Suppressor of cytokine signaling 7

Overview
NameSuppressor of cytokine signaling 7
Smed IDSMED30028309
Length (bp)3552
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Suppressor of cytokine signaling 7 (SMED30028309) t-SNE clustered cells

Violin plots show distribution of expression levels for Suppressor of cytokine signaling 7 (SMED30028309) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Suppressor of cytokine signaling 7 (SMED30028309) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Suppressor of cytokine signaling 7 (SMED30028309) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30028309

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30028309SMESG000041674.1 SmedASXL_012694SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
parapharyngeal cellSMED30028309SMESG000041674.1 dd_Smed_v4_12768_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30028309SMESG000041674.1 dd_Smed_v6_12768_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30028309SMESG000041674.1 OX_Smed_1.0.20289ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Suppressor of cytokine signaling 7 vs. Ensembl Human
Match: SOCS7 (suppressor of cytokine signaling 7 [Source:HGNC Symbol;Acc:HGNC:29846])

HSP 1 Score: 167.162 bits (422), Expect = 5.716e-43
Identity = 78/172 (45.35%), Postives = 113/172 (65.70%), Query Frame = 1
Query: 2653 PARKAFQENMLSLKEVGWYWGPLSFTEAERLMENKANGTFLVRDSGHDTYFLSLTFRVRETTYHTRIEYSQGTFSFWSQPE-SHSATTISEFIDKAVAHSQSGKFHYFLLTNVPGQPPMEVSLLYPLTRNQIVHSLKHLSRFVILSNIRKDHIANLNIPSPLKLYLLEKQYY 3165
            P   +F  ++  L++ GWYWGP+++ +AE  ++ K +G+FLVRDS    Y LSL+FR +  T+HTR+E+ +GTFS W  P+      ++ EFI +A+ HS++GKF YFL + VPG PP  V LLYP++R   V SL+HL RF I   +R DHI +L +P PL  Y+ +  YY
Sbjct:  349 PDSSSFAASLRELEKCGWYWGPMNWEDAEMKLKGKPDGSFLVRDSSDPRYILSLSFRSQGITHHTRMEHYRGTFSLWCHPKFEDRCQSVVEFIKRAIMHSKNGKFLYFLRSRVPGLPPTPVQLLYPVSRFSNVKSLQHLCRFRIRQLVRIDHIPDLPLPKPLISYIRKFYYY 520          
BLAST of Suppressor of cytokine signaling 7 vs. Ensembl Human
Match: SOCS7 (suppressor of cytokine signaling 7 [Source:HGNC Symbol;Acc:HGNC:29846])

HSP 1 Score: 167.162 bits (422), Expect = 6.465e-43
Identity = 78/172 (45.35%), Postives = 113/172 (65.70%), Query Frame = 1
Query: 2653 PARKAFQENMLSLKEVGWYWGPLSFTEAERLMENKANGTFLVRDSGHDTYFLSLTFRVRETTYHTRIEYSQGTFSFWSQPE-SHSATTISEFIDKAVAHSQSGKFHYFLLTNVPGQPPMEVSLLYPLTRNQIVHSLKHLSRFVILSNIRKDHIANLNIPSPLKLYLLEKQYY 3165
            P   +F  ++  L++ GWYWGP+++ +AE  ++ K +G+FLVRDS    Y LSL+FR +  T+HTR+E+ +GTFS W  P+      ++ EFI +A+ HS++GKF YFL + VPG PP  V LLYP++R   V SL+HL RF I   +R DHI +L +P PL  Y+ +  YY
Sbjct:  355 PDSSSFAASLRELEKCGWYWGPMNWEDAEMKLKGKPDGSFLVRDSSDPRYILSLSFRSQGITHHTRMEHYRGTFSLWCHPKFEDRCQSVVEFIKRAIMHSKNGKFLYFLRSRVPGLPPTPVQLLYPVSRFSNVKSLQHLCRFRIRQLVRIDHIPDLPLPKPLISYIRKFYYY 526          
BLAST of Suppressor of cytokine signaling 7 vs. Ensembl Human
Match: SOCS7 (suppressor of cytokine signaling 7 [Source:HGNC Symbol;Acc:HGNC:29846])

HSP 1 Score: 167.162 bits (422), Expect = 1.177e-42
Identity = 78/172 (45.35%), Postives = 113/172 (65.70%), Query Frame = 1
Query: 2653 PARKAFQENMLSLKEVGWYWGPLSFTEAERLMENKANGTFLVRDSGHDTYFLSLTFRVRETTYHTRIEYSQGTFSFWSQPE-SHSATTISEFIDKAVAHSQSGKFHYFLLTNVPGQPPMEVSLLYPLTRNQIVHSLKHLSRFVILSNIRKDHIANLNIPSPLKLYLLEKQYY 3165
            P   +F  ++  L++ GWYWGP+++ +AE  ++ K +G+FLVRDS    Y LSL+FR +  T+HTR+E+ +GTFS W  P+      ++ EFI +A+ HS++GKF YFL + VPG PP  V LLYP++R   V SL+HL RF I   +R DHI +L +P PL  Y+ +  YY
Sbjct:  383 PDSSSFAASLRELEKCGWYWGPMNWEDAEMKLKGKPDGSFLVRDSSDPRYILSLSFRSQGITHHTRMEHYRGTFSLWCHPKFEDRCQSVVEFIKRAIMHSKNGKFLYFLRSRVPGLPPTPVQLLYPVSRFSNVKSLQHLCRFRIRQLVRIDHIPDLPLPKPLISYIRKFYYY 554          
BLAST of Suppressor of cytokine signaling 7 vs. Ensembl Human
Match: SOCS7 (suppressor of cytokine signaling 7 [Source:HGNC Symbol;Acc:HGNC:29846])

HSP 1 Score: 167.162 bits (422), Expect = 1.177e-42
Identity = 78/172 (45.35%), Postives = 113/172 (65.70%), Query Frame = 1
Query: 2653 PARKAFQENMLSLKEVGWYWGPLSFTEAERLMENKANGTFLVRDSGHDTYFLSLTFRVRETTYHTRIEYSQGTFSFWSQPE-SHSATTISEFIDKAVAHSQSGKFHYFLLTNVPGQPPMEVSLLYPLTRNQIVHSLKHLSRFVILSNIRKDHIANLNIPSPLKLYLLEKQYY 3165
            P   +F  ++  L++ GWYWGP+++ +AE  ++ K +G+FLVRDS    Y LSL+FR +  T+HTR+E+ +GTFS W  P+      ++ EFI +A+ HS++GKF YFL + VPG PP  V LLYP++R   V SL+HL RF I   +R DHI +L +P PL  Y+ +  YY
Sbjct:  383 PDSSSFAASLRELEKCGWYWGPMNWEDAEMKLKGKPDGSFLVRDSSDPRYILSLSFRSQGITHHTRMEHYRGTFSLWCHPKFEDRCQSVVEFIKRAIMHSKNGKFLYFLRSRVPGLPPTPVQLLYPVSRFSNVKSLQHLCRFRIRQLVRIDHIPDLPLPKPLISYIRKFYYY 554          
BLAST of Suppressor of cytokine signaling 7 vs. Ensembl Human
Match: SOCS7 (suppressor of cytokine signaling 7 [Source:HGNC Symbol;Acc:HGNC:29846])

HSP 1 Score: 167.162 bits (422), Expect = 2.566e-42
Identity = 78/172 (45.35%), Postives = 113/172 (65.70%), Query Frame = 1
Query: 2653 PARKAFQENMLSLKEVGWYWGPLSFTEAERLMENKANGTFLVRDSGHDTYFLSLTFRVRETTYHTRIEYSQGTFSFWSQPE-SHSATTISEFIDKAVAHSQSGKFHYFLLTNVPGQPPMEVSLLYPLTRNQIVHSLKHLSRFVILSNIRKDHIANLNIPSPLKLYLLEKQYY 3165
            P   +F  ++  L++ GWYWGP+++ +AE  ++ K +G+FLVRDS    Y LSL+FR +  T+HTR+E+ +GTFS W  P+      ++ EFI +A+ HS++GKF YFL + VPG PP  V LLYP++R   V SL+HL RF I   +R DHI +L +P PL  Y+ +  YY
Sbjct:  447 PDSSSFAASLRELEKCGWYWGPMNWEDAEMKLKGKPDGSFLVRDSSDPRYILSLSFRSQGITHHTRMEHYRGTFSLWCHPKFEDRCQSVVEFIKRAIMHSKNGKFLYFLRSRVPGLPPTPVQLLYPVSRFSNVKSLQHLCRFRIRQLVRIDHIPDLPLPKPLISYIRKFYYY 618          
BLAST of Suppressor of cytokine signaling 7 vs. Ensembl Celegans
Match: F39B2.5 (pep chromosome:WBcel235:I:14775184:14776663:-1 gene:WBGene00009556.1 transcript:F39B2.5.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F39B2.5)

HSP 1 Score: 64.6994 bits (156), Expect = 1.924e-11
Identity = 44/166 (26.51%), Postives = 83/166 (50.00%), Query Frame = 1
Query: 2689 LKEVGWYWGPLSFTEAERLMENKANGTFLVRDSGHDTYFLSLTFRVRETTYHTRIEYSQGTFSFWS-QP-ESHSATTISEFIDKAVAHSQSGKFHYFLLTNVPGQPPMEVSLLYPLTRNQIVHSLKHLSRFVILSNIRKDHIANLN-IPSPLKLYLLEKQYYISNL 3177
            L +  WYWG L +  AERL+     G FL+RDS  +T+  ++++  ++  YH+R+       +  S QP  S     + E I++++  S +G+                V+L  PLT+ +++ SL++L RF + ++ +K        +P  +  YL + ++ I +L
Sbjct:   11 LYDCDWYWGDLDWKWAERLLLLCPIGYFLIRDSRSETHLFTVSYHFQDRVYHSRLSLEDSRRNLGSRQPYVSRDYWNLVEIIERSLEQSLTGQQEMLHYRRGHEAEAARVNLTRPLTKRELLPSLQYLCRFTLKTSQQKPPTPKTAPLPPTILKYLSDSKWIIPDL 176          
BLAST of Suppressor of cytokine signaling 7 vs. Ensembl Fly
Match: Socs16D (gene:FBgn0030869 transcript:FBtr0310310)

HSP 1 Score: 144.436 bits (363), Expect = 1.381e-34
Identity = 81/179 (45.25%), Postives = 110/179 (61.45%), Query Frame = 1
Query: 2632 KQNNNPEPARKAFQENMLSLKEVGWYWGPLSFTEAERLMENKANGTFLVRDSGHDTYFLSLTFRVRETTYHTRIEYSQGTFSFWSQPESHSATTISEFIDKAVAHSQSGKFHYFLLTNVPGQPPMEVSLLYPLTRNQIVHSLKHLSRFVIL-SNIRKDHIANLNIPSPLKLYLLEKQYY 3165
            K N   EP    F  ++  +K+ GWYWGPLS   AE+++ ++ +G+F+VRDS  D Y  SL+F++     H RIE  QGTFSF S  +  S  TI+EFI+KAV HS+SG++ +FL    P   PM V L  P++R + V SL+H+ RFVIL + IRKD I  L +P  L  YL  K  Y
Sbjct:  826 KTNAIQEPRALQFTSSIEKVKDYGWYWGPLSSEAAEKVLSSEPDGSFIVRDSSDDHYIFSLSFKLNNCVRHVRIEQDQGTFSFGSYAKFKS-QTITEFIEKAVEHSRSGRYLFFLHRR-PEHGPMRVQLTNPVSRFKHVQSLQHMCRFVILKAVIRKDLIQTLPLPRRLLDYLNYKHCY 1002          
BLAST of Suppressor of cytokine signaling 7 vs. Ensembl Fly
Match: Socs16D (gene:FBgn0030869 transcript:FBtr0074473)

HSP 1 Score: 144.436 bits (363), Expect = 1.442e-34
Identity = 81/179 (45.25%), Postives = 110/179 (61.45%), Query Frame = 1
Query: 2632 KQNNNPEPARKAFQENMLSLKEVGWYWGPLSFTEAERLMENKANGTFLVRDSGHDTYFLSLTFRVRETTYHTRIEYSQGTFSFWSQPESHSATTISEFIDKAVAHSQSGKFHYFLLTNVPGQPPMEVSLLYPLTRNQIVHSLKHLSRFVIL-SNIRKDHIANLNIPSPLKLYLLEKQYY 3165
            K N   EP    F  ++  +K+ GWYWGPLS   AE+++ ++ +G+F+VRDS  D Y  SL+F++     H RIE  QGTFSF S  +  S  TI+EFI+KAV HS+SG++ +FL    P   PM V L  P++R + V SL+H+ RFVIL + IRKD I  L +P  L  YL  K  Y
Sbjct:  821 KTNAIQEPRALQFTSSIEKVKDYGWYWGPLSSEAAEKVLSSEPDGSFIVRDSSDDHYIFSLSFKLNNCVRHVRIEQDQGTFSFGSYAKFKS-QTITEFIEKAVEHSRSGRYLFFLHRR-PEHGPMRVQLTNPVSRFKHVQSLQHMCRFVILKAVIRKDLIQTLPLPRRLLDYLNYKHCY 997          
BLAST of Suppressor of cytokine signaling 7 vs. Ensembl Fly
Match: Socs36E (gene:FBgn0041184 transcript:FBtr0329927)

HSP 1 Score: 83.9593 bits (206), Expect = 4.884e-16
Identity = 56/154 (36.36%), Postives = 74/154 (48.05%), Query Frame = 1
Query: 2704 WYWGPLSFTEAERLMENKANGTFLVRDSGHDTYFLSLTFRVRETTYHTRIEYSQGTFSF-WSQPESHSATTISEFIDKAVAHSQSGKFHYFLLTNVPGQPPMEVSLLYPLTRNQIVHSLKHLSRFVILSNIRKDHIANLNIPSPLKLYLLEKQY 3162
            +YWG +   EAE L+E K  GTFL+RDS  + +  S+TFR    + H RIE S   FSF    P   +A T++  ++    H +      F           E  L  PL R Q   SL+ LSR  I+SN   D I  + +P  LK YL E  Y
Sbjct:  474 FYWGKMDRYEAEHLLEGKPEGTFLLRDSAQEEFLFSVTFRKYGRSLHARIEQSGHKFSFDCHDPCVFTAPTVTGLLE----HYKDPACVMFF----------EPCLTIPLHRRQ-TFSLQQLSRATIVSNTSYDGINQMELPGRLKSYLKEYHY 612          
BLAST of Suppressor of cytokine signaling 7 vs. Ensembl Fly
Match: Socs36E (gene:FBgn0041184 transcript:FBtr0081040)

HSP 1 Score: 83.9593 bits (206), Expect = 4.884e-16
Identity = 56/154 (36.36%), Postives = 74/154 (48.05%), Query Frame = 1
Query: 2704 WYWGPLSFTEAERLMENKANGTFLVRDSGHDTYFLSLTFRVRETTYHTRIEYSQGTFSF-WSQPESHSATTISEFIDKAVAHSQSGKFHYFLLTNVPGQPPMEVSLLYPLTRNQIVHSLKHLSRFVILSNIRKDHIANLNIPSPLKLYLLEKQY 3162
            +YWG +   EAE L+E K  GTFL+RDS  + +  S+TFR    + H RIE S   FSF    P   +A T++  ++    H +      F           E  L  PL R Q   SL+ LSR  I+SN   D I  + +P  LK YL E  Y
Sbjct:  474 FYWGKMDRYEAEHLLEGKPEGTFLLRDSAQEEFLFSVTFRKYGRSLHARIEQSGHKFSFDCHDPCVFTAPTVTGLLE----HYKDPACVMFF----------EPCLTIPLHRRQ-TFSLQQLSRATIVSNTSYDGINQMELPGRLKSYLKEYHY 612          
BLAST of Suppressor of cytokine signaling 7 vs. Ensembl Fly
Match: Socs44A (gene:FBgn0033266 transcript:FBtr0088784)

HSP 1 Score: 81.6481 bits (200), Expect = 5.249e-16
Identity = 47/148 (31.76%), Postives = 75/148 (50.68%), Query Frame = 1
Query: 2704 WYWGPLSFTEAERLMENKANGTFLVRDSGHDTYFLSLTFRVRETTYHTRIEYSQGTFSFWSQPESHSATTISEFIDKAVAHSQSGKFHYFLLTNVPGQPPMEVSLLYPLTRNQIVHSLKHLSRFVILSNIRKDHIANLNIPSPLKLYL 3147
            WYWG +S  +++R + +K  G+FLVRDS       +L+FR+   T H R+EY    + F    E     +I E I+  +    +  F  F+      QPP  V L YPL+R   +  L+ L R V+   + ++ +A L +P+ +  YL
Sbjct:  189 WYWGEISRRDSQRQLSDKPTGSFLVRDSETSGSQFTLSFRIVNVTLHYRLEYRDNFWHF----EELKYESIVEMIEDILHRCTNDNFVCFVKVPNEMQPPFPVILKYPLSRYSNMPKLQDLCRRVLQRQMSREQLAQLPVPAQMLEYL 332          
BLAST of Suppressor of cytokine signaling 7 vs. Ensembl Zebrafish
Match: socs7 (suppressor of cytokine signaling 7 [Source:ZFIN;Acc:ZDB-GENE-080204-125])

HSP 1 Score: 172.17 bits (435), Expect = 8.175e-45
Identity = 84/191 (43.98%), Postives = 116/191 (60.73%), Query Frame = 1
Query: 2641 NNPEPARKA---------------FQENMLSLKEVGWYWGPLSFTEAERLMENKANGTFLVRDSGHDTYFLSLTFRVRETTYHTRIEYSQGTFSFWSQPE-SHSATTISEFIDKAVAHSQSGKFHYFLLTNVPGQPPMEVSLLYPLTRNQIVHSLKHLSRFVILSNIRKDHIANLNIPSPLKLYLLEKQYY 3165
             NP PAR A               F  ++  L+  GWYWGP+++ +AE  +  K +G+FLVRDS    Y LSL+FR +  T+HTR+E+ +GTFS W  P+      ++ EFI++A+ HS++GKF YFL + VPG PP  V LLYP++R   V SL+HL RF I   +R DHI  L +P PL +YL +  YY
Sbjct:  319 ENPAPARLAPPQVMCPLRGADSSSFTASLRELERCGWYWGPMNWEDAEMKLRGKPDGSFLVRDSSDPRYILSLSFRSQGVTHHTRMEHYRGTFSLWCHPKFEDRCHSVVEFIERAIMHSKNGKFLYFLRSRVPGLPPTPVQLLYPVSRFSNVKSLQHLCRFCIRQLVRIDHIQELPLPKPLIVYLRKFYYY 509          
BLAST of Suppressor of cytokine signaling 7 vs. Ensembl Zebrafish
Match: socs7 (suppressor of cytokine signaling 7 [Source:ZFIN;Acc:ZDB-GENE-080204-125])

HSP 1 Score: 172.17 bits (435), Expect = 4.731e-44
Identity = 84/191 (43.98%), Postives = 116/191 (60.73%), Query Frame = 1
Query: 2641 NNPEPARKA---------------FQENMLSLKEVGWYWGPLSFTEAERLMENKANGTFLVRDSGHDTYFLSLTFRVRETTYHTRIEYSQGTFSFWSQPE-SHSATTISEFIDKAVAHSQSGKFHYFLLTNVPGQPPMEVSLLYPLTRNQIVHSLKHLSRFVILSNIRKDHIANLNIPSPLKLYLLEKQYY 3165
             NP PAR A               F  ++  L+  GWYWGP+++ +AE  +  K +G+FLVRDS    Y LSL+FR +  T+HTR+E+ +GTFS W  P+      ++ EFI++A+ HS++GKF YFL + VPG PP  V LLYP++R   V SL+HL RF I   +R DHI  L +P PL +YL +  YY
Sbjct:  442 ENPAPARLAPPQVMCPLRGADSSSFTASLRELERCGWYWGPMNWEDAEMKLRGKPDGSFLVRDSSDPRYILSLSFRSQGVTHHTRMEHYRGTFSLWCHPKFEDRCHSVVEFIERAIMHSKNGKFLYFLRSRVPGLPPTPVQLLYPVSRFSNVKSLQHLCRFCIRQLVRIDHIQELPLPKPLIVYLRKFYYY 632          
BLAST of Suppressor of cytokine signaling 7 vs. Ensembl Zebrafish
Match: socs7 (suppressor of cytokine signaling 7 [Source:ZFIN;Acc:ZDB-GENE-080204-125])

HSP 1 Score: 172.17 bits (435), Expect = 4.731e-44
Identity = 84/191 (43.98%), Postives = 116/191 (60.73%), Query Frame = 1
Query: 2641 NNPEPARKA---------------FQENMLSLKEVGWYWGPLSFTEAERLMENKANGTFLVRDSGHDTYFLSLTFRVRETTYHTRIEYSQGTFSFWSQPE-SHSATTISEFIDKAVAHSQSGKFHYFLLTNVPGQPPMEVSLLYPLTRNQIVHSLKHLSRFVILSNIRKDHIANLNIPSPLKLYLLEKQYY 3165
             NP PAR A               F  ++  L+  GWYWGP+++ +AE  +  K +G+FLVRDS    Y LSL+FR +  T+HTR+E+ +GTFS W  P+      ++ EFI++A+ HS++GKF YFL + VPG PP  V LLYP++R   V SL+HL RF I   +R DHI  L +P PL +YL +  YY
Sbjct:  442 ENPAPARLAPPQVMCPLRGADSSSFTASLRELERCGWYWGPMNWEDAEMKLRGKPDGSFLVRDSSDPRYILSLSFRSQGVTHHTRMEHYRGTFSLWCHPKFEDRCHSVVEFIERAIMHSKNGKFLYFLRSRVPGLPPTPVQLLYPVSRFSNVKSLQHLCRFCIRQLVRIDHIQELPLPKPLIVYLRKFYYY 632          
BLAST of Suppressor of cytokine signaling 7 vs. Ensembl Zebrafish
Match: socs7 (suppressor of cytokine signaling 7 [Source:ZFIN;Acc:ZDB-GENE-080204-125])

HSP 1 Score: 172.17 bits (435), Expect = 8.816e-44
Identity = 84/190 (44.21%), Postives = 116/190 (61.05%), Query Frame = 1
Query: 2644 NPEPARKA---------------FQENMLSLKEVGWYWGPLSFTEAERLMENKANGTFLVRDSGHDTYFLSLTFRVRETTYHTRIEYSQGTFSFWSQPE-SHSATTISEFIDKAVAHSQSGKFHYFLLTNVPGQPPMEVSLLYPLTRNQIVHSLKHLSRFVILSNIRKDHIANLNIPSPLKLYLLEKQYY 3165
            NP PAR A               F  ++  L+  GWYWGP+++ +AE  +  K +G+FLVRDS    Y LSL+FR +  T+HTR+E+ +GTFS W  P+      ++ EFI++A+ HS++GKF YFL + VPG PP  V LLYP++R   V SL+HL RF I   +R DHI  L +P PL +YL +  YY
Sbjct:  517 NPAPARLAPPQVMCPLRGADSSSFTASLRELERCGWYWGPMNWEDAEMKLRGKPDGSFLVRDSSDPRYILSLSFRSQGVTHHTRMEHYRGTFSLWCHPKFEDRCHSVVEFIERAIMHSKNGKFLYFLRSRVPGLPPTPVQLLYPVSRFSNVKSLQHLCRFCIRQLVRIDHIQELPLPKPLIVYLRKFYYY 706          
BLAST of Suppressor of cytokine signaling 7 vs. Ensembl Zebrafish
Match: socs7 (suppressor of cytokine signaling 7 [Source:ZFIN;Acc:ZDB-GENE-080204-125])

HSP 1 Score: 171.785 bits (434), Expect = 1.955e-43
Identity = 84/190 (44.21%), Postives = 116/190 (61.05%), Query Frame = 1
Query: 2644 NPEPARKA---------------FQENMLSLKEVGWYWGPLSFTEAERLMENKANGTFLVRDSGHDTYFLSLTFRVRETTYHTRIEYSQGTFSFWSQPE-SHSATTISEFIDKAVAHSQSGKFHYFLLTNVPGQPPMEVSLLYPLTRNQIVHSLKHLSRFVILSNIRKDHIANLNIPSPLKLYLLEKQYY 3165
            NP PAR A               F  ++  L+  GWYWGP+++ +AE  +  K +G+FLVRDS    Y LSL+FR +  T+HTR+E+ +GTFS W  P+      ++ EFI++A+ HS++GKF YFL + VPG PP  V LLYP++R   V SL+HL RF I   +R DHI  L +P PL +YL +  YY
Sbjct:  561 NPAPARLAPPQVMCPLRGADSSSFTASLRELERCGWYWGPMNWEDAEMKLRGKPDGSFLVRDSSDPRYILSLSFRSQGVTHHTRMEHYRGTFSLWCHPKFEDRCHSVVEFIERAIMHSKNGKFLYFLRSRVPGLPPTPVQLLYPVSRFSNVKSLQHLCRFCIRQLVRIDHIQELPLPKPLIVYLRKFYYY 750          
BLAST of Suppressor of cytokine signaling 7 vs. Ensembl Xenopus
Match: cdc42se1 (cdc42 small effector 1 [Source:Xenbase;Acc:XB-GENE-945193])

HSP 1 Score: 165.236 bits (417), Expect = 4.207e-43
Identity = 78/168 (46.43%), Postives = 111/168 (66.07%), Query Frame = 1
Query: 2665 AFQENMLSLKEVGWYWGPLSFTEAERLMENKANGTFLVRDSGHDTYFLSLTFRVRETTYHTRIEYSQGTFSFWSQPE-SHSATTISEFIDKAVAHSQSGKFHYFLLTNVPGQPPMEVSLLYPLTRNQIVHSLKHLSRFVILSNIRKDHIANLNIPSPLKLYLLEKQYY 3165
            +F  ++  L++ GWYWGP+++ +AE  ++ K +G+FLVRDS    Y LSL+FR +  T+HTR+E+ +GTFS W  P+      ++ EFI +A+ HS++GKF YFL + VPG PP  V LLYP++R   V SL+HL RF I   +R DHI  L +P PL  YL +  YY
Sbjct:  258 SFAASLRELEKCGWYWGPMNWEDAEMKLKAKPDGSFLVRDSSDPRYILSLSFRSQGITHHTRMEHYRGTFSLWCHPKFEDRCQSVVEFIKRAIMHSKNGKFLYFLRSRVPGLPPTPVQLLYPVSRFSNVKSLQHLCRFRIRQLVRIDHIPELPLPKPLISYLRKFYYY 425          
BLAST of Suppressor of cytokine signaling 7 vs. Ensembl Xenopus
Match: cdc42se1 (cdc42 small effector 1 [Source:Xenbase;Acc:XB-GENE-945193])

HSP 1 Score: 166.777 bits (421), Expect = 7.493e-43
Identity = 78/168 (46.43%), Postives = 111/168 (66.07%), Query Frame = 1
Query: 2665 AFQENMLSLKEVGWYWGPLSFTEAERLMENKANGTFLVRDSGHDTYFLSLTFRVRETTYHTRIEYSQGTFSFWSQPE-SHSATTISEFIDKAVAHSQSGKFHYFLLTNVPGQPPMEVSLLYPLTRNQIVHSLKHLSRFVILSNIRKDHIANLNIPSPLKLYLLEKQYY 3165
            +F  ++  L++ GWYWGP+++ +AE  ++ K +G+FLVRDS    Y LSL+FR +  T+HTR+E+ +GTFS W  P+      ++ EFI +A+ HS++GKF YFL + VPG PP  V LLYP++R   V SL+HL RF I   +R DHI  L +P PL  YL +  YY
Sbjct:  342 SFAASLRELEKCGWYWGPMNWEDAEMKLKAKPDGSFLVRDSSDPRYILSLSFRSQGITHHTRMEHYRGTFSLWCHPKFEDRCQSVVEFIKRAIMHSKNGKFLYFLRSRVPGLPPTPVQLLYPVSRFSNVKSLQHLCRFRIRQLVRIDHIPELPLPKPLISYLRKFYYY 509          
BLAST of Suppressor of cytokine signaling 7 vs. Ensembl Xenopus
Match: cdc42se1 (cdc42 small effector 1 [Source:Xenbase;Acc:XB-GENE-945193])

HSP 1 Score: 166.392 bits (420), Expect = 1.608e-42
Identity = 78/168 (46.43%), Postives = 111/168 (66.07%), Query Frame = 1
Query: 2665 AFQENMLSLKEVGWYWGPLSFTEAERLMENKANGTFLVRDSGHDTYFLSLTFRVRETTYHTRIEYSQGTFSFWSQPE-SHSATTISEFIDKAVAHSQSGKFHYFLLTNVPGQPPMEVSLLYPLTRNQIVHSLKHLSRFVILSNIRKDHIANLNIPSPLKLYLLEKQYY 3165
            +F  ++  L++ GWYWGP+++ +AE  ++ K +G+FLVRDS    Y LSL+FR +  T+HTR+E+ +GTFS W  P+      ++ EFI +A+ HS++GKF YFL + VPG PP  V LLYP++R   V SL+HL RF I   +R DHI  L +P PL  YL +  YY
Sbjct:  376 SFAASLRELEKCGWYWGPMNWEDAEMKLKAKPDGSFLVRDSSDPRYILSLSFRSQGITHHTRMEHYRGTFSLWCHPKFEDRCQSVVEFIKRAIMHSKNGKFLYFLRSRVPGLPPTPVQLLYPVSRFSNVKSLQHLCRFRIRQLVRIDHIPELPLPKPLISYLRKFYYY 543          
BLAST of Suppressor of cytokine signaling 7 vs. Ensembl Xenopus
Match: tmbim6 (transmembrane BAX inhibitor motif containing 6 [Source:Xenbase;Acc:XB-GENE-952610])

HSP 1 Score: 139.428 bits (350), Expect = 8.170e-34
Identity = 76/176 (43.18%), Postives = 102/176 (57.95%), Query Frame = 1
Query: 2635 QNNNPEPARKAFQENMLSLKEVGWYWGPLSFTEAERLMENKANGTFLVRDSGHDTYFLSLTFRVRETTYHTRIEYSQGTFSFWSQPESHSATTISEFIDKAVAHSQSGKFHYFLLTNVPGQPPMEVSLLYPLTRNQIVHSLKHLSRFVILSNIRKDHIANLNIPSPLKLYLLEKQY 3162
            QN+ P     +  E +  L   GWYWGP++  EAE  + N  +G+FLVRDS  D Y LSL+FR    T HTRIE+S G FSF+ QP+    T+I E I+ ++  S++G F Y   + VPG     V L  P++R   V SL++L RFVI    R D I  L +P+ +K YL EK Y
Sbjct:  360 QNSGPM-VVTSLTEELKKLARQGWYWGPITRWEAEEKLANVLDGSFLVRDSSDDRYLLSLSFRSHSKTLHTRIEHSNGRFSFYEQPDVEGHTSIVELIEHSIRDSENGAFCYS-RSRVPGSATYPVRLTNPVSRFMQVRSLQYLCRFVIRQYTRIDLIQKLPLPNKMKDYLQEKHY 533          
BLAST of Suppressor of cytokine signaling 7 vs. Ensembl Xenopus
Match: socs2 (suppressor of cytokine signaling 2 [Source:NCBI gene;Acc:100151723])

HSP 1 Score: 75.0998 bits (183), Expect = 1.424e-14
Identity = 53/171 (30.99%), Postives = 83/171 (48.54%), Query Frame = 1
Query: 2668 FQENMLSLKEVGWYWGPLSFTEAERLMENKANGTFLVRDSGHDTYFLSLTFRVRETTYHTRIEYSQGTFSFWSQPESHSAT----TISEFIDKAVAHSQSGKFHYFLLTNVPGQPPMEVSLLYPLTRNQIVHSLKHLSRFVILSNIRKDHIANLNIPSPLKLYLLEKQYYI 3168
              E+M  L+  GWYWG ++  EA+  +++   GTFLVRDS H  Y L+++ +      + RIEY +G F   S     S      ++   I+  V  S++ K     L N      + + L+ PL  +    SL+HL R  +  N   D I  L +P  LK Y+ E +Y++
Sbjct:   39 IAESMSELRRSGWYWGNMTVDEAKEKLQDAPEGTFLVRDSSHTDYLLTISVKTSAGPTNLRIEYREGKFRLDSVVCVRSRLKQFDSVVHLIEYYVLLSKNKKIESETLPN----RTVHLWLVKPLYTS--APSLQHLCRMTV--NKCTDKIDELPLPMRLKEYITEYRYHV 201          
BLAST of Suppressor of cytokine signaling 7 vs. Ensembl Mouse
Match: Socs7 (suppressor of cytokine signaling 7 [Source:MGI Symbol;Acc:MGI:2651588])

HSP 1 Score: 167.162 bits (422), Expect = 7.358e-43
Identity = 78/172 (45.35%), Postives = 113/172 (65.70%), Query Frame = 1
Query: 2653 PARKAFQENMLSLKEVGWYWGPLSFTEAERLMENKANGTFLVRDSGHDTYFLSLTFRVRETTYHTRIEYSQGTFSFWSQPE-SHSATTISEFIDKAVAHSQSGKFHYFLLTNVPGQPPMEVSLLYPLTRNQIVHSLKHLSRFVILSNIRKDHIANLNIPSPLKLYLLEKQYY 3165
            P   +F  ++  L++ GWYWGP+++ +AE  ++ K +G+FLVRDS    Y LSL+FR +  T+HTR+E+ +GTFS W  P+      ++ EFI +A+ HS++GKF YFL + VPG PP  V LLYP++R   V SL+HL RF I   +R DHI +L +P PL  Y+ +  YY
Sbjct:  381 PDSSSFAASLRELEKCGWYWGPMNWEDAEMKLKGKPDGSFLVRDSSDPRYILSLSFRSQGITHHTRMEHYRGTFSLWCHPKFEDRCQSVVEFIKRAIMHSKNGKFLYFLRSRVPGLPPTPVQLLYPVSRFSNVKSLQHLCRFRIRQLVRIDHIPDLPLPKPLISYIRKFYYY 552          
BLAST of Suppressor of cytokine signaling 7 vs. Ensembl Mouse
Match: Socs7 (suppressor of cytokine signaling 7 [Source:MGI Symbol;Acc:MGI:2651588])

HSP 1 Score: 167.162 bits (422), Expect = 2.055e-42
Identity = 78/172 (45.35%), Postives = 113/172 (65.70%), Query Frame = 1
Query: 2653 PARKAFQENMLSLKEVGWYWGPLSFTEAERLMENKANGTFLVRDSGHDTYFLSLTFRVRETTYHTRIEYSQGTFSFWSQPE-SHSATTISEFIDKAVAHSQSGKFHYFLLTNVPGQPPMEVSLLYPLTRNQIVHSLKHLSRFVILSNIRKDHIANLNIPSPLKLYLLEKQYY 3165
            P   +F  ++  L++ GWYWGP+++ +AE  ++ K +G+FLVRDS    Y LSL+FR +  T+HTR+E+ +GTFS W  P+      ++ EFI +A+ HS++GKF YFL + VPG PP  V LLYP++R   V SL+HL RF I   +R DHI +L +P PL  Y+ +  YY
Sbjct:  450 PDSSSFAASLRELEKCGWYWGPMNWEDAEMKLKGKPDGSFLVRDSSDPRYILSLSFRSQGITHHTRMEHYRGTFSLWCHPKFEDRCQSVVEFIKRAIMHSKNGKFLYFLRSRVPGLPPTPVQLLYPVSRFSNVKSLQHLCRFRIRQLVRIDHIPDLPLPKPLISYIRKFYYY 621          
BLAST of Suppressor of cytokine signaling 7 vs. Ensembl Mouse
Match: Socs6 (suppressor of cytokine signaling 6 [Source:MGI Symbol;Acc:MGI:1924885])

HSP 1 Score: 135.191 bits (339), Expect = 1.541e-32
Identity = 71/166 (42.77%), Postives = 99/166 (59.64%), Query Frame = 1
Query: 2665 AFQENMLSLKEVGWYWGPLSFTEAERLMENKANGTFLVRDSGHDTYFLSLTFRVRETTYHTRIEYSQGTFSFWSQPESHSATTISEFIDKAVAHSQSGKFHYFLLTNVPGQPPMEVSLLYPLTRNQIVHSLKHLSRFVILSNIRKDHIANLNIPSPLKLYLLEKQY 3162
            +  E +  L + GWYWGP++  EAE  + N  +G+FLVRDS  D Y LSL+FR    T HTRIE+S G FSF+ QP+    T+I + I+ ++  S++G F Y   + +PG     V L  P++R   V SL++L RFVI    R D I  L +P+ +K YL EK Y
Sbjct:  369 SLTEELKKLAKQGWYWGPITRWEAEGKLANVPDGSFLVRDSSDDRYLLSLSFRSHGKTLHTRIEHSNGRFSFYEQPDVEGHTSIVDLIEHSIRDSENGAFCYS-RSRLPGSATYPVRLTNPVSRFMQVRSLQYLCRFVIRQYTRIDLIQKLPLPNKMKDYLQEKHY 533          
BLAST of Suppressor of cytokine signaling 7 vs. Ensembl Mouse
Match: Socs6 (suppressor of cytokine signaling 6 [Source:MGI Symbol;Acc:MGI:1924885])

HSP 1 Score: 135.191 bits (339), Expect = 1.541e-32
Identity = 71/166 (42.77%), Postives = 99/166 (59.64%), Query Frame = 1
Query: 2665 AFQENMLSLKEVGWYWGPLSFTEAERLMENKANGTFLVRDSGHDTYFLSLTFRVRETTYHTRIEYSQGTFSFWSQPESHSATTISEFIDKAVAHSQSGKFHYFLLTNVPGQPPMEVSLLYPLTRNQIVHSLKHLSRFVILSNIRKDHIANLNIPSPLKLYLLEKQY 3162
            +  E +  L + GWYWGP++  EAE  + N  +G+FLVRDS  D Y LSL+FR    T HTRIE+S G FSF+ QP+    T+I + I+ ++  S++G F Y   + +PG     V L  P++R   V SL++L RFVI    R D I  L +P+ +K YL EK Y
Sbjct:  369 SLTEELKKLAKQGWYWGPITRWEAEGKLANVPDGSFLVRDSSDDRYLLSLSFRSHGKTLHTRIEHSNGRFSFYEQPDVEGHTSIVDLIEHSIRDSENGAFCYS-RSRLPGSATYPVRLTNPVSRFMQVRSLQYLCRFVIRQYTRIDLIQKLPLPNKMKDYLQEKHY 533          
BLAST of Suppressor of cytokine signaling 7 vs. Ensembl Mouse
Match: Socs6 (suppressor of cytokine signaling 6 [Source:MGI Symbol;Acc:MGI:1924885])

HSP 1 Score: 135.191 bits (339), Expect = 1.541e-32
Identity = 71/166 (42.77%), Postives = 99/166 (59.64%), Query Frame = 1
Query: 2665 AFQENMLSLKEVGWYWGPLSFTEAERLMENKANGTFLVRDSGHDTYFLSLTFRVRETTYHTRIEYSQGTFSFWSQPESHSATTISEFIDKAVAHSQSGKFHYFLLTNVPGQPPMEVSLLYPLTRNQIVHSLKHLSRFVILSNIRKDHIANLNIPSPLKLYLLEKQY 3162
            +  E +  L + GWYWGP++  EAE  + N  +G+FLVRDS  D Y LSL+FR    T HTRIE+S G FSF+ QP+    T+I + I+ ++  S++G F Y   + +PG     V L  P++R   V SL++L RFVI    R D I  L +P+ +K YL EK Y
Sbjct:  369 SLTEELKKLAKQGWYWGPITRWEAEGKLANVPDGSFLVRDSSDDRYLLSLSFRSHGKTLHTRIEHSNGRFSFYEQPDVEGHTSIVDLIEHSIRDSENGAFCYS-RSRLPGSATYPVRLTNPVSRFMQVRSLQYLCRFVIRQYTRIDLIQKLPLPNKMKDYLQEKHY 533          
BLAST of Suppressor of cytokine signaling 7 vs. UniProt/SwissProt
Match: sp|Q8VHQ2|SOCS7_MOUSE (Suppressor of cytokine signaling 7 OS=Mus musculus OX=10090 GN=Socs7 PE=1 SV=1)

HSP 1 Score: 167.162 bits (422), Expect = 5.147e-42
Identity = 78/172 (45.35%), Postives = 113/172 (65.70%), Query Frame = 1
Query: 2653 PARKAFQENMLSLKEVGWYWGPLSFTEAERLMENKANGTFLVRDSGHDTYFLSLTFRVRETTYHTRIEYSQGTFSFWSQPE-SHSATTISEFIDKAVAHSQSGKFHYFLLTNVPGQPPMEVSLLYPLTRNQIVHSLKHLSRFVILSNIRKDHIANLNIPSPLKLYLLEKQYY 3165
            P   +F  ++  L++ GWYWGP+++ +AE  ++ K +G+FLVRDS    Y LSL+FR +  T+HTR+E+ +GTFS W  P+      ++ EFI +A+ HS++GKF YFL + VPG PP  V LLYP++R   V SL+HL RF I   +R DHI +L +P PL  Y+ +  YY
Sbjct:  381 PDSSSFAASLRELEKCGWYWGPMNWEDAEMKLKGKPDGSFLVRDSSDPRYILSLSFRSQGITHHTRMEHYRGTFSLWCHPKFEDRCQSVVEFIKRAIMHSKNGKFLYFLRSRVPGLPPTPVQLLYPVSRFSNVKSLQHLCRFRIRQLVRIDHIPDLPLPKPLISYIRKFYYY 552          
BLAST of Suppressor of cytokine signaling 7 vs. UniProt/SwissProt
Match: sp|O14512|SOCS7_HUMAN (Suppressor of cytokine signaling 7 OS=Homo sapiens OX=9606 GN=SOCS7 PE=1 SV=2)

HSP 1 Score: 167.162 bits (422), Expect = 5.652e-42
Identity = 78/172 (45.35%), Postives = 113/172 (65.70%), Query Frame = 1
Query: 2653 PARKAFQENMLSLKEVGWYWGPLSFTEAERLMENKANGTFLVRDSGHDTYFLSLTFRVRETTYHTRIEYSQGTFSFWSQPE-SHSATTISEFIDKAVAHSQSGKFHYFLLTNVPGQPPMEVSLLYPLTRNQIVHSLKHLSRFVILSNIRKDHIANLNIPSPLKLYLLEKQYY 3165
            P   +F  ++  L++ GWYWGP+++ +AE  ++ K +G+FLVRDS    Y LSL+FR +  T+HTR+E+ +GTFS W  P+      ++ EFI +A+ HS++GKF YFL + VPG PP  V LLYP++R   V SL+HL RF I   +R DHI +L +P PL  Y+ +  YY
Sbjct:  383 PDSSSFAASLRELEKCGWYWGPMNWEDAEMKLKGKPDGSFLVRDSSDPRYILSLSFRSQGITHHTRMEHYRGTFSLWCHPKFEDRCQSVVEFIKRAIMHSKNGKFLYFLRSRVPGLPPTPVQLLYPVSRFSNVKSLQHLCRFRIRQLVRIDHIPDLPLPKPLISYIRKFYYY 554          
BLAST of Suppressor of cytokine signaling 7 vs. UniProt/SwissProt
Match: sp|Q5RCM6|SOCS6_PONAB (Suppressor of cytokine signaling 6 OS=Pongo abelii OX=9601 GN=SOCS6 PE=2 SV=1)

HSP 1 Score: 135.961 bits (341), Expect = 5.273e-32
Identity = 71/166 (42.77%), Postives = 99/166 (59.64%), Query Frame = 1
Query: 2665 AFQENMLSLKEVGWYWGPLSFTEAERLMENKANGTFLVRDSGHDTYFLSLTFRVRETTYHTRIEYSQGTFSFWSQPESHSATTISEFIDKAVAHSQSGKFHYFLLTNVPGQPPMEVSLLYPLTRNQIVHSLKHLSRFVILSNIRKDHIANLNIPSPLKLYLLEKQY 3162
            +  E +  L + GWYWGP++  EAE  + N  +G+FLVRDS  D Y LSL+FR    T HTRIE+S G FSF+ QP+    T+I + I+ ++  S++G F Y   + +PG     V L  P++R   V SL++L RFVI    R D I  L +P+ +K YL EK Y
Sbjct:  371 SLTEELKKLAKQGWYWGPITRWEAEGKLANVPDGSFLVRDSSDDRYLLSLSFRSHGKTLHTRIEHSNGRFSFYEQPDVEGHTSIVDLIEHSIRDSENGAFCYS-RSRLPGSATYPVRLTNPVSRFMQVRSLQYLCRFVIRQYTRIDLIQKLPLPNKMKDYLQEKHY 535          
BLAST of Suppressor of cytokine signaling 7 vs. UniProt/SwissProt
Match: sp|O14544|SOCS6_HUMAN (Suppressor of cytokine signaling 6 OS=Homo sapiens OX=9606 GN=SOCS6 PE=1 SV=2)

HSP 1 Score: 135.961 bits (341), Expect = 5.937e-32
Identity = 71/166 (42.77%), Postives = 99/166 (59.64%), Query Frame = 1
Query: 2665 AFQENMLSLKEVGWYWGPLSFTEAERLMENKANGTFLVRDSGHDTYFLSLTFRVRETTYHTRIEYSQGTFSFWSQPESHSATTISEFIDKAVAHSQSGKFHYFLLTNVPGQPPMEVSLLYPLTRNQIVHSLKHLSRFVILSNIRKDHIANLNIPSPLKLYLLEKQY 3162
            +  E +  L + GWYWGP++  EAE  + N  +G+FLVRDS  D Y LSL+FR    T HTRIE+S G FSF+ QP+    T+I + I+ ++  S++G F Y   + +PG     V L  P++R   V SL++L RFVI    R D I  L +P+ +K YL EK Y
Sbjct:  371 SLTEELKKLAKQGWYWGPITRWEAEGKLANVPDGSFLVRDSSDDRYLLSLSFRSHGKTLHTRIEHSNGRFSFYEQPDVEGHTSIVDLIEHSIRDSENGAFCYS-RSRLPGSATYPVRLTNPVSRFMQVRSLQYLCRFVIRQYTRIDLIQKLPLPNKMKDYLQEKHY 535          
BLAST of Suppressor of cytokine signaling 7 vs. UniProt/SwissProt
Match: sp|Q9JLY0|SOCS6_MOUSE (Suppressor of cytokine signaling 6 OS=Mus musculus OX=10090 GN=Socs6 PE=1 SV=2)

HSP 1 Score: 135.191 bits (339), Expect = 1.078e-31
Identity = 71/166 (42.77%), Postives = 99/166 (59.64%), Query Frame = 1
Query: 2665 AFQENMLSLKEVGWYWGPLSFTEAERLMENKANGTFLVRDSGHDTYFLSLTFRVRETTYHTRIEYSQGTFSFWSQPESHSATTISEFIDKAVAHSQSGKFHYFLLTNVPGQPPMEVSLLYPLTRNQIVHSLKHLSRFVILSNIRKDHIANLNIPSPLKLYLLEKQY 3162
            +  E +  L + GWYWGP++  EAE  + N  +G+FLVRDS  D Y LSL+FR    T HTRIE+S G FSF+ QP+    T+I + I+ ++  S++G F Y   + +PG     V L  P++R   V SL++L RFVI    R D I  L +P+ +K YL EK Y
Sbjct:  369 SLTEELKKLAKQGWYWGPITRWEAEGKLANVPDGSFLVRDSSDDRYLLSLSFRSHGKTLHTRIEHSNGRFSFYEQPDVEGHTSIVDLIEHSIRDSENGAFCYS-RSRLPGSATYPVRLTNPVSRFMQVRSLQYLCRFVIRQYTRIDLIQKLPLPNKMKDYLQEKHY 533          
BLAST of Suppressor of cytokine signaling 7 vs. TrEMBL
Match: W6V3R8 (Suppressor of cytokine signaling 7 OS=Echinococcus granulosus OX=6210 GN=EGR_04527 PE=4 SV=1)

HSP 1 Score: 267.314 bits (682), Expect = 4.434e-77
Identity = 122/190 (64.21%), Postives = 154/190 (81.05%), Query Frame = 1
Query: 2659 RKAFQENMLSLKEVGWYWGPLSFTEAERLMENKANGTFLVRDSGHDTYFLSLTFRVRETTYHTRIEYSQGTFSFWSQPESHSATTISEFIDKAVAHSQSGKFHYFLLTNVPGQPPMEVSLLYPLTRNQIVHSLKHLSRFVILSNIRKDHIANLNIPSPLKLYLLEKQYYISNLDHFIEATMDAHPLNYKP 3228
            R +FQE+M +L+++GWYWGPLSFTEAE+L+ N+ +GTFLVRDS HDT+FLSL+FRVR TTYHTRIE++QG FSFW +PESHSA+T+ EFI+KAVAHS  GK+HYFL T+ PGQ P+EVSLLYPL+R Q+V SLKHL+RF ILS++R+DH+A L +P     YLLEKQ Y  +L+ F E   D  PL + P
Sbjct:  110 RSSFQESMKALRKMGWYWGPLSFTEAEKLLANRPDGTFLVRDSAHDTFFLSLSFRVRGTTYHTRIEHNQGRFSFWFEPESHSASTVVEFIEKAVAHSIGGKYHYFLQTSTPGQQPVEVSLLYPLSRFQVVQSLKHLARFTILSHVRRDHVARLPLPPGQIGYLLEKQVYWESLEDFEETIRDRPPLQFTP 299          
BLAST of Suppressor of cytokine signaling 7 vs. TrEMBL
Match: A0A0R3T5D4 (Uncharacterized protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS2271 PE=4 SV=1)

HSP 1 Score: 274.248 bits (700), Expect = 3.221e-74
Identity = 129/221 (58.37%), Postives = 166/221 (75.11%), Query Frame = 1
Query: 2560 TAPTVAISNLSSFNIHQQHFNLKDKQNNNPEPARKAFQENMLSLKEVGWYWGPLSFTEAERLMENKANGTFLVRDSGHDTYFLSLTFRVRETTYHTRIEYSQGTFSFWSQPESHSATTISEFIDKAVAHSQSGKFHYFLLTNVPGQPPMEVSLLYPLTRNQIVHSLKHLSRFVILSNIRKDHIANLNIPSPLKLYLLEKQYYISNLDHFIEATMDAHPLNY 3222
            T  T+A S  +S +  Q   N  D         R +FQE+M +L+++GWYWGPLSFTEAE+L+ N+ +GTFLVRDS HDT+FLSL+FRVR++TYHTRIE++QG FSFW +PESHSA+T+ EFI+KAVAHS  GK+HYFL T+ PGQ P+EVSLLYPL+R Q+V SLKHL+RF ILS++R+DH+A L +P     YLLEKQ Y  +L+ F EA  D  PL +
Sbjct:  579 TTATIAQSVPTSASNQQSSTNAADH--------RSSFQESMKALRKMGWYWGPLSFTEAEKLLANRPDGTFLVRDSAHDTFFLSLSFRVRDSTYHTRIEHNQGRFSFWFEPESHSASTVVEFIEKAVAHSIGGKYHYFLQTSTPGQQPVEVSLLYPLSRFQVVQSLKHLARFTILSHVRRDHVARLPLPPSQIGYLLEKQVYWESLEDFEEAIRDRPPLQF 791          
BLAST of Suppressor of cytokine signaling 7 vs. TrEMBL
Match: A0A158QEV7 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS7970 PE=4 SV=1)

HSP 1 Score: 273.863 bits (699), Expect = 4.600e-74
Identity = 122/188 (64.89%), Postives = 154/188 (81.91%), Query Frame = 1
Query: 2659 RKAFQENMLSLKEVGWYWGPLSFTEAERLMENKANGTFLVRDSGHDTYFLSLTFRVRETTYHTRIEYSQGTFSFWSQPESHSATTISEFIDKAVAHSQSGKFHYFLLTNVPGQPPMEVSLLYPLTRNQIVHSLKHLSRFVILSNIRKDHIANLNIPSPLKLYLLEKQYYISNLDHFIEATMDAHPLNY 3222
            R +FQE+M +L+++GWYWGPLSFTEAE+L+ N+ +GTFLVRDS HDT+FLSL+FRVR TTYHTRIE++QG FSFW +PESHSA+T+ EFI+KAVAHS  GK+HYFL T+ PGQ P+EVSLLYPL+R Q+V SLKHL+RF ILS++R+DH+A L +P     YLLEKQ Y  +L+ F EA  D  PL +
Sbjct:  605 RSSFQESMKALRKMGWYWGPLSFTEAEKLLANRPDGTFLVRDSAHDTFFLSLSFRVRGTTYHTRIEHNQGRFSFWFEPESHSASTVVEFIEKAVAHSIGGKYHYFLQTSTPGQQPVEVSLLYPLSRFQVVQSLKHLARFTILSHVRRDHVARLPLPPSQIGYLLEKQVYWESLEDFEEAIRDRPPLQF 792          
BLAST of Suppressor of cytokine signaling 7 vs. TrEMBL
Match: A0A0R3X8K9 (Uncharacterized protein OS=Hydatigena taeniaeformis OX=6205 GN=TTAC_LOCUS9869 PE=4 SV=1)

HSP 1 Score: 274.633 bits (701), Expect = 1.361e-73
Identity = 123/190 (64.74%), Postives = 154/190 (81.05%), Query Frame = 1
Query: 2659 RKAFQENMLSLKEVGWYWGPLSFTEAERLMENKANGTFLVRDSGHDTYFLSLTFRVRETTYHTRIEYSQGTFSFWSQPESHSATTISEFIDKAVAHSQSGKFHYFLLTNVPGQPPMEVSLLYPLTRNQIVHSLKHLSRFVILSNIRKDHIANLNIPSPLKLYLLEKQYYISNLDHFIEATMDAHPLNYKP 3228
            R +FQE+M +L+++GWYWGPLSFTEAE+L+ N+ +GTFLVRDS HDT+FLSL+FRVR TTYHTRIE++QG FSFW +PESHSA+T+ EFI+KAVAHS  GK+HYFL T+ PGQ P+EVSLLYPL+R Q+V SLKHL+RF ILSN+R+DH+A L +P     YLLEKQ Y  +L+ F E   D  PL + P
Sbjct:  718 RSSFQESMKALRKMGWYWGPLSFTEAEKLLANRPDGTFLVRDSAHDTFFLSLSFRVRGTTYHTRIEHNQGRFSFWFEPESHSASTVVEFIEKAVAHSIGGKYHYFLQTSTPGQQPVEVSLLYPLSRFQVVQSLKHLARFTILSNVRRDHVARLPLPPGQIGYLLEKQVYWESLEDFEETIRDRPPLQFTP 907          
BLAST of Suppressor of cytokine signaling 7 vs. TrEMBL
Match: A0A564YWL8 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS10212 PE=4 SV=1)

HSP 1 Score: 251.136 bits (640), Expect = 4.359e-73
Identity = 116/175 (66.29%), Postives = 143/175 (81.71%), Query Frame = 1
Query: 2698 VGWYWGPLSFTEAERLMENKANGTFLVRDSGHDTYFLSLTFRVRETTYHTRIEYSQGTFSFWSQPESHSATTISEFIDKAVAHSQSGKFHYFLLTNVPGQPPMEVSLLYPLTRNQIVHSLKHLSRFVILSNIRKDHIANLNIPSPLKLYLLEKQYYISNLDHFIEATMDAHPLNY 3222
            +GWYWGPLSFTEAE+L+ N+ +GTFLVRDS HDT+FLSL+FRVR TTYHTRIE++QG FSFW +PESHSA+T+ EFI+KAVAHS  GK+HYFL T+ PGQ P+EVSLLYPL+R Q+V SLKHL+RF ILS++R+DH+A L +P     YLLEKQ Y  +L+ F EA  D  PL +
Sbjct:    1 MGWYWGPLSFTEAEKLLANRPDGTFLVRDSAHDTFFLSLSFRVRGTTYHTRIEHNQGRFSFWFEPESHSASTVVEFIEKAVAHSIGGKYHYFLQTSTPGQQPVEVSLLYPLSRFQVVQSLKHLARFTILSHVRRDHVARLPLPPSQIGYLLEKQVYWESLEDFEEAIRDRPPLQF 175          
BLAST of Suppressor of cytokine signaling 7 vs. Ensembl Cavefish
Match: ENSAMXT00000044677.1 (suppressor of cytokine signaling 7-like [Source:NCBI gene;Acc:103036776])

HSP 1 Score: 172.555 bits (436), Expect = 4.353e-44
Identity = 78/172 (45.35%), Postives = 116/172 (67.44%), Query Frame = 1
Query: 2653 PARKAFQENMLSLKEVGWYWGPLSFTEAERLMENKANGTFLVRDSGHDTYFLSLTFRVRETTYHTRIEYSQGTFSFWSQPE-SHSATTISEFIDKAVAHSQSGKFHYFLLTNVPGQPPMEVSLLYPLTRNQIVHSLKHLSRFVILSNIRKDHIANLNIPSPLKLYLLEKQYY 3165
            P   +F  ++  L++ GWYWGP+++ +AE  ++ KA+G+FLVRDS    Y LSL+FR +  T+HTR+E+ +GTFS W  P+      ++ EFI++A+ HS++G+F YFL + VPG PP  V LLYP++R   V SL+HL RF I   +R DHI  L +P+PL +YL +  +Y
Sbjct:  504 PDSSSFATSLRELEKCGWYWGPMNWEDAEMKLKGKADGSFLVRDSSDPRYILSLSFRSQGVTHHTRMEHYRGTFSLWCHPKFEDRCHSVVEFIERAIMHSKNGRFLYFLRSRVPGLPPTPVQLLYPVSRFSSVKSLQHLCRFCIRQLVRIDHIQELPLPTPLIVYLRKFYFY 675          
BLAST of Suppressor of cytokine signaling 7 vs. Ensembl Cavefish
Match: ENSAMXT00000008256.2 (suppressor of cytokine signaling 7-like [Source:NCBI gene;Acc:103036776])

HSP 1 Score: 172.555 bits (436), Expect = 6.652e-44
Identity = 78/172 (45.35%), Postives = 116/172 (67.44%), Query Frame = 1
Query: 2653 PARKAFQENMLSLKEVGWYWGPLSFTEAERLMENKANGTFLVRDSGHDTYFLSLTFRVRETTYHTRIEYSQGTFSFWSQPE-SHSATTISEFIDKAVAHSQSGKFHYFLLTNVPGQPPMEVSLLYPLTRNQIVHSLKHLSRFVILSNIRKDHIANLNIPSPLKLYLLEKQYY 3165
            P   +F  ++  L++ GWYWGP+++ +AE  ++ KA+G+FLVRDS    Y LSL+FR +  T+HTR+E+ +GTFS W  P+      ++ EFI++A+ HS++G+F YFL + VPG PP  V LLYP++R   V SL+HL RF I   +R DHI  L +P+PL +YL +  +Y
Sbjct:  538 PDSSSFATSLRELEKCGWYWGPMNWEDAEMKLKGKADGSFLVRDSSDPRYILSLSFRSQGVTHHTRMEHYRGTFSLWCHPKFEDRCHSVVEFIERAIMHSKNGRFLYFLRSRVPGLPPTPVQLLYPVSRFSSVKSLQHLCRFCIRQLVRIDHIQELPLPTPLIVYLRKFYFY 709          
BLAST of Suppressor of cytokine signaling 7 vs. Ensembl Cavefish
Match: socs7 (suppressor of cytokine signaling 7 [Source:ZFIN;Acc:ZDB-GENE-080204-125])

HSP 1 Score: 169.088 bits (427), Expect = 2.306e-43
Identity = 78/168 (46.43%), Postives = 112/168 (66.67%), Query Frame = 1
Query: 2665 AFQENMLSLKEVGWYWGPLSFTEAERLMENKANGTFLVRDSGHDTYFLSLTFRVRETTYHTRIEYSQGTFSFWSQPE-SHSATTISEFIDKAVAHSQSGKFHYFLLTNVPGQPPMEVSLLYPLTRNQIVHSLKHLSRFVILSNIRKDHIANLNIPSPLKLYLLEKQYY 3165
            +F  ++  L+  GWYWGP+++ +AE  ++ K +G+FLVRDS    Y LSL+FR +  T+HTR+E+ +GTFS W  P+      ++ EFI++A+ HS++GKF YFL + VPG PP  V LLYP++R   V SL+HL RF I   +R DHI  L +P PL +YL +  YY
Sbjct:  424 SFTASLRELERCGWYWGPMNWEDAELKLKGKPDGSFLVRDSSDPRYILSLSFRSQGVTHHTRMEHYRGTFSLWCHPKFEDRCHSVVEFIERAIMHSKNGKFLYFLRSRVPGLPPTPVQLLYPVSRFCNVKSLQHLCRFCIRQLVRIDHIQELPLPKPLIVYLRKFYYY 591          
BLAST of Suppressor of cytokine signaling 7 vs. Ensembl Cavefish
Match: socs7 (suppressor of cytokine signaling 7 [Source:ZFIN;Acc:ZDB-GENE-080204-125])

HSP 1 Score: 169.474 bits (428), Expect = 2.492e-43
Identity = 78/168 (46.43%), Postives = 112/168 (66.67%), Query Frame = 1
Query: 2665 AFQENMLSLKEVGWYWGPLSFTEAERLMENKANGTFLVRDSGHDTYFLSLTFRVRETTYHTRIEYSQGTFSFWSQPE-SHSATTISEFIDKAVAHSQSGKFHYFLLTNVPGQPPMEVSLLYPLTRNQIVHSLKHLSRFVILSNIRKDHIANLNIPSPLKLYLLEKQYY 3165
            +F  ++  L+  GWYWGP+++ +AE  ++ K +G+FLVRDS    Y LSL+FR +  T+HTR+E+ +GTFS W  P+      ++ EFI++A+ HS++GKF YFL + VPG PP  V LLYP++R   V SL+HL RF I   +R DHI  L +P PL +YL +  YY
Sbjct:  448 SFTASLRELERCGWYWGPMNWEDAELKLKGKPDGSFLVRDSSDPRYILSLSFRSQGVTHHTRMEHYRGTFSLWCHPKFEDRCHSVVEFIERAIMHSKNGKFLYFLRSRVPGLPPTPVQLLYPVSRFCNVKSLQHLCRFCIRQLVRIDHIQELPLPKPLIVYLRKFYYY 615          
BLAST of Suppressor of cytokine signaling 7 vs. Ensembl Cavefish
Match: socs6a (suppressor of cytokine signaling 6a [Source:ZFIN;Acc:ZDB-GENE-080722-35])

HSP 1 Score: 134.42 bits (337), Expect = 5.747e-33
Identity = 70/166 (42.17%), Postives = 100/166 (60.24%), Query Frame = 1
Query: 2665 AFQENMLSLKEVGWYWGPLSFTEAERLMENKANGTFLVRDSGHDTYFLSLTFRVRETTYHTRIEYSQGTFSFWSQPESHSATTISEFIDKAVAHSQSGKFHYFLLTNVPGQPPMEVSLLYPLTRNQIVHSLKHLSRFVILSNIRKDHIANLNIPSPLKLYLLEKQY 3162
            +  E +  L + GWYWGP++  EAE  + +  +G+FLVRDS  D Y LSL+FR +  T HTRIE+S G FSF+ QP+    T+I + I+ ++  S++G F Y   + +PG     V L  P++R   V SL++L RFVI    R D I  L +P+ +K YL EK Y
Sbjct:  285 SLTEELKKLAKQGWYWGPITRWEAEEKLLDLPDGSFLVRDSSDDRYLLSLSFRSQSKTLHTRIEHSNGRFSFYEQPDVEGHTSIVDLIEHSIKDSENGAFCYS-RSRLPGSATYPVRLTNPVSRFMQVRSLQYLCRFVIRQYTRIDLIQKLPLPNKMKDYLQEKHY 449          
BLAST of Suppressor of cytokine signaling 7 vs. Ensembl Sea Lamprey
Match: socs6b (suppressor of cytokine signaling 6b [Source:ZFIN;Acc:ZDB-GENE-030131-1670])

HSP 1 Score: 135.191 bits (339), Expect = 2.262e-33
Identity = 70/169 (41.42%), Postives = 99/169 (58.58%), Query Frame = 1
Query: 2656 ARKAFQENMLSLKEVGWYWGPLSFTEAERLMENKANGTFLVRDSGHDTYFLSLTFRVRETTYHTRIEYSQGTFSFWSQPESHSATTISEFIDKAVAHSQSGKFHYFLLTNVPGQPPMEVSLLYPLTRNQIVHSLKHLSRFVILSNIRKDHIANLNIPSPLKLYLLEKQY 3162
            A  +  E +  L   GWYWGP++  EAE  +    +G+FLVRDS  + Y LSL+FR +  T HTRIE+S G FSF+ Q E+    ++ E ++++V  S+ G F Y   + +PG     V L  P++R   V SL++L RFVI  + R D I  L +PS +K YL EK Y
Sbjct:  363 AVSSLTEELKKLARQGWYWGPITRWEAEEKLHGLQDGSFLVRDSSDERYLLSLSFRSQNRTLHTRIEHSNGRFSFYEQLEAEGQASVVELVERSVRDSEVGAFCYS-RSRLPGSATYPVRLTVPVSRFMQVRSLQYLCRFVIRQSTRIDLIRKLPLPSKMKDYLQEKPY 530          
BLAST of Suppressor of cytokine signaling 7 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000768.1 (pep scaffold:Pmarinus_7.0:GL477892:18588:20066:-1 gene:ENSPMAG00000000700.1 transcript:ENSPMAT00000000768.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 70.0922 bits (170), Expect = 1.522e-12
Identity = 48/163 (29.45%), Postives = 71/163 (43.56%), Query Frame = 1
Query: 2677 NMLSLKEVGWYWGPLSFTEAERLMENKANGTFLVRDSGHDTYFLSLTFRVRETTYHTRIEYSQGTFSFWSQ-PESHSATTISEFIDKAVAHSQSGKFHYFLLTNVPGQPPMEVSLLYPLTRNQIVHSLKHLSRFVILSNIRKDHIANLNIPSPLKLYLLEKQY 3162
            +++ +    +YWG +   +AE L+EN+  GTFL+RDS  + Y  S++FR    + H R+E     FSF +  P    A  ++  +      S    F   L T++P   P                 L+ L R  I S +  D    L IP  LK YL E  Y
Sbjct:  304 DLVEITNSSFYWGVMDRYQAEALLENRPEGTFLLRDSAQEDYLFSVSFRRYGRSLHARVEQWNHNFSFDAHDPCVFYAPAVTTLLRHYKDPSACMFFEPLLATSLPRTFPF---------------GLQRLCRAAICSRVTYDSTEALPIPQALKEYLREYHY 451          
BLAST of Suppressor of cytokine signaling 7 vs. Ensembl Sea Lamprey
Match: cishb (cytokine inducible SH2-containing protein b [Source:ZFIN;Acc:ZDB-GENE-080204-120])

HSP 1 Score: 64.6994 bits (156), Expect = 1.198e-11
Identity = 28/61 (45.90%), Postives = 40/61 (65.57%), Query Frame = 1
Query: 2698 VGWYWGPLSFTEAERLMENKANGTFLVRDSGHDTYFLSLTFRVRETTYHTRIEYSQGTFSF 2880
            +GWYWG L+ T+A +L+ + A GTFLVRDS H  + L+L+ +      + RIE+S G FS 
Sbjct:   93 LGWYWGSLTATQARQLLMSAAEGTFLVRDSTHPDFLLTLSVQTSRGPTNVRIEHSGGAFSL 153          
BLAST of Suppressor of cytokine signaling 7 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008880.1 (pep scaffold:Pmarinus_7.0:GL479886:17807:19633:1 gene:ENSPMAG00000008039.1 transcript:ENSPMAT00000008880.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 66.6254 bits (161), Expect = 2.096e-11
Identity = 48/163 (29.45%), Postives = 73/163 (44.79%), Query Frame = 1
Query: 2677 NMLSLKEVGWYWGPLSFTEAERLMENKANGTFLVRDSGHDTYFLSLTFRVRETTYHTRIEYSQGTFSFWSQPESHSATTI-SEFIDKAVAHSQSGKFHYFLLTNVPGQPPMEVSLLYPLTRNQIVHSLKHLSRFVILSNIRKDHIANLNIPSPLKLYLLEKQY 3162
            ++L + +  +YWG +   +AE L+E +  GTFL+RDS  + Y  S++FR    + H R+E     FSF    ++H      +  +   + H +      F           E  L  PL R+    SL+ L R  I   +  D I  L +P  LK YL E  Y
Sbjct:  375 DLLDITQSPFYWGVMDRYQAEALLEGRPEGTFLLRDSAQEDYLFSVSFRRYGRSLHARVEQWNHNFSF----DAHDPCVFHAPAVTALLRHYKDPSACMFF----------EPLLATPLHRS-FPFSLQRLCRASICGRVTYDGIDALPVPHVLKDYLKEYHY 522          
BLAST of Suppressor of cytokine signaling 7 vs. Ensembl Nematostella
Match: EDO37051 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SGW3])

HSP 1 Score: 103.219 bits (256), Expect = 2.479e-25
Identity = 59/151 (39.07%), Postives = 83/151 (54.97%), Query Frame = 1
Query: 2686 SLKEVGWYWGPLSFTEAERLMENKANGTFLVRDSGHDTYFLSLTFRVRETTYHTRIEYSQGTFSFWSQPESHSATTISEFIDKAVAHSQSGKFHYFLLTNVPGQ----PPMEVSLLYPLTRNQIVHSLKHLSRFVILSNIRKDHIANLNIP 3126
            +L   GWYWGP+S  EAE+ + N+ +G FLVRDS +D + LS++FR +  T HTR+ Y++G FSF+   +     +  E I  A+  SQ G     +L N  G         V L  P++R   V  L+ L RFVI  NIR D +  L +P
Sbjct:   23 TLSNCGWYWGPMSSKEAEKELYNQPDGCFLVRDSENDYHLLSVSFRSKGATCHTRLIYNKGKFSFFQ--DEMGKDSAYELIMHAMEASQDG-----ILCNSRGHNRNTICYPVRLQVPISRFNTVPPLQFLCRFVIRQNIRCDQLDQLPLP 166          
BLAST of Suppressor of cytokine signaling 7 vs. Ensembl Nematostella
Match: EDO35739 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKN8])

HSP 1 Score: 77.411 bits (189), Expect = 1.621e-16
Identity = 50/167 (29.94%), Postives = 78/167 (46.71%), Query Frame = 1
Query: 2668 FQENMLSLKEVGWYWGPLSFTEAERLMENKANGTFLVRDSGHDTYFLSLTFRVRETTYHTRIEYSQGTFSFWSQPESHS--ATTISEFIDKAVAHSQSGKFHYFLLTNVPGQPPMEVSLLYPLTRNQIVHSLKHLSRFVILSNIRKDHIANLNIPSPLKLYLLEKQY 3162
            F  ++L +    WYWG ++  EAER+++   +GTFL+RDS    Y  S++FR    TYH RIE  +  +SF  +P  +S  + T+ E +       Q   +   LL  +P +  +                L+HL R  I  N+    +  L IP  L+ +L E  Y
Sbjct:    4 FIRDLLEITNCPWYWGKINRFEAERVLDGLPDGTFLLRDSAQYQYLFSVSFRRYFRTYHARIEQWKHRYSF-DKPSDYSFCSKTLHELLQHYSQAEQCMYYEPLLLNALPRKNTL---------------PLQHLCRATICKNVSFQDVDELPIPKSLQTFLREYHY 154          
BLAST of Suppressor of cytokine signaling 7 vs. Ensembl Nematostella
Match: EDO29286 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T428])

HSP 1 Score: 75.485 bits (184), Expect = 8.300e-16
Identity = 52/162 (32.10%), Postives = 81/162 (50.00%), Query Frame = 1
Query: 2668 FQENMLSLKEVGWYWGPLSFTEAERLMENKANGTFLVRDSGHDTYFLSLTFRVRETTYHTRIEYSQGTFSFWSQPESHS--ATTISEFIDKAVAHSQSGKFHYFLLTNVPGQPPMEVSLLYPLTRNQIVHSLKHLSRFVILSNIRKDHIANLNIPSPLKLYL 3147
            F  ++L +    WYWG ++  EAER+++   +GTFL+RDS    Y  S++FR    TYH RIE  +  +SF  +P  +S  + T+ E +     +SQ+ +  Y+           E  LL  L R   +  L+HL R  I  N+    +  L IP  L+ +L
Sbjct:    4 FIRDLLEITNCPWYWGKINRFEAERVLDGLPDGTFLLRDSAQYQYLFSVSFRRYFRTYHARIEQWKHRYSF-DKPSDYSFCSKTLHELLQH---YSQAEQCMYY-----------EPLLLNALPRKNTL-PLQHLCRATICKNVSFQDVDELPIPKSLQTFL 149          
BLAST of Suppressor of cytokine signaling 7 vs. Ensembl Nematostella
Match: EDO44866 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUJ8])

HSP 1 Score: 57.3806 bits (137), Expect = 3.172e-9
Identity = 45/165 (27.27%), Postives = 76/165 (46.06%), Query Frame = 1
Query: 2686 SLKEVGWYWGPLSFTEAERLMENKANGTFLVRDSGHDTYFLSLTFRVRETTYHTRIEYSQGTFSFWS----QPESHSATTISEFIDKAVAHSQSGKFHYFLLTNVPGQPPMEVSLLYPLTRNQIVHSLKHLSRFVILSNIRKDHIANLNIPSPLKLYLLEKQYYI 3168
            +L++ G+YW  ++  +A+ ++ +   G F++RDS    +  +L+ R      + RI   +G FS  S      E  S   +   I   V +S+  + H  L  N   + P +  L         V SL+HL R  I   +R + +  L IP+ LK+Y+   QY I
Sbjct:   24 TLRQSGFYWRGITKEQADIILRSCDMGAFIIRDSSSPNFLFTLSVRTVFGVTNIRIAMDRGRFSLESIDNENSEGPSFKCVVHLIYYYVKNSRHSERH--LEDNYLRREPTKYKLYLGRPIYGAVSSLQHLCRRSINKQMRPNGVYALPIPAKLKIYISNYQYPI 186          
BLAST of Suppressor of cytokine signaling 7 vs. Ensembl Medaka
Match: ENSORLT00000028429.1 (suppressor of cytokine signaling 7 [Source:NCBI gene;Acc:100144378])

HSP 1 Score: 169.088 bits (427), Expect = 6.989e-44
Identity = 87/216 (40.28%), Postives = 126/216 (58.33%), Query Frame = 1
Query: 2641 NNPEPARKA---------------FQENMLSLKEVGWYWGPLSFTEAERLMENKANGTFLVRDSGHDTYFLSLTFRVRETTYHTRIEYSQGTFSFWSQPE-SHSATTISEFIDKAVAHSQSGKFHYFLLTNVPGQPPMEVSLLYPLTRNQIVHSLKHLSRFVILSNIRKDHIANLNIPSPLKLYLLEKQYY---------ISNLDHFIEATMDAHP 3213
            + P PAR+A               F  ++  L++ GWYWGP+++ +AE  ++ K +G+FLVRDS    Y LSL+FR +  T+HTR+E+ +GTFS W  P+      ++ EFI++A+ HS++GKF YFL + VPG PP  V LLYP++R   V SL+HL RF I   +R DHI  L +P PL  YL +  YY         I ++   + A  +A P
Sbjct:  318 DAPLPARQAPPPVLCALRRSEASNFTASLRELEKCGWYWGPMNWEDAEMKLKGKPDGSFLVRDSSDPRYILSLSFRSQGVTHHTRMEHYRGTFSLWCHPKFEDRCHSVVEFIERAIMHSKNGKFLYFLRSRVPGLPPTPVQLLYPVSRFSNVKSLQHLCRFCIRQIVRIDHIQELPLPRPLISYLSKFYYYDPEEEMYLSIKSIRGVVGAEQEAEP 533          
BLAST of Suppressor of cytokine signaling 7 vs. Ensembl Medaka
Match: ENSORLT00000043526.1 (suppressor of cytokine signaling 7 [Source:NCBI gene;Acc:100144378])

HSP 1 Score: 169.474 bits (428), Expect = 1.026e-42
Identity = 96/276 (34.78%), Postives = 142/276 (51.45%), Query Frame = 1
Query: 2494 DSVDSPEAGSFIYNPFSPLTKRTAPTVAISNLSSFNIHQQHFNLKDK-----------QNNNPEPARKA---------------FQENMLSLKEVGWYWGPLSFTEAERLMENKANGTFLVRDSGHDTYFLSLTFRVRETTYHTRIEYSQGTFSFWSQPE-SHSATTISEFIDKAVAHSQSGKFHYFLLTNVPGQPPMEVSLLYPLTRNQIVHSLKHLSRFVILSNIRKDHIANLNIPSPLKLYLLEKQYY---------ISNLDHFIEATMDAHP 3213
            D +  P+ GSF+ +      +     +      S    Q   +L D              + P PAR+A               F  ++  L++ GWYWGP+++ +AE  ++ K +G+FLVRDS    Y LSL+FR +  T+HTR+E+ +GTFS W  P+      ++ EFI++A+ HS++GKF YFL + VPG PP  V LLYP++R   V SL+HL RF I   +R DHI  L +P PL  YL +  YY         I ++   + A  +A P
Sbjct:  529 DDIAGPQPGSFLVSVMGASLQSLPLPLPPPPPPSHATIQHSLSLNDAFLRALPHSNPSPADAPLPARQAPPPVLCALRRSEASNFTASLRELEKCGWYWGPMNWEDAEMKLKGKPDGSFLVRDSSDPRYILSLSFRSQGVTHHTRMEHYRGTFSLWCHPKFEDRCHSVVEFIERAIMHSKNGKFLYFLRSRVPGLPPTPVQLLYPVSRFSNVKSLQHLCRFCIRQIVRIDHIQELPLPRPLISYLSKFYYYDPEEEMYLSIKSIRGVVGAEQEAEP 804          
BLAST of Suppressor of cytokine signaling 7 vs. Ensembl Medaka
Match: socs6 (suppressor of cytokine signaling 6 [Source:NCBI gene;Acc:100144377])

HSP 1 Score: 136.732 bits (343), Expect = 3.413e-33
Identity = 72/166 (43.37%), Postives = 100/166 (60.24%), Query Frame = 1
Query: 2665 AFQENMLSLKEVGWYWGPLSFTEAERLMENKANGTFLVRDSGHDTYFLSLTFRVRETTYHTRIEYSQGTFSFWSQPESHSATTISEFIDKAVAHSQSGKFHYFLLTNVPGQPPMEVSLLYPLTRNQIVHSLKHLSRFVILSNIRKDHIANLNIPSPLKLYLLEKQY 3162
            +  E +  L   GWYWGP++  EAE  + N A+G+FLVRDS  D Y LSL+FR +  T HTRIE+S G FSF+ QP+    T+I + I+ ++  S++G F Y   + +PG     V L  P++R   V SL++L RFVI    R D I  L +P+ +K YL EK Y
Sbjct:  372 SLTEELKKLARQGWYWGPITRWEAEEKLFNLADGSFLVRDSSDDRYLLSLSFRSQSKTLHTRIEHSNGRFSFYEQPDVEGHTSIVDLIEHSIKDSENGAFCYS-RSRLPGSATYPVRLTNPVSRFMQVRSLQYLCRFVIRQYTRIDLIQKLPLPNKMKDYLQEKHY 536          
BLAST of Suppressor of cytokine signaling 7 vs. Ensembl Medaka
Match: socs8 (suppressor of cytokine signaling 8 [Source:NCBI gene;Acc:100144389])

HSP 1 Score: 72.0182 bits (175), Expect = 1.310e-13
Identity = 52/165 (31.52%), Postives = 76/165 (46.06%), Query Frame = 1
Query: 2689 LKEVGWYWGPLSFTEAERLMENKANGTFLVRDSGHDTYFLSLTFRVRETTYHTRIEYSQGTFSFWSQPESHSATTISEFIDK-------AVAHSQSGKFHYFLLTNVPGQ-----PPMEVSLLYPLTRNQIVHSLKHLSRFVILSNIRKDHIANLNIPSPLKLYL 3147
            L+  GWYWG +S  EA+  +  K  GTFL+RDS H  + L+L+ + R      RI+Y++G   FW    S  A  +  F D         V+   S     F     P Q       + + L+ PL R +   SL+HL+R  I  N + +    L +P PL  +L
Sbjct:   43 LQASGWYWGSISAGEAKEALLTKPEGTFLLRDSSHPQFMLALSVKTRCGPTSVRIDYNRG--CFWLDSISRGAPHLKTFSDVLSLIQHYTVSGQTSQDLASFKTKADPSQHAAKDAGVPLRLVRPLHRREGFPSLQHLARLTI--NKQTNCPDQLPLPKPLLDFL 203          
BLAST of Suppressor of cytokine signaling 7 vs. Ensembl Medaka
Match: socs8 (suppressor of cytokine signaling 8 [Source:NCBI gene;Acc:100144389])

HSP 1 Score: 72.0182 bits (175), Expect = 1.310e-13
Identity = 52/165 (31.52%), Postives = 76/165 (46.06%), Query Frame = 1
Query: 2689 LKEVGWYWGPLSFTEAERLMENKANGTFLVRDSGHDTYFLSLTFRVRETTYHTRIEYSQGTFSFWSQPESHSATTISEFIDK-------AVAHSQSGKFHYFLLTNVPGQ-----PPMEVSLLYPLTRNQIVHSLKHLSRFVILSNIRKDHIANLNIPSPLKLYL 3147
            L+  GWYWG +S  EA+  +  K  GTFL+RDS H  + L+L+ + R      RI+Y++G   FW    S  A  +  F D         V+   S     F     P Q       + + L+ PL R +   SL+HL+R  I  N + +    L +P PL  +L
Sbjct:   43 LQASGWYWGSISAGEAKEALLTKPEGTFLLRDSSHPQFMLALSVKTRCGPTSVRIDYNRG--CFWLDSISRGAPHLKTFSDVLSLIQHYTVSGQTSQDLASFKTKADPSQHAAKDAGVPLRLVRPLHRREGFPSLQHLARLTI--NKQTNCPDQLPLPKPLLDFL 203          
BLAST of Suppressor of cytokine signaling 7 vs. Planmine SMEST
Match: SMESG000041674.1 (SMESG000041674.1)

HSP 1 Score: 1918.28 bits (4968), Expect = 0.000e+0
Identity = 1051/1052 (99.90%), Postives = 1051/1052 (99.90%), Query Frame = 1
Query:   73 MLRTTPHCACRNSQLHTEDSQRLNAKAYSILPTYPNKADINRQSSKTITNFENSHSLFSKNKFGCHNRNENEFKNYENIEYYTSGIFRPHSCPFNKRKDSSDIPPNPGDFCTESTMKPNKNYYQNQINKSHYDSVKNNERYHKKNLKTSISKPEHKNLNNIQCDDDLGPNNKYYFDSKYMDYQSGLNYYMKNSQIPIPITNEEHKSKRLSHTLYNDDNLLTTNMKKTSCGLKYIIFQKLSIMTHFITGSKNRKSTLFNKHNNLSDENLFKDKSSLRTERSKSYHAIETNFDHSTCNKCENHFKSNLIKKYSKPRTXXXXXXXXXXXXXXXXDAHAGSPITIMTTVCGNILSNGSNPLVSNTICHSKSKWXXXXXXXXXXXXXXXTNQQGNYNFHKENLNNYQVXXXXXXXXXXXXXXXXXXXXXXXXXXXHMCNDCPCSSQFPCNQMPCEQICGHQCCTKPHVQPSFQXXXXXXXXXXXXXXXXXXXXQSPYMCCSPSNFMHHCSISKPICLHSFFPCNSSHIANNACTSSSILCNSCQAKNVDRCHSVNLNNCNKIFWNNSNENKQFQNVYSNTQKYRSKGEXXXXXXXXXXXXXXXXXXXXXXXXXXEVPIHKSKPKRHYSNKASSSGKVCNHCSEKIPVISQDGADNVQNIIYSHLNNTVACQSSKNNDNTEVFQRVKNTSINCENRLKNLPRNISWNSQNDRIQENMFRNSNENDQIKYMTNAQDVTDRRSADIYRHRSSAATPIINSTHKPRFISKTPETYKSKYDRRQKSHQGETKRILKHKSLSTPKEYNDIDQETFYRNDSVDSPEAGSFIYNPFSPLTKRTAPTVAISNLSSFNIHQQHFNLKDKQNNNPEPARKAFQENMLSLKEVGWYWGPLSFTEAERLMENKANGTFLVRDSGHDTYFLSLTFRVRETTYHTRIEYSQGTFSFWSQPESHSATTISEFIDKAVAHSQSGKFHYFLLTNVPGQPPMEVSLLYPLTRNQIVHSLKHLSRFVILSNIRKDHIANLNIPSPLKLYLLEKQYYISNLDHFIEATMDAHPLNYKP 3228
            MLRTTPHCACRNSQLHTEDSQRLNAKAYSILPTY NKADINRQSSKTITNFENSHSLFSKNKFGCHNRNENEFKNYENIEYYTSGIFRPHSCPFNKRKDSSDIPPNPGDFCTESTMKPNKNYYQNQINKSHYDSVKNNERYHKKNLKTSISKPEHKNLNNIQCDDDLGPNNKYYFDSKYMDYQSGLNYYMKNSQIPIPITNEEHKSKRLSHTLYNDDNLLTTNMKKTSCGLKYIIFQKLSIMTHFITGSKNRKSTLFNKHNNLSDENLFKDKSSLRTERSKSYHAIETNFDHSTCNKCENHFKSNLIKKYSKPRTSKIKLSNASNSSSGSIDAHAGSPITIMTTVCGNILSNGSNPLVSNTICHSKSKWKNEEKFFENFPENKETNQQGNYNFHKENLNNYQVNKPNFNQHNNNNNNILNINNNKPTTNHHMCNDCPCSSQFPCNQMPCEQICGHQCCTKPHVQPSFQSCHYCCCSSHSHVVMHPSYSQSPYMCCSPSNFMHHCSISKPICLHSFFPCNSSHIANNACTSSSILCNSCQAKNVDRCHSVNLNNCNKIFWNNSNENKQFQNVYSNTQKYRSKGETKSRSSKPTSIPPPPPPPPSSLYSTKEVPIHKSKPKRHYSNKASSSGKVCNHCSEKIPVISQDGADNVQNIIYSHLNNTVACQSSKNNDNTEVFQRVKNTSINCENRLKNLPRNISWNSQNDRIQENMFRNSNENDQIKYMTNAQDVTDRRSADIYRHRSSAATPIINSTHKPRFISKTPETYKSKYDRRQKSHQGETKRILKHKSLSTPKEYNDIDQETFYRNDSVDSPEAGSFIYNPFSPLTKRTAPTVAISNLSSFNIHQQHFNLKDKQNNNPEPARKAFQENMLSLKEVGWYWGPLSFTEAERLMENKANGTFLVRDSGHDTYFLSLTFRVRETTYHTRIEYSQGTFSFWSQPESHSATTISEFIDKAVAHSQSGKFHYFLLTNVPGQPPMEVSLLYPLTRNQIVHSLKHLSRFVILSNIRKDHIANLNIPSPLKLYLLEKQYYISNLDHFIEATMDAHPLNYKP
Sbjct:    1 MLRTTPHCACRNSQLHTEDSQRLNAKAYSILPTYQNKADINRQSSKTITNFENSHSLFSKNKFGCHNRNENEFKNYENIEYYTSGIFRPHSCPFNKRKDSSDIPPNPGDFCTESTMKPNKNYYQNQINKSHYDSVKNNERYHKKNLKTSISKPEHKNLNNIQCDDDLGPNNKYYFDSKYMDYQSGLNYYMKNSQIPIPITNEEHKSKRLSHTLYNDDNLLTTNMKKTSCGLKYIIFQKLSIMTHFITGSKNRKSTLFNKHNNLSDENLFKDKSSLRTERSKSYHAIETNFDHSTCNKCENHFKSNLIKKYSKPRTSKIKLSNASNSSSGSIDAHAGSPITIMTTVCGNILSNGSNPLVSNTICHSKSKWKNEEKFFENFPENKETNQQGNYNFHKENLNNYQVNKPNFNQHNNNNNNILNINNNKPTTNHHMCNDCPCSSQFPCNQMPCEQICGHQCCTKPHVQPSFQSCHYCCCSSHSHVVMHPSYSQSPYMCCSPSNFMHHCSISKPICLHSFFPCNSSHIANNACTSSSILCNSCQAKNVDRCHSVNLNNCNKIFWNNSNENKQFQNVYSNTQKYRSKGETKSRSSKPTSIPPPPPPPPSSLYSTKEVPIHKSKPKRHYSNKASSSGKVCNHCSEKIPVISQDGADNVQNIIYSHLNNTVACQSSKNNDNTEVFQRVKNTSINCENRLKNLPRNISWNSQNDRIQENMFRNSNENDQIKYMTNAQDVTDRRSADIYRHRSSAATPIINSTHKPRFISKTPETYKSKYDRRQKSHQGETKRILKHKSLSTPKEYNDIDQETFYRNDSVDSPEAGSFIYNPFSPLTKRTAPTVAISNLSSFNIHQQHFNLKDKQNNNPEPARKAFQENMLSLKEVGWYWGPLSFTEAERLMENKANGTFLVRDSGHDTYFLSLTFRVRETTYHTRIEYSQGTFSFWSQPESHSATTISEFIDKAVAHSQSGKFHYFLLTNVPGQPPMEVSLLYPLTRNQIVHSLKHLSRFVILSNIRKDHIANLNIPSPLKLYLLEKQYYISNLDHFIEATMDAHPLNYKP 1052          
BLAST of Suppressor of cytokine signaling 7 vs. Planmine SMEST
Match: SMESG000034034.1 (SMESG000034034.1)

HSP 1 Score: 322.398 bits (825), Expect = 1.838e-92
Identity = 152/206 (73.79%), Postives = 172/206 (83.50%), Query Frame = 1
Query: 2611 QHFNLKDKQNNNPEPARKAFQENMLSLKEVGWYWGPLSFTEAERLMENKANGTFLVRDSGHDTYFLSLTFRVRETTYHTRIEYSQGTFSFWSQPESHSATTISEFIDKAVAHSQSGKFHYFLLTNVPGQPPMEVSLLYPLTRNQIVHSLKHLSRFVILSNIRKDHIANLNIPSPLKLYLLEKQYYISNLDHFIEATMDAHPLNYKP 3228
            Q  NL D  N+  EP RK F+ENML+L+ +GWYWGPL+  EAE L+EN+ +GTFLVRDS HDTYFLSLTFRV  TTYHTRIEYSQG FSFWSQPESHSATTI EFIDKAVAHS SGKFHYFL T+ PGQPPMEVSLLYPL+R QI+ SL+HLSRFVILSNIRKDH++ L +PS LK YLLEKQYYI N+D F++ T DA PL Y+P
Sbjct:  905 QMTNLVD-SNDKFEPWRKTFKENMLALRNLGWYWGPLNHLEAENLVENRPDGTFLVRDSAHDTYFLSLTFRVLGTTYHTRIEYSQGKFSFWSQPESHSATTIVEFIDKAVAHSASGKFHYFLQTSTPGQPPMEVSLLYPLSRYQIIQSLQHLSRFVILSNIRKDHVSQLQLPSSLKGYLLEKQYYIDNIDSFVKLTKDAEPLIYEP 1109          
BLAST of Suppressor of cytokine signaling 7 vs. Planmine SMEST
Match: SMESG000034034.1 (SMESG000034034.1)

HSP 1 Score: 322.398 bits (825), Expect = 3.197e-92
Identity = 152/206 (73.79%), Postives = 172/206 (83.50%), Query Frame = 1
Query: 2611 QHFNLKDKQNNNPEPARKAFQENMLSLKEVGWYWGPLSFTEAERLMENKANGTFLVRDSGHDTYFLSLTFRVRETTYHTRIEYSQGTFSFWSQPESHSATTISEFIDKAVAHSQSGKFHYFLLTNVPGQPPMEVSLLYPLTRNQIVHSLKHLSRFVILSNIRKDHIANLNIPSPLKLYLLEKQYYISNLDHFIEATMDAHPLNYKP 3228
            Q  NL D  N+  EP RK F+ENML+L+ +GWYWGPL+  EAE L+EN+ +GTFLVRDS HDTYFLSLTFRV  TTYHTRIEYSQG FSFWSQPESHSATTI EFIDKAVAHS SGKFHYFL T+ PGQPPMEVSLLYPL+R QI+ SL+HLSRFVILSNIRKDH++ L +PS LK YLLEKQYYI N+D F++ T DA PL Y+P
Sbjct:  942 QMTNLVD-SNDKFEPWRKTFKENMLALRNLGWYWGPLNHLEAENLVENRPDGTFLVRDSAHDTYFLSLTFRVLGTTYHTRIEYSQGKFSFWSQPESHSATTIVEFIDKAVAHSASGKFHYFLQTSTPGQPPMEVSLLYPLSRYQIIQSLQHLSRFVILSNIRKDHVSQLQLPSSLKGYLLEKQYYIDNIDSFVKLTKDAEPLIYEP 1146          
BLAST of Suppressor of cytokine signaling 7 vs. Planmine SMEST
Match: SMESG000016754.1 (SMESG000016754.1)

HSP 1 Score: 165.622 bits (418), Expect = 2.817e-44
Identity = 83/178 (46.63%), Postives = 114/178 (64.04%), Query Frame = 1
Query: 2674 ENMLSLKEVGWYWGPLSFTEAERLMENKANGTFLVRDSGHDTYFLSLTFRVRETTYHTRIEYSQGTFSFW-SQPESHSATTISEFIDKAVAHSQSGKFHYF-----LLTNVPGQPPMEVSLLYPLTRNQIVHSLKHLSRFVILSNIRKDHIANLNIPSPLKLYLLEKQYYISNLDHFI 3189
            +N   L+ + WYWGPL+  +AE L++NK +G FLVRDSGH+ Y LS++FR     YHTRIE+S G FSFW +   +  A +I +FI++ +  S++G   Y      L+  +     + VSLLYPL+R +IV SL HL RF IL+ IR+DHI NL IP+ LK YL   QY+I   D F+
Sbjct:  195 DNFRQLRRIPWYWGPLTKYDAELLLQNKEDGVFLVRDSGHEAYVLSVSFRAGNKIYHTRIEHSLGKFSFWLNDRNAVKAASIVDFINQLIEESRNGHVRYLINDSSLIGQLAETGRVSVSLLYPLSRFKIVQSLMHLCRFEILALIRQDHINNLQIPNFLKRYLKAPQYFIEKFDEFL 372          
BLAST of Suppressor of cytokine signaling 7 vs. Planmine SMEST
Match: SMESG000045026.1 (SMESG000045026.1)

HSP 1 Score: 148.673 bits (374), Expect = 1.023e-37
Identity = 70/150 (46.67%), Postives = 100/150 (66.67%), Query Frame = 1
Query: 2656 ARKAFQENMLSLKEVGWYWGPLSFTEAERLMENKANGTFLVRDSGHDTYFLSLTFRVRETTYHTRIEYSQGTFSFWSQPESHSATTISEFIDKAVAHSQSGKFHYFLLTNVPGQPPMEVSLLYPLTRNQIVHSLKHLSRFVILSNIRKDH 3105
            +R    +N+L LK+VGWYWG +S  EAE +M ++ NGTFLVRDS H  +  S+TFRV   TYH+RI++SQ  F +    +     +I+E I  ++  S+ G+  YF  T+    PP  VSLL+PL+R +++ SLKHL+RFVI+SN+R DH
Sbjct:  280 SRNFLTKNLLELKKVGWYWGSISSDEAENVMAHQPNGTFLVRDSAHSDHLFSVTFRVNSFTYHSRIQFSQNRFWWNRNNQDDGFDSITELIQNSIEISKRGECRYFENTDNVNVPPYAVSLLHPLSRLKLMSSLKHLARFVIISNVRSDH 429          
The following BLAST results are available for this feature:
BLAST of Suppressor of cytokine signaling 7 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SOCS75.716e-4345.35suppressor of cytokine signaling 7 [Source:HGNC Sy... [more]
SOCS76.465e-4345.35suppressor of cytokine signaling 7 [Source:HGNC Sy... [more]
SOCS71.177e-4245.35suppressor of cytokine signaling 7 [Source:HGNC Sy... [more]
SOCS71.177e-4245.35suppressor of cytokine signaling 7 [Source:HGNC Sy... [more]
SOCS72.566e-4245.35suppressor of cytokine signaling 7 [Source:HGNC Sy... [more]
back to top
BLAST of Suppressor of cytokine signaling 7 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
F39B2.51.924e-1126.51pep chromosome:WBcel235:I:14775184:14776663:-1 gen... [more]
back to top
BLAST of Suppressor of cytokine signaling 7 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Socs16D1.381e-3445.25gene:FBgn0030869 transcript:FBtr0310310[more]
Socs16D1.442e-3445.25gene:FBgn0030869 transcript:FBtr0074473[more]
Socs36E4.884e-1636.36gene:FBgn0041184 transcript:FBtr0329927[more]
Socs36E4.884e-1636.36gene:FBgn0041184 transcript:FBtr0081040[more]
Socs44A5.249e-1631.76gene:FBgn0033266 transcript:FBtr0088784[more]
back to top
BLAST of Suppressor of cytokine signaling 7 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
socs78.175e-4543.98suppressor of cytokine signaling 7 [Source:ZFIN;Ac... [more]
socs74.731e-4443.98suppressor of cytokine signaling 7 [Source:ZFIN;Ac... [more]
socs74.731e-4443.98suppressor of cytokine signaling 7 [Source:ZFIN;Ac... [more]
socs78.816e-4444.21suppressor of cytokine signaling 7 [Source:ZFIN;Ac... [more]
socs71.955e-4344.21suppressor of cytokine signaling 7 [Source:ZFIN;Ac... [more]
back to top
BLAST of Suppressor of cytokine signaling 7 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cdc42se14.207e-4346.43cdc42 small effector 1 [Source:Xenbase;Acc:XB-GENE... [more]
cdc42se17.493e-4346.43cdc42 small effector 1 [Source:Xenbase;Acc:XB-GENE... [more]
cdc42se11.608e-4246.43cdc42 small effector 1 [Source:Xenbase;Acc:XB-GENE... [more]
tmbim68.170e-3443.18transmembrane BAX inhibitor motif containing 6 [So... [more]
socs21.424e-1430.99suppressor of cytokine signaling 2 [Source:NCBI ge... [more]
back to top
BLAST of Suppressor of cytokine signaling 7 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Socs77.358e-4345.35suppressor of cytokine signaling 7 [Source:MGI Sym... [more]
Socs72.055e-4245.35suppressor of cytokine signaling 7 [Source:MGI Sym... [more]
Socs61.541e-3242.77suppressor of cytokine signaling 6 [Source:MGI Sym... [more]
Socs61.541e-3242.77suppressor of cytokine signaling 6 [Source:MGI Sym... [more]
Socs61.541e-3242.77suppressor of cytokine signaling 6 [Source:MGI Sym... [more]
back to top
BLAST of Suppressor of cytokine signaling 7 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8VHQ2|SOCS7_MOUSE5.147e-4245.35Suppressor of cytokine signaling 7 OS=Mus musculus... [more]
sp|O14512|SOCS7_HUMAN5.652e-4245.35Suppressor of cytokine signaling 7 OS=Homo sapiens... [more]
sp|Q5RCM6|SOCS6_PONAB5.273e-3242.77Suppressor of cytokine signaling 6 OS=Pongo abelii... [more]
sp|O14544|SOCS6_HUMAN5.937e-3242.77Suppressor of cytokine signaling 6 OS=Homo sapiens... [more]
sp|Q9JLY0|SOCS6_MOUSE1.078e-3142.77Suppressor of cytokine signaling 6 OS=Mus musculus... [more]
back to top
BLAST of Suppressor of cytokine signaling 7 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
W6V3R84.434e-7764.21Suppressor of cytokine signaling 7 OS=Echinococcus... [more]
A0A0R3T5D43.221e-7458.37Uncharacterized protein OS=Rodentolepis nana OX=10... [more]
A0A158QEV74.600e-7464.89Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
A0A0R3X8K91.361e-7364.74Uncharacterized protein OS=Hydatigena taeniaeformi... [more]
A0A564YWL84.359e-7366.29Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
back to top
BLAST of Suppressor of cytokine signaling 7 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000044677.14.353e-4445.35suppressor of cytokine signaling 7-like [Source:NC... [more]
ENSAMXT00000008256.26.652e-4445.35suppressor of cytokine signaling 7-like [Source:NC... [more]
socs72.306e-4346.43suppressor of cytokine signaling 7 [Source:ZFIN;Ac... [more]
socs72.492e-4346.43suppressor of cytokine signaling 7 [Source:ZFIN;Ac... [more]
socs6a5.747e-3342.17suppressor of cytokine signaling 6a [Source:ZFIN;A... [more]
back to top
BLAST of Suppressor of cytokine signaling 7 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
socs6b2.262e-3341.42suppressor of cytokine signaling 6b [Source:ZFIN;A... [more]
ENSPMAT00000000768.11.522e-1229.45pep scaffold:Pmarinus_7.0:GL477892:18588:20066:-1 ... [more]
cishb1.198e-1145.90cytokine inducible SH2-containing protein b [Sourc... [more]
ENSPMAT00000008880.12.096e-1129.45pep scaffold:Pmarinus_7.0:GL479886:17807:19633:1 g... [more]
back to top
BLAST of Suppressor of cytokine signaling 7 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Suppressor of cytokine signaling 7 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO370512.479e-2539.07Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO357391.621e-1629.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO292868.300e-1632.10Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO448663.172e-927.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Suppressor of cytokine signaling 7 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000028429.16.989e-4440.28suppressor of cytokine signaling 7 [Source:NCBI ge... [more]
ENSORLT00000043526.11.026e-4234.78suppressor of cytokine signaling 7 [Source:NCBI ge... [more]
socs63.413e-3343.37suppressor of cytokine signaling 6 [Source:NCBI ge... [more]
socs81.310e-1331.52suppressor of cytokine signaling 8 [Source:NCBI ge... [more]
socs81.310e-1331.52suppressor of cytokine signaling 8 [Source:NCBI ge... [more]
back to top
BLAST of Suppressor of cytokine signaling 7 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000041674.10.000e+099.90SMESG000041674.1[more]
SMESG000034034.11.838e-9273.79SMESG000034034.1[more]
SMESG000034034.13.197e-9273.79SMESG000034034.1[more]
SMESG000016754.12.817e-4446.63SMESG000016754.1[more]
SMESG000045026.11.023e-3746.67SMESG000045026.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30028309 ID=SMED30028309|Name=Suppressor of cytokine signaling 7|organism=Schmidtea mediterranea sexual|type=transcript|length=3552bp
TATAAATCTTATATGATTAAAATTTATTCAAACGTATAATGTGAATATAA
ATTTTAAATAAATTTACAAAATATGTTAAGAACAACACCGCACTGTGCGT
GCCGAAATTCTCAACTGCATACTGAAGATAGTCAAAGACTTAATGCCAAA
GCTTACTCAATTCTTCCAACTTATCCAAACAAAGCTGATATCAATCGACA
ATCATCAAAAACAATTACAAATTTTGAAAACTCCCACTCCTTATTTTCTA
AAAACAAATTCGGATGTCACAATCGAAATGAAAACGAATTTAAAAATTAT
GAAAACATTGAATACTACACTAGCGGTATATTTCGCCCGCACTCGTGCCC
GTTTAATAAACGCAAAGATTCTTCAGATATCCCTCCGAACCCTGGAGATT
TCTGTACAGAGTCGACAATGAAACCTAATAAAAATTATTACCAAAATCAA
ATAAATAAATCACATTACGATTCTGTGAAAAATAATGAGCGATATCATAA
AAAGAATTTAAAGACAAGTATCAGTAAACCTGAGCATAAAAATCTCAACA
ATATCCAATGTGATGATGATCTGGGACCTAATAATAAGTATTATTTCGAT
TCCAAATACATGGACTATCAATCTGGGTTAAATTACTACATGAAAAACTC
ACAAATCCCAATCCCAATCACAAATGAGGAACATAAAAGTAAACGACTCA
GTCATACTCTTTATAATGATGACAACCTCTTAACAACAAATATGAAGAAA
ACATCATGTGGATTAAAATACATAATTTTTCAAAAGCTCTCAATAATGAC
CCATTTTATCACTGGATCAAAAAACAGAAAATCAACATTATTTAACAAAC
ACAATAATTTATCCGATGAAAATTTATTCAAAGACAAATCATCACTAAGA
ACTGAGCGATCTAAAAGCTATCACGCTATCGAAACAAATTTCGATCATTC
GACGTGTAATAAGTGCGAAAATCATTTTAAATCTAATTTGATAAAAAAAT
ATTCCAAACCAAGAACGTCAAAAATTAAATTGTCAAATGCTTCAAACAGT
TCGTCGGGATCTATCGATGCCCATGCAGGATCTCCAATAACGATCATGAC
AACCGTGTGTGGAAACATTCTGTCAAATGGATCGAATCCTTTAGTTTCTA
ACACAATTTGTCATTCTAAATCTAAATGGAAAAATGAAGAAAAATTCTTT
GAAAACTTTCCCGAAAATAAAGAAACAAATCAACAAGGAAATTATAATTT
TCATAAGGAAAATTTGAACAATTATCAAGTAAATAAACCAAATTTCAACC
AGCATAACAATAATAACAACAACATCCTCAACATCAACAACAATAAACCA
ACGACAAATCATCACATGTGCAATGATTGTCCCTGTTCTTCACAGTTTCC
CTGTAATCAAATGCCTTGTGAACAAATTTGTGGCCACCAGTGCTGTACGA
AACCTCACGTACAACCATCTTTCCAGTCATGTCATTATTGTTGTTGCAGC
AGTCATTCCCATGTCGTAATGCATCCATCATATTCACAGAGTCCTTATAT
GTGCTGCAGTCCATCAAACTTCATGCATCATTGCTCAATTTCCAAACCAA
TTTGTTTGCATTCGTTCTTTCCATGTAATTCTTCACACATAGCGAACAAC
GCTTGCACTTCTTCATCCATTCTCTGCAATTCATGTCAAGCAAAAAATGT
TGATCGATGCCACAGTGTTAATCTCAATAATTGTAACAAGATATTTTGGA
ATAATTCAAATGAAAATAAACAGTTTCAAAATGTATATTCAAATACTCAA
AAGTATCGATCAAAAGGTGAAACGAAAAGTCGCAGCTCCAAACCAACATC
AATTCCACCTCCTCCACCGCCGCCACCATCATCATTATATTCAACGAAAG
AAGTTCCAATTCACAAATCGAAACCAAAACGACATTATTCAAATAAAGCT
TCAAGCTCAGGAAAGGTTTGTAATCATTGTTCCGAGAAAATTCCTGTTAT
CAGTCAAGACGGTGCCGATAATGTACAAAACATAATATATTCTCATCTCA
ATAACACTGTTGCCTGCCAATCATCAAAGAACAATGACAATACTGAAGTA
TTCCAACGAGTGAAGAACACATCAATAAACTGTGAAAACAGATTAAAAAA
TCTTCCAAGAAATATTTCATGGAACTCACAAAATGATCGAATACAAGAAA
ACATGTTTAGAAATTCGAATGAGAACGATCAAATTAAGTATATGACCAAT
GCTCAAGATGTTACCGACAGACGTTCTGCTGATATCTATAGGCACCGATC
TTCAGCTGCTACCCCGATAATAAATTCCACTCATAAGCCTCGATTTATCT
CAAAAACACCGGAGACATATAAGAGCAAATATGATCGTCGACAAAAGAGT
CATCAAGGTGAAACAAAGCGAATACTGAAACACAAAAGCCTCAGTACTCC
TAAAGAGTATAATGACATTGATCAAGAGACATTTTATCGAAATGATTCCG
TTGATTCGCCTGAAGCCGGTTCATTTATTTACAATCCATTTTCACCGTTA
ACAAAAAGAACTGCTCCGACTGTCGCTATTAGTAATTTGTCTTCCTTTAA
TATTCATCAACAGCATTTCAATCTCAAAGACAAACAAAACAACAATCCGG
AACCGGCACGGAAAGCTTTTCAAGAAAATATGTTATCTTTGAAAGAAGTT
GGATGGTACTGGGGTCCTCTAAGTTTCACTGAAGCTGAACGTTTGATGGA
GAATAAAGCAAATGGGACATTTCTTGTGAGGGATAGTGGACATGACACTT
ATTTTTTAAGTCTTACATTCCGAGTCCGAGAAACAACTTACCATACTCGG
ATCGAATATTCCCAAGGTACATTCAGTTTCTGGTCTCAGCCAGAATCACA
CAGTGCCACAACTATTTCAGAATTTATAGACAAAGCAGTAGCGCATTCTC
AAAGTGGAAAATTTCATTATTTCTTATTAACAAATGTTCCTGGTCAGCCA
CCAATGGAGGTTTCACTGCTGTATCCATTGACCAGAAATCAAATTGTTCA
TTCATTGAAACATTTGTCGAGATTTGTAATTCTTAGTAATATTCGCAAAG
ACCATATAGCTAATTTGAATATTCCATCCCCCTTAAAGTTGTATTTACTG
GAAAAACAATATTACATAAGTAATCTTGACCATTTCATTGAAGCAACTAT
GGACGCTCACCCTCTCAATTACAAGCCGTCCATATCCAGTGAATCTCTCA
ACGAATAGATCATTTGACTTTGTGTTCGCTGATTTTTATGTAAATAACTT
AATTTAAAGTTTCGTTCATTTTTCGTTCATTTGTAAAAATATTATCTTCC
ATTATATTTTATACACAGCGTGCAAAACGATGAACTAGATTATATAATTG
AGAATTAAAGTTGTAAAGTTGTTTGTATAAATGAATTTTCTGTTGAGGCA
GCTTTTAATAAATTTATTAACGAATTTTTATGAAAATGATTTTAACAGTT
TGATCGTAATATAATGCTTGAATGAATTTCGGTTTTTGCGATATCAATAA
GC
back to top

protein sequence of SMED30028309-orf-1

>SMED30028309-orf-1 ID=SMED30028309-orf-1|Name=SMED30028309-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1062bp
MLRTTPHCACRNSQLHTEDSQRLNAKAYSILPTYPNKADINRQSSKTITN
FENSHSLFSKNKFGCHNRNENEFKNYENIEYYTSGIFRPHSCPFNKRKDS
SDIPPNPGDFCTESTMKPNKNYYQNQINKSHYDSVKNNERYHKKNLKTSI
SKPEHKNLNNIQCDDDLGPNNKYYFDSKYMDYQSGLNYYMKNSQIPIPIT
NEEHKSKRLSHTLYNDDNLLTTNMKKTSCGLKYIIFQKLSIMTHFITGSK
NRKSTLFNKHNNLSDENLFKDKSSLRTERSKSYHAIETNFDHSTCNKCEN
HFKSNLIKKYSKPRTSKIKLSNASNSSSGSIDAHAGSPITIMTTVCGNIL
SNGSNPLVSNTICHSKSKWKNEEKFFENFPENKETNQQGNYNFHKENLNN
YQVNKPNFNQHNNNNNNILNINNNKPTTNHHMCNDCPCSSQFPCNQMPCE
QICGHQCCTKPHVQPSFQSCHYCCCSSHSHVVMHPSYSQSPYMCCSPSNF
MHHCSISKPICLHSFFPCNSSHIANNACTSSSILCNSCQAKNVDRCHSVN
LNNCNKIFWNNSNENKQFQNVYSNTQKYRSKGETKSRSSKPTSIPPPPPP
PPSSLYSTKEVPIHKSKPKRHYSNKASSSGKVCNHCSEKIPVISQDGADN
VQNIIYSHLNNTVACQSSKNNDNTEVFQRVKNTSINCENRLKNLPRNISW
NSQNDRIQENMFRNSNENDQIKYMTNAQDVTDRRSADIYRHRSSAATPII
NSTHKPRFISKTPETYKSKYDRRQKSHQGETKRILKHKSLSTPKEYNDID
QETFYRNDSVDSPEAGSFIYNPFSPLTKRTAPTVAISNLSSFNIHQQHFN
LKDKQNNNPEPARKAFQENMLSLKEVGWYWGPLSFTEAERLMENKANGTF
LVRDSGHDTYFLSLTFRVRETTYHTRIEYSQGTFSFWSQPESHSATTISE
FIDKAVAHSQSGKFHYFLLTNVPGQPPMEVSLLYPLTRNQIVHSLKHLSR
FVILSNIRKDHIANLNIPSPLKLYLLEKQYYISNLDHFIEATMDAHPLNY
KPSISSESLNE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR036860SH2_dom_sf
IPR028423SOCS7
IPR036036SOCS_box-like_dom_sf
IPR001496SOCS_box
IPR000980SH2
Vocabulary: biological process
TermDefinition
GO:0035556intracellular signal transduction
GO:0040008regulation of growth
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001496SOCS box domainSMARTSM00253socs_2coord: 986..1029
e-value: 1.9E-5
score: 34.1
IPR001496SOCS box domainSMARTSM00969SOCS_box_2coord: 992..1028
e-value: 6.7E-6
score: 35.6
IPR001496SOCS box domainPFAMPF07525SOCS_boxcoord: 992..1026
e-value: 2.3E-6
score: 27.8
IPR001496SOCS box domainPROSITEPS50225SOCScoord: 981..1031
score: 10.86
IPR000980SH2 domainSMARTSM00252SH2_5coord: 876..961
e-value: 1.5E-15
score: 67.6
IPR000980SH2 domainPFAMPF00017SH2coord: 878..933
e-value: 3.1E-8
score: 33.6
IPR000980SH2 domainPROSITEPS50001SH2coord: 878..986
score: 12.822
IPR036860SH2 domain superfamilyGENE3DG3DSA:3.30.505.10coord: 862..1039
e-value: 1.7E-41
score: 144.0
IPR036860SH2 domain superfamilySUPERFAMILYSSF55550SH2 domaincoord: 868..975
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 591..606
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 576..628
NoneNo IPR availablePANTHERPTHR10155PHOSPHATIDYLINOSITOL 3-KINASE REGULATORY SUBUNITcoord: 407..1032
IPR028423Suppressor of cytokine signalling 7PANTHERPTHR10155:SF5SUPPRESSOR OF CYTOKINE SIGNALING 7coord: 407..1032
IPR036036SOCS box-like domain superfamilySUPERFAMILYSSF158235SOCS box-likecoord: 992..1032