGTGGTAGAGTCGGCGTGGATGAAGTTAGGGCGGCTTTAATTAACTT
AATAACAAGAAAATACAGTCTTGAAGATATGTGGGAAGAGAGATGGGATT
ATTTGCAATTAATTTTGGAAGTTTACCAATTTGCAAGAGATGCATCGGTG
GCAGAAGCTTGGATTTTGGCTCAAGAGCCATATTTAGCGAATAAAACATT
GGGCGAAACACTTGATGAAACCTTATCATTATTAAAAAAACACATTAATT
TCGAAAAAACTGTAATGTCACAAGAGGAAAGATTTGAAGCATTAGAAAAA
CTAACAACGATGGAAATAAGAGCTAAAGAAATAACCAAAGAATCAATTTT
GCTTAAAGACAAACATAAACAAGAACGGATAGAAAACGCAATAAAAATAT
TTCAACCTCCACCATCTCCTGAATTGGTCCACGAATCTCCTAAAGTCTCG
ATATCTGAGGAAGATGAAGAAGGGAAAAGTCACCAACACAAGATTTCAGT
AATTTCAAAAGAGGCTGCTGAAATGTGCCAGTCATCAGAAACAAAAACTG
ATATACGAGGAATTCTAATCAGAAAGCATGAATGGGAATATAAAAATCGC
AAAGCATTAAATCGTTCATGGCATGAGTTTTTAGTCGTATTGTCAATTGA
AAAAAACAAACTTCTAGTTTACAAAGACGAGAAACATTACAACGAGAAAC
CTCAGGATACATATCATAAAGATTCAGGATTAGATTTGAATGATTTGGTC
GCTGCTCCAGCATCTGATTATCTGAAACGACCATTTGTTTTTCGCATAAA
AATCACTTCAACTGGAGCTGAATATTTATTTCAAGCAAAAGATGAAGAGG
ACATGTTAAGATGGGTGAATAGCATAAATGAAAACTCACAAAAAGATTTG
AAATCCGAAACGACTGCACCGGGAAAGTCCAGTACTCTTCCTGCTTGCAC
AAGTGATCCACACGTTCCAAGTACTCAAGCTACTGGATTCAAAAAGAAAT
TCTTTACTCTTACTCGCAAAAAATAGATCTTATTAAGAAATTATGCATGG
ACTTCACTCGGAATGATTGCTATTATTTATTGTAATTTATGTTCTTGTTA
AGTGTACAAAATCTCAACTGAGTTACATTCAAAAAGCAATTTCTCTTTTG
TCTTTGGACAATCTTTGTCTAGAAAAACTTATTATTTAGCAATAAATCTA
TTCTTCGGATTTGGATCGAGCTTTAAAACTGTAAAAAAAAGAAGTGATGA
ATTTTATTTTTGGTTTTCTGAATATTTTTTTTTCGAATGTTTGAAATTCT
TGTCGATATGAATGGAAGGAAAATCTCTATAAAATGTGTGATAAAGAAAT
TGAGTTTTTAGCTTTTATACCCAAAAAACATATAATGAATGTAATTATTT
GTCAGCTTGATGCTGATTTCTGCATGATCTCGTTGCTAG
back to top

protein sequence of SMED30028311-orf-1

>SMED30028311-orf-1 ID=SMED30028311-orf-1|Name=SMED30028311-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=2325bp
MADVAYTLPWSNGTGDTNGNITTDDEWDTEDSTSKLYERFRIKALAGERE
KVQKKTFTKWINSHLNKLKQSIDDLYNDLKDGKMLLLLLEILSGEQLPYP
TKGKMRIHCLENVDKSLNFLIEQRVHLENMGAHDIVDGNARLTLGLIWTI
ILRFQIQDIVVEEDDTSEKRQAKDALLLWCQMKTAGYPNTNVRNFSTCWR
DGLAFNAIIHRHRPDLLEYSALSRSNPNENLEQAIRIAEEKLGIPRLLDP
EDVSVENPDEKSIMTYVVTFYHFFSKMKADSVHSKRVGKILSQSMETEEM
MVHYDKLTSNLLEWINQTIELLNDRTFANSLSGVQQQLAAFNTYRVTEKP
PKFQEKGNLEMLLFSIQSQMRANNQMPYLPIEGKLISDINNAWNKLDKAE
HARELALRDELIRQEKLEQLALRFDRKAGMREAWLTENQRLITQDNFGQD
LSAVEAAGKKHEAIKTDILAYEERVNSVTLVTSELENECYHDVERVLCRR
DNVIRLWEKLLDMLAVRKLRLDACYKVQKLFQDIKHLLDLINDLKARLKT
EDIGRHLMGVEDLIHKHSLLEIDIRMVGTKIEGIMSDAQPFINSEFGLGS
GDFQPADPNEVILRTVNLKEEYDNLLELSRNRKDNLSASKVMWEFLWGVA
DEEQWMKEKIQLMLNPDLGHDLSSVHRLISKHKVIEEDVRNHSNYLQNVI
QGGQQLILDKNPGAEKVADNLKELELLWNELIELTENRRSKLEQSLAYFH
CLADCGEVEIWIIEQVKLVKIDETSINEESIITDIHKHEQLSKSIEDYES
NINSLDEQVKKLSEGDLELVTIEEKVSNIKSQYAILIELTNQKQNKLTDT
LSLFRVLRKADTVKTWIDEKEKLLMSLIPTDELEELEVFRHRFDGFEKEM
NIQADQVEFVNTLAEKLSDMDHPQIADVVNKRFELNKLWNSLADLVEARR
EQLQTSYEFNQYLLECKQTGEWIREKSRLVESTDELGDDLAGIMQLQRRM
GGMQRDMDAIRAKLEHLDEEMDTLIAKRPNDEELIREERMILEDFWAELG
DMLADRDDRLSESSELQRFLQDLDHIHIWLSKMQTTVASEDLPKDLADAE
KSLVQHEQLKEEIDSYQDEFIRLLDYGRRITEDKTDAQYMFLSQRLNALE
EGWQELCQMWENRQGLLSQSLSLQVFLRDAIQSEVLLAQEENFLSKEDIP
ISIENSQNLLRKHEGFLTTLQANHDHTIAVIEFGRNLVERGHFCSDKINL
RVKSILERRESNKRRSNEAYEKLKDQVLYQELSQDIDDLSKWIQEKMIIA
TDESFREEKNIARRYNRHRAFDEEIQANKDRLCQAIDYAMQIVEERPQLA
DMIYPQIDSLNQQWEELEQTTFLKGEKMIEANREAIFEEGTMDVMTWLET
IGESIIVTEEEVETLTDVNVKLKKVEEADNEMEIKRKQIQDLKMHAAKLK
EEQPEKAFGIEQKHLILEHRFTQLQMPIKNKKIQLIQRKRIQQFLRNLDD
QKAWVDDKLLLAESTNFGNNLLTVQQLLRRHRYLATEVNNHKPQLEYLKE
EGAVLIEEVSPMQREKFVAGLQELESLWNRLEHSIDLRQQRLKESEATQT
FLFDAEEAESWLWEQELFLLSEERGIRDQEAAINVIKKHDARQKTIEDYG
EEITKLGTRSRLLIEKDHPQADRIALAQSHVDKVYAGLRDLCLEKKQRLS
EIQKLNHLYREIVDLENWIYERTLVASSHDLGVDFEHCCLLRERFDEFFH
ETHLLGKDRVKAANDLCASLISQCHADSAEIAQWHDRINDSWAELQELMQ
TRIQLLRTAWEFYKYLSSCQDVLDRICEKIASIPTDVSKDSQSVAIQQRK
HATFLSDAQALEGQVQWVVDEANHLLPSYAGQKEWHICERRDDVLATWNQ
LNMQAERRRHQLEDAADLQRFFSMVRELLQWMDLVALQINEKTRPKDVSG
VELLINDHRSIKAEIAAREESMSICVNLGRTLLHRGRVGVDEVRAALINL
ITRKYSLEDMWEERWDYLQLILEVYQFARDASVAEAWILAQEPYLANKTL
GETLDETLSLLKKHINFEKTVMSQEERFEALEKLTTMEIRAKEITKESIL
LKDKHKQERIENAIKIFQPPPSPELVHESPKVSISEEDEEGKSHQHKISV
ISKEAAEMCQSSETKTDIRGILIRKHEWEYKNRKALNRSWHEFLVVLSIE
KNKLLVYKDEKHYNEKPQDTYHKDSGLDLNDLVAAPASDYLKRPFVFRIK
ITSTGAEYLFQAKDEEDMLRWVNSINENSQKDLKSETTAPGKSSTLPACT
SDPHVPSTQATGFKKKFFTLTRKK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005856cytoskeleton
GO:0008091spectrin
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000028Category 2 cell
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR036872CH_dom_sf
IPR041681PH_9
IPR016343Spectrin_bsu
IPR002017Spectrin_repeat
IPR001589Actinin_actin-bd_CS
IPR001605PH_dom-spectrin-type
IPR001715CH-domain
IPR018159Spectrin/alpha-actinin
IPR001849PH_domain
IPR011993PH-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0005543phospholipid binding
GO:0005515protein binding
GO:0005200structural constituent of cytoskeleton
GO:0003779actin binding
Vocabulary: biological process
TermDefinition
GO:0007010cytoskeleton organization
GO:0051693actin filament capping
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 788..815
NoneNo IPR availableCOILSCoilCoilcoord: 1099..1126
NoneNo IPR availableCOILSCoilCoilcoord: 993..1027
NoneNo IPR availableCOILSCoilCoilcoord: 1895..1915
NoneNo IPR availableCOILSCoilCoilcoord: 1256..1276
NoneNo IPR availableCOILSCoilCoilcoord: 1422..1452
NoneNo IPR availableCOILSCoilCoilcoord: 527..547
NoneNo IPR availableGENE3DG3DSA:1.20.58.1940coord: 282..536
e-value: 1.0E-77
score: 263.6
NoneNo IPR availableGENE3DG3DSA:1.20.58.60coord: 1381..1487
e-value: 1.4E-7
score: 33.7
NoneNo IPR availableGENE3DG3DSA:1.20.58.60coord: 1913..2021
e-value: 1.8E-29
score: 104.1
NoneNo IPR availableGENE3DG3DSA:1.20.58.1940coord: 554..730
e-value: 3.8E-36
score: 126.5
NoneNo IPR availableGENE3DG3DSA:1.20.58.60coord: 731..835
e-value: 1.2E-12
score: 49.8
NoneNo IPR availableGENE3DG3DSA:1.20.58.60coord: 2022..2097
e-value: 4.0E-24
score: 86.4
NoneNo IPR availableGENE3DG3DSA:1.20.58.60coord: 1066..1165
e-value: 2.0E-28
score: 100.8
NoneNo IPR availableGENE3DG3DSA:1.20.58.1940coord: 845..1064
e-value: 4.7E-46
score: 159.2
NoneNo IPR availableGENE3DG3DSA:1.20.58.60coord: 1277..1380
e-value: 2.4E-20
score: 74.9
NoneNo IPR availableGENE3DG3DSA:1.20.58.60coord: 1491..1593
e-value: 9.9E-18
score: 66.4
NoneNo IPR availableGENE3DG3DSA:1.20.58.60coord: 1167..1276
e-value: 1.6E-31
score: 110.6
NoneNo IPR availableGENE3DG3DSA:1.20.58.1940coord: 1594..1901
e-value: 1.7E-85
score: 289.0
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 2121..2145
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 2280..2307
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 2130..2145
NoneNo IPR availablePANTHERPTHR11915:SF226SPECTRIN BETA CHAIN, NON-ERYTHROCYTIC 1coord: 21..2098
coord: 2147..2300
NoneNo IPR availablePANTHERPTHR11915SPECTRIN/FILAMIN RELATED CYTOSKELETAL PROTEINcoord: 21..2098
coord: 2147..2300
NoneNo IPR availableCDDcd00176SPECcoord: 958..1171
e-value: 6.9079E-31
score: 120.243
NoneNo IPR availableCDDcd00176SPECcoord: 1492..1701
e-value: 1.38548E-23
score: 99.0571
NoneNo IPR availableCDDcd00176SPECcoord: 303..525
e-value: 2.26784E-11
score: 63.6188
NoneNo IPR availableCDDcd00176SPECcoord: 1811..2019
e-value: 1.45352E-23
score: 99.0571
NoneNo IPR availableCDDcd00176SPECcoord: 1599..1810
e-value: 3.40314E-22
score: 95.2051
NoneNo IPR availableCDDcd00176SPECcoord: 752..957
e-value: 8.908E-21
score: 90.9679
NoneNo IPR availableCDDcd00176SPECcoord: 1278..1485
e-value: 4.60388E-16
score: 77.1007
NoneNo IPR availableCDDcd00176SPECcoord: 420..639
e-value: 4.21679E-25
score: 103.294
NoneNo IPR availableCDDcd00176SPECcoord: 1173..1369
e-value: 7.14858E-24
score: 99.8275
NoneNo IPR availableCDDcd10571PH_beta_spectrincoord: 2168..2276
e-value: 1.06669E-34
score: 126.959
NoneNo IPR availableCDDcd00176SPECcoord: 644..851
e-value: 6.26122E-28
score: 111.769
NoneNo IPR availableSUPERFAMILYSSF46966Spectrin repeatcoord: 643..745
NoneNo IPR availableSUPERFAMILYSSF46966Spectrin repeatcoord: 741..855
NoneNo IPR availableSUPERFAMILYSSF46966Spectrin repeatcoord: 1758..1877
NoneNo IPR availableSUPERFAMILYSSF46966Spectrin repeatcoord: 527..637
NoneNo IPR availableSUPERFAMILYSSF46966Spectrin repeatcoord: 1230..1372
NoneNo IPR availableSUPERFAMILYSSF50729PH domain-likecoord: 2168..2290
NoneNo IPR availableSUPERFAMILYSSF46966Spectrin repeatcoord: 1863..2019
NoneNo IPR availableSUPERFAMILYSSF46966Spectrin repeatcoord: 1447..1561
NoneNo IPR availableSUPERFAMILYSSF46966Spectrin repeatcoord: 1543..1699
NoneNo IPR availableSUPERFAMILYSSF46966Spectrin repeatcoord: 2023..2100
NoneNo IPR availableSUPERFAMILYSSF46966Spectrin repeatcoord: 293..413
NoneNo IPR availableSUPERFAMILYSSF46966Spectrin repeatcoord: 423..523
NoneNo IPR availableSUPERFAMILYSSF46966Spectrin repeatcoord: 1013..1158
NoneNo IPR availableSUPERFAMILYSSF46966Spectrin repeatcoord: 905..1061
IPR001605Pleckstrin homology domain, spectrin-typePRINTSPR00683SPECTRINPHcoord: 2255..2273
score: 56.73
coord: 2168..2187
score: 40.56
IPR001715Calponin homology domainSMARTSM00033ch_5coord: 53..153
e-value: 1.4E-20
score: 84.4
coord: 172..270
e-value: 3.0E-22
score: 89.9
IPR001715Calponin homology domainPFAMPF00307CHcoord: 172..275
e-value: 2.5E-24
score: 85.5
coord: 52..155
e-value: 4.4E-21
score: 75.1
IPR001715Calponin homology domainPROSITEPS50021CHcoord: 51..155
score: 23.137
IPR001715Calponin homology domainPROSITEPS50021CHcoord: 170..275
score: 26.573
IPR001715Calponin homology domainCDDcd00014CHcoord: 172..272
e-value: 9.22472E-25
score: 98.5371
IPR001715Calponin homology domainCDDcd00014CHcoord: 52..155
e-value: 1.34159E-16
score: 75.4251
IPR001849Pleckstrin homology domainSMARTSM00233PH_updatecoord: 2166..2282
e-value: 2.5E-9
score: 47.0
IPR001849Pleckstrin homology domainPROSITEPS50003PH_DOMAINcoord: 2165..2280
score: 13.642
IPR018159Spectrin/alpha-actininSMARTSM00150SPEC_4coord: 528..637
e-value: 1.7E-13
score: 60.8
coord: 1706..1807
e-value: 7.0E-13
score: 58.8
coord: 2025..2205
e-value: 9.8E-8
score: 41.7
coord: 1919..2019
e-value: 3.9E-14
score: 63.0
coord: 854..954
e-value: 2.4E-20
score: 83.6
coord: 1492..1593
e-value: 1.3E-18
score: 77.8
coord: 1813..1913
e-value: 1.3E-9
score: 47.9
coord: 1599..1700
e-value: 2.5E-15
score: 66.9
coord: 749..848
e-value: 6.1E-10
score: 49.0
coord: 422..522
e-value: 3.9E-19
score: 79.6
coord: 1385..1486
e-value: 0.16
score: 19.3
coord: 1174..1274
e-value: 1.9E-11
score: 54.1
coord: 643..743
e-value: 1.1E-24
score: 98.0
coord: 1280..1379
e-value: 1.2E-12
score: 58.0
coord: 1067..1168
e-value: 4.5E-21
score: 86.0
coord: 960..1061
e-value: 5.6E-13
score: 59.1
IPR036872CH domain superfamilyGENE3DG3DSA:1.10.418.10coord: 161..279
e-value: 3.3E-48
score: 164.4
IPR036872CH domain superfamilyGENE3DG3DSA:1.10.418.10coord: 38..160
e-value: 3.5E-44
score: 151.7
IPR036872CH domain superfamilySUPERFAMILYSSF47576Calponin-homology domain, CH-domaincoord: 26..276
IPR011993PH-like domain superfamilyGENE3DG3DSA:2.30.29.30coord: 2160..2281
e-value: 3.2E-30
score: 106.4
IPR016343Spectrin, beta subunitPIRSFPIRSF002297Spectrin_betacoord: 4..2324
e-value: 0.0
score: 2675.5
IPR041681Pleckstrin homology domain 9PFAMPF15410PH_9coord: 2170..2276
e-value: 3.2E-17
score: 63.0
IPR002017Spectrin repeatPFAMPF00435Spectrincoord: 526..637
e-value: 2.5E-10
score: 40.8
coord: 958..1062
e-value: 1.6E-13
score: 51.0
coord: 1065..1168
e-value: 3.4E-17
score: 62.9
coord: 1391..1485
e-value: 1.9E-5
score: 25.1
coord: 2024..2085
e-value: 3.8E-9
score: 37.0
coord: 1917..2019
e-value: 1.1E-10
score: 42.0
coord: 1490..1594
e-value: 6.1E-14
score: 52.4
coord: 853..954
e-value: 1.6E-16
score: 60.7
coord: 1812..1914
e-value: 9.6E-10
score: 38.9
coord: 642..744
e-value: 1.2E-17
score: 64.3
coord: 1278..1372
e-value: 1.2E-12
score: 48.2
coord: 301..408
e-value: 2.1E-9
score: 37.8
coord: 753..848
e-value: 6.4E-9
score: 36.2
coord: 1173..1273
e-value: 2.9E-10
score: 40.6
coord: 1598..1701
e-value: 1.4E-10
score: 41.6
coord: 420..522
e-value: 5.1E-14
score: 52.6
coord: 1705..1807
e-value: 5.6E-11
score: 42.9
IPR001589Actinin-type actin-binding domain, conserved sitePROSITEPS00019ACTININ_1coord: 53..62
IPR001589Actinin-type actin-binding domain, conserved sitePROSITEPS00020ACTININ_2coord: 127..151