WW domain-containing protein

Overview
NameWW domain-containing protein
Smed IDSMED30028310
Length (bp)3774
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of WW domain-containing protein (SMED30028310) t-SNE clustered cells

Violin plots show distribution of expression levels for WW domain-containing protein (SMED30028310) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of WW domain-containing protein (SMED30028310) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for WW domain-containing protein (SMED30028310) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30028310

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30028310h1SMcG0016457 SmedASXL_015755SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30028310h1SMcG0016457 SmedASXL_015755SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X1 cellSMED30028310h1SMcG0016457 SmedASXL_017637SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30028310h1SMcG0016457 SmedASXL_017637SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
neoblastSMED30028310h1SMcG0016457 dd_Smed_v4_7846_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of WW domain-containing protein vs. Ensembl Human
Match: SETD2 (SET domain containing 2, histone lysine methyltransferase [Source:HGNC Symbol;Acc:HGNC:18420])

HSP 1 Score: 89.3521 bits (220), Expect = 4.116e-17
Identity = 60/189 (31.75%), Postives = 93/189 (49.21%), Query Frame = 2
Query: 3080 LPPFWVSKECAYKDQYRVFFYHRVTKLVQWEMPVYPWEGNDDNELEIYDYNLASEIQVSHDEIQQMYVNLNNMYEMKQKKLQV--TKANVAKRKKESQENQKKDLFKRKIMAVIAHLLRPYRDSRCSEGKIETDEDLNYLTNKLSQTILYKELKIINDKTDHLEVTAQVESKTKAYVKTYMQSRGIIYK 3640
            LPP W   + A   + ++++YH +T+  QW+ P   WE   D      D +L  E ++   ++     + N M   K+ K     T + +AK+ KE        +F++++   I   L PYR   C  G+I T ED  +L  KL+  ++ KELK   +  D LE    V+ KTK Y+K YMQ  G +YK
Sbjct: 2391 LPPNW---KTARDPEGKIYYYHVITRQTQWDPPT--WESPGD------DASLEHEAEM---DLGTPTYDENPMKASKKPKTAEADTSSELAKKSKE--------VFRKEMSQFIVQCLNPYRKPDCKVGRITTTEDFKHLARKLTHGVMNKELKYCKNPED-LECNENVKHKTKEYIKKYMQKFGAVYK 2556          
BLAST of WW domain-containing protein vs. Ensembl Human
Match: NSD1 (nuclear receptor binding SET domain protein 1 [Source:HGNC Symbol;Acc:HGNC:14234])

HSP 1 Score: 55.0694 bits (131), Expect = 1.229e-6
Identity = 48/183 (26.23%), Postives = 72/183 (39.34%), Query Frame = 2
Query: 1850 CRCTMPNPDEWNEGVRSCSSGQNCILAQLRIECDNQHCPTESLCCNTQFFDLDTKSNKSRNIEFFFDVFHSIPWKIRTKKFIQKNKLIFEVAGIGEMSPGKGHEPEASTTSVFISKH-------IKIDVSR--DVHSYMHYLRYTRSLEQANVDIEKWIACGRTRLGIFAVKDLQPGEELLLH 2371
            C+ T  NP         C     CI   L  EC    CP    C N  F        +   +E F  +     W +RTK  I+K + + E   +GE+      E E      +  +H       + +D  R  D     +Y R+     Q N + +KW   G TR+G+FA+ D++ G EL  +
Sbjct: 1897 CKATDENP---------CGIDSECINRMLLYECHPTVCPAGGRCQNQCF-----SKRQYPEVEIFRTLQRG--WGLRTKTDIKKGEFVNEY--VGELI----DEEECRARIRYAQEHDITNFYMLTLDKDRIIDAGPKGNYARFMNHCCQPNCETQKWSVNGDTRVGLFALSDIKAGTELTFN 2057          
BLAST of WW domain-containing protein vs. Ensembl Human
Match: NSD1 (nuclear receptor binding SET domain protein 1 [Source:HGNC Symbol;Acc:HGNC:14234])

HSP 1 Score: 54.6842 bits (130), Expect = 1.440e-6
Identity = 48/183 (26.23%), Postives = 72/183 (39.34%), Query Frame = 2
Query: 1850 CRCTMPNPDEWNEGVRSCSSGQNCILAQLRIECDNQHCPTESLCCNTQFFDLDTKSNKSRNIEFFFDVFHSIPWKIRTKKFIQKNKLIFEVAGIGEMSPGKGHEPEASTTSVFISKH-------IKIDVSR--DVHSYMHYLRYTRSLEQANVDIEKWIACGRTRLGIFAVKDLQPGEELLLH 2371
            C+ T  NP         C     CI   L  EC    CP    C N  F        +   +E F  +     W +RTK  I+K + + E   +GE+      E E      +  +H       + +D  R  D     +Y R+     Q N + +KW   G TR+G+FA+ D++ G EL  +
Sbjct: 1628 CKATDENP---------CGIDSECINRMLLYECHPTVCPAGGRCQNQCF-----SKRQYPEVEIFRTLQRG--WGLRTKTDIKKGEFVNEY--VGELI----DEEECRARIRYAQEHDITNFYMLTLDKDRIIDAGPKGNYARFMNHCCQPNCETQKWSVNGDTRVGLFALSDIKAGTELTFN 1788          
BLAST of WW domain-containing protein vs. Ensembl Human
Match: NSD1 (nuclear receptor binding SET domain protein 1 [Source:HGNC Symbol;Acc:HGNC:14234])

HSP 1 Score: 54.6842 bits (130), Expect = 1.440e-6
Identity = 48/183 (26.23%), Postives = 72/183 (39.34%), Query Frame = 2
Query: 1850 CRCTMPNPDEWNEGVRSCSSGQNCILAQLRIECDNQHCPTESLCCNTQFFDLDTKSNKSRNIEFFFDVFHSIPWKIRTKKFIQKNKLIFEVAGIGEMSPGKGHEPEASTTSVFISKH-------IKIDVSR--DVHSYMHYLRYTRSLEQANVDIEKWIACGRTRLGIFAVKDLQPGEELLLH 2371
            C+ T  NP         C     CI   L  EC    CP    C N  F        +   +E F  +     W +RTK  I+K + + E   +GE+      E E      +  +H       + +D  R  D     +Y R+     Q N + +KW   G TR+G+FA+ D++ G EL  +
Sbjct: 1628 CKATDENP---------CGIDSECINRMLLYECHPTVCPAGGRCQNQCF-----SKRQYPEVEIFRTLQRG--WGLRTKTDIKKGEFVNEY--VGELI----DEEECRARIRYAQEHDITNFYMLTLDKDRIIDAGPKGNYARFMNHCCQPNCETQKWSVNGDTRVGLFALSDIKAGTELTFN 1788          
BLAST of WW domain-containing protein vs. Ensembl Fly
Match: Set2 (gene:FBgn0030486 transcript:FBtr0301559)

HSP 1 Score: 67.3958 bits (163), Expect = 1.134e-10
Identity = 37/118 (31.36%), Postives = 66/118 (55.93%), Query Frame = 2
Query: 3302 EMKQKKLQVTKANV-AKRKKESQENQKKDLFKRKIMAVIAHLLRPYRDSRCSEGKIETDEDLNYLTNKLSQTILYKELKIINDKTDHLEVTAQVESKTKAYVKTYMQSRGIIYKRPVH 3652
            E + KK++ +++ + A   +E+ E      F+ +I   +A+ LRPYR   C+ G+I +DED  +L N+LS  I  KE++      + L  T  V+ K+  ++  YM+ +G +YK+P  
Sbjct: 2199 EQRSKKVKSSQSPLTATSAREAHEK-----FRFEISGHVANFLRPYRKESCTLGRITSDEDYKFLVNRLSYHITTKEMRYCEVSGNPLSCTESVKHKSYDFINQYMRQKGPVYKKPAE 2311          
BLAST of WW domain-containing protein vs. Ensembl Fly
Match: Set2 (gene:FBgn0030486 transcript:FBtr0073779)

HSP 1 Score: 67.0106 bits (162), Expect = 1.176e-10
Identity = 37/118 (31.36%), Postives = 66/118 (55.93%), Query Frame = 2
Query: 3302 EMKQKKLQVTKANV-AKRKKESQENQKKDLFKRKIMAVIAHLLRPYRDSRCSEGKIETDEDLNYLTNKLSQTILYKELKIINDKTDHLEVTAQVESKTKAYVKTYMQSRGIIYKRPVH 3652
            E + KK++ +++ + A   +E+ E      F+ +I   +A+ LRPYR   C+ G+I +DED  +L N+LS  I  KE++      + L  T  V+ K+  ++  YM+ +G +YK+P  
Sbjct: 2248 EQRSKKVKSSQSPLTATSAREAHEK-----FRFEISGHVANFLRPYRKESCTLGRITSDEDYKFLVNRLSYHITTKEMRYCEVSGNPLSCTESVKHKSYDFINQYMRQKGPVYKKPAE 2360          
BLAST of WW domain-containing protein vs. Ensembl Zebrafish
Match: setd2 (SET domain containing 2, histone lysine methyltransferase [Source:ZFIN;Acc:ZDB-GENE-030131-2140])

HSP 1 Score: 84.3445 bits (207), Expect = 9.129e-16
Identity = 56/190 (29.47%), Postives = 88/190 (46.32%), Query Frame = 2
Query: 3080 LPPFWVSKECAYKDQYRVFFYHRVTKLVQWEMPVYPWEGNDDNELEIYDYNLASEIQVSHDEIQQMYVNL--NNMYEMKQKKLQV-TKANVAKRKKESQENQKKDLFKRKIMAVIAHLLRPYRDSRCSEGKIETDEDLNYLTNKLSQTILYKELKIINDKTDHLEVTAQVESKTKAYVKTYMQSRGIIYK 3640
            LPP W   + A   + R+++YH +T+  QW+ P   W+G  +            E  V H+    +       N  +   K  +  T + +AK+ KE        +F++++   I   L PYR   C  G+I   ED  +L  KL+  ++ KELK   +  D LE    V+ KTK Y+K YMQ  G +Y+
Sbjct: 2523 LPPSW---KVARDPEGRIYYYHIITRQTQWDPPS--WDGTTE------------EASVEHEAEMDLGTPTYDENPSKFSTKTAEADTSSELAKKSKE--------VFRKEMSQFIVQCLNPYRKPDCKLGRISNTEDFKHLARKLTHGVMNKELKSCKNPED-LECNENVKHKTKEYIKKYMQKFGSVYR 2686          
BLAST of WW domain-containing protein vs. Ensembl Zebrafish
Match: setd2 (SET domain containing 2, histone lysine methyltransferase [Source:ZFIN;Acc:ZDB-GENE-030131-2140])

HSP 1 Score: 84.3445 bits (207), Expect = 9.789e-16
Identity = 56/190 (29.47%), Postives = 88/190 (46.32%), Query Frame = 2
Query: 3080 LPPFWVSKECAYKDQYRVFFYHRVTKLVQWEMPVYPWEGNDDNELEIYDYNLASEIQVSHDEIQQMYVNL--NNMYEMKQKKLQV-TKANVAKRKKESQENQKKDLFKRKIMAVIAHLLRPYRDSRCSEGKIETDEDLNYLTNKLSQTILYKELKIINDKTDHLEVTAQVESKTKAYVKTYMQSRGIIYK 3640
            LPP W   + A   + R+++YH +T+  QW+ P   W+G  +            E  V H+    +       N  +   K  +  T + +AK+ KE        +F++++   I   L PYR   C  G+I   ED  +L  KL+  ++ KELK   +  D LE    V+ KTK Y+K YMQ  G +Y+
Sbjct: 2564 LPPSW---KVARDPEGRIYYYHIITRQTQWDPPS--WDGTTE------------EASVEHEAEMDLGTPTYDENPSKFSTKTAEADTSSELAKKSKE--------VFRKEMSQFIVQCLNPYRKPDCKLGRISNTEDFKHLARKLTHGVMNKELKSCKNPED-LECNENVKHKTKEYIKKYMQKFGSVYR 2727          
BLAST of WW domain-containing protein vs. Ensembl Zebrafish
Match: setd2 (SET domain containing 2, histone lysine methyltransferase [Source:ZFIN;Acc:ZDB-GENE-030131-2140])

HSP 1 Score: 84.3445 bits (207), Expect = 1.004e-15
Identity = 56/190 (29.47%), Postives = 88/190 (46.32%), Query Frame = 2
Query: 3080 LPPFWVSKECAYKDQYRVFFYHRVTKLVQWEMPVYPWEGNDDNELEIYDYNLASEIQVSHDEIQQMYVNL--NNMYEMKQKKLQV-TKANVAKRKKESQENQKKDLFKRKIMAVIAHLLRPYRDSRCSEGKIETDEDLNYLTNKLSQTILYKELKIINDKTDHLEVTAQVESKTKAYVKTYMQSRGIIYK 3640
            LPP W   + A   + R+++YH +T+  QW+ P   W+G  +            E  V H+    +       N  +   K  +  T + +AK+ KE        +F++++   I   L PYR   C  G+I   ED  +L  KL+  ++ KELK   +  D LE    V+ KTK Y+K YMQ  G +Y+
Sbjct: 2566 LPPSW---KVARDPEGRIYYYHIITRQTQWDPPS--WDGTTE------------EASVEHEAEMDLGTPTYDENPSKFSTKTAEADTSSELAKKSKE--------VFRKEMSQFIVQCLNPYRKPDCKLGRISNTEDFKHLARKLTHGVMNKELKSCKNPED-LECNENVKHKTKEYIKKYMQKFGSVYR 2729          
BLAST of WW domain-containing protein vs. Ensembl Zebrafish
Match: setd2 (SET domain containing 2, histone lysine methyltransferase [Source:ZFIN;Acc:ZDB-GENE-030131-2140])

HSP 1 Score: 82.4185 bits (202), Expect = 3.254e-15
Identity = 55/187 (29.41%), Postives = 88/187 (47.06%), Query Frame = 2
Query: 3080 LPPFWVSKECAYKDQYRVFFYHRVTKLVQWEMPVYPWEGNDDNELEIYDYNLASEIQVSHDEIQQMYVNLNNMYEMKQKKLQVTKANVAKRKKESQENQKKDLFKRKIMAVIAHLLRPYRDSRCSEGKIETDEDLNYLTNKLSQTILYKELKIINDKTDHLEVTAQVESKTKAYVKTYMQSRGIIYK 3640
            LPP W   + A   + R+++YH +T+  QW+ P   W+G  +          + E +   D     Y    + +  K  +   T + +AK+ KE        +F++++   I   L PYR   C  G+I   ED  +L  KL+  ++ KELK   +  D LE    V+ KTK Y+K YMQ  G +Y+
Sbjct: 2479 LPPSW---KVARDPEGRIYYYHIITRQTQWDPP--SWDGTTEEA--------SVEHEAEMDLGTPTYDENPSKFSTKTAEAD-TSSELAKKSKE--------VFRKEMSQFIVQCLNPYRKPDCKLGRISNTEDFKHLARKLTHGVMNKELKSCKNPED-LECNENVKHKTKEYIKKYMQKFGSVYR 2642          
BLAST of WW domain-containing protein vs. Ensembl Xenopus
Match: macroh2a1 (macroH2A.1 histone [Source:Xenbase;Acc:XB-GENE-855803])

HSP 1 Score: 82.0333 bits (201), Expect = 7.687e-15
Identity = 57/190 (30.00%), Postives = 92/190 (48.42%), Query Frame = 2
Query: 3080 LPPFWVSKECAYKDQYRVFFYHRVTKLVQWEMPVYPWEGNDDNELE-IYDYNLASEIQVSHDEIQQMYVNLNNMYEMKQKKLQV--TKANVAKRKKESQENQKKDLFKRKIMAVIAHLLRPYRDSRCSEGKIETDEDLNYLTNKLSQTILYKELKIINDKTDHLEVTAQVESKTKAYVKTYMQSRGIIYK 3640
            LP  W   + A   + ++++YH +T+  QW+ P +   G +   LE   + +L +    ++DE        N M   K+ K     T + +AK+ KE        +F++++   I   L PYR   C  G+I   ED  +L  KL+  ++ KELK   +  D L+    V+ KTK Y+K YMQ  G +YK
Sbjct: 2797 LPSGW---KTARDPEGKIYYYHVITRQTQWDPPAWDSPGEEGGALEHEAEMDLGT---PTYDE--------NPMKSSKKTKTAEADTSSELAKKSKE--------VFRKEMSQFIVQCLNPYRKPDCKMGRINNTEDFKHLARKLTHGVMNKELKYCKNPED-LDCNENVKHKTKEYIKKYMQKFGTVYK 2963          
BLAST of WW domain-containing protein vs. Ensembl Xenopus
Match: macroh2a1 (macroH2A.1 histone [Source:Xenbase;Acc:XB-GENE-855803])

HSP 1 Score: 81.6481 bits (200), Expect = 8.475e-15
Identity = 57/190 (30.00%), Postives = 92/190 (48.42%), Query Frame = 2
Query: 3080 LPPFWVSKECAYKDQYRVFFYHRVTKLVQWEMPVYPWEGNDDNELE-IYDYNLASEIQVSHDEIQQMYVNLNNMYEMKQKKLQV--TKANVAKRKKESQENQKKDLFKRKIMAVIAHLLRPYRDSRCSEGKIETDEDLNYLTNKLSQTILYKELKIINDKTDHLEVTAQVESKTKAYVKTYMQSRGIIYK 3640
            LP  W   + A   + ++++YH +T+  QW+ P +   G +   LE   + +L +    ++DE        N M   K+ K     T + +AK+ KE        +F++++   I   L PYR   C  G+I   ED  +L  KL+  ++ KELK   +  D L+    V+ KTK Y+K YMQ  G +YK
Sbjct: 2043 LPSGW---KTARDPEGKIYYYHVITRQTQWDPPAWDSPGEEGGALEHEAEMDLGT---PTYDE--------NPMKSSKKTKTAEADTSSELAKKSKE--------VFRKEMSQFIVQCLNPYRKPDCKMGRINNTEDFKHLARKLTHGVMNKELKYCKNPED-LDCNENVKHKTKEYIKKYMQKFGTVYK 2209          
BLAST of WW domain-containing protein vs. Ensembl Xenopus
Match: macroh2a1 (macroH2A.1 histone [Source:Xenbase;Acc:XB-GENE-855803])

HSP 1 Score: 81.6481 bits (200), Expect = 9.686e-15
Identity = 54/189 (28.57%), Postives = 87/189 (46.03%), Query Frame = 2
Query: 3080 LPPFWVSKECAYKDQYRVFFYHRVTKLVQWEMPVYPWEGNDDNELEIYDYNLASEIQVSHDEIQQMYVNLNNMYEMKQKKLQV--TKANVAKRKKESQENQKKDLFKRKIMAVIAHLLRPYRDSRCSEGKIETDEDLNYLTNKLSQTILYKELKIINDKTDHLEVTAQVESKTKAYVKTYMQSRGIIYK 3640
            LP  W   + A   + ++++YH +T+  QW+ P +   G +   LE             H+    +     +   MK+ K     T + +AK+ KE        +F++++   I   L PYR   C  G+I   ED  +L  KL+  ++ KELK   +  D L+    V+ KTK Y+K YMQ  G +YK
Sbjct: 2528 LPSGW---KTARDPEGKIYYYHVITRQTQWDPPAWDSPGEEGGALE-------------HEAEMDLGTPTYDENPMKKTKTAEADTSSELAKKSKE--------VFRKEMSQFIVQCLNPYRKPDCKMGRINNTEDFKHLARKLTHGVMNKELKYCKNPED-LDCNENVKHKTKEYIKKYMQKFGTVYK 2691          
BLAST of WW domain-containing protein vs. Ensembl Xenopus
Match: macroh2a1 (macroH2A.1 histone [Source:Xenbase;Acc:XB-GENE-855803])

HSP 1 Score: 81.6481 bits (200), Expect = 9.786e-15
Identity = 54/189 (28.57%), Postives = 87/189 (46.03%), Query Frame = 2
Query: 3080 LPPFWVSKECAYKDQYRVFFYHRVTKLVQWEMPVYPWEGNDDNELEIYDYNLASEIQVSHDEIQQMYVNLNNMYEMKQKKLQV--TKANVAKRKKESQENQKKDLFKRKIMAVIAHLLRPYRDSRCSEGKIETDEDLNYLTNKLSQTILYKELKIINDKTDHLEVTAQVESKTKAYVKTYMQSRGIIYK 3640
            LP  W   + A   + ++++YH +T+  QW+ P +   G +   LE             H+    +     +   MK+ K     T + +AK+ KE        +F++++   I   L PYR   C  G+I   ED  +L  KL+  ++ KELK   +  D L+    V+ KTK Y+K YMQ  G +YK
Sbjct: 2563 LPSGW---KTARDPEGKIYYYHVITRQTQWDPPAWDSPGEEGGALE-------------HEAEMDLGTPTYDENPMKKTKTAEADTSSELAKKSKE--------VFRKEMSQFIVQCLNPYRKPDCKMGRINNTEDFKHLARKLTHGVMNKELKYCKNPED-LDCNENVKHKTKEYIKKYMQKFGTVYK 2726          
BLAST of WW domain-containing protein vs. Ensembl Mouse
Match: Setd2 (SET domain containing 2 [Source:MGI Symbol;Acc:MGI:1918177])

HSP 1 Score: 89.3521 bits (220), Expect = 2.942e-17
Identity = 60/189 (31.75%), Postives = 93/189 (49.21%), Query Frame = 2
Query: 3080 LPPFWVSKECAYKDQYRVFFYHRVTKLVQWEMPVYPWEGNDDNELEIYDYNLASEIQVSHDEIQQMYVNLNNMYEMKQKKLQV--TKANVAKRKKESQENQKKDLFKRKIMAVIAHLLRPYRDSRCSEGKIETDEDLNYLTNKLSQTILYKELKIINDKTDHLEVTAQVESKTKAYVKTYMQSRGIIYK 3640
            LPP W   + A   + ++++YH +T+  QW+ P   WE   D      D +L  E ++   ++     + N M   K+ K     T + +AK+ KE        +F++++   I   L PYR   C  G+I T ED  +L  KL+  ++ KELK   +  D LE    V+ KTK Y+K YMQ  G +YK
Sbjct: 2364 LPPNW---KTARDPEGKIYYYHVITRQTQWDPPT--WESPGD------DASLEHEAEM---DLGTPTYDENPMKTSKKPKTAEADTSSELAKKSKE--------VFRKEMSQFIVQCLNPYRKPDCKVGRITTTEDFKHLARKLTHGVMNKELKYCKNPED-LECNENVKHKTKEYIKKYMQKFGAVYK 2529          
BLAST of WW domain-containing protein vs. Ensembl Mouse
Match: Setd2 (SET domain containing 2 [Source:MGI Symbol;Acc:MGI:1918177])

HSP 1 Score: 88.1965 bits (217), Expect = 3.957e-17
Identity = 60/189 (31.75%), Postives = 93/189 (49.21%), Query Frame = 2
Query: 3080 LPPFWVSKECAYKDQYRVFFYHRVTKLVQWEMPVYPWEGNDDNELEIYDYNLASEIQVSHDEIQQMYVNLNNMYEMKQKKLQV--TKANVAKRKKESQENQKKDLFKRKIMAVIAHLLRPYRDSRCSEGKIETDEDLNYLTNKLSQTILYKELKIINDKTDHLEVTAQVESKTKAYVKTYMQSRGIIYK 3640
            LPP W   + A   + ++++YH +T+  QW+ P   WE   D      D +L  E ++   ++     + N M   K+ K     T + +AK+ KE        +F++++   I   L PYR   C  G+I T ED  +L  KL+  ++ KELK   +  D LE    V+ KTK Y+K YMQ  G +YK
Sbjct:  587 LPPNW---KTARDPEGKIYYYHVITRQTQWDPPT--WESPGD------DASLEHEAEM---DLGTPTYDENPMKTSKKPKTAEADTSSELAKKSKE--------VFRKEMSQFIVQCLNPYRKPDCKVGRITTTEDFKHLARKLTHGVMNKELKYCKNPED-LECNENVKHKTKEYIKKYMQKFGAVYK 752          
BLAST of WW domain-containing protein vs. Ensembl Mouse
Match: Nsd1 (nuclear receptor-binding SET-domain protein 1 [Source:MGI Symbol;Acc:MGI:1276545])

HSP 1 Score: 54.6842 bits (130), Expect = 1.129e-6
Identity = 48/183 (26.23%), Postives = 73/183 (39.89%), Query Frame = 2
Query: 1850 CRCTMPNPDEWNEGVRSCSSGQNCILAQLRIECDNQHCPTESLCCNTQFFDLDTKSNKSRNIEFFFDVFHSIPWKIRTKKFIQKNKLIFEVAGIGEMSPGKGHEPEASTTSVFISKH-------IKIDVSR--DVHSYMHYLRYTRSLEQANVDIEKWIACGRTRLGIFAVKDLQPGEELLLH 2371
            C+ T  NP         C     CI   L  EC    CP    C N  F        +  ++E F  +     W +RTK  I+K + + E   +GE+      E E      +  +H       + +D  R  D     +Y R+     Q N + +KW   G TR+G+FA+ D++ G EL  +
Sbjct: 1795 CKATDENP---------CGIDSECINRMLLYECHPTVCPAGVRCQNQCF-----SKRQYPDVEIFRTLQRG--WGLRTKTDIKKGEFVNEY--VGELI----DEEECRARIRYAQEHDITNFYMLTLDKDRIIDAGPKGNYARFMNHCCQPNCETQKWSVNGDTRVGLFALSDIKAGTELTFN 1955          
BLAST of WW domain-containing protein vs. Ensembl Mouse
Match: Nsd1 (nuclear receptor-binding SET-domain protein 1 [Source:MGI Symbol;Acc:MGI:1276545])

HSP 1 Score: 54.299 bits (129), Expect = 1.264e-6
Identity = 48/183 (26.23%), Postives = 73/183 (39.89%), Query Frame = 2
Query: 1850 CRCTMPNPDEWNEGVRSCSSGQNCILAQLRIECDNQHCPTESLCCNTQFFDLDTKSNKSRNIEFFFDVFHSIPWKIRTKKFIQKNKLIFEVAGIGEMSPGKGHEPEASTTSVFISKH-------IKIDVSR--DVHSYMHYLRYTRSLEQANVDIEKWIACGRTRLGIFAVKDLQPGEELLLH 2371
            C+ T  NP         C     CI   L  EC    CP    C N  F        +  ++E F  +     W +RTK  I+K + + E   +GE+      E E      +  +H       + +D  R  D     +Y R+     Q N + +KW   G TR+G+FA+ D++ G EL  +
Sbjct: 1898 CKATDENP---------CGIDSECINRMLLYECHPTVCPAGVRCQNQCF-----SKRQYPDVEIFRTLQRG--WGLRTKTDIKKGEFVNEY--VGELI----DEEECRARIRYAQEHDITNFYMLTLDKDRIIDAGPKGNYARFMNHCCQPNCETQKWSVNGDTRVGLFALSDIKAGTELTFN 2058          
BLAST of WW domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9BYW2|SETD2_HUMAN (Histone-lysine N-methyltransferase SETD2 OS=Homo sapiens OX=9606 GN=SETD2 PE=1 SV=3)

HSP 1 Score: 89.3521 bits (220), Expect = 1.977e-16
Identity = 60/189 (31.75%), Postives = 93/189 (49.21%), Query Frame = 2
Query: 3080 LPPFWVSKECAYKDQYRVFFYHRVTKLVQWEMPVYPWEGNDDNELEIYDYNLASEIQVSHDEIQQMYVNLNNMYEMKQKKLQV--TKANVAKRKKESQENQKKDLFKRKIMAVIAHLLRPYRDSRCSEGKIETDEDLNYLTNKLSQTILYKELKIINDKTDHLEVTAQVESKTKAYVKTYMQSRGIIYK 3640
            LPP W   + A   + ++++YH +T+  QW+ P   WE   D      D +L  E ++   ++     + N M   K+ K     T + +AK+ KE        +F++++   I   L PYR   C  G+I T ED  +L  KL+  ++ KELK   +  D LE    V+ KTK Y+K YMQ  G +YK
Sbjct: 2391 LPPNW---KTARDPEGKIYYYHVITRQTQWDPPT--WESPGD------DASLEHEAEM---DLGTPTYDENPMKASKKPKTAEADTSSELAKKSKE--------VFRKEMSQFIVQCLNPYRKPDCKVGRITTTEDFKHLARKLTHGVMNKELKYCKNPED-LECNENVKHKTKEYIKKYMQKFGAVYK 2556          
BLAST of WW domain-containing protein vs. UniProt/SwissProt
Match: sp|E9Q5F9|SETD2_MOUSE (Histone-lysine N-methyltransferase SETD2 OS=Mus musculus OX=10090 GN=Setd2 PE=1 SV=1)

HSP 1 Score: 89.3521 bits (220), Expect = 2.058e-16
Identity = 60/189 (31.75%), Postives = 93/189 (49.21%), Query Frame = 2
Query: 3080 LPPFWVSKECAYKDQYRVFFYHRVTKLVQWEMPVYPWEGNDDNELEIYDYNLASEIQVSHDEIQQMYVNLNNMYEMKQKKLQV--TKANVAKRKKESQENQKKDLFKRKIMAVIAHLLRPYRDSRCSEGKIETDEDLNYLTNKLSQTILYKELKIINDKTDHLEVTAQVESKTKAYVKTYMQSRGIIYK 3640
            LPP W   + A   + ++++YH +T+  QW+ P   WE   D      D +L  E ++   ++     + N M   K+ K     T + +AK+ KE        +F++++   I   L PYR   C  G+I T ED  +L  KL+  ++ KELK   +  D LE    V+ KTK Y+K YMQ  G +YK
Sbjct: 2364 LPPNW---KTARDPEGKIYYYHVITRQTQWDPPT--WESPGD------DASLEHEAEM---DLGTPTYDENPMKTSKKPKTAEADTSSELAKKSKE--------VFRKEMSQFIVQCLNPYRKPDCKVGRITTTEDFKHLARKLTHGVMNKELKYCKNPED-LECNENVKHKTKEYIKKYMQKFGAVYK 2529          
BLAST of WW domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9VYD1|C1716_DROME (Probable histone-lysine N-methyltransferase CG1716 OS=Drosophila melanogaster OX=7227 GN=Set2 PE=1 SV=2)

HSP 1 Score: 66.2402 bits (160), Expect = 2.194e-9
Identity = 37/118 (31.36%), Postives = 66/118 (55.93%), Query Frame = 2
Query: 3302 EMKQKKLQVTKANV-AKRKKESQENQKKDLFKRKIMAVIAHLLRPYRDSRCSEGKIETDEDLNYLTNKLSQTILYKELKIINDKTDHLEVTAQVESKTKAYVKTYMQSRGIIYKRPVH 3652
            E + KK++ +++ + A   +E+ E      F+ +I   +A+ LRPYR   C+ G+I +DED  +L N+LS  I  KE++      + L  T  V+ K+  ++  YM+ +G +YK+P  
Sbjct: 2199 EQRSKKVKSSQSPLTATSAREAHEK-----FRFEISGHVANFLRPYRKESCTLGRITSDEDYKFLVNRLSYHITTKEMRYCEVSGNPLSCTESVKHKSYDFINQYMRQKGPVYKKPAE 2311          
BLAST of WW domain-containing protein vs. UniProt/SwissProt
Match: sp|Q96L73|NSD1_HUMAN (Histone-lysine N-methyltransferase, H3 lysine-36 specific OS=Homo sapiens OX=9606 GN=NSD1 PE=1 SV=1)

HSP 1 Score: 55.0694 bits (131), Expect = 5.900e-6
Identity = 48/183 (26.23%), Postives = 72/183 (39.34%), Query Frame = 2
Query: 1850 CRCTMPNPDEWNEGVRSCSSGQNCILAQLRIECDNQHCPTESLCCNTQFFDLDTKSNKSRNIEFFFDVFHSIPWKIRTKKFIQKNKLIFEVAGIGEMSPGKGHEPEASTTSVFISKH-------IKIDVSR--DVHSYMHYLRYTRSLEQANVDIEKWIACGRTRLGIFAVKDLQPGEELLLH 2371
            C+ T  NP         C     CI   L  EC    CP    C N  F        +   +E F  +     W +RTK  I+K + + E   +GE+      E E      +  +H       + +D  R  D     +Y R+     Q N + +KW   G TR+G+FA+ D++ G EL  +
Sbjct: 1897 CKATDENP---------CGIDSECINRMLLYECHPTVCPAGGRCQNQCF-----SKRQYPEVEIFRTLQRG--WGLRTKTDIKKGEFVNEY--VGELI----DEEECRARIRYAQEHDITNFYMLTLDKDRIIDAGPKGNYARFMNHCCQPNCETQKWSVNGDTRVGLFALSDIKAGTELTFN 2057          
BLAST of WW domain-containing protein vs. UniProt/SwissProt
Match: sp|Q2LAE1|ASHH2_ARATH (Histone-lysine N-methyltransferase ASHH2 OS=Arabidopsis thaliana OX=3702 GN=ASHH2 PE=1 SV=1)

HSP 1 Score: 54.6842 bits (130), Expect = 6.887e-6
Identity = 46/200 (23.00%), Postives = 85/200 (42.50%), Query Frame = 2
Query: 1784 SVTINEIVSQHNSPRYFTHEMRCRCTMPNPDEWNEGVRSCSSGQNCILAQLRIECDNQHCPTESLCCNTQFFDLDTKSNKSRNIEFFFDVFHSIPWKIRTKKFIQKNKLIFEVAGIGEMSPGKGHEPEASTTSVFISKH-----IKIDVSRDVHSYMHYLRYTRSLEQANVDIEKWIACGRTRLGIFAVKDLQPGEELLL 2368
            ++  N+ + ++   +     M C C  P+PD    G   C  G+ C+   L IEC    CP   LC N QF        K + ++F         + +R  + +++ + + E   +GE+   + +E      +    KH     +  +   D  +  +  R+     + N   EKW+  G   +GIF+++DL+ G+EL  
Sbjct:  957 AIKTNQFLHRNRKSQTIDEIMVCHCK-PSPD----GRLGC--GEECLNRMLNIECLQGTCPAGDLCSNQQF-------QKRKYVKFERFQSGKKGYGLRLLEDVREGQFLIEY--VGEVLDMQSYETRQKEYAFKGQKHFYFMTLNGNEVIDAGAKGNLGRFINHSCEPNCRTEKWMVNGEICVGIFSMQDLKKGQELTF 1140          
BLAST of WW domain-containing protein vs. TrEMBL
Match: A0A5J4NH37 (WW domain-containing protein (Fragment) OS=Paragonimus westermani OX=34504 GN=DEA37_0001707 PE=4 SV=1)

HSP 1 Score: 108.997 bits (271), Expect = 2.443e-21
Identity = 65/205 (31.71%), Postives = 105/205 (51.22%), Query Frame = 2
Query: 3098 SKECAYKDQYRVFFYHRVTKLVQWEMPVYPWE-----------GNDDNELEIYDYNLASEIQVSHDEIQQMYVNLNN-MYEMKQKKLQVTKANVAKRKKESQENQKKDLFKRKIMAVIAHLLRPYRDSRCSEGKIETDEDLNYLTNKLSQTILYKELKIINDKTDHL-----------EVTAQVESKTKAYVKTYMQSRGIIYKR 3643
              EC   + Y  ++YH  T+  +W+ PVYPW+           G DD E   Y++  AS+  V+HDEI+ MY  +   + E +  +L    A     K +S +   +  F  ++  ++ ++LR +RD+RC  G+I  DEDL YLT KL+Q ++ KE++  +                 EV+  V+S+   YVK YM+S+G  Y+R
Sbjct:   89 GTECDSSNMYAYYYYHVRTRQTRWDPPVYPWDADPMDTLTGDTGEDDPEAP-YNWGCASKFSVTHDEIEAMYSRIRQRILERQCTELLHELAG----KPDSPQGATEQSFAIELFTLVHNVLRTFRDARCKMGRIINDEDLYYLTKKLAQAVILKEVQKFHLAQAASSSSLFSAALVPEVSPIVQSRVTTYVKKYMESKGSFYRR 288          
BLAST of WW domain-containing protein vs. TrEMBL
Match: A0A0R3SGL2 (WW domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS4045 PE=4 SV=1)

HSP 1 Score: 107.842 bits (268), Expect = 6.134e-21
Identity = 63/213 (29.58%), Postives = 110/213 (51.64%), Query Frame = 2
Query: 3080 LPPFW------VSKECAYKDQYRVFFYHRVTKLVQWEMPVYPWEGN----------DDNELEIYDYNLASEIQVSHDEIQQMYVNLNNMYEMKQKKLQVTKANVAKRKKESQENQKKDLFKRKIMAVIAHLLRPYRDSRCSEGKIETDEDLNYLTNKLSQTILYKELKIINDK---------TDHLEVTAQVESKTKAYVKTYMQSRGIIYKR 3643
            LPP W       + E      Y  ++YH  T++ +W+ PVYPW+ +          DD+    Y++  A    V+H+EI+ MY       +M +++      ++  R    Q+ Q++  F  ++ ++I + LR +RDSR   G+I  DEDL+YLTNKL+Q ++ KE++ ++               EVT  ++ +  +YV+ YM+S+G  Y+R
Sbjct:  175 LPPGWQRAPNPAAAEGGEDGGYPYYYYHTKTRVTRWDPPVYPWDADPDDNLIADRPDDDPEAPYNWGCAHRYAVTHEEIEAMYAQYRK--KMLERQCMELIHDMGARPDAPQDAQEQS-FAIELFSLIHNELRRFRDSRVDLGRITNDEDLHYLTNKLAQEVVPKEIRNLHRAQQANASSLFAATPEVTPSIKDRVTSYVRRYMESKGSHYRR 384          
BLAST of WW domain-containing protein vs. TrEMBL
Match: A0A0R3UKB8 (WW domain-containing protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS8019 PE=4 SV=1)

HSP 1 Score: 102.449 bits (254), Expect = 4.146e-20
Identity = 60/212 (28.30%), Postives = 107/212 (50.47%), Query Frame = 2
Query: 3080 LPPFWVSKECAYKDQ----YRVFFYHRVTKLVQWEMPVYPWEGN----------DDNELEIYDYNLASEIQVSHDEIQQMYVNLNNMYEMKQKKLQVTKANVAKRKKESQENQKKDLFKRKIMAVIAHLLRPYRDSRCSEGKIETDEDLNYLTNKLSQTILYKELKIINDKTDH----------LEVTAQVESKTKAYVKTYMQSRGIIYKR 3643
            +PP W        D     Y  ++YH  T+  +W+ PVYPW+ +          DD+    Y++N A    V+H+EI+ MY    +   + +++       +  R    Q  Q+++ F  ++  +I + LR +RD+R + G+I +DEDL YLTNKL+Q ++ KE++ ++                EVT  +  +  +YV+ YM+++G  Y+R
Sbjct:   41 IPPGWQRAPNTASDGSDGGYAYYYYHTKTRQTRWDPPVYPWDADPEDNLIPDRPDDDPEAPYNWNCAHRFAVTHEEIEAMYAQYRS--RILERQCMELIHEMGARPDTPQGAQEQN-FAIELFTLIHNELRQFRDARVNLGRITSDEDLYYLTNKLAQEVIPKEIRSLHRAQQANASSLFAAVLPEVTPAIRERATSYVRRYMEAKGSCYRR 249          
BLAST of WW domain-containing protein vs. TrEMBL
Match: A0A564YT26 (WW domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS9299 PE=4 SV=1)

HSP 1 Score: 107.071 bits (266), Expect = 4.322e-20
Identity = 63/213 (29.58%), Postives = 110/213 (51.64%), Query Frame = 2
Query: 3080 LPPFW------VSKECAYKDQYRVFFYHRVTKLVQWEMPVYPWEGN----------DDNELEIYDYNLASEIQVSHDEIQQMYVNLNNMYEMKQKKLQVTKANVAKRKKESQENQKKDLFKRKIMAVIAHLLRPYRDSRCSEGKIETDEDLNYLTNKLSQTILYKELKIINDKTDH---------LEVTAQVESKTKAYVKTYMQSRGIIYKR 3643
            LPP W       + E      Y  ++YH  T++ +W+ PVYPW+ +          DD+    Y++  A    V+H+EI+ MY       +M +++      ++  R    Q+ Q++  F  ++ ++I + LR +RDSR   G+I  DEDL+YLTNKL+Q ++ KE++ ++               EVT  ++ +  +YV+ YM+S+G  Y+R
Sbjct:  317 LPPGWQRAPNPAAAEGGEDGGYPYYYYHTKTRVTRWDPPVYPWDADPDDNLIADRPDDDPEAPYNWGCAHRYAVTHEEIEAMYAQYRK--KMLERQCMELIHDMGARPDAPQDAQEQS-FAIELFSLIHNELRRFRDSRVDLGRITNDEDLHYLTNKLAQEVVPKEIRNLHRAQQANASSLFAATPEVTPSIKDRVTSYVRRYMESKGSHYRR 526          
BLAST of WW domain-containing protein vs. TrEMBL
Match: A0A0R3TTK4 (WW domain-containing protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS11042 PE=4 SV=2)

HSP 1 Score: 103.99 bits (258), Expect = 1.825e-19
Identity = 64/221 (28.96%), Postives = 113/221 (51.13%), Query Frame = 2
Query: 3080 LPPFW------VSKECAYKDQYRVFFYHRVTKLVQWEMPVYPWEGN----------DDNELEIYDYNLASEIQVSHDEIQQMYVN---LNNMYEMKQKKLQVTKA-----NVAKRKKESQENQKKDLFKRKIMAVIAHLLRPYRDSRCSEGKIETDEDLNYLTNKLSQTILYKELKIINDK---------TDHLEVTAQVESKTKAYVKTYMQSRGIIYKR 3643
            LPP W       + E      Y  ++YH  T++ +W+ PVYPW+ +          DD+    Y++  A    V+H+EI+ +  +    ++MY   +KK+   +       +  R    Q+  +++ F  ++ ++I + LR +RDSR   G+I  DEDL+YLTNKL+Q +L KE++ ++               EVT  ++ +  +YV+ YM+S+G  Y+R
Sbjct:  186 LPPGWQRAPNPAAAEGGEDGGYPYYYYHTKTRVTRWDPPVYPWDADPDDNLIPDRPDDDPEAPYNWGCAHRYAVTHEEIETVRNSSDYFDSMYAQYRKKMLERQCMELIHEMGARPDAPQDGLEQN-FAIELFSLIHNELRRFRDSRVDLGRITNDEDLHYLTNKLAQEVLPKEIRNLHRAQQVNASSLFATTPEVTPSIKDRVASYVRRYMESKGSHYRR 405          
BLAST of WW domain-containing protein vs. Ensembl Cavefish
Match: setd2 (SET domain containing 2, histone lysine methyltransferase [Source:NCBI gene;Acc:103039344])

HSP 1 Score: 85.1149 bits (209), Expect = 5.214e-16
Identity = 56/190 (29.47%), Postives = 88/190 (46.32%), Query Frame = 2
Query: 3080 LPPFWVSKECAYKDQYRVFFYHRVTKLVQWEMPVYPWEGNDDNELEIYDYNLASEIQVSHDEIQQMYVNL--NNMYEMKQKKLQV-TKANVAKRKKESQENQKKDLFKRKIMAVIAHLLRPYRDSRCSEGKIETDEDLNYLTNKLSQTILYKELKIINDKTDHLEVTAQVESKTKAYVKTYMQSRGIIYK 3640
            LPP W   + A   + ++++YH VT+  QW+ P   W+G            +  E  V H+    +       N  +   K  +  T + +AK+ KE        +F++++   I   L PYR   C  G+I   ED  +L  KL+  ++ KELK   +  D LE    V+ KTK Y+K YMQ  G +Y+
Sbjct: 2715 LPPTW---KVARDPEGKIYYYHVVTRQTQWDPPT--WDG------------VGEEASVEHEAEMDLGTPTYDENPSKFSTKTAEADTSSELAKKSKE--------VFRKEMSQFIVQCLNPYRKPDCKLGRISNTEDFKHLARKLTHGVMNKELKSCKNPED-LECNENVKHKTKEYIKKYMQKFGTVYR 2878          
BLAST of WW domain-containing protein vs. Ensembl Cavefish
Match: setd2 (SET domain containing 2, histone lysine methyltransferase [Source:NCBI gene;Acc:103039344])

HSP 1 Score: 53.9138 bits (128), Expect = 1.493e-6
Identity = 37/145 (25.52%), Postives = 62/145 (42.76%), Query Frame = 2
Query: 3080 LPPFWVSKECAYKDQYRVFFYHRVTKLVQWEMPVYPWEGNDDNELEIYDYNLASEIQVSHDEIQQMYVNL--NNMYEMKQKKLQV-TKANVAKRKKESQENQKKDLFKRKIMAVIAHLLRPYRDSRCSEGKIETDEDLNYLTNKL 3505
            LPP W   + A   + ++++YH VT+  QW+ P   W+G            +  E  V H+    +       N  +   K  +  T + +AK+ KE        +F++++   I   L PYR   C  G+I   ED  +L  K+
Sbjct: 2673 LPPTW---KVARDPEGKIYYYHVVTRQTQWDPPT--WDG------------VGEEASVEHEAEMDLGTPTYDENPSKFSTKTAEADTSSELAKKSKE--------VFRKEMSQFIVQCLNPYRKPDCKLGRISNTEDFKHLARKV 2792          
BLAST of WW domain-containing protein vs. Ensembl Cavefish
Match: setd2 (SET domain containing 2, histone lysine methyltransferase [Source:NCBI gene;Acc:103039344])

HSP 1 Score: 53.5286 bits (127), Expect = 1.726e-6
Identity = 37/145 (25.52%), Postives = 62/145 (42.76%), Query Frame = 2
Query: 3080 LPPFWVSKECAYKDQYRVFFYHRVTKLVQWEMPVYPWEGNDDNELEIYDYNLASEIQVSHDEIQQMYVNL--NNMYEMKQKKLQV-TKANVAKRKKESQENQKKDLFKRKIMAVIAHLLRPYRDSRCSEGKIETDEDLNYLTNKL 3505
            LPP W   + A   + ++++YH VT+  QW+ P   W+G            +  E  V H+    +       N  +   K  +  T + +AK+ KE        +F++++   I   L PYR   C  G+I   ED  +L  K+
Sbjct: 2729 LPPTW---KVARDPEGKIYYYHVVTRQTQWDPPT--WDG------------VGEEASVEHEAEMDLGTPTYDENPSKFSTKTAEADTSSELAKKSKE--------VFRKEMSQFIVQCLNPYRKPDCKLGRISNTEDFKHLARKV 2848          
BLAST of WW domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000211.1 (pep scaffold:Pmarinus_7.0:GL478810:17844:31366:-1 gene:ENSPMAG00000000188.1 transcript:ENSPMAT00000000211.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 88.9669 bits (219), Expect = 3.282e-18
Identity = 57/188 (30.32%), Postives = 90/188 (47.87%), Query Frame = 2
Query: 3080 LPPFWVSKECAYKDQYRVFFYHRVTKLVQWEMPVYPWEGNDDNELEIYDYNLASEIQVSHDEIQQMYVNLNNMYEMKQKKLQVTKANVAKRKKE-SQENQKKDLFKRKIMAVIAHLLRPYRDSRCSEGKIETDEDLNYLTNKLSQTILYKELKIINDKTDHLEVTAQVESKTKAYVKTYMQSRGIIYK 3640
            LPP W     A   + ++++YH V+++ QW+ P   WEG+ D              +V  D   +M +      E   K  +  K   A    E +++N  K+ F++++  +I H L  +R   C  GKI   ED  YL  KL+  ++ KE+K+  +  D LE    V+ KTK Y+K YM   G +YK
Sbjct:  592 LPPNW---RTATDQEGKIYYYHVVSRVTQWDPPA--WEGDSD--------------EVGGDRESEMDLGTPTYDETPTKASKKPKTAEADTSSELAKKN--KETFRKELSQLIVHCLNAFRKPDCKIGKITNTEDFKYLARKLTHGVMSKEMKLCRNPED-LECNENVKHKTKEYIKKYMTKFGAVYK 757          
BLAST of WW domain-containing protein vs. Ensembl Nematostella
Match: EDO43764 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXF0])

HSP 1 Score: 70.4774 bits (171), Expect = 5.595e-14
Identity = 49/188 (26.06%), Postives = 83/188 (44.15%), Query Frame = 2
Query: 3080 LPPFWVSKECAYKDQYRVFFYHRVTKLVQWEMPVYPWEGNDDNELEIYDYNLASEIQVSHDEIQQMYVNLNNMYEMKQKKLQVTKANVAKRKKESQENQKKDLFKRKIMAVIAHLLRPYRDSRCSEGKIETDEDLNYLTNKLSQTILYKELKIINDKTDHLEVTAQVESKTKAYVKTYMQSRGIIYKR 3643
            LPP W   + A   Q ++++YH +T+  QW+ P                     EI VS     + +     M    ++     K           + + KD F+ K+  V+ + L PY    C +G+I   ED  YL  KL+  ++ KEL+ +    + L+    V+ KTK Y+++YM+  G +Y+R
Sbjct:    5 LPPNW---KTATDPQGKIYYYHTLTRRTQWDPPT-------------------PEIVVS----PRKFTTDMEMDSGDEEPPLKKKKPKTPSTPPGAKQKIKDAFRVKLSNVVVNCLNPYHKVDCKQGRITNVEDFKYLARKLTHGVMMKELQHVKS-AESLQCNDSVKVKTKDYIRSYMKKFGPVYQR 165          
BLAST of WW domain-containing protein vs. Ensembl Nematostella
Match: EDO43763 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXE9])

HSP 1 Score: 50.8322 bits (120), Expect = 2.086e-6
Identity = 47/193 (24.35%), Postives = 75/193 (38.86%), Query Frame = 2
Query: 1835 THEMRCRCTMPNPDEWNEGVRSCSSGQNCILAQLRIECDNQHCPTESLCCNTQFFDLDTKSNKSRNIEFFFDVFHS--IPWKIRTKKFIQKNKLIFEVAGIGEMSPGKGHEPEASTTSVFISKHIKIDVSRDVHSYMHYLRYTRSLE---------------QANVDIEKWIACGRTRLGIFAVKDLQPGEEL 2362
              +M C C  P PD  N     C  G++C+   L IEC N  CP   LC N +F             +   +VF +    W ++T + +++N+ + E  G            E      F S+  + D  +  H Y   LR    ++               + N   +KW   G  R+G F ++ ++ GEEL
Sbjct:   24 VRKMTCEC-YPEPD--NPDFVGC--GEDCLNRLLMIEC-NHRCPCGDLCTNRRF---------QEGCKIKVEVFKTEKKGWGVKTLEDLEQNQFVIEYCG------------EVMNYRDFQSRAQRYDRQKRRHYYFMTLRADEIIDATLKGSISRFINHSCEPNCVTQKWTVNGLLRIGFFTLRTIKAGEEL 189          
BLAST of WW domain-containing protein vs. Ensembl Nematostella
Match: EDO43156 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZJ4])

HSP 1 Score: 51.6026 bits (122), Expect = 2.263e-6
Identity = 42/174 (24.14%), Postives = 71/174 (40.80%), Query Frame = 2
Query: 1850 CRCTMPNPDEWNEGVRSCSSGQNCILAQLRIECDNQHCPTESLCCNTQFFDLDTKSNKSRNIEFFFDVFHSIPWKIRTKKFIQKNKLIFEVAG-IGEMSPGKGHEPEASTTSVFISKHIKIDVSRDVHSYMHYLRYTRSLEQANVDIEKWIACGRTRLGIFAVKDLQPGEELLL 2368
            C CT   PD+      +C    NC+   L+ EC    CP    C N +F     +  +  + E F    HS  W +R+K+ I+K   + E  G + + +  +    +    + +    I  D   D     +  R+       N + +KW   G  R+G+F  +D++  EEL  
Sbjct:  333 CECT---PDQ------ACGQDANCLNLMLQFECVASRCPAGDKCQNQRF-----QKRQYVDCEPF--RAHSRGWGLRSKQAIKKGTFVIEYVGELIDDATCRERVKKGDDDTNYYMLTIDKDCIIDAGPMGNLSRFMNHSCYPNCETQKWTVNGEVRVGLFTSRDVESQEELTF 490          
BLAST of WW domain-containing protein vs. Ensembl Medaka
Match: setd2 (SET domain containing 2, histone lysine methyltransferase [Source:NCBI gene;Acc:101163764])

HSP 1 Score: 88.1965 bits (217), Expect = 6.029e-17
Identity = 59/191 (30.89%), Postives = 94/191 (49.21%), Query Frame = 2
Query: 3080 LPPFWVSKECAYKDQYRVFFYHRVTKLVQWEMPVYPWEGNDDNELEIYDYNLASEIQV---SHDEIQQMYVNLNNMYEMKQKKLQV-TKANVAKRKKESQENQKKDLFKRKIMAVIAHLLRPYRDSRCSEGKIETDEDLNYLTNKLSQTILYKELKIINDKTDHLEVTAQVESKTKAYVKTYMQSRGIIYK 3640
            LPP W   + A   + ++++YH VT+  QW+ P   WEG+ D+       +  SE+ +   ++DE         N  +   K  +  T + +AK+ KE+        F++++   I   L PYR   C  G+I   ED  +L  KL+  ++ KELK   +  D LE    V+ KTK Y+K YMQ  G +Y+
Sbjct: 2416 LPPNW---KVARDPEGKIYYYHIVTRQTQWDPPT--WEGSSDS----TSVDHESEMDLGTPTYDE---------NPSKFSTKTAEADTSSELAKKSKET--------FRKEMSQFIVQCLNPYRKPDCKSGRISNTEDFKHLARKLTHGVMNKELKACKNPED-LECNENVKHKTKEYIKKYMQRFGTVYR 2579          
BLAST of WW domain-containing protein vs. Ensembl Medaka
Match: setd2 (SET domain containing 2, histone lysine methyltransferase [Source:NCBI gene;Acc:101163764])

HSP 1 Score: 87.8113 bits (216), Expect = 6.878e-17
Identity = 59/191 (30.89%), Postives = 94/191 (49.21%), Query Frame = 2
Query: 3080 LPPFWVSKECAYKDQYRVFFYHRVTKLVQWEMPVYPWEGNDDNELEIYDYNLASEIQV---SHDEIQQMYVNLNNMYEMKQKKLQV-TKANVAKRKKESQENQKKDLFKRKIMAVIAHLLRPYRDSRCSEGKIETDEDLNYLTNKLSQTILYKELKIINDKTDHLEVTAQVESKTKAYVKTYMQSRGIIYK 3640
            LPP W   + A   + ++++YH VT+  QW+ P   WEG+ D+       +  SE+ +   ++DE         N  +   K  +  T + +AK+ KE+        F++++   I   L PYR   C  G+I   ED  +L  KL+  ++ KELK   +  D LE    V+ KTK Y+K YMQ  G +Y+
Sbjct: 2368 LPPNW---KVARDPEGKIYYYHIVTRQTQWDPPT--WEGSSDS----TSVDHESEMDLGTPTYDE---------NPSKFSTKTAEADTSSELAKKSKET--------FRKEMSQFIVQCLNPYRKPDCKSGRISNTEDFKHLARKLTHGVMNKELKACKNPED-LECNENVKHKTKEYIKKYMQRFGTVYR 2531          
BLAST of WW domain-containing protein vs. Ensembl Medaka
Match: nsd1b (histone-lysine N-methyltransferase, H3 lysine-36 and H4 lysine-20 specific [Source:NCBI gene;Acc:101161079])

HSP 1 Score: 53.5286 bits (127), Expect = 1.637e-6
Identity = 46/163 (28.22%), Postives = 69/163 (42.33%), Query Frame = 2
Query: 1901 CSSGQNCILAQLRIECDNQHCPTESLCCNTQFFDLDTKSNKSRNIEFFFDVFHSIPWKIRTKKFIQKNKLIFEVAGI----GEMSPGKGHEPEASTTSVFISKHIKIDVSR--DVHSYMHYLRYTRSLEQANVDIEKWIACGRTRLGIFAVKDLQPGEELLLH 2371
            C S   CI   L  EC+ Q CP    C N  F    TK   S+ +E F  +  S  W +R    I+K + + E  G      E      H  E    + ++   + +D  R  D     +  R+     Q N + +KW   G TR+G+FA+ D++ G EL  +
Sbjct: 1644 CGSDSECINRMLLYECNPQVCPAGEKCLNQAF----TKRQYSQ-VEIFRTL--SRGWGLRCVHDIKKGQFVSEYVGEVIDEEECRSRIRHAQENDICNFYM---LTLDKDRIIDAGPKGNEARFMNHCCQPNCETQKWTVNGDTRVGLFALVDVKAGTELTFN 1796          
BLAST of WW domain-containing protein vs. Ensembl Medaka
Match: nsd1b (histone-lysine N-methyltransferase, H3 lysine-36 and H4 lysine-20 specific [Source:NCBI gene;Acc:101161079])

HSP 1 Score: 53.1434 bits (126), Expect = 2.518e-6
Identity = 46/163 (28.22%), Postives = 69/163 (42.33%), Query Frame = 2
Query: 1901 CSSGQNCILAQLRIECDNQHCPTESLCCNTQFFDLDTKSNKSRNIEFFFDVFHSIPWKIRTKKFIQKNKLIFEVAGI----GEMSPGKGHEPEASTTSVFISKHIKIDVSR--DVHSYMHYLRYTRSLEQANVDIEKWIACGRTRLGIFAVKDLQPGEELLLH 2371
            C S   CI   L  EC+ Q CP    C N  F    TK   S+ +E F  +  S  W +R    I+K + + E  G      E      H  E    + ++   + +D  R  D     +  R+     Q N + +KW   G TR+G+FA+ D++ G EL  +
Sbjct: 2050 CGSDSECINRMLLYECNPQVCPAGEKCLNQAF----TKRQYSQ-VEIFRTL--SRGWGLRCVHDIKKGQFVSEYVGEVIDEEECRSRIRHAQENDICNFYM---LTLDKDRIIDAGPKGNEARFMNHCCQPNCETQKWTVNGDTRVGLFALVDVKAGTELTFN 2202          
BLAST of WW domain-containing protein vs. Ensembl Medaka
Match: nsd1b (histone-lysine N-methyltransferase, H3 lysine-36 and H4 lysine-20 specific [Source:NCBI gene;Acc:101161079])

HSP 1 Score: 53.1434 bits (126), Expect = 2.518e-6
Identity = 46/163 (28.22%), Postives = 69/163 (42.33%), Query Frame = 2
Query: 1901 CSSGQNCILAQLRIECDNQHCPTESLCCNTQFFDLDTKSNKSRNIEFFFDVFHSIPWKIRTKKFIQKNKLIFEVAGI----GEMSPGKGHEPEASTTSVFISKHIKIDVSR--DVHSYMHYLRYTRSLEQANVDIEKWIACGRTRLGIFAVKDLQPGEELLLH 2371
            C S   CI   L  EC+ Q CP    C N  F    TK   S+ +E F  +  S  W +R    I+K + + E  G      E      H  E    + ++   + +D  R  D     +  R+     Q N + +KW   G TR+G+FA+ D++ G EL  +
Sbjct: 2050 CGSDSECINRMLLYECNPQVCPAGEKCLNQAF----TKRQYSQ-VEIFRTL--SRGWGLRCVHDIKKGQFVSEYVGEVIDEEECRSRIRHAQENDICNFYM---LTLDKDRIIDAGPKGNEARFMNHCCQPNCETQKWTVNGDTRVGLFALVDVKAGTELTFN 2202          
BLAST of WW domain-containing protein vs. Planmine SMEST
Match: SMESG000049121.1 (SMESG000049121.1)

HSP 1 Score: 2034.22 bits (5269), Expect = 0.000e+0
Identity = 1110/1206 (92.04%), Postives = 1120/1206 (92.87%), Query Frame = 2
Query:   77 MNINDIPLPPTPKNKLYNASKVLENKDNHASSSRIFPVKRHVNKLPVGVIKKNDDGKIGELTLHRKELFLPTMNDKIQLAMSNLNPTQSKKLEMLLNATKLKPVELHINDNIVNHNQMNKVKNKFVDEKFENRKRRQEHNLKGSKKPKIEMINNHEKERLDKIKNEAQDNPXXXXXXXXXXXXXXXHSANYNNDNRSKYYTKWNLSPHYHDRNRNNVRDYHRNSSNHNNNDYKQNKSSFMAPILNYGRGDQKHEHQSHRTLGNHYPIHRNDLRHRERSKGKGIDGHRWKEQQSTVAVKPHRTKQWAAEAGKSGKKVVPSTREQSALXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRNTNEPMELPAVSPNSPDEDNPLMDSSNDGQVPYELECTALANNCLKELSATLVKMNQAYKSVYSKIPNIKLNEEKLLNIPLPISDKAPCTDSPTLNARYPQSVSTDNRIDKPPLQLTNGACDVTTDGVPKEEQPEMPLKPRIVSDNMDNLSHISRSSCGSKNGKSPFYSHNLSNASKESECLDAKSRPLVPKISNFSIDYCNIDSVTINEIVSQHNSPRYFTHEMRCRCTMPNPDEWNEGVRSCSSGQNCILAQLRIECDNQHCPTESLCCNTQFFDLDTKSNKSRNIEFFFDVFHSIPWKIRTKKFIQKNKLIFEVAGIGEMSPGKGHEPEASTTSVFISKHIKIDVSRDVHSYMHYLRYTRSLEQANVDIEKWIACGRTRLGIFAVKDLQPGEELLLHLPDDNAIDTSYTXXXXXXXXXXXXXXXXXXXXXXTDKADVLACIRY----XXXXXXXXXXXXXXXXXXXXXXQSCRPNQNHPPVLLNWVVELGMPAVLCCICDDELAASCRRR-HKXXXXXXXXXXXXXXXXXXXXLSFHKLIDLLLLLVPYSHRKQLQTLGFDLPGFVSRTYSQLAAANPRIPLTAHFVEKLHNLCQKLSSIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDMLHCRLPPFWVSKECAYKDQYRVFFYHRVTKLVQWEMPVYPWEGNDDNELEIYDYNLASEIQVSHDEIQQMYVNLNNMYEMKQKKLQVTKANVAKRKKESQENQKKDLFKRKIMAVIAHLLRPYRDSRCSEGKIETDEDLNYLTNKLSQTILYKELKIINDKTDHLEVTAQVESKTKAYVKTYMQSRGIIYKRPVHCSIPDQRNG 3679
            MNINDIPLPPTPKNKLYNASKVLENKDNHASSSRIFPVKRHVNKLPVGVIKKNDDGKIGELTLHRKELFLPTMNDKIQLAMSNLNPTQSKKLEMLLNATKLKPVELHINDNIVNHNQMNKVKNKFVDEKFENRKRRQEHNLKGSKKPKIEMINNH KERLDK KNEAQDNPVVMKSQVVVKK+NMKHSANYNNDNRSKYYTKWNLSPHYHDRNRNNVRDYHRNSSNHNNNDYKQNKSSFM PILNYGRGDQKHEHQSHRTLGNHYPIHRNDLRHRERSK KGIDGHRWKEQ+STVAVKPHRTKQWAAEAGKSGKKVVPSTREQSALSPSTSRSSSSSSSSS S S SS  SSGSS S  S    RNTNEPMELPAVSPNSPDEDNPLMDSSNDGQVP ELECTALANNCLKELSATLVKMNQAYKSVYSKIPNIKLN+EKLLNIPLPISDKAPCTDSPTLNARYPQSVSTDNRIDKPPLQLTNGACDVTTDGVPKEEQPEMPLKPRIVSDNMDNLSHISRSSCGSKNGKSPFYSHNLSNASKESECLDAKSRPLVPKISNFSIDYCNIDSVTINEIVSQHNSPRYFTHEMRCRCTMPNPDEWNEGVRSCSSGQNCILAQLRIECD QHCPTE LCCNTQFFDLDTKSNKSRNIEFFFDV+HSIPWKIRTKKFIQKNKLIFEVAGIGEMSPGKGH PEAS TSVFISKHIKIDVSRDVHSYMHYLRYTRSLEQANVDIEKWIACGRTRLGIFAVKDLQPGEELLLHLPDDNAIDTSYT  P           LSPSQL PTDKADVLACIRY          A  + L +     LLLQSCRPNQ++PPVLLNWVVELGMPAVLCCICDDELAASCRRR HK     GEGEGEGE    AAELSFHKLIDLLLLLVPYSH KQLQT GFDLPGFVSRTYSQLAAANPRIPLTAHFVEKLHNLCQKLSSI                  P APPAPPLSAAAADMLHCRLPPFWVSKECAYK QYRVFFYHRVTKLVQWEMPVYPWEGNDDNELEIYDYNLASEIQVSHDEIQQMYVNLNNMYEMKQKKLQVTKANVAKRKKESQENQKKDLFKRKIMAVIAHLLRPYRDSRC+EGKIETDEDLNYLTNKLSQTILYKELKI+NDKTDHLEVTAQVESKTKAYVKTYMQSRGIIYKRPVHCSIPDQRNG
Sbjct:    1 MNINDIPLPPTPKNKLYNASKVLENKDNHASSSRIFPVKRHVNKLPVGVIKKNDDGKIGELTLHRKELFLPTMNDKIQLAMSNLNPTQSKKLEMLLNATKLKPVELHINDNIVNHNQMNKVKNKFVDEKFENRKRRQEHNLKGSKKPKIEMINNHVKERLDKRKNEAQDNPVVMKSQVVVKKTNMKHSANYNNDNRSKYYTKWNLSPHYHDRNRNNVRDYHRNSSNHNNNDYKQNKSSFMEPILNYGRGDQKHEHQSHRTLGNHYPIHRNDLRHRERSKVKGIDGHRWKEQESTVAVKPHRTKQWAAEAGKSGKKVVPSTREQSALSPSTSRSSSSSSSSSSSGSSSSGSSSGSSASINSS---RNTNEPMELPAVSPNSPDEDNPLMDSSNDGQVPDELECTALANNCLKELSATLVKMNQAYKSVYSKIPNIKLNKEKLLNIPLPISDKAPCTDSPTLNARYPQSVSTDNRIDKPPLQLTNGACDVTTDGVPKEEQPEMPLKPRIVSDNMDNLSHISRSSCGSKNGKSPFYSHNLSNASKESECLDAKSRPLVPKISNFSIDYCNIDSVTINEIVSQHNSPRYFTHEMRCRCTMPNPDEWNEGVRSCSSGQNCILAQLRIECDIQHCPTECLCCNTQFFDLDTKSNKSRNIEFFFDVYHSIPWKIRTKKFIQKNKLIFEVAGIGEMSPGKGHGPEASRTSVFISKHIKIDVSRDVHSYMHYLRYTRSLEQANVDIEKWIACGRTRLGIFAVKDLQPGEELLLHLPDDNAIDTSYT-LPPSLSPLSPLSPLSPSQLLPTDKADVLACIRYLIHEPPAAAAAVPLLLPVLDTLLLLLQSCRPNQHNPPVLLNWVVELGMPAVLCCICDDELAASCRRRGHK--GAAGEGEGEGEGELPAAELSFHKLIDLLLLLVPYSHSKQLQTFGFDLPGFVSRTYSQLAAANPRIPLTAHFVEKLHNLCQKLSSI----------GAGESPGAPPAPPAPPLSAAAADMLHCRLPPFWVSKECAYKGQYRVFFYHRVTKLVQWEMPVYPWEGNDDNELEIYDYNLASEIQVSHDEIQQMYVNLNNMYEMKQKKLQVTKANVAKRKKESQENQKKDLFKRKIMAVIAHLLRPYRDSRCTEGKIETDEDLNYLTNKLSQTILYKELKILNDKTDHLEVTAQVESKTKAYVKTYMQSRGIIYKRPVHCSIPDQRNG 1190          
BLAST of WW domain-containing protein vs. Planmine SMEST
Match: SMESG000049121.1 (SMESG000049121.1)

HSP 1 Score: 1962.19 bits (5082), Expect = 0.000e+0
Identity = 1076/1172 (91.81%), Postives = 1086/1172 (92.66%), Query Frame = 2
Query:   77 MNINDIPLPPTPKNKLYNASKVLENKDNHASSSRIFPVKRHVNKLPVGVIKKNDDGKIGELTLHRKELFLPTMNDKIQLAMSNLNPTQSKKLEMLLNATKLKPVELHINDNIVNHNQMNKVKNKFVDEKFENRKRRQEHNLKGSKKPKIEMINNHEKERLDKIKNEAQDNPXXXXXXXXXXXXXXXHSANYNNDNRSKYYTKWNLSPHYHDRNRNNVRDYHRNSSNHNNNDYKQNKSSFMAPILNYGRGDQKHEHQSHRTLGNHYPIHRNDLRHRERSKGKGIDGHRWKEQQSTVAVKPHRTKQWAAEAGKSGKKVVPSTREQSALXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRNTNEPMELPAVSPNSPDEDNPLMDSSNDGQVPYELECTALANNCLKELSATLVKMNQAYKSVYSKIPNIKLNEEKLLNIPLPISDKAPCTDSPTLNARYPQSVSTDNRIDKPPLQLTNGACDVTTDGVPKEEQPEMPLKPRIVSDNMDNLSHISRSSCGSKNGKSPFYSHNLSNASKESECLDAKSRPLVPKISNFSIDYCNIDSVTINEIVSQHNSPRYFTHEMRCRCTMPNPDEWNEGVRSCSSGQNCILAQLRIECDNQHCPTESLCCNTQFFDLDTKSNKSRNIEFFFDVFHSIPWKIRTKKFIQKNKLIFEVAGIGEMSPGKGHEPEASTTSVFISKHIKIDVSRDVHSYMHYLRYTRSLEQANVDIEKWIACGRTRLGIFAVKDLQPGEELLLHLPDDNAIDTSYTXXXXXXXXXXXXXXXXXXXXXXTDKADVLACIRY----XXXXXXXXXXXXXXXXXXXXXXQSCRPNQNHPPVLLNWVVELGMPAVLCCICDDELAASCRRR-HKXXXXXXXXXXXXXXXXXXXXLSFHKLIDLLLLLVPYSHRKQLQTLGFDLPGFVSRTYSQLAAANPRIPLTAHFVEKLHNLCQKLSSIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDMLHCRLPPFWVSKECAYKDQYRVFFYHRVTKLVQWEMPVYPWEGNDDNELEIYDYNLASEIQVSHDEIQQMYVNLNNMYEMKQKKLQVTKANVAKRKKESQENQKKDLFKRKIMAVIAHLLRPYRDSRCSEGKIETDEDLNYLTNKLSQTILYKELKIINDKTDHLEVTAQ 3577
            MNINDIPLPPTPKNKLYNASKVLENKDNHASSSRIFPVKRHVNKLPVGVIKKNDDGKIGELTLHRKELFLPTMNDKIQLAMSNLNPTQSKKLEMLLNATKLKPVELHINDNIVNHNQMNKVKNKFVDEKFENRKRRQEHNLKGSKKPKIEMINNH KERLDK KNEAQDNPVVMKSQVVVKK+NMKHSANYNNDNRSKYYTKWNLSPHYHDRNRNNVRDYHRNSSNHNNNDYKQNKSSFM PILNYGRGDQKHEHQSHRTLGNHYPIHRNDLRHRERSK KGIDGHRWKEQ+STVAVKPHRTKQWAAEAGKSGKKVVPSTREQSALSPSTSRSSSSSSSSS S S SS  SSGSS S  S    RNTNEPMELPAVSPNSPDEDNPLMDSSNDGQVP ELECTALANNCLKELSATLVKMNQAYKSVYSKIPNIKLN+EKLLNIPLPISDKAPCTDSPTLNARYPQSVSTDNRIDKPPLQLTNGACDVTTDGVPKEEQPEMPLKPRIVSDNMDNLSHISRSSCGSKNGKSPFYSHNLSNASKESECLDAKSRPLVPKISNFSIDYCNIDSVTINEIVSQHNSPRYFTHEMRCRCTMPNPDEWNEGVRSCSSGQNCILAQLRIECD QHCPTE LCCNTQFFDLDTKSNKSRNIEFFFDV+HSIPWKIRTKKFIQKNKLIFEVAGIGEMSPGKGH PEAS TSVFISKHIKIDVSRDVHSYMHYLRYTRSLEQANVDIEKWIACGRTRLGIFAVKDLQPGEELLLHLPDDNAIDTSYT  P           LSPSQL PTDKADVLACIRY          A  + L +     LLLQSCRPNQ++PPVLLNWVVELGMPAVLCCICDDELAASCRRR HK     GEGEGEGE    AAELSFHKLIDLLLLLVPYSH KQLQT GFDLPGFVSRTYSQLAAANPRIPLTAHFVEKLHNLCQKLSSI                  P APPAPPLSAAAADMLHCRLPPFWVSKECAYK QYRVFFYHRVTKLVQWEMPVYPWEGNDDNELEIYDYNLASEIQVSHDEIQQMYVNLNNMYEMKQKKLQVTKANVAKRKKESQENQKKDLFKRKIMAVIAHLLRPYRDSRC+EGKIETDEDLNYLTNKLSQTILYKELKI+NDKTDHLEVTAQ
Sbjct:    1 MNINDIPLPPTPKNKLYNASKVLENKDNHASSSRIFPVKRHVNKLPVGVIKKNDDGKIGELTLHRKELFLPTMNDKIQLAMSNLNPTQSKKLEMLLNATKLKPVELHINDNIVNHNQMNKVKNKFVDEKFENRKRRQEHNLKGSKKPKIEMINNHVKERLDKRKNEAQDNPVVMKSQVVVKKTNMKHSANYNNDNRSKYYTKWNLSPHYHDRNRNNVRDYHRNSSNHNNNDYKQNKSSFMEPILNYGRGDQKHEHQSHRTLGNHYPIHRNDLRHRERSKVKGIDGHRWKEQESTVAVKPHRTKQWAAEAGKSGKKVVPSTREQSALSPSTSRSSSSSSSSSSSGSSSSGSSSGSSASINSS---RNTNEPMELPAVSPNSPDEDNPLMDSSNDGQVPDELECTALANNCLKELSATLVKMNQAYKSVYSKIPNIKLNKEKLLNIPLPISDKAPCTDSPTLNARYPQSVSTDNRIDKPPLQLTNGACDVTTDGVPKEEQPEMPLKPRIVSDNMDNLSHISRSSCGSKNGKSPFYSHNLSNASKESECLDAKSRPLVPKISNFSIDYCNIDSVTINEIVSQHNSPRYFTHEMRCRCTMPNPDEWNEGVRSCSSGQNCILAQLRIECDIQHCPTECLCCNTQFFDLDTKSNKSRNIEFFFDVYHSIPWKIRTKKFIQKNKLIFEVAGIGEMSPGKGHGPEASRTSVFISKHIKIDVSRDVHSYMHYLRYTRSLEQANVDIEKWIACGRTRLGIFAVKDLQPGEELLLHLPDDNAIDTSYT-LPPSLSPLSPLSPLSPSQLLPTDKADVLACIRYLIHEPPAAAAAVPLLLPVLDTLLLLLQSCRPNQHNPPVLLNWVVELGMPAVLCCICDDELAASCRRRGHK--GAAGEGEGEGEGELPAAELSFHKLIDLLLLLVPYSHSKQLQTFGFDLPGFVSRTYSQLAAANPRIPLTAHFVEKLHNLCQKLSSI----------GAGESPGAPPAPPAPPLSAAAADMLHCRLPPFWVSKECAYKGQYRVFFYHRVTKLVQWEMPVYPWEGNDDNELEIYDYNLASEIQVSHDEIQQMYVNLNNMYEMKQKKLQVTKANVAKRKKESQENQKKDLFKRKIMAVIAHLLRPYRDSRCTEGKIETDEDLNYLTNKLSQTILYKELKILNDKTDHLEVTAQ 1156          
BLAST of WW domain-containing protein vs. Planmine SMEST
Match: SMESG000076590.1 (SMESG000076590.1)

HSP 1 Score: 112.849 bits (281), Expect = 1.049e-24
Identity = 58/190 (30.53%), Postives = 115/190 (60.53%), Query Frame = 2
Query: 3080 LPPFWVSKECAYKDQYRVFFYHRVTKLVQWEMPVYPWEGNDDNELEIYDYNLASEIQVSHDEIQQMYVNLNNMYEMKQ----KKLQVTKANVAKRKKESQENQKKDLFKRKIMAVIAHLLRPYRDSRCSEGKIETDEDLNYLTNKLSQTILYKELKIINDKTDHLEVTAQVESKTKAYVKTYMQSRGIIY 3637
            LPP W S++    +   +++Y+ VTK+ QWE+PVYPW+  + + +  Y++  AS+ Q+S  ++Q MY      Y++++    +K ++ ++ + ++   S  ++ K  F +++   +  +++PY  S C  G+I+  +DL +L  K + TI+ KE+K++ +  D LE+ A V+SK K+Y++ YM ++G  Y
Sbjct: 2172 LPPNWHSRQA---ENGNLYYYNTVTKITQWEIPVYPWDAGEADPM-AYNFGNASDYQISRKDVQIMYEEYRKSYKLQRLEERRKTRIERS-IQRKLNLSPGDKNKIEFSKQVFRAVKTVVKPYNTSSCKLGRIQHKQDLKFLCEKFADTIIGKEVKLVANLED-LEMNANVKSKIKSYIEKYMANQGRCY 2355          

HSP 2 Score: 64.3142 bits (155), Expect = 6.546e-10
Identity = 53/178 (29.78%), Postives = 74/178 (41.57%), Query Frame = 2
Query: 1850 CRCTMPNPDEWNEGVRSCSSGQNCILAQLRIECDNQHCPTESLCCNTQFFDLDTKSNKSRNIEFFFDVFHSI---PWKIRTKKFIQKNKLIFEVAG-----------IGEMSPGKGHEPEASTTSVFISKHIKIDVSRDV-HSYMHYLRYTRSLEQANVDIEKWIACGRTRLGIFAVK 2338
            C C  PNPDE   G  +C  G+NC   ++++EC N+ CP   LC N +F            I   F+ F+      W IRT   I     I E  G           I + S    H   +   S++I   +K + SR V HS              N  IE+W+  G+TR+G F+ K
Sbjct: 1567 CNCVPPNPDEIKLGKTAC--GENCFNRRIKVEC-NRKCPVYELCTNRRF---------QEQIYAPFEPFYCTNGKGWGIRTTNRIYPGTFIIEYVGELIDFHEFLSRIRQKSTYNHHFIMSIQKSMYIDAGMKGNWSRFVNHSC-----------DPNTVIERWVVNGKTRIGFFSKK 1721          
BLAST of WW domain-containing protein vs. Planmine SMEST
Match: SMESG000015015.1 (SMESG000015015.1)

HSP 1 Score: 52.7582 bits (125), Expect = 1.832e-6
Identity = 41/160 (25.62%), Postives = 68/160 (42.50%), Query Frame = 2
Query: 1901 CSSGQNCILAQLRIECDNQHCPTESLCCNTQFFDLDTKSNKSRNIEFFFDVFHSIPWKIRTKKFIQKNKLIFEVAG-IGEMSPGKGHEPEASTTSVFISKHIKIDVSR--DVHSYMHYLRYTRSLEQANVDIEKWIACGRTRLGIFAVKDLQPGEELLLH 2371
            CS G  C     + ECD Q C     C N  F     K    +   F+ +      W ++  +FI+  + + E  G I  M   +     A+  ++     +++D  R  D   + +  R+  +    N+  EKWI     R+G+FA++D+Q GEEL   
Sbjct:  603 CSIGSGCFNVASKCECDPQICNLGDKCKNQNF----VKRIYPKQYTFWAN---DRGWGLKADEFIKTKQFVNEYIGEIITMEESEKRILWANENNISDFYFMELDNGRLIDARQFSNLSRFINNSCDPNLVAEKWIVNREHRIGLFALRDIQKGEELTFQ 755          
The following BLAST results are available for this feature:
BLAST of WW domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
SETD24.116e-1731.75SET domain containing 2, histone lysine methyltran... [more]
NSD11.229e-626.23nuclear receptor binding SET domain protein 1 [Sou... [more]
NSD11.440e-626.23nuclear receptor binding SET domain protein 1 [Sou... [more]
NSD11.440e-626.23nuclear receptor binding SET domain protein 1 [Sou... [more]
back to top
BLAST of WW domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of WW domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Set21.134e-1031.36gene:FBgn0030486 transcript:FBtr0301559[more]
Set21.176e-1031.36gene:FBgn0030486 transcript:FBtr0073779[more]
back to top
BLAST of WW domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
setd29.129e-1629.47SET domain containing 2, histone lysine methyltran... [more]
setd29.789e-1629.47SET domain containing 2, histone lysine methyltran... [more]
setd21.004e-1529.47SET domain containing 2, histone lysine methyltran... [more]
setd23.254e-1529.41SET domain containing 2, histone lysine methyltran... [more]
back to top
BLAST of WW domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
macroh2a17.687e-1530.00macroH2A.1 histone [Source:Xenbase;Acc:XB-GENE-855... [more]
macroh2a18.475e-1530.00macroH2A.1 histone [Source:Xenbase;Acc:XB-GENE-855... [more]
macroh2a19.686e-1528.57macroH2A.1 histone [Source:Xenbase;Acc:XB-GENE-855... [more]
macroh2a19.786e-1528.57macroH2A.1 histone [Source:Xenbase;Acc:XB-GENE-855... [more]
back to top
BLAST of WW domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Setd22.942e-1731.75SET domain containing 2 [Source:MGI Symbol;Acc:MGI... [more]
Setd23.957e-1731.75SET domain containing 2 [Source:MGI Symbol;Acc:MGI... [more]
Nsd11.129e-626.23nuclear receptor-binding SET-domain protein 1 [Sou... [more]
Nsd11.264e-626.23nuclear receptor-binding SET-domain protein 1 [Sou... [more]
back to top
BLAST of WW domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9BYW2|SETD2_HUMAN1.977e-1631.75Histone-lysine N-methyltransferase SETD2 OS=Homo s... [more]
sp|E9Q5F9|SETD2_MOUSE2.058e-1631.75Histone-lysine N-methyltransferase SETD2 OS=Mus mu... [more]
sp|Q9VYD1|C1716_DROME2.194e-931.36Probable histone-lysine N-methyltransferase CG1716... [more]
sp|Q96L73|NSD1_HUMAN5.900e-626.23Histone-lysine N-methyltransferase, H3 lysine-36 s... [more]
sp|Q2LAE1|ASHH2_ARATH6.887e-623.00Histone-lysine N-methyltransferase ASHH2 OS=Arabid... [more]
back to top
BLAST of WW domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5J4NH372.443e-2131.71WW domain-containing protein (Fragment) OS=Paragon... [more]
A0A0R3SGL26.134e-2129.58WW domain-containing protein OS=Hymenolepis diminu... [more]
A0A0R3UKB84.146e-2028.30WW domain-containing protein OS=Mesocestoides cort... [more]
A0A564YT264.322e-2029.58WW domain-containing protein OS=Hymenolepis diminu... [more]
A0A0R3TTK41.825e-1928.96WW domain-containing protein OS=Rodentolepis nana ... [more]
back to top
BLAST of WW domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
setd25.214e-1629.47SET domain containing 2, histone lysine methyltran... [more]
setd21.493e-625.52SET domain containing 2, histone lysine methyltran... [more]
setd21.726e-625.52SET domain containing 2, histone lysine methyltran... [more]
back to top
BLAST of WW domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000000211.13.282e-1830.32pep scaffold:Pmarinus_7.0:GL478810:17844:31366:-1 ... [more]
back to top
BLAST of WW domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of WW domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO437645.595e-1426.06Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO437632.086e-624.35Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO431562.263e-624.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of WW domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
setd26.029e-1730.89SET domain containing 2, histone lysine methyltran... [more]
setd26.878e-1730.89SET domain containing 2, histone lysine methyltran... [more]
nsd1b1.637e-628.22histone-lysine N-methyltransferase, H3 lysine-36 a... [more]
nsd1b2.518e-628.22histone-lysine N-methyltransferase, H3 lysine-36 a... [more]
nsd1b2.518e-628.22histone-lysine N-methyltransferase, H3 lysine-36 a... [more]
back to top
BLAST of WW domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000049121.10.000e+092.04SMESG000049121.1[more]
SMESG000049121.10.000e+091.81SMESG000049121.1[more]
SMESG000076590.11.049e-2430.53SMESG000076590.1[more]
SMESG000015015.11.832e-625.63SMESG000015015.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30028310 ID=SMED30028310|Name=WW domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=3774bp
ATCGAAATGTATATAAATCTTATATGATAATCAATTTATTTTTTCCCTAA
TTTTGTTATAAAAATCACATAGATTTATGAATATAAATGATATTCCTTTA
CCTCCAACACCTAAAAATAAGCTTTATAACGCTTCTAAAGTCTTAGAAAA
TAAAGATAATCATGCATCATCAAGTCGCATTTTCCCAGTGAAACGCCATG
TGAATAAATTACCAGTTGGTGTCATAAAGAAGAATGATGACGGTAAAATT
GGGGAATTAACGCTTCATAGAAAAGAATTATTTTTGCCTACAATGAATGA
TAAAATTCAACTAGCTATGTCTAATCTAAATCCAACTCAAAGTAAAAAAT
TAGAAATGCTATTAAATGCAACAAAATTAAAGCCTGTTGAATTACATATT
AACGACAATATTGTAAATCATAACCAAATGAATAAAGTAAAAAATAAGTT
TGTTGATGAAAAATTTGAAAACAGAAAACGTAGACAAGAACATAATTTAA
AAGGTTCCAAAAAACCTAAAATTGAAATGATAAATAATCATGAAAAGGAA
AGACTAGACAAAATAAAGAATGAAGCTCAAGATAATCCTGTTGTTATGAA
ATCACAGGTTGTTGTAAAGAAAAGCAATATGAAACATTCCGCAAATTACA
ACAATGATAATAGAAGCAAATATTACACGAAATGGAATCTATCACCTCAT
TATCATGACCGGAATCGTAATAATGTGCGTGATTATCACCGAAATAGCAG
CAACCATAATAACAATGATTACAAACAAAACAAATCATCATTTATGGCAC
CAATACTGAATTATGGCAGAGGCGACCAGAAACACGAGCATCAATCGCAC
AGGACGCTGGGTAATCACTATCCAATCCACCGGAATGACTTGCGTCATAG
AGAAAGAAGCAAGGGGAAAGGGATTGATGGCCACCGATGGAAAGAGCAAC
AATCAACCGTAGCGGTAAAGCCACATAGAACAAAGCAGTGGGCGGCGGAA
GCAGGGAAAAGCGGGAAGAAAGTTGTGCCATCGACACGAGAGCAATCGGC
GCTGTCACCAAGCACATCGCGGAGCTCATCATCATCATCATCATCATCAG
GATCATCATCAGGATCATCATCCGGCTCATCCGGCTCATCCGGCTCATCA
GCATCCATTAACAGCAGCAGGAACACTAATGAACCAATGGAGCTGCCGGC
GGTCAGTCCCAACAGCCCAGATGAGGATAACCCACTGATGGACAGCAGCA
ATGACGGGCAGGTACCCTATGAGTTAGAGTGCACAGCACTGGCCAATAAT
TGCCTCAAGGAGTTATCAGCCACTCTGGTCAAGATGAATCAGGCGTACAA
ATCCGTTTATTCCAAAATTCCAAACATCAAACTGAATGAAGAGAAATTAT
TGAATATCCCGTTGCCAATCAGTGATAAAGCGCCTTGTACCGATTCCCCC
ACATTGAATGCGCGATATCCCCAGAGCGTGTCCACTGACAACCGCATCGA
TAAACCACCATTACAACTGACCAATGGGGCTTGCGATGTCACCACAGACG
GTGTACCGAAGGAGGAGCAGCCTGAAATGCCGCTCAAGCCAAGAATTGTC
AGTGATAACATGGACAATCTCTCACATATCAGCCGCAGCTCCTGCGGCTC
CAAAAATGGTAAATCTCCATTTTACTCTCACAACCTGTCCAACGCCAGCA
AGGAATCAGAATGCTTGGACGCAAAATCACGTCCACTGGTCCCGAAAATA
TCGAATTTCTCAATCGATTATTGCAATATAGATTCAGTGACCATCAATGA
AATAGTGTCCCAGCATAACTCACCTCGATATTTCACCCATGAGATGCGCT
GCCGCTGTACAATGCCCAATCCTGATGAGTGGAACGAAGGAGTTAGATCA
TGCAGTAGTGGTCAAAACTGCATTCTCGCCCAGTTGCGCATCGAATGTGA
TAATCAACATTGCCCAACCGAAAGTTTATGCTGCAATACTCAATTCTTCG
ATCTCGATACAAAATCAAATAAATCGCGCAATATCGAGTTCTTTTTCGAT
GTCTTCCACTCGATTCCGTGGAAAATTCGCACAAAGAAATTCATTCAAAA
GAACAAGCTGATATTCGAGGTTGCGGGAATCGGGGAAATGTCCCCTGGAA
AAGGACACGAACCTGAAGCCTCCACGACATCAGTATTCATATCGAAACAC
ATCAAGATCGATGTCAGTAGGGATGTGCACAGCTACATGCATTATTTGCG
CTACACACGGTCCCTGGAGCAGGCGAATGTCGACATTGAGAAATGGATCG
CCTGCGGTAGGACGCGGCTGGGGATATTTGCCGTGAAGGATTTGCAGCCG
GGCGAGGAATTGCTGCTCCACCTCCCGGATGACAATGCGATTGACACGAG
TTACACGCTGCCGCCCTCCCTGTCCCCACTGTCCCCCCTGTCCCCCTCCC
TGTCCCCCTCCCAGTTGCCCCCCACCGACAAAGCGGATGTATTGGCTTGC
ATTCGCTACCTGGTCCATGAGCCGCCAGCAGCAGCAGTTCCCCTGCTGCT
GCCCGTGCTTGATACGCTGCTGCTGCAGTCCTGCCGTCCAAACCAGAACC
ACCCGCCCGTTCTCCTCAATTGGGTAGTGGAACTGGGAATGCCAGCAGTG
CTGTGCTGCATCTGTGATGATGAATTGGCTGCCTCCTGCCGCCGCCGCCA
TAAAGGGGCAGCAGGAGAGGGAGAGGGAGAGGGAGAGGGGGAATTACCCG
CTGCCGCTGCCGAGCTCTCATTCCACAAGCTGATCGACCTGCTGCTGTTA
CTCGTGCCTTACTCACATAGGAAACAGCTACAGACACTCGGTTTCGACCT
GCCCGGCTTTGTCAGCCGTACCTACAGCCAATTGGCAGCCGCCAATCCGC
GGATTCCGCTCACCGCTCATTTCGTTGAAAAACTCCACAATCTCTGTCAG
AAACTCTCTTCCATTGGTGCAGGGGAATCTCCTGGTGCTCCTCCTCCTGG
TGCTCCTCCCGGTGCTCCTCCCGGTGCTCCTCCTGCTCCTCCATTGTCCG
CCGCCGCAGCCGACATGCTACACTGCCGGCTGCCTCCGTTCTGGGTTTCA
AAGGAGTGCGCATACAAGGATCAATATCGGGTATTCTTCTATCACCGCGT
GACGAAATTGGTGCAGTGGGAAATGCCGGTCTATCCCTGGGAGGGTAACG
ATGACAATGAGCTTGAGATCTATGACTACAACTTGGCTAGTGAGATACAG
GTTTCCCATGACGAGATTCAGCAGATGTACGTCAACCTGAACAACATGTA
CGAAATGAAACAGAAAAAGTTGCAAGTGACCAAGGCAAATGTCGCCAAGC
GCAAGAAAGAAAGCCAAGAGAATCAAAAGAAAGATCTATTCAAGAGAAAG
ATCATGGCAGTCATTGCTCACTTGCTCAGGCCGTATCGAGATTCTCGGTG
TTCCGAAGGCAAAATAGAGACCGACGAGGATCTCAATTATTTGACGAACA
AGCTGTCCCAAACTATCCTATACAAAGAGCTCAAGATCATCAACGACAAA
ACCGATCACCTTGAAGTTACAGCACAGGTGGAATCCAAAACAAAAGCCTA
TGTGAAAACATATATGCAATCCAGGGGAATTATCTATAAGCGGCCCGTTC
ATTGCTCAATACCAGATCAGAGAAATGGACTGCTGCCTCCACTGCTGCCT
CCATTGCCACAAGGGTGACAATACGTGATTATCGATTTTGTATATTGTAT
ATTATGTCGTTTCTTTTATCATCA
back to top

protein sequence of SMED30028310-orf-1

>SMED30028310-orf-1 ID=SMED30028310-orf-1|Name=SMED30028310-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1214bp
MNINDIPLPPTPKNKLYNASKVLENKDNHASSSRIFPVKRHVNKLPVGVI
KKNDDGKIGELTLHRKELFLPTMNDKIQLAMSNLNPTQSKKLEMLLNATK
LKPVELHINDNIVNHNQMNKVKNKFVDEKFENRKRRQEHNLKGSKKPKIE
MINNHEKERLDKIKNEAQDNPVVMKSQVVVKKSNMKHSANYNNDNRSKYY
TKWNLSPHYHDRNRNNVRDYHRNSSNHNNNDYKQNKSSFMAPILNYGRGD
QKHEHQSHRTLGNHYPIHRNDLRHRERSKGKGIDGHRWKEQQSTVAVKPH
RTKQWAAEAGKSGKKVVPSTREQSALSPSTSRSSSSSSSSSGSSSGSSSG
SSGSSGSSASINSSRNTNEPMELPAVSPNSPDEDNPLMDSSNDGQVPYEL
ECTALANNCLKELSATLVKMNQAYKSVYSKIPNIKLNEEKLLNIPLPISD
KAPCTDSPTLNARYPQSVSTDNRIDKPPLQLTNGACDVTTDGVPKEEQPE
MPLKPRIVSDNMDNLSHISRSSCGSKNGKSPFYSHNLSNASKESECLDAK
SRPLVPKISNFSIDYCNIDSVTINEIVSQHNSPRYFTHEMRCRCTMPNPD
EWNEGVRSCSSGQNCILAQLRIECDNQHCPTESLCCNTQFFDLDTKSNKS
RNIEFFFDVFHSIPWKIRTKKFIQKNKLIFEVAGIGEMSPGKGHEPEAST
TSVFISKHIKIDVSRDVHSYMHYLRYTRSLEQANVDIEKWIACGRTRLGI
FAVKDLQPGEELLLHLPDDNAIDTSYTLPPSLSPLSPLSPSLSPSQLPPT
DKADVLACIRYLVHEPPAAAVPLLLPVLDTLLLQSCRPNQNHPPVLLNWV
VELGMPAVLCCICDDELAASCRRRHKGAAGEGEGEGEGELPAAAAELSFH
KLIDLLLLLVPYSHRKQLQTLGFDLPGFVSRTYSQLAAANPRIPLTAHFV
EKLHNLCQKLSSIGAGESPGAPPPGAPPGAPPGAPPAPPLSAAAADMLHC
RLPPFWVSKECAYKDQYRVFFYHRVTKLVQWEMPVYPWEGNDDNELEIYD
YNLASEIQVSHDEIQQMYVNLNNMYEMKQKKLQVTKANVAKRKKESQENQ
KKDLFKRKIMAVIAHLLRPYRDSRCSEGKIETDEDLNYLTNKLSQTILYK
ELKIINDKTDHLEVTAQVESKTKAYVKTYMQSRGIIYKRPVHCSIPDQRN
GLLPPLLPPLPQG*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR038190SRI_sf
IPR042294SETD2
IPR013257SRI
IPR001202WW_dom
IPR006560AWS_dom
Vocabulary: molecular function
TermDefinition
GO:0046975histone methyltransferase activity (H3-K36 specific)
GO:0018024histone-lysine N-methyltransferase activity
GO:0005515protein binding
GO:0008168methyltransferase activity
GO:0016740transferase activity
Vocabulary: biological process
TermDefinition
GO:0097198histone H3-K36 trimethylation
GO:0006355regulation of transcription, DNA-templated
GO:0034968histone lysine methylation
GO:0032259methylation
Vocabulary: cellular component
TermDefinition
GO:0005694chromosome
GO:0005634nucleus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 1076..1096
NoneNo IPR availableGENE3DG3DSA:2.170.270.10coord: 562..768
e-value: 3.4E-14
score: 54.9
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 269..297
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 317..371
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 269..382
NoneNo IPR availableSUPERFAMILYSSF82199SET domaincoord: 556..761
IPR013257Set2 Rpb1 interacting domainPFAMPF08236SRIcoord: 1088..1177
e-value: 3.4E-13
score: 49.6
IPR038190Set2 Rpb1 interacting domain superfamilyGENE3DG3DSA:1.10.1740.100coord: 1073..1183
e-value: 2.6E-24
score: 87.2
IPR042294Histone-lysine N-methyltransferase SETD2PANTHERPTHR46711FAMILY NOT NAMEDcoord: 974..1178
IPR001202WW domainPROSITEPS50020WW_DOMAIN_2coord: 989..1025
score: 9.044