Protein KIAA0556 homolog

Overview
NameProtein KIAA0556 homolog
Smed IDSMED30028292
Length (bp)3919
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein KIAA0556 homolog (SMED30028292) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein KIAA0556 homolog (SMED30028292) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein KIAA0556 homolog (SMED30028292) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein KIAA0556 homolog (SMED30028292) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30028292

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30028292h1SMcG0014712 SmedASXL_017058SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
protonephridiaSMED30028292h1SMcG0014712 dd_Smed_v4_10945_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30028292h1SMcG0014712 dd_Smed_v6_10945_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30028292h1SMcG0014712 dd_Smed_v4_10945_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein KIAA0556 homolog vs. Ensembl Human
Match: KIAA0556 (KIAA0556 [Source:HGNC Symbol;Acc:HGNC:29068])

HSP 1 Score: 557.755 bits (1436), Expect = 7.744e-173
Identity = 331/776 (42.65%), Postives = 456/776 (58.76%), Query Frame = 1
Query: 1564 NSNRKESARFGRRSELDECS-GRDQLKELIXXXXXXXXXXXXXKNKSEN-LEKSWSSLKFFNKSQAGRLS-LDHTGDILDKYVDQ------------------IKRNQK-LDXXXXXXXXFVIPELPRGKEMVMNILSTWGDPHYVGLTGIEMFASTGERVTVRNISADPPDINILTGYGTDPRVVTNLLDGVNKTHDDVHMWLAPFTASQNHFIKIEFEKEIDLALLRIWNYNKSRIHSSRGAKDVEIKLNGTVIFKGEIARAFH--CSEIEEFGEVILFTSDDQILDRIGQNDQEF-VDSGHNNDASTDGQSPVGQSDETKELLDSLAMRPPTAKQSPTNERKTDE----TNKQSTNLYRPFTSTRPVRFCEEKQI---IKVKLNLADTWGDNFYIGLTGLEFVGDNGDAISVDMDNISTNTQAL------RDDVRRVENIFNGTNLTTNDEHMWLAPFNSNEDHCLTVXXXXXXXXXXXXXWNYNKSLEDSYRGVKILHVWINDKRVSSDEGYFIRRAPGHVQYDFVQEI----HIKTNVALPE------------ALIQYNH--LPCGFVYQFNILSSWNDLYYVGLNGIEIYDQHCQSISISPQQVYAYPDSVNSLTPKNQRTFSNLDVRTPDKLVDGINDSYDAKHMWLAPILPGCLNRIFFVFDRPVCVSMIKIWNYSKTPSRGVKDFSILVDDLLIYSGTLPSATSSSITRGILPNMNESIAPTNRHKTVLF--DRTSGALLNQEKLFLLEHSISSGQDVILINDNDI 3717
            N  R  S R G R +    S G DQ       + + T S    +++ E+ L +SWSSL  F++S  GR+S  +  GDILD+ + Q                  + R Q     E +   +F IP LP G+ +V++I STWGD HYVGL GIE+F+S GE V + NI ADPPDINIL  YG DPRVVTNL+DGVN+T DD+H+WLAPFT  ++H I I+F     +AL+RIWNYNKSRIHS RG KD+ + L+   IF+GEIA+A        E FG+ ILFT+DD IL+ I  +D+ F +D              VG  D    L D  AMR P+      +ER   +     +++   L  P +S  P     E  I   I ++LN   +WGD  Y+GLTGLE VG  G A+ + +  IS + + L       DD R ++ + +GTN+T  DEHMWL PF+   DH +T+ ++ A  I+ +R WNYNKS ED+YRG KI+HV ++   VS  EG+ IR+ PG+  +DF QEI    +++  + LP+            A + Y    +PCGF++QF +L+SW D YY+GL G+E+YD+  + I +S   + A+PDSVNSL           DVRTPDKL+D +ND+ D +HMWLAPILPG +NR++ +FD P  VSMIK+WNY+KTP RGVK+F +LVDDLL+Y+G L  A  S +  GILP    +  PT  + T+LF  DR    + +QEK   + +  +  QDV ++N+N I
Sbjct:  846 NRERPASGRRGSRKDAGSSSHGDDQPASREDTWSSRTPSRSRWRSEQEHTLHESWSSLSAFDRSHRGRISNTELPGDILDELLQQKSSRHSDLPPSKKGEQPGLSRGQDGYSGETDAGGDFKIPVLPYGQRLVIDIKSTWGDRHYVGLNGIEIFSSKGEPVQISNIKADPPDINILPAYGKDPRVVTNLIDGVNRTQDDMHVWLAPFTRGRSHSITIDFTHPCHVALIRIWNYNKSRIHSFRGVKDITMLLDTQCIFEGEIAKASGTLAGAPEHFGDTILFTTDDDILEAIFYSDEMFDLD--------------VGSLD---SLQDEEAMRRPSTADGEGDERPFTQAGLGADERIPELELPSSSPVPQVTTPEPGIYHGICLQLNFTASWGDLHYLGLTGLEVVGKEGQALPIHLHQISASPRDLNELPEYSDDSRALDKLIDGTNITMEDEHMWLIPFSPGLDHVVTIRLDRAESIAGLRFWNYNKSPEDTYRGAKIVHVSLDGLCVSPPEGFLIRKGPGNCHFDFAQEILFVDYLRAQL-LPQPARRLDMRSLECASMDYEAPLMPCGFIFQFQLLTSWGDPYYIGLTGLELYDERGEKIPLSENNIAAFPDSVNSL------EGVGGDVRTPDKLIDQVNDTSDGRHMWLAPILPGLVNRVYVIFDLPTTVSMIKLWNYAKTPHRGVKEFGLLVDDLLVYNGIL--AMVSHLVGGILP----TCEPTVPYHTILFTEDRD---IRHQEKHTTISNQ-AEDQDVQMMNENQI 1587          

HSP 2 Score: 53.1434 bits (126), Expect = 4.296e-6
Identity = 48/190 (25.26%), Postives = 87/190 (45.79%), Query Frame = 1
Query:  787 VDRVLKMNFNQQQKLLSTLDKIET---------------VYETD---------IESEVDLELTIESNWGHPSRVGLTEVEFWDSNKQRIMIMNVE---SNERVEGKLNNIINDKKDTAKEKNMWSTNFTNARPITICFML-STQSVADVQF--IGIWNFNKSLDSLSIGVQKFSLRHSGKVICSGIVNKA 1266
            +DR+  +   QQQKLL  L  +E+               V +T+         I+  + + + I SNWG+   VGLTEVEF+D N  ++ +   +    N    G+L  ++N      K+ + W+  F    P+ + F++ +T+ + D     I + N+  +   L IG +   L  +  +I +G ++K 
Sbjct:  420 MDRIGLLGSRQQQKLLKVLQAVESDSAHLGRVVSPTKEQVSDTEDKQRMRADEIKDAIYVTMEILSNWGNSWWVGLTEVEFFDLNDTKLYVSPHDVDIRNTATPGELGRLVNRNLAGKKDSSPWTCPFHP--PLQLFFVIRNTRQLGDFHLAKIKVRNYWTADGDLDIGAKNVKLYVNRNLIFNGKLDKG 607          
BLAST of Protein KIAA0556 homolog vs. Ensembl Celegans
Match: K04F10.2 (pep chromosome:WBcel235:I:6360844:6364172:1 gene:WBGene00019395.1 transcript:K04F10.2.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:K04F10.2)

HSP 1 Score: 298.901 bits (764), Expect = 1.975e-88
Identity = 197/577 (34.14%), Postives = 299/577 (51.82%), Query Frame = 1
Query: 1864 IPELPRGKEMVMNILSTWGDPHYVGLTGIEMFASTGERVTVRNISADPPDINILTGYGTDPRVVTNLLDGVNKTH--DDVHMWLAPFTASQNHFIKIEFEKEIDLALLRIWNYNKSRIHSSRGAKDVEIKLNGTVIFKGEIARAFHCSEIEEF----GEVILFTSDDQILDRIGQNDQEFVDSGHNNDASTDGQSPVGQSDETKELLDSLA-MRPPT--AKQSPTNERKTDETNKQSTNLYRPFTSTRPVRFCEEKQIIK-----VKLNLADTWGDNFYIGLTGLEFVGDNGDAISVDMDNISTNTQALRDDVRRVENIFNGTNLTTNDEHMWLAPFNSNEDHCLTVXXXXXXXXXXXXXWNYNKSLEDSYRGVKILHVWINDKRVSSDEGYFIRRAPGHVQYDFVQEIHIKTNVA----LPEALIQYNHLPCGFVYQFNILSSWNDLYYVGLNGIEIYDQHCQSISISPQQVYAYPDSVNSLTPKNQRTFSNLDVRTPDKLVDGINDSYDAKHMWLAPILPGCLNRIFFVFDRPVCVSMIKIWNYSKTPSRGVKDFSILVDDLLIYSGTLPSATSS 3540
            IPELP G+ + + +LS WGD HY+GL  +E+F STGER  +  I+      N+    G+   ++      V + H  D   MW A  T  +   + +E ++   LAL+R WNYN SR+H+  G + +E+ L+G  IF+GE+  AF  S   EF    GE +LFT+ D IL+ I  +D   +         +  + P+  S       D L   RP T  AK +P+                 P T   P  F +     K     + + L   WG +  IGLTGLE V ++   I  D    +  T     D+ +   +FNG NLT +   MWL  F+S     +++       + +I +WNYN S E SY GVK   ++IN K +   +   +R+A G V +D+VQ++ +  N      +P+ + Q      GFV+Q  +LS+W D +Y+GLNGIE+Y++  + + I    + A+P+SVN L P  +      D+RT + L+   ND+  A++MWL  +LP    R+FFVFD    +S I I+NY KTP RGV+  S+ VDDL+I+SG +PS+T++
Sbjct:   35 IPELPEGRVLELRLLSNWGDSHYIGLNSVEIFTSTGERAVIDKIAT-----NVTEYTGSLESLI------VQRVHCKDAEKMWCAK-TTEEKIVLTLELKETCKLALIRFWNYNASRVHAQIGVRYLEMYLDGVGIFRGELECAF--SADSEFTPVMGETVLFTTSDNILELIALHDVCLI---------SLPEEPISNSSIEMLKADHLTPYRPSTCEAKDAPST----------------PVTIVPPPIFRQTGTAYKHDVKTLHIELLSNWGMDGLIGLTGLELVDEHSQLI--DESQYTVTTSDGNSDLSK--KLFNGRNLTRDPHDMWLVDFDSKNFTTISITFHDNVALKAISVWNYNASFELSYAGVKAAKIYINGKLI---KNVLLRKATGFVYFDYVQDVVLDPNNTERDFVPKGISQS---IGGFVFQIRLLSTWGDEFYIGLNGIELYNRKGELMKIREHNLAAFPESVNIL-PNIKN-----DLRTSNNLITQPNDTDIARNMWLTALLPNRCARVFFVFDVQTYISKIVIYNYRKTPERGVRHISVTVDDLIIFSGEIPSSTAT 556          

HSP 2 Score: 52.373 bits (124), Expect = 2.237e-6
Identity = 37/135 (27.41%), Postives = 56/135 (41.48%), Query Frame = 1
Query:  892 LELTIESNWGHPSRVGLTEVEFWDSNKQRIMIMNVESN-ERVEGKLNNIINDKKDTAKEKNMWSTNFTNARPITICFMLSTQSVADVQFIGIWNFNKSLDSLSIGVQKFSLRHSGKVICSGIVNKAL-GNQVFNP 1290
            LEL + SNWG    +GL  VE + S  +R +I  + +N     G L ++I  +      + MW    T  +   I   L  +    +  I  WN+N S     IGV+   +   G  I  G +  A   +  F P
Sbjct:   44 LELRLLSNWGDSHYIGLNSVEIFTSTGERAVIDKIATNVTEYTGSLESLIVQRVHCKDAEKMWCAKTTEEK---IVLTLELKETCKLALIRFWNYNASRVHAQIGVRYLEMYLDGVGIFRGELECAFSADSEFTP 175          

HSP 3 Score: 50.8322 bits (120), Expect = 6.408e-6
Identity = 43/151 (28.48%), Postives = 73/151 (48.34%), Query Frame = 1
Query:  856 TVYETDIESEVDLELTIESNWGHPSRVGLTEVEFWDSNKQRI-----MIMNVESNERVEGKLNNIINDKKDTAKEKNMWSTNF--TNARPITICFMLSTQSVADVQFIGIWNFNKSLDSLSIGVQKFSLRHSGKVICSGIVNKALGNQVFN 1287
            T Y+ D+++   L + + SNWG    +GLT +E  D + Q I      +   + N  +  KL    N +  T    +MW  +F   N   I+I F     +VA ++ I +WN+N S +    GV+   +  +GK+I + ++ KA G   F+
Sbjct:  252 TAYKHDVKT---LHIELLSNWGMDGLIGLTGLELVDEHSQLIDESQYTVTTSDGNSDLSKKL---FNGRNLTRDPHDMWLVDFDSKNFTTISITFH---DNVA-LKAISVWNYNASFELSYAGVKAAKIYINGKLIKNVLLRKATGFVYFD 392          
BLAST of Protein KIAA0556 homolog vs. Ensembl Zebrafish
Match: si:dkey-161j23.7 (si:dkey-161j23.7 [Source:ZFIN;Acc:ZDB-GENE-091204-391])

HSP 1 Score: 270.011 bits (689), Expect = 9.907e-81
Identity = 147/350 (42.00%), Postives = 211/350 (60.29%), Query Frame = 1
Query: 2812 HMWLAPFNSNEDHCLTVXXXXXXXXXXXXXWNYNKSLEDSYRGVKILHVWINDKRVSSDEGYFIRRAPGHVQYDFVQEI------------------------HIKTNVALPEALIQYNH--LPCGFVYQFNILSSWNDLYYVGLNGIEIYDQHCQSISISPQQVYAYPDSVNSLTPKNQRTFSNL--DVRTPDKLVDGINDSYDAKHMWLAPILPGCLNRIFFVFDRPVCVSMIKIWNYSKTPSRGVKDFSILVDDLLIYSGTLPSATSSSITRGILPNMNESIAPTNRHKTVLFDRTSGALLNQEKLFLLEHSISSGQDVILINDNDINSVH----CANQKYRPMTSV 3765
            HMWL PF    +H LTV       I+  R+WNYNKS EDSYRGVK++HV+++   +S  EG+ IR+ PG+  +DF QE+                        H   N     A + Y    +PCGF++Q  +L++W D YY+GLNG+E YDQ+ Q I +S   + A+PDSVN L         N+  DVRTPDKL+DG+N+++D +HMWLAP+LPG +NR++ +FD+P+ VSMIK+WNYSKTP RGVK+F +LVDDLL+Y+G L      +++RGILP ++    P   + T+LF   +  + ++EK  ++ + +   QDV L N+N I   H     A+   RP T +
Sbjct:    1 HMWLIPFTDASEHTLTVQFPQPQTIAGFRVWNYNKSPEDSYRGVKVVHVFLDGVCISPLEGFLIRKGPGNCHFDFAQELLFIDYLQSNPNSAAYSRSLTADDTHRAGNRRAEMASMDYEAPLMPCGFIFQLQLLTTWGDPYYIGLNGLEFYDQNDQKIPLSDNNISAFPDSVNVL--------DNVCGDVRTPDKLIDGVNNTHDGRHMWLAPVLPGLVNRVYVIFDQPMTVSMIKLWNYSKTPQRGVKEFGLLVDDLLVYNGILECV--KNVSRGILPTLD----PVVPYHTILFTDNT-HITHREKSTIISNHVED-QDVKLTNENQIIHQHRKKQTADPALRPKTCM 334          

HSP 2 Score: 100.523 bits (249), Expect = 3.396e-22
Identity = 63/221 (28.51%), Postives = 111/221 (50.23%), Query Frame = 1
Query: 1867 PELPRGKEMVMNILSTWGDPHYVGLTGIEMFASTGERVTVR--NISADPPDINILTGYGTDPRVVTNLLDGVNKTHDDVHMWLAPFTASQNHFIKIEFEKEIDLALLRIWNYNKSRIHSSRGAKDVEIKLNGTVIFKG--EIARAFHCSEIEEFGEV-----ILFTSDDQILDRIGQNDQEFVDSGH--NNDASTDGQSPVGQSDETKELLDSLAMRPPTA 2496
            P +P G    + +L+TWGDP+Y+GL G+E +    +++ +   NISA P  +N+L     D R    L+DGVN THD  HMWLAP      + + + F++ + ++++++WNY+K+     RG K+  + ++  +++ G  E  +      +     V     ILFT +  I  R    ++  + S H  + D     ++ +      K+  D  A+RP T 
Sbjct:  121 PLMPCGFIFQLQLLTTWGDPYYIGLNGLEFYDQNDQKIPLSDNNISAFPDSVNVLDNVCGDVRTPDKLIDGVNNTHDGRHMWLAPVLPGLVNRVYVIFDQPMTVSMIKLWNYSKT---PQRGVKEFGLLVDDLLVYNGILECVKNVSRGILPTLDPVVPYHTILFTDNTHITHR----EKSTIISNHVEDQDVKLTNENQIIHQHRKKQTADP-ALRPKTC 333          

HSP 3 Score: 96.2857 bits (238), Expect = 1.149e-20
Identity = 91/305 (29.84%), Postives = 131/305 (42.95%), Query Frame = 1
Query: 2098 HMWLAPFTASQNHFIKIEFEKEIDLALLRIWNYNKSRIHSSRGAKDVEIKLNGTVIFKGEIARAFHCSEIEEFGEVILFTSDDQILDRIGQNDQEFVDSGHNNDASTDGQSPVGQSDETKELL--DSLAMRPPTAKQSPTNERKTDETNKQSTNLYRPFTST---RPVRFCEEKQIIKVKLNLADTWGDNFYIGLTGLEFVGDNGDAISVDMDNISTNTQALR------DDVRRVENIFNGTNLTTNDEHMWLAPFNSNEDHCLTVXXXXXXXXXXXXXWNYNKSLEDSYRGVKILHVWINDKRV 2979
            HMWL PFT +  H + ++F +   +A  R+WNYNKS   S RG K V + L+G  I           S +E F            L R G  +  F                    D  +ELL  D L   P +A  S       D+T++ + N      S     P+  C        +L L  TWGD +YIGL GLEF   N   I +  +NIS    ++        DVR  + + +G N T +  HMWLAP      + + V  +    +S I++WNY+K+ +   RGVK   + ++D  V
Sbjct:    1 HMWLIPFTDASEHTLTVQFPQPQTIAGFRVWNYNKSPEDSYRGVKVVHVFLDGVCI-----------SPLEGF------------LIRKGPGNCHF--------------------DFAQELLFIDYLQSNPNSAAYS--RSLTADDTHR-AGNRRAEMASMDYEAPLMPCG----FIFQLQLLTTWGDPYYIGLNGLEFYDQNDQKIPLSDNNISAFPDSVNVLDNVCGDVRTPDKLIDGVNNTHDGRHMWLAPVLPGLVNRVYVIFDQPMTVSMIKLWNYSKTPQ---RGVKEFGLLVDDLLV 252          
BLAST of Protein KIAA0556 homolog vs. Ensembl Zebrafish
Match: si:dkey-161j23.6 (si:dkey-161j23.6 [Source:ZFIN;Acc:ZDB-GENE-091204-173])

HSP 1 Score: 236.884 bits (603), Expect = 2.491e-67
Identity = 120/255 (47.06%), Postives = 167/255 (65.49%), Query Frame = 1
Query: 1708 LEKSWSSLKFFNKSQAGRLS-LDHTGDILDKYVDQIKRNQKLDXXXXX-----------XXXFVIPELPRGKEMVMNILSTWGDPHYVGLTGIEMFASTGERVTVRNISADPPDINILTGYGTDPRVVTNLLDGVNKTHDDVHMWLAPFTASQNHFIKIEFEKEIDLALLRIWNYNKSRIHSSRGAKDVEIKLNGTVIFKGEIARAFH--CSEIEEFGEVILFTSDDQILDRIGQNDQEFVDSGHNNDASTDGQS 2430
            L +SW SL  FN+ Q GR+S +   GDI D+++ +  R   +  +               E+F IP LP+G+ +V NILSTWGD HYVGL GIE+F+S+GE +T  +I+ADPPDINIL  YG DPRVV NL DGV++T DD+H+WLAPFT  + H + ++      LA++R+WNYNKSRIHS RG +++E+ L+G  IF+GEIA+A       +++FG+ ILFT+DD+IL+ + Q D  F      N+  T G S
Sbjct:  191 LMESWDSLTKFNQCQRGRISNMGLEGDIFDEFLQRQSRPAPVAAQSPALPDSDDPEDDPHEDFEIPVLPQGRHLVFNILSTWGDRHYVGLNGIEIFSSSGEPITPVHITADPPDINILPAYGKDPRVVKNLTDGVHRTQDDMHLWLAPFTPGRRHVVCMDLGGRCCLAMIRVWNYNKSRIHSFRGVREMEMLLDGRCIFRGEIAKASGTLSGALDQFGDTILFTTDDEILEAMAQFDDTF-----GNEMETSGPS 440          

HSP 2 Score: 100.138 bits (248), Expect = 2.533e-21
Identity = 57/164 (34.76%), Postives = 86/164 (52.44%), Query Frame = 1
Query: 3100 LPCGFVYQFNILSSWNDLYYVGLNGIEIYDQHCQSISISPQQVYAYPDSVNSLTPKNQRTFSNLDVRTPDKLVDGINDSYDAKHMWLAPILPGCLNRIFFVFDRPVCVSMIKIWNYSKT---PSRGVKDFSILVDDLLIYSGTLPSATSSSITRGILPNMNESI 3582
            LP G    FNILS+W D +YVGLNGIEI+    + I+  P  + A P  +N L    +      D R    L DG++ + D  H+WLAP  PG  + +        C++MI++WNY+K+     RGV++  +L+D   I+ G +  A +S    G L    ++I
Sbjct:  258 LPQGRHLVFNILSTWGDRHYVGLNGIEIFSSSGEPIT--PVHITADPPDINILPAYGK------DPRVVKNLTDGVHRTQDDMHLWLAPFTPGRRHVVCMDLGGRCCLAMIRVWNYNKSRIHSFRGVREMEMLLDGRCIFRGEI--AKASGTLSGALDQFGDTI 411          

HSP 3 Score: 77.7962 bits (190), Expect = 3.801e-14
Identity = 51/165 (30.91%), Postives = 85/165 (51.52%), Query Frame = 1
Query: 2623 LNLADTWGDNFYIGLTGLEFVGDNGDAIS---VDMDNISTNT-QALRDDVRRVENIFNGTNLTTNDEHMWLAPFNSNEDHCLTVXXXXXXXXXXXXXWNYNKSLEDSYRGVKILHVWINDKRVSSDEGYFIRRAPGHVQY---DFVQEIHIKTNVALPEALIQYN 3096
             N+  TWGD  Y+GL G+E    +G+ I+   +  D    N   A   D R V+N+ +G + T +D H+WLAPF     H + + +     ++ IR+WNYNKS   S+RGV+ + + ++ + +   E   I +A G +      F   I   T+  + EA+ Q++
Sbjct:  266 FNILSTWGDRHYVGLNGIEIFSSSGEPITPVHITADPPDINILPAYGKDPRVVKNLTDGVHRTQDDMHLWLAPFTPGRRHVVCMDLGGRCCLAMIRVWNYNKSRIHSFRGVREMEMLLDGRCIFRGE---IAKASGTLSGALDQFGDTILFTTDDEILEAMAQFD 427          
BLAST of Protein KIAA0556 homolog vs. Ensembl Xenopus
Match: tfip11 (tuftelin interacting protein 11 [Source:Xenbase;Acc:XB-GENE-984521])

HSP 1 Score: 540.806 bits (1392), Expect = 1.119e-166
Identity = 333/888 (37.50%), Postives = 472/888 (53.15%), Query Frame = 1
Query: 1405 NAQNLTFRMGMSERKLEDKLEEMVTTERKPENKLEMKLEGISNNLLMEESE--------------KCNSNRKESARFGRRSELDECSGRDQLKELIXXXXXXXXXXXXXKNKSENLEKSWSSLKFFNKSQAGRLS-LDHTGDILDKYVDQIKRNQKLDXXXXXXX--------------------XFVIPELPRGKEMVMNILSTWGDPHYVGLTGIEMFASTGERVTVRNISADPPDINILTGYGTDPRVVTNLLDGVNKTHDDVHMWLAPFTASQNHFIKIEFEKEIDLALLRIWNYNKSRIHSSRGAKDVEIKLNGTVIFKGEIARAFH--CSEIEEFGEVILFTSDDQILDRIGQNDQEFVDSGHNNDASTDGQSPVGQSDETKELLDSLAMRPPTAKQSPTNERKTDETNKQSTNLYRPFTSTRPVRFCEEKQ--IIKV-----------------KLNLADTWGDNFYIGLTGLEFVGDNGDAISVDMDNISTNTQAL------RDDVRRVENIFNGTNLTTNDEHMWLAPFNSNEDHCLTVXXXXXXXXXXXXXWNYNKSLEDSYRGVKILHVWINDKRVSSDEGYFIRRAPGHVQYDFVQEI--------------HIKTNVALPE-ALIQYNH--LPCGFVYQFNILSSWNDLYYVGLNGIEIYDQHCQSISISPQQVYAYPDSVNSLTPKNQRTFSNLDVRTPDKLVDGINDSYDAKHMWLAPILPGCLNRIFFVFDRPVCVSMIKIWNYSKTPSRGVKDFSILVDDLLIYSGTLPSATSSSITRGILPNMNESIAPTNRHKTVLF---------DRTSGALLNQEKLFLLEHSISSGQDVILINDNDI----NSVHCANQKYRPMTSVKVRAMVK*T 3792
            NA +  F    S+  +   LE+ VT+ ++  NK      G  N +L   S+               CN +R  S R  +   + + S R    + I +  T         ++  NL +SW+SL  FNKS  GR+S L+  GDI D+++ Q K  +  D  +                         F IP LP G+ + + I++TWGD HY+GL GIE+FASTG+ V +  I ADPPDINIL  YG DPRVVTNL+DG+N+T DD+H+WLAPFT  + HF+ ++F     +A++RIWNYNKSRIHS RG K VEI L+  +IFKGEIA+A        E+FG+ ILFT+DD+IL  +   D+ F +     ++S + +            +DSL  RP TA                S    RPFT      F E+ Q  I  V                 +LN   TWGD  Y+GLTG+E VG +G A+   +  +S     L       +D R ++ + +G N+T  D HMWL PF S  DH +T+    +  I+ IR WNYNKS ED+YRG KI+H+ ++   +S  EG+ IR+ PG+  +DF QEI               ++++    E A + Y    +PCGF++Q  +++SW D YY+GLNG+E++ +H + I+++   + A+P+S+N L           DVRTPDKL+D +ND+ D +HMWL+PILPG +NRI+ VFD+P  VSMIK+WNY+KTP RGVK+F +LVDDLL+Y+G L     S I+ GILP  +    P   + T+LF         DR + A+ NQ +           QDV ++NDN I         A+   RP T +  R   K T
Sbjct:  782 NASSGNFTNKRSDHNINQFLEDYVTSYKRDSNKNSKN--GNQNKMLCSSSKMENEDDLENFSNQNSCNPDRPVSGR-RKTVHMQDKSERTSFHKTINQVNTENIRPRWQNDQENNLMESWTSLIQFNKSHRGRISNLEFEGDIFDEFLQQQKAGKHYDATKNGSSLARPKGATEINLEFEKEEGSNFEIPVLPYGQHLCIKIVTTWGDRHYIGLNGIEIFASTGKPVEISRIRADPPDINILPAYGKDPRVVTNLIDGINRTQDDMHLWLAPFTPGKLHFLNLDFADPCRVAMIRIWNYNKSRIHSFRGVKQVEILLDNELIFKGEIAKASGTLSGAAEQFGDTILFTTDDEILQAMSLFDETFSEELKATESSAEHE------------IDSL--RPSTA---------------DSVEEERPFTQ---AGFSEKLQNNISDVFENNSHKLPGIYNGKCLQLNFTMTWGDPHYLGLTGMEIVGRDGKALPFTLAELSACPHDLSILPEYHNDTRTLDKLIDGVNITNEDSHMWLIPFTSGADHTITINFNKSEDIAGIRFWNYNKSPEDTYRGGKIVHLTLDGHTISPPEGFLIRKGPGNCHFDFAQEILFVDYIHEKQITDTQLRSHSKCMEFAAMDYEAPLMPCGFIFQLQLITSWGDPYYIGLNGLEMFSEHGEKINLTENNIAAFPESINVLDGVCG------DVRTPDKLIDNVNDTCDGRHMWLSPILPGMVNRIYVVFDQPTTVSMIKMWNYAKTPHRGVKEFGLLVDDLLVYNGILNQV--SHISHGILPTCD----PVIPYHTILFANPEKFSEADRRT-AICNQVE----------DQDVRMMNDNKIVVTSKKKQVADPALRPKTCLTERGSGKKT 1611          

HSP 2 Score: 84.7297 bits (208), Expect = 9.315e-16
Identity = 59/217 (27.19%), Postives = 109/217 (50.23%), Query Frame = 1
Query:  760 DNEKRLKAIVDRVLKMNFNQQQKLLSTLDKIE-----------------TVY-ETDIESEVDLELTIESNWGHPSRVGLTEVEFWDSNKQRIMIMNVESNER---VEGKLNNIINDKKDTAKEKNMWSTNFTNARPITICFML--STQSVA-DVQFIGIWNFNKSLDSLSIGVQKFSLRHSGKVICSGIVNKALGNQVFNPPTVLEIGSGIVNSKSI 1338
            DNE  +   ++++  M  +QQ+KLL  L  I+                 +VY E  ++  + + + I SNWG+   +G+TE++F+D   + I +   + + R   V G    ++N K  T KE  MW+  F    P+ + F++  +T+S   D+  + IWN+NK+L  L+IG +   +     ++  G ++K  GNQ F+    +++ +G + S S 
Sbjct:  377 DNEGVVSKAIEKINLMKISQQKKLLKVLQDIDNDSSSYSNLEGELLKWDSVYVEPAVKDAIYVTVEILSNWGNQYFIGITEIQFFDLKNEEIYVSPHDVDIRNMDVPGDPTCLVNGKTLTTKEHFMWTCPF--HPPVQLYFIIRNATKSADFDISKLKIWNYNKALSDLNIGAKHVKIYKDETLVFDGPLDKGSGNQEFDYSNTIDLQTGQIKSSSF 591          

HSP 3 Score: 65.4698 bits (158), Expect = 7.460e-10
Identity = 46/148 (31.08%), Postives = 75/148 (50.68%), Query Frame = 1
Query: 1858 FVIPELPRGKEMVMNILSTWGDPHYVGLTGIEMFASTGERVTVRNISADPPDINILT-GYGTDPRVVTNLLDGVNKTHDDVHMWLAPFTAS-QNHFIKIEFEK--EIDLALLRIWNYNKSRIHSSRGAKDVEIKLNGTVIFKGEIARA 2289
            +V P +     + + ILS WG+ +++G+T I+ F    E + V      P D++I       DP   T L++G   T  +  MW  PF    Q +FI     K  + D++ L+IWNYNK+    + GAK V+I  + T++F G + + 
Sbjct:  428 YVEPAVKDAIYVTVEILSNWGNQYFIGITEIQFFDLKNEEIYVS-----PHDVDIRNMDVPGDP---TCLVNGKTLTTKEHFMWTCPFHPPVQLYFIIRNATKSADFDISKLKIWNYNKALSDLNIGAKHVKIYKDETLVFDGPLDKG 567          

HSP 4 Score: 54.299 bits (129), Expect = 1.605e-6
Identity = 41/144 (28.47%), Postives = 63/144 (43.75%), Query Frame = 1
Query: 3130 ILSSWNDLYYVGLNGIEIYDQHCQSISISPQQVYAYPDSVNSLTPKNQRTFSNLDVRT-PDKLVDGINDSYDAKHMWLAPILPGCLNRIFFV---------FDRPVCVSMIKIWNYSKTPSR---GVKDFSILVDDLLIYSGTL 3522
            ILS+W + Y++G+  I+ +D   + I +SP  V                   N+DV   P  LV+G   +     MW  P  P    +++F+         FD    +S +KIWNY+K  S    G K   I  D+ L++ G L
Sbjct:  443 ILSNWGNQYFIGITEIQFFDLKNEEIYVSPHDV----------------DIRNMDVPGDPTCLVNGKTLTTKEHFMWTCPFHPPV--QLYFIIRNATKSADFD----ISKLKIWNYNKALSDLNIGAKHVKIYKDETLVFDGPL 564          
BLAST of Protein KIAA0556 homolog vs. Ensembl Xenopus
Match: tfip11 (tuftelin interacting protein 11 [Source:Xenbase;Acc:XB-GENE-984521])

HSP 1 Score: 530.791 bits (1366), Expect = 5.315e-166
Identity = 297/738 (40.24%), Postives = 430/738 (58.27%), Query Frame = 1
Query: 1693 NKSENLEKSWSSLKFFNKSQAGRLS-LDHTGDILDKYVDQIKRNQKLDXXXXXXXX--------------------FVIPELPRGKEMVMNILSTWGDPHYVGLTGIEMFASTGERVTVRNISADPPDINILTGYGTDPRVVTNLLDGVNKTHDDVHMWLAPFTASQNHFIKIEFEKEIDLALLRIWNYNKSRIHSSRGAKDVEIKLNGTVIFKGEIARAFHC--SEIEEFGEVILFTSDDQILDRIGQNDQEFVDSGHNNDASTDGQSPVGQSDETKELLDSLAMRPPTA----KQSP-TNERKTDETNKQSTNLYRPFTSTRPVRF---CEEKQIIKVKLNLADTWGDNFYIGLTGLEFVGDNGDAISVDMDNISTNTQAL------RDDVRRVENIFNGTNLTTNDEHMWLAPFNSNEDHCLTVXXXXXXXXXXXXXWNYNKSLEDSYRGVKILHVWINDKRVSSDEGYFIRRAPGHVQYDFVQEI--------------HIKTNVALPE-ALIQYNH--LPCGFVYQFNILSSWNDLYYVGLNGIEIYDQHCQSISISPQQVYAYPDSVNSLTPKNQRTFSNLDVRTPDKLVDGINDSYDAKHMWLAPILPGCLNRIFFVFDRPVCVSMIKIWNYSKTPSRGVKDFSILVDDLLIYSGTLPSATSSSITRGILPNMNESIAPTNRHKTVLF---------DRTSGALLNQEKLFLLEHSISSGQDVILINDNDI 3717
            ++  NL +SW+SL  FNKS  GR+S L+  GDI D+++ Q K  +  D  +                         F IP LP G+ + + I++TWGD HY+GL GIE+FASTG+ V +  I ADPPDINIL  YG DPRVVTNL+DG+N+T DD+H+WLAPFT  + HF+ ++F     +A++RIWNYNKSRIHS RG K VEI L+  +IFKGEIA+A        E+FG+ ILFT+DD+IL  +   D+ F +     ++S + +            +DSL  RP TA    ++ P T    +++     ++++   +   P  +   C       ++LN   TWGD  Y+GLTG+E VG +G A+   +  +S     L       +D R ++ + +G N+T  D HMWL PF S  DH +T+    +  I+ IR WNYNKS ED+YRG KI+H+ ++   +S  EG+ IR+ PG+  +DF QEI               ++++    E A + Y    +PCGF++Q  +++SW D YY+GLNG+E++ +H + I+++   + A+P+S+N L           DVRTPDKL+D +ND+ D +HMWL+PILPG +NRI+ VFD+P  VSMIK+WNY+KTP RGVK+F +LVDDLL+Y+G L     S I+ GILP  +    P   + T+LF         DR + A+ NQ +           QDV ++NDN I
Sbjct:  539 DQENNLMESWTSLIQFNKSHRGRISNLEFEGDIFDEFLQQQKAGKHYDATKNGSSLARPKGATEINLEFEKEEGSNFEIPVLPYGQHLCIKIVTTWGDRHYIGLNGIEIFASTGKPVEISRIRADPPDINILPAYGKDPRVVTNLIDGINRTQDDMHLWLAPFTPGKLHFLNLDFADPCRVAMIRIWNYNKSRIHSFRGVKQVEILLDNELIFKGEIAKASGTLSGAAEQFGDTILFTTDDEILQAMSLFDETFSEELKATESSAEHE------------IDSL--RPSTADSVEEERPFTQAGFSEKLQNNISDVFENNSHKLPGIYNGKC-------LQLNFTMTWGDPHYLGLTGMEIVGRDGKALPFTLAELSACPHDLSILPEYHNDTRTLDKLIDGVNITNEDSHMWLIPFTSGADHTITINFNKSEDIAGIRFWNYNKSPEDTYRGGKIVHLTLDGHTISPPEGFLIRKGPGNCHFDFAQEILFVDYIHEKQITDTQLRSHSKCMEFAAMDYEAPLMPCGFIFQLQLITSWGDPYYIGLNGLEMFSEHGEKINLTENNIAAFPESINVLDGVCG------DVRTPDKLIDNVNDTCDGRHMWLSPILPGMVNRIYVVFDQPTTVSMIKMWNYAKTPHRGVKEFGLLVDDLLVYNGILNQV--SHISHGILPTCD----PVIPYHTILFANPEKFSEADRRT-AICNQVE----------DQDVRMMNDNKI 1232          

HSP 2 Score: 72.7886 bits (177), Expect = 4.510e-12
Identity = 43/156 (27.56%), Postives = 84/156 (53.85%), Query Frame = 1
Query:  874 IESEVDLELTIESNWGHPSRVGLTEVEFWDSNKQRIMIMNVESNER---VEGKLNNIINDKKDTAKEKNMWSTNFTNARPITICFML--STQSV-ADVQFIGIWNFNKSLDSLSIGVQKFSLRHSGKVICSGIVNKALGNQVFNPPTVLEIGSGIV 1323
            ++  + + + I SNWG+   +G+TE++F+D   + I +   + + R   V G    ++N K  T KE  MW+  F    P+ + F++  +T+S   D+  + IWN+NK+L  L+IG +   +     ++  G ++K  GNQ F+    +++ +G +
Sbjct:  164 VKDAIYVTVEILSNWGNQYFIGITEIQFFDLKNEEIYVSPHDVDIRNMDVPGDPTCLVNGKTLTTKEHFMWTCPF--HPPVQLYFIIRNATKSADFDISKLKIWNYNKALSDLNIGAKHVKIYKDETLVFDGPLDKGSGNQEFDYSNTIDLQTGQI 317          

HSP 3 Score: 63.5438 bits (153), Expect = 2.704e-9
Identity = 41/136 (30.15%), Postives = 70/136 (51.47%), Query Frame = 1
Query: 1891 MVMNILSTWGDPHYVGLTGIEMFASTGERVTVRNISADPPDINILTGYGTDPRVVTNLLDGVNKTHDDVHMWLAPFTAS-QNHFIKIEFEK--EIDLALLRIWNYNKSRIHSSRGAKDVEIKLNGTVIFKGEIARA 2289
            + + ILS WG+ +++G+T I+ F    E + V     D  ++++       P   T L++G   T  +  MW  PF    Q +FI     K  + D++ L+IWNYNK+    + GAK V+I  + T++F G + + 
Sbjct:  170 VTVEILSNWGNQYFIGITEIQFFDLKNEEIYVSPHDVDIRNMDV-------PGDPTCLVNGKTLTTKEHFMWTCPFHPPVQLYFIIRNATKSADFDISKLKIWNYNKALSDLNIGAKHVKIYKDETLVFDGPLDKG 298          

HSP 4 Score: 53.9138 bits (128), Expect = 2.572e-6
Identity = 41/144 (28.47%), Postives = 63/144 (43.75%), Query Frame = 1
Query: 3130 ILSSWNDLYYVGLNGIEIYDQHCQSISISPQQVYAYPDSVNSLTPKNQRTFSNLDVRT-PDKLVDGINDSYDAKHMWLAPILPGCLNRIFFV---------FDRPVCVSMIKIWNYSKTPSR---GVKDFSILVDDLLIYSGTL 3522
            ILS+W + Y++G+  I+ +D   + I +SP  V                   N+DV   P  LV+G   +     MW  P  P    +++F+         FD    +S +KIWNY+K  S    G K   I  D+ L++ G L
Sbjct:  174 ILSNWGNQYFIGITEIQFFDLKNEEIYVSPHDV----------------DIRNMDVPGDPTCLVNGKTLTTKEHFMWTCPFHPPV--QLYFIIRNATKSADFD----ISKLKIWNYNKALSDLNIGAKHVKIYKDETLVFDGPL 295          
BLAST of Protein KIAA0556 homolog vs. Ensembl Xenopus
Match: tfip11 (tuftelin interacting protein 11 [Source:Xenbase;Acc:XB-GENE-984521])

HSP 1 Score: 527.324 bits (1357), Expect = 2.675e-165
Identity = 285/695 (41.01%), Postives = 413/695 (59.42%), Query Frame = 1
Query: 1693 NKSENLEKSWSSLKFFNKSQAGRLS-LDHTGDILDKYVDQIKRNQKLDXXXXXXXX--------------------FVIPELPRGKEMVMNILSTWGDPHYVGLTGIEMFASTGERVTVRNISADPPDINILTGYGTDPRVVTNLLDGVNKTHDDVHMWLAPFTASQNHFIKIEFEKEIDLALLRIWNYNKSRIHSSRGAKDVEIKLNGTVIFKGEIARAFHC--SEIEEFGEVILFTSDDQILDRIGQNDQEFVDSGHNNDASTDGQSPVGQSDETKELLDSLAMRPPTA----KQSP-TNERKTDETNKQSTNLYRPFTSTRPVRF---CEEKQIIKVKLNLADTWGDNFYIGLTGLEFVGDNGDAISVDMDNISTNTQAL------RDDVRRVENIFNGTNLTTNDEHMWLAPFNSNEDHCLTVXXXXXXXXXXXXXWNYNKSLEDSYRGVKILHVWINDKRVSSDEGYFIRRAPGHVQYDFVQEI--------------HIKTNVALPE-ALIQYNH--LPCGFVYQFNILSSWNDLYYVGLNGIEIYDQHCQSISISPQQVYAYPDSVNSLTPKNQRTFSNLDVRTPDKLVDGINDSYDAKHMWLAPILPGCLNRIFFVFDRPVCVSMIKIWNYSKTPSRGVKDFSILVDDLLIYSGTLPSATSSSITRGILPNMNESIAPTNRHKTVLF 3615
            ++  NL +SW+SL  FNKS  GR+S L+  GDI D+++ Q K  +  D  +                         F IP LP G+ + + I++TWGD HY+GL GIE+FASTG+ V +  I ADPPDINIL  YG DPRVVTNL+DG+N+T DD+H+WLAPFT  + HF+ ++F     +A++RIWNYNKSRIHS RG K VEI L+  +IFKGEIA+A        E+FG+ ILFT+DD+IL  +   D+ F +     ++S + +            +DSL  RP TA    ++ P T    +++     ++++   +   P  +   C       ++LN   TWGD  Y+GLTG+E VG +G A+   +  +S     L       +D R ++ + +G N+T  D HMWL PF S  DH +T+    +  I+ IR WNYNKS ED+YRG KI+H+ ++   +S  EG+ IR+ PG+  +DF QEI               ++++    E A + Y    +PCGF++Q  +++SW D YY+GLNG+E++ +H + I+++   + A+P+S+N L           DVRTPDKL+D +ND+ D +HMWL+PILPG +NRI+ VFD+P  VSMIK+WNY+KTP RGVK+F +LVDDLL+Y+G L     S I+ GILP  +    P   + T+LF
Sbjct:  490 DQENNLMESWTSLIQFNKSHRGRISNLEFEGDIFDEFLQQQKAGKHYDATKNGSSLARPKGATEINLEFEKEEGSNFEIPVLPYGQHLCIKIVTTWGDRHYIGLNGIEIFASTGKPVEISRIRADPPDINILPAYGKDPRVVTNLIDGINRTQDDMHLWLAPFTPGKLHFLNLDFADPCRVAMIRIWNYNKSRIHSFRGVKQVEILLDNELIFKGEIAKASGTLSGAAEQFGDTILFTTDDEILQAMSLFDETFSEELKATESSAEHE------------IDSL--RPSTADSVEEERPFTQAGFSEKLQNNISDVFENNSHKLPGIYNGKC-------LQLNFTMTWGDPHYLGLTGMEIVGRDGKALPFTLAELSACPHDLSILPEYHNDTRTLDKLIDGVNITNEDSHMWLIPFTSGADHTITINFNKSEDIAGIRFWNYNKSPEDTYRGGKIVHLTLDGHTISPPEGFLIRKGPGNCHFDFAQEILFVDYIHEKQITDTQLRSHSKCMEFAAMDYEAPLMPCGFIFQLQLITSWGDPYYIGLNGLEMFSEHGEKINLTENNIAAFPESINVLDGVCG------DVRTPDKLIDNVNDTCDGRHMWLSPILPGMVNRIYVVFDQPTTVSMIKMWNYAKTPHRGVKEFGLLVDDLLVYNGILNQV--SHISHGILPTCD----PVIPYHTILF 1151          

HSP 2 Score: 77.0258 bits (188), Expect = 1.868e-13
Identity = 49/173 (28.32%), Postives = 92/173 (53.18%), Query Frame = 1
Query:  841 LDKIETVY-ETDIESEVDLELTIESNWGHPSRVGLTEVEFWDSNKQRIMIMNVESNER---VEGKLNNIINDKKDTAKEKNMWSTNFTNARPITICFML--STQSV-ADVQFIGIWNFNKSLDSLSIGVQKFSLRHSGKVICSGIVNKALGNQVFNPPTVLEIGSGIVNSKSI 1338
            L ++  VY E  ++  + + + I SNWG+   +G+TE++F+D   + I +   + + R   V G    ++N K  T KE  MW+  F    P+ + F++  +T+S   D+  + IWN+NK+L  L+IG +   +     ++  G ++K  GNQ F+    +++ +G + S S 
Sbjct:  139 LVRLTVVYVEPAVKDAIYVTVEILSNWGNQYFIGITEIQFFDLKNEEIYVSPHDVDIRNMDVPGDPTCLVNGKTLTTKEHFMWTCPF--HPPVQLYFIIRNATKSADFDISKLKIWNYNKALSDLNIGAKHVKIYKDETLVFDGPLDKGSGNQEFDYSNTIDLQTGQIKSSSF 309          

HSP 3 Score: 65.0846 bits (157), Expect = 8.881e-10
Identity = 43/147 (29.25%), Postives = 74/147 (50.34%), Query Frame = 1
Query: 1858 FVIPELPRGKEMVMNILSTWGDPHYVGLTGIEMFASTGERVTVRNISADPPDINILTGYGTDPRVVTNLLDGVNKTHDDVHMWLAPFTAS-QNHFIKIEFEK--EIDLALLRIWNYNKSRIHSSRGAKDVEIKLNGTVIFKGEIARA 2289
            +V P +     + + ILS WG+ +++G+T I+ F    E + V     D  ++++       P   T L++G   T  +  MW  PF    Q +FI     K  + D++ L+IWNYNK+    + GAK V+I  + T++F G + + 
Sbjct:  146 YVEPAVKDAIYVTVEILSNWGNQYFIGITEIQFFDLKNEEIYVSPHDVDIRNMDV-------PGDPTCLVNGKTLTTKEHFMWTCPFHPPVQLYFIIRNATKSADFDISKLKIWNYNKALSDLNIGAKHVKIYKDETLVFDGPLDKG 285          

HSP 4 Score: 53.5286 bits (127), Expect = 2.817e-6
Identity = 41/144 (28.47%), Postives = 63/144 (43.75%), Query Frame = 1
Query: 3130 ILSSWNDLYYVGLNGIEIYDQHCQSISISPQQVYAYPDSVNSLTPKNQRTFSNLDVRT-PDKLVDGINDSYDAKHMWLAPILPGCLNRIFFV---------FDRPVCVSMIKIWNYSKTPSR---GVKDFSILVDDLLIYSGTL 3522
            ILS+W + Y++G+  I+ +D   + I +SP  V                   N+DV   P  LV+G   +     MW  P  P    +++F+         FD    +S +KIWNY+K  S    G K   I  D+ L++ G L
Sbjct:  161 ILSNWGNQYFIGITEIQFFDLKNEEIYVSPHDV----------------DIRNMDVPGDPTCLVNGKTLTTKEHFMWTCPFHPPV--QLYFIIRNATKSADFD----ISKLKIWNYNKALSDLNIGAKHVKIYKDETLVFDGPL 282          
BLAST of Protein KIAA0556 homolog vs. Ensembl Xenopus
Match: tfip11 (tuftelin interacting protein 11 [Source:Xenbase;Acc:XB-GENE-984521])

HSP 1 Score: 527.324 bits (1357), Expect = 3.540e-165
Identity = 285/695 (41.01%), Postives = 413/695 (59.42%), Query Frame = 1
Query: 1693 NKSENLEKSWSSLKFFNKSQAGRLS-LDHTGDILDKYVDQIKRNQKLDXXXXXXXX--------------------FVIPELPRGKEMVMNILSTWGDPHYVGLTGIEMFASTGERVTVRNISADPPDINILTGYGTDPRVVTNLLDGVNKTHDDVHMWLAPFTASQNHFIKIEFEKEIDLALLRIWNYNKSRIHSSRGAKDVEIKLNGTVIFKGEIARAFHC--SEIEEFGEVILFTSDDQILDRIGQNDQEFVDSGHNNDASTDGQSPVGQSDETKELLDSLAMRPPTA----KQSP-TNERKTDETNKQSTNLYRPFTSTRPVRF---CEEKQIIKVKLNLADTWGDNFYIGLTGLEFVGDNGDAISVDMDNISTNTQAL------RDDVRRVENIFNGTNLTTNDEHMWLAPFNSNEDHCLTVXXXXXXXXXXXXXWNYNKSLEDSYRGVKILHVWINDKRVSSDEGYFIRRAPGHVQYDFVQEI--------------HIKTNVALPE-ALIQYNH--LPCGFVYQFNILSSWNDLYYVGLNGIEIYDQHCQSISISPQQVYAYPDSVNSLTPKNQRTFSNLDVRTPDKLVDGINDSYDAKHMWLAPILPGCLNRIFFVFDRPVCVSMIKIWNYSKTPSRGVKDFSILVDDLLIYSGTLPSATSSSITRGILPNMNESIAPTNRHKTVLF 3615
            ++  NL +SW+SL  FNKS  GR+S L+  GDI D+++ Q K  +  D  +                         F IP LP G+ + + I++TWGD HY+GL GIE+FASTG+ V +  I ADPPDINIL  YG DPRVVTNL+DG+N+T DD+H+WLAPFT  + HF+ ++F     +A++RIWNYNKSRIHS RG K VEI L+  +IFKGEIA+A        E+FG+ ILFT+DD+IL  +   D+ F +     ++S + +            +DSL  RP TA    ++ P T    +++     ++++   +   P  +   C       ++LN   TWGD  Y+GLTG+E VG +G A+   +  +S     L       +D R ++ + +G N+T  D HMWL PF S  DH +T+    +  I+ IR WNYNKS ED+YRG KI+H+ ++   +S  EG+ IR+ PG+  +DF QEI               ++++    E A + Y    +PCGF++Q  +++SW D YY+GLNG+E++ +H + I+++   + A+P+S+N L           DVRTPDKL+D +ND+ D +HMWL+PILPG +NRI+ VFD+P  VSMIK+WNY+KTP RGVK+F +LVDDLL+Y+G L     S I+ GILP  +    P   + T+LF
Sbjct:  509 DQENNLMESWTSLIQFNKSHRGRISNLEFEGDIFDEFLQQQKAGKHYDATKNGSSLARPKGATEINLEFEKEEGSNFEIPVLPYGQHLCIKIVTTWGDRHYIGLNGIEIFASTGKPVEISRIRADPPDINILPAYGKDPRVVTNLIDGINRTQDDMHLWLAPFTPGKLHFLNLDFADPCRVAMIRIWNYNKSRIHSFRGVKQVEILLDNELIFKGEIAKASGTLSGAAEQFGDTILFTTDDEILQAMSLFDETFSEELKATESSAEHE------------IDSL--RPSTADSVEEERPFTQAGFSEKLQNNISDVFENNSHKLPGIYNGKC-------LQLNFTMTWGDPHYLGLTGMEIVGRDGKALPFTLAELSACPHDLSILPEYHNDTRTLDKLIDGVNITNEDSHMWLIPFTSGADHTITINFNKSEDIAGIRFWNYNKSPEDTYRGGKIVHLTLDGHTISPPEGFLIRKGPGNCHFDFAQEILFVDYIHEKQITDTQLRSHSKCMEFAAMDYEAPLMPCGFIFQLQLITSWGDPYYIGLNGLEMFSEHGEKINLTENNIAAFPESINVLDGVCG------DVRTPDKLIDNVNDTCDGRHMWLSPILPGMVNRIYVVFDQPTTVSMIKMWNYAKTPHRGVKEFGLLVDDLLVYNGILNQV--SHISHGILPTCD----PVIPYHTILF 1170          

HSP 2 Score: 77.0258 bits (188), Expect = 1.977e-13
Identity = 49/173 (28.32%), Postives = 92/173 (53.18%), Query Frame = 1
Query:  841 LDKIETVY-ETDIESEVDLELTIESNWGHPSRVGLTEVEFWDSNKQRIMIMNVESNER---VEGKLNNIINDKKDTAKEKNMWSTNFTNARPITICFML--STQSV-ADVQFIGIWNFNKSLDSLSIGVQKFSLRHSGKVICSGIVNKALGNQVFNPPTVLEIGSGIVNSKSI 1338
            L ++  VY E  ++  + + + I SNWG+   +G+TE++F+D   + I +   + + R   V G    ++N K  T KE  MW+  F    P+ + F++  +T+S   D+  + IWN+NK+L  L+IG +   +     ++  G ++K  GNQ F+    +++ +G + S S 
Sbjct:  158 LVRLTVVYVEPAVKDAIYVTVEILSNWGNQYFIGITEIQFFDLKNEEIYVSPHDVDIRNMDVPGDPTCLVNGKTLTTKEHFMWTCPF--HPPVQLYFIIRNATKSADFDISKLKIWNYNKALSDLNIGAKHVKIYKDETLVFDGPLDKGSGNQEFDYSNTIDLQTGQIKSSSF 328          

HSP 3 Score: 65.0846 bits (157), Expect = 8.478e-10
Identity = 43/147 (29.25%), Postives = 74/147 (50.34%), Query Frame = 1
Query: 1858 FVIPELPRGKEMVMNILSTWGDPHYVGLTGIEMFASTGERVTVRNISADPPDINILTGYGTDPRVVTNLLDGVNKTHDDVHMWLAPFTAS-QNHFIKIEFEK--EIDLALLRIWNYNKSRIHSSRGAKDVEIKLNGTVIFKGEIARA 2289
            +V P +     + + ILS WG+ +++G+T I+ F    E + V     D  ++++       P   T L++G   T  +  MW  PF    Q +FI     K  + D++ L+IWNYNK+    + GAK V+I  + T++F G + + 
Sbjct:  165 YVEPAVKDAIYVTVEILSNWGNQYFIGITEIQFFDLKNEEIYVSPHDVDIRNMDV-------PGDPTCLVNGKTLTTKEHFMWTCPFHPPVQLYFIIRNATKSADFDISKLKIWNYNKALSDLNIGAKHVKIYKDETLVFDGPLDKG 304          

HSP 4 Score: 53.5286 bits (127), Expect = 2.642e-6
Identity = 41/144 (28.47%), Postives = 63/144 (43.75%), Query Frame = 1
Query: 3130 ILSSWNDLYYVGLNGIEIYDQHCQSISISPQQVYAYPDSVNSLTPKNQRTFSNLDVRT-PDKLVDGINDSYDAKHMWLAPILPGCLNRIFFV---------FDRPVCVSMIKIWNYSKTPSR---GVKDFSILVDDLLIYSGTL 3522
            ILS+W + Y++G+  I+ +D   + I +SP  V                   N+DV   P  LV+G   +     MW  P  P    +++F+         FD    +S +KIWNY+K  S    G K   I  D+ L++ G L
Sbjct:  180 ILSNWGNQYFIGITEIQFFDLKNEEIYVSPHDV----------------DIRNMDVPGDPTCLVNGKTLTTKEHFMWTCPFHPPV--QLYFIIRNATKSADFD----ISKLKIWNYNKALSDLNIGAKHVKIYKDETLVFDGPL 301          
BLAST of Protein KIAA0556 homolog vs. Ensembl Xenopus
Match: tfip11 (tuftelin interacting protein 11 [Source:Xenbase;Acc:XB-GENE-984521])

HSP 1 Score: 401.364 bits (1030), Expect = 1.643e-117
Identity = 240/672 (35.71%), Postives = 361/672 (53.72%), Query Frame = 1
Query: 1405 NAQNLTFRMGMSERKLEDKLEEMVTTERKPENKLEMKLEGISNNLLMEESE--------------KCNSNRKESARFGRRSELDECSGRDQLKELIXXXXXXXXXXXXXKNKSENLEKSWSSLKFFNKSQAGRLS-LDHTGDILDKYVDQIKRNQKLDXXXXXXX--------------------XFVIPELPRGKEMVMNILSTWGDPHYVGLTGIEMFASTGERVTVRNISADPPDINILTGYGTDPRVVTNLLDGVNKTHDDVHMWLAPFTASQNHFIKIEFEKEIDLALLRIWNYNKSRIHSSRGAKDVEIKLNGTVIFKGEIARAFH--CSEIEEFGEVILFTSDDQILDRIGQNDQEFVDSGHNNDASTDGQSPVGQSDETKELLDSLAMRPPTA----KQSP-TNERKTDETNKQSTNLYRPFTSTRPVRF---CEEKQIIKVKLNLADTWGDNFYIGLTGLEFVGDNGDAISVDMDNISTNTQAL------RDDVRRVENIFNGTNLTTNDEHMWLAPFNSNEDHCLTVXXXXXXXXXXXXXWNYNKSLEDSYRGVKILHVWINDKRVSSDEGYFIRRAPGHVQYDFVQEI--------------HIKTNVALPE-ALIQYNH--LPCGFVYQFNILSSWNDLYYVGLNGIEIYDQHCQSISIS 3216
            NA +  F    S+  +   LE+ VT+ ++  NK      G  N +L   S+               CN +R  S R  +   + + S R    + I +  T         ++  NL +SW+SL  FNKS  GR+S L+  GDI D+++ Q K  +  D  +                         F IP LP G+ + + I++TWGD HY+GL GIE+FASTG+ V +  I ADPPDINIL  YG DPRVVTNL+DG+N+T DD+H+WLAPFT  + HF+ ++F     +A++RIWNYNKSRIHS RG K VEI L+  +IFKGEIA+A        E+FG+ ILFT+DD+IL  +   D+ F +     ++S + +            +DSL  RP TA    ++ P T    +++     ++++   +   P  +   C       ++LN   TWGD  Y+GLTG+E VG +G A+   +  +S     L       +D R ++ + +G N+T  D HMWL PF S  DH +T+    +  I+ IR WNYNKS ED+YRG KI+H+ ++   +S  EG+ IR+ PG+  +DF QEI               ++++    E A + Y    +PCGF++Q  +++SW D YY+GLNG+E++ +H + I+++
Sbjct:  744 NASSGNFTNKRSDHNINQFLEDYVTSYKRDSNKNSKN--GNQNKMLCSSSKMENEDDLENFSNQNSCNPDRPVSGR-RKTVHMQDKSERTSFHKTINQVNTENIRPRWQNDQENNLMESWTSLIQFNKSHRGRISNLEFEGDIFDEFLQQQKAGKHYDATKNGSSLARPKGATEINLEFEKEEGSNFEIPVLPYGQHLCIKIVTTWGDRHYIGLNGIEIFASTGKPVEISRIRADPPDINILPAYGKDPRVVTNLIDGINRTQDDMHLWLAPFTPGKLHFLNLDFADPCRVAMIRIWNYNKSRIHSFRGVKQVEILLDNELIFKGEIAKASGTLSGAAEQFGDTILFTTDDEILQAMSLFDETFSEELKATESSAEHE------------IDSL--RPSTADSVEEERPFTQAGFSEKLQNNISDVFENNSHKLPGIYNGKC-------LQLNFTMTWGDPHYLGLTGMEIVGRDGKALPFTLAELSACPHDLSILPEYHNDTRTLDKLIDGVNITNEDSHMWLIPFTSGADHTITINFNKSEDIAGIRFWNYNKSPEDTYRGGKIVHLTLDGHTISPPEGFLIRKGPGNCHFDFAQEILFVDYIHEKQITDTQLRSHSKCMEFAAMDYEAPLMPCGFIFQLQLITSWGDPYYIGLNGLEMFSEHGEKINLT 1391          

HSP 2 Score: 102.449 bits (254), Expect = 3.131e-21
Identity = 57/150 (38.00%), Postives = 84/150 (56.00%), Query Frame = 1
Query: 3100 LPCGFVYQFNILSSWNDLYYVGLNGIEIYDQHCQSISISPQQVYAYPDSVNSLTPKNQRTFSNLDVRTPDKLVDGINDSYDAKHMWLAPILPGCLNRIFFVFDRPVCVSMIKIWNYSKT---PSRGVKDFSILVDDLLIYSGTLPSATSS 3540
            LP G      I+++W D +Y+GLNGIEI+    + + IS  ++ A P  +N L    +      D R    L+DGIN + D  H+WLAP  PG L+ +   F  P  V+MI+IWNY+K+     RGVK   IL+D+ LI+ G +  A+ +
Sbjct:  932 LPYGQHLCIKIVTTWGDRHYIGLNGIEIFASTGKPVEIS--RIRADPPDINILPAYGK------DPRVVTNLIDGINRTQDDMHLWLAPFTPGKLHFLNLDFADPCRVAMIRIWNYNKSRIHSFRGVKQVEILLDNELIFKGEIAKASGT 1073          

HSP 3 Score: 84.7297 bits (208), Expect = 8.901e-16
Identity = 59/217 (27.19%), Postives = 109/217 (50.23%), Query Frame = 1
Query:  760 DNEKRLKAIVDRVLKMNFNQQQKLLSTLDKIE-----------------TVY-ETDIESEVDLELTIESNWGHPSRVGLTEVEFWDSNKQRIMIMNVESNER---VEGKLNNIINDKKDTAKEKNMWSTNFTNARPITICFML--STQSVA-DVQFIGIWNFNKSLDSLSIGVQKFSLRHSGKVICSGIVNKALGNQVFNPPTVLEIGSGIVNSKSI 1338
            DNE  +   ++++  M  +QQ+KLL  L  I+                 +VY E  ++  + + + I SNWG+   +G+TE++F+D   + I +   + + R   V G    ++N K  T KE  MW+  F    P+ + F++  +T+S   D+  + IWN+NK+L  L+IG +   +     ++  G ++K  GNQ F+    +++ +G + S S 
Sbjct:  339 DNEGVVSKAIEKINLMKISQQKKLLKVLQDIDNDSSSYSNLEGELLKWDSVYVEPAVKDAIYVTVEILSNWGNQYFIGITEIQFFDLKNEEIYVSPHDVDIRNMDVPGDPTCLVNGKTLTTKEHFMWTCPF--HPPVQLYFIIRNATKSADFDISKLKIWNYNKALSDLNIGAKHVKIYKDETLVFDGPLDKGSGNQEFDYSNTIDLQTGQIKSSSF 553          

HSP 4 Score: 76.2554 bits (186), Expect = 3.524e-13
Identity = 42/132 (31.82%), Postives = 70/132 (53.03%), Query Frame = 1
Query: 3109 GFVYQFNILSSWNDLYYVGLNGIEIYDQHCQSISISPQQVYAYPDSVNSLTPKNQRTFSNLDVRTPDKLVDGINDSYDAKHMWLAPILPGCLNRIFFVFDRPVCVSMIKIWNYSKTPS---RGVKDFSILVD 3495
            G   Q N   +W D +Y+GL G+EI  +  +++  +  ++ A P  + S+ P+        D RT DKL+DG+N + +  HMWL P   G  + I   F++   ++ I+ WNY+K+P    RG K   + +D
Sbjct: 1166 GKCLQLNFTMTWGDPHYLGLTGMEIVGRDGKALPFTLAELSACPHDL-SILPEYHN-----DTRTLDKLIDGVNITNEDSHMWLIPFTSGADHTITINFNKSEDIAGIRFWNYNKSPEDTYRGGKIVHLTLD 1291          

HSP 5 Score: 65.4698 bits (158), Expect = 6.210e-10
Identity = 43/147 (29.25%), Postives = 74/147 (50.34%), Query Frame = 1
Query: 1858 FVIPELPRGKEMVMNILSTWGDPHYVGLTGIEMFASTGERVTVRNISADPPDINILTGYGTDPRVVTNLLDGVNKTHDDVHMWLAPFTAS-QNHFIKIEFEK--EIDLALLRIWNYNKSRIHSSRGAKDVEIKLNGTVIFKGEIARA 2289
            +V P +     + + ILS WG+ +++G+T I+ F    E + V     D  ++++       P   T L++G   T  +  MW  PF    Q +FI     K  + D++ L+IWNYNK+    + GAK V+I  + T++F G + + 
Sbjct:  390 YVEPAVKDAIYVTVEILSNWGNQYFIGITEIQFFDLKNEEIYVSPHDVDIRNMDV-------PGDPTCLVNGKTLTTKEHFMWTCPFHPPVQLYFIIRNATKSADFDISKLKIWNYNKALSDLNIGAKHVKIYKDETLVFDGPLDKG 529          

HSP 6 Score: 54.6842 bits (130), Expect = 1.369e-6
Identity = 41/144 (28.47%), Postives = 63/144 (43.75%), Query Frame = 1
Query: 3130 ILSSWNDLYYVGLNGIEIYDQHCQSISISPQQVYAYPDSVNSLTPKNQRTFSNLDVRT-PDKLVDGINDSYDAKHMWLAPILPGCLNRIFFV---------FDRPVCVSMIKIWNYSKTPSR---GVKDFSILVDDLLIYSGTL 3522
            ILS+W + Y++G+  I+ +D   + I +SP  V                   N+DV   P  LV+G   +     MW  P  P    +++F+         FD    +S +KIWNY+K  S    G K   I  D+ L++ G L
Sbjct:  405 ILSNWGNQYFIGITEIQFFDLKNEEIYVSPHDV----------------DIRNMDVPGDPTCLVNGKTLTTKEHFMWTCPFHPPV--QLYFIIRNATKSADFD----ISKLKIWNYNKALSDLNIGAKHVKIYKDETLVFDGPL 526          
BLAST of Protein KIAA0556 homolog vs. Ensembl Mouse
Match: D430042O09Rik (RIKEN cDNA D430042O09 gene [Source:MGI Symbol;Acc:MGI:2442760])

HSP 1 Score: 552.747 bits (1423), Expect = 1.935e-171
Identity = 313/742 (42.18%), Postives = 437/742 (58.89%), Query Frame = 1
Query: 1708 LEKSWSSLKFFNKSQAGRLS-LDHTGDILDKYVDQIKRNQ-------------KLDXXXXXXXXFVIPELPRGKEMVMNILSTWGDPHYVGLTGIEMFASTGERVTVRNISADPPDINILTGYGTDPRVVTNLLDGVNKTHDDVHMWLAPFTASQNHFIKIEFEKEIDLALLRIWNYNKSRIHSSRGAKDVEIKLNGTVIFKGEIARAFHC--SEIEEFGEVILFTSDDQILDRIGQNDQEFVDSGHNNDASTDGQSPVGQSDETKELLDSLAMRPPTAKQSPTNERKTDETN-----------KQSTNLYRPFTSTRPVRFCEEKQIIKVKLNLADTWGDNFYIGLTGLEFVGDNGDAISVDMDNISTNTQAL------RDDVRRVENIFNGTNLTTNDEHMWLAPFNSNEDHCLTVXXXXXXXXXXXXXWNYNKSLEDSYRGVKILHVWINDKRVSSDEGYFIRRAPGHVQYDFVQEI----HIKTNV-----------ALPEALIQYNH--LPCGFVYQFNILSSWNDLYYVGLNGIEIYDQHCQSISISPQQVYAYPDSVNSLTPKNQRTFSNLDVRTPDKLVDGINDSYDAKHMWLAPILPGCLNRIFFVFDRPVCVSMIKIWNYSKTPSRGVKDFSILVDDLLIYSGTLPSATSSSITRGILPNMNESIAPTNRHKTVLFDRTSGALLNQEKLFLLEHSISSGQDVILINDNDINSVH-----CANQKYRPMTSVK 3768
            L  SW SL  F+++  GR+S L+  GDILD+++ Q + ++             +   E   + +F IP LP G+ +V++I STWGD HYVGL GIE+F+S+GE V + +I+ADPPDINIL  YG DPRVV+NL+DGVN+T DD+H+WLAPFT    H I IEF     +AL+RIWNYNKSRIHS RG KD+ + L+   IF+GEIA+A        E FG+ ILFT D+ IL+ I   D  F           D +S  G   E  E L     RP TA     +ER   +              Q++      T+  P  F      + ++LNL  +WGD  YIGLTGLE VG +G+A+ +    +S + + L       DD R ++ + +G N+TT DEHMWL PF+   DH + +  + A  I+ +R+WNYNKS ED+YRGVKI HV ++   VS  EG+ IR+ PG+  +DF QEI    +++T +           +L  A + Y    +PCGF++QF +LSSW D YY+GL G+E+YD+H + I +S   + A+PDSVN+L           DVRTPDKL+D +ND+ D +HMWLAPILPG +NR++ +FD P  VSMIK+WNY+KTP RGVK+F +LVDDLL+Y+G L  A  S +  GILP    +  PT  H T+LF   +    +QEK  ++       QD+ ++N+N + +        A+   RP T ++
Sbjct:  866 LHASWDSLTAFDRAHRGRISALEPQGDILDEFLKQQRSSRHEEFPAPCREEEPEPSTEMGGDSDFKIPVLPYGQHLVIDIKSTWGDRHYVGLNGIEIFSSSGEPVQISSITADPPDINILPAYGKDPRVVSNLIDGVNRTQDDMHVWLAPFTPGMTHTISIEFTHPCQVALIRIWNYNKSRIHSFRGVKDITMLLDTQCIFEGEIAKASGTLMGAPEHFGDTILFTMDEDILEAIFCLDDTF---------DMDAESLCGLQPE--EAL----RRPSTADGEGQDERPFTQAGLGAQDQVPGLELQTSPPVSEVTTPEPGIFYG----LCLRLNLTASWGDLHYIGLTGLEVVGKDGEALPIQPHQLSASPRDLNDLPEYNDDSRTLDKLIDGMNITTEDEHMWLIPFSPGLDHVVMIHFDRAQSIAGLRLWNYNKSPEDTYRGVKIAHVSLDGLCVSPAEGFLIRKGPGNCHFDFAQEILFGDYLQTRLPPAPTRRLDAKSLERASMDYEAPLMPCGFIFQFQLLSSWGDPYYIGLTGLELYDEHGERIPLSQNNIAAFPDSVNAL------EGVCGDVRTPDKLIDQVNDTSDGRHMWLAPILPGLVNRVYVIFDLPTTVSMIKLWNYTKTPQRGVKEFGLLVDDLLVYNGIL--AMVSHLVGGILP----TCEPTVPHHTILFAEDTD-FCHQEKHAIISKP-EEDQDIQMMNENQVITTSRRKPGTADPALRPKTCIR 1574          

HSP 2 Score: 52.373 bits (124), Expect = 6.025e-6
Identity = 58/248 (23.39%), Postives = 113/248 (45.56%), Query Frame = 1
Query:  562 LEAKNEISLQVNKKPTTSEKELNKQMKINKSKHLEEKCLENMED----EDTKIVTLELKMDADLVDINDTDNEKRLKAIVDRVLKMNFNQQQKLLSTLDKIE-TVYETDIESEVDLELTIESNWGHPSRVGLTEVEFWDSNKQRIMIMNVESNER---VEGKLNNIINDKKDTAKEKNMWSTNFTNARPITICFML-STQSVAD--VQFIGIWNFNKSLDSLSIGVQKFSLRHSGKVICSGIVNKALG 1272
            L+AK +I   +   P T++ EL +     K+     + ++ M      +  K+V +   M++D            L  +     K   N ++K  + +D+IE  +Y T         + I SNWG+ S VGLTEV+F+D N  ++ +   + + R   + G+L  ++N    + K+  +W+  F    P+ + F++ + + + D  +  I + N+  +   L IG +   L  +  +I  G++ K  G
Sbjct:  357 LKAKEDIPELLPATPVTTDPELCRAAAGAKAV---SQAMDGMSPLGSRQQHKLVGVLQTMESDTT---------HLSQVAIPTEKPVPNSEEKWKARVDEIEDAIYVT---------MEILSNWGNASWVGLTEVQFFDLNNIKLYVSPHDVDIRNAVLPGELGCLVNRDLVSKKDPPVWTCPFHP--PLQLYFIIHNMRQLRDFGLTMIKVRNYWTADGDLDIGAKNVKLYVNKSLIFDGVLEKGGG 581          
BLAST of Protein KIAA0556 homolog vs. Ensembl Mouse
Match: D430042O09Rik (RIKEN cDNA D430042O09 gene [Source:MGI Symbol;Acc:MGI:2442760])

HSP 1 Score: 553.132 bits (1424), Expect = 2.222e-171
Identity = 313/742 (42.18%), Postives = 437/742 (58.89%), Query Frame = 1
Query: 1708 LEKSWSSLKFFNKSQAGRLS-LDHTGDILDKYVDQIKRNQ-------------KLDXXXXXXXXFVIPELPRGKEMVMNILSTWGDPHYVGLTGIEMFASTGERVTVRNISADPPDINILTGYGTDPRVVTNLLDGVNKTHDDVHMWLAPFTASQNHFIKIEFEKEIDLALLRIWNYNKSRIHSSRGAKDVEIKLNGTVIFKGEIARAFHC--SEIEEFGEVILFTSDDQILDRIGQNDQEFVDSGHNNDASTDGQSPVGQSDETKELLDSLAMRPPTAKQSPTNERKTDETN-----------KQSTNLYRPFTSTRPVRFCEEKQIIKVKLNLADTWGDNFYIGLTGLEFVGDNGDAISVDMDNISTNTQAL------RDDVRRVENIFNGTNLTTNDEHMWLAPFNSNEDHCLTVXXXXXXXXXXXXXWNYNKSLEDSYRGVKILHVWINDKRVSSDEGYFIRRAPGHVQYDFVQEI----HIKTNV-----------ALPEALIQYNH--LPCGFVYQFNILSSWNDLYYVGLNGIEIYDQHCQSISISPQQVYAYPDSVNSLTPKNQRTFSNLDVRTPDKLVDGINDSYDAKHMWLAPILPGCLNRIFFVFDRPVCVSMIKIWNYSKTPSRGVKDFSILVDDLLIYSGTLPSATSSSITRGILPNMNESIAPTNRHKTVLFDRTSGALLNQEKLFLLEHSISSGQDVILINDNDINSVH-----CANQKYRPMTSVK 3768
            L  SW SL  F+++  GR+S L+  GDILD+++ Q + ++             +   E   + +F IP LP G+ +V++I STWGD HYVGL GIE+F+S+GE V + +I+ADPPDINIL  YG DPRVV+NL+DGVN+T DD+H+WLAPFT    H I IEF     +AL+RIWNYNKSRIHS RG KD+ + L+   IF+GEIA+A        E FG+ ILFT D+ IL+ I   D  F           D +S  G   E  E L     RP TA     +ER   +              Q++      T+  P  F      + ++LNL  +WGD  YIGLTGLE VG +G+A+ +    +S + + L       DD R ++ + +G N+TT DEHMWL PF+   DH + +  + A  I+ +R+WNYNKS ED+YRGVKI HV ++   VS  EG+ IR+ PG+  +DF QEI    +++T +           +L  A + Y    +PCGF++QF +LSSW D YY+GL G+E+YD+H + I +S   + A+PDSVN+L           DVRTPDKL+D +ND+ D +HMWLAPILPG +NR++ +FD P  VSMIK+WNY+KTP RGVK+F +LVDDLL+Y+G L  A  S +  GILP    +  PT  H T+LF   +    +QEK  ++       QD+ ++N+N + +        A+   RP T ++
Sbjct:  892 LHASWDSLTAFDRAHRGRISALEPQGDILDEFLKQQRSSRHEEFPAPCREEEPEPSTEMGGDSDFKIPVLPYGQHLVIDIKSTWGDRHYVGLNGIEIFSSSGEPVQISSITADPPDINILPAYGKDPRVVSNLIDGVNRTQDDMHVWLAPFTPGMTHTISIEFTHPCQVALIRIWNYNKSRIHSFRGVKDITMLLDTQCIFEGEIAKASGTLMGAPEHFGDTILFTMDEDILEAIFCLDDTF---------DMDAESLCGLQPE--EAL----RRPSTADGEGQDERPFTQAGLGAQDQVPGLELQTSPPVSEVTTPEPGIFYG----LCLRLNLTASWGDLHYIGLTGLEVVGKDGEALPIQPHQLSASPRDLNDLPEYNDDSRTLDKLIDGMNITTEDEHMWLIPFSPGLDHVVMIHFDRAQSIAGLRLWNYNKSPEDTYRGVKIAHVSLDGLCVSPAEGFLIRKGPGNCHFDFAQEILFGDYLQTRLPPAPTRRLDAKSLERASMDYEAPLMPCGFIFQFQLLSSWGDPYYIGLTGLELYDEHGERIPLSQNNIAAFPDSVNAL------EGVCGDVRTPDKLIDQVNDTSDGRHMWLAPILPGLVNRVYVIFDLPTTVSMIKLWNYTKTPQRGVKEFGLLVDDLLVYNGIL--AMVSHLVGGILP----TCEPTVPHHTILFAEDTD-FCHQEKHAIISKP-EEDQDIQMMNENQVITTSRRKPGTADPALRPKTCIR 1600          

HSP 2 Score: 51.9878 bits (123), Expect = 7.521e-6
Identity = 58/248 (23.39%), Postives = 113/248 (45.56%), Query Frame = 1
Query:  562 LEAKNEISLQVNKKPTTSEKELNKQMKINKSKHLEEKCLENMED----EDTKIVTLELKMDADLVDINDTDNEKRLKAIVDRVLKMNFNQQQKLLSTLDKIE-TVYETDIESEVDLELTIESNWGHPSRVGLTEVEFWDSNKQRIMIMNVESNER---VEGKLNNIINDKKDTAKEKNMWSTNFTNARPITICFML-STQSVAD--VQFIGIWNFNKSLDSLSIGVQKFSLRHSGKVICSGIVNKALG 1272
            L+AK +I   +   P T++ EL +     K+     + ++ M      +  K+V +   M++D            L  +     K   N ++K  + +D+IE  +Y T         + I SNWG+ S VGLTEV+F+D N  ++ +   + + R   + G+L  ++N    + K+  +W+  F    P+ + F++ + + + D  +  I + N+  +   L IG +   L  +  +I  G++ K  G
Sbjct:  383 LKAKEDIPELLPATPVTTDPELCRAAAGAKAV---SQAMDGMSPLGSRQQHKLVGVLQTMESDTT---------HLSQVAIPTEKPVPNSEEKWKARVDEIEDAIYVT---------MEILSNWGNASWVGLTEVQFFDLNNIKLYVSPHDVDIRNAVLPGELGCLVNRDLVSKKDPPVWTCPFHP--PLQLYFIIHNMRQLRDFGLTMIKVRNYWTADGDLDIGAKNVKLYVNKSLIFDGVLEKGGG 607          
BLAST of Protein KIAA0556 homolog vs. Ensembl Mouse
Match: D430042O09Rik (RIKEN cDNA D430042O09 gene [Source:MGI Symbol;Acc:MGI:2442760])

HSP 1 Score: 191.43 bits (485), Expect = 7.966e-55
Identity = 106/261 (40.61%), Postives = 147/261 (56.32%), Query Frame = 1
Query: 2752 DDVRRVENIFNGTNLTTNDEHMWLAPFNSNEDHCLTVXXXXXXXXXXXXXWNYNKSLEDSYRGVKILHVWINDKRVSSDEGYFIRRAPGHVQYDFVQEI----HIKTNV-----------ALPEALIQYNH--LPCGFVYQFNILSSWNDLYYVGLNGIEIYDQHCQSISISPQQVYAYPDSVNSLTPKNQRTFSNLDVRTPDKLVDGINDSYDAKHMWLAPILPGCLNRIFFVFDRPVCVSMIKIWNYSKTPSRGVKDFS 3483
            DD R ++ + +G N+TT DEHMWL PF+   DH + +  + A  I+ +R+WNYNKS ED+YRGVKI HV ++   VS  EG+ IR+ PG+  +DF QEI    +++T +           +L  A + Y    +PCG++                                      A+PDSVN+L           DVRTPDKL+D +ND+ D +HMWLAPILPG +NR++ +FD P  VSMIK+WNY+KTP RGVK+F 
Sbjct:    2 DDSRTLDKLIDGMNITTEDEHMWLIPFSPGLDHVVMIHFDRAQSIAGLRLWNYNKSPEDTYRGVKIAHVSLDGLCVSPAEGFLIRKGPGNCHFDFAQEILFGDYLQTRLPPAPTRRLDAKSLERASMDYEAPLMPCGYIA-------------------------------------AFPDSVNALEGVCG------DVRTPDKLIDQVNDTSDGRHMWLAPILPGLVNRVYVIFDLPTTVSMIKLWNYTKTPQRGVKEFG 219          

HSP 2 Score: 77.411 bits (189), Expect = 2.684e-15
Identity = 50/171 (29.24%), Postives = 80/171 (46.78%), Query Frame = 1
Query: 2041 DPRVVTNLLDGVNKTHDDVHMWLAPFTASQNHFIKIEFEKEIDLALLRIWNYNKSRIHSSRGAKDVEIKLNGTVIFKGE--IARAFHCSEIEEFGEVILFTSDDQILDRIGQNDQEFVDSGHNNDASTDGQSPVGQSDETKELLDSLAMRPPTAKQSPTNERKTDETNKQS 2547
            D R +  L+DG+N T +D HMWL PF+   +H + I F++   +A LR+WNYNKS   + RG K   + L+G  +   E  + R    +   +F + ILF   D +  R+       +D+     AS D ++P+          DS+           T ++  D+ N  S
Sbjct:    3 DSRTLDKLIDGMNITTEDEHMWLIPFSPGLDHVVMIHFDRAQSIAGLRLWNYNKSPEDTYRGVKIAHVSLDGLCVSPAEGFLIRKGPGNCHFDFAQEILF--GDYLQTRLPPAPTRRLDAKSLERASMDYEAPLMPCGYIAAFPDSVNALEGVCGDVRTPDKLIDQVNDTS 171          

HSP 3 Score: 61.6178 bits (148), Expect = 6.821e-10
Identity = 30/75 (40.00%), Postives = 47/75 (62.67%), Query Frame = 1
Query: 3292 DVRTPDKLVDGINDSYDAKHMWLAPILPGCLNRIFFVFDRPVCVSMIKIWNYSKTPS---RGVKDFSILVDDLLI 3507
            D RT DKL+DG+N + + +HMWL P  PG  + +   FDR   ++ +++WNY+K+P    RGVK   + +D L +
Sbjct:    3 DSRTLDKLIDGMNITTEDEHMWLIPFSPGLDHVVMIHFDRAQSIAGLRLWNYNKSPEDTYRGVKIAHVSLDGLCV 77          

HSP 4 Score: 54.299 bits (129), Expect = 2.244e-7
Identity = 28/81 (34.57%), Postives = 43/81 (53.09%), Query Frame = 1
Query: 1993 ISADPPDINILTGYGTDPRVVTNLLDGVNKTHDDVHMWLAPFTASQNHFIKIEFEKEIDLALLRIWNYNKSRIHSSRGAKD 2235
            I+A P  +N L G   D R    L+D VN T D  HMWLAP      + + + F+    ++++++WNY K+     RG K+
Sbjct:  140 IAAFPDSVNALEGVCGDVRTPDKLIDQVNDTSDGRHMWLAPILPGLVNRVYVIFDLPTTVSMIKLWNYTKT---PQRGVKE 217          
BLAST of Protein KIAA0556 homolog vs. UniProt/SwissProt
Match: sp|O60303|K0556_HUMAN (Protein KIAA0556 OS=Homo sapiens OX=9606 GN=KIAA0556 PE=1 SV=4)

HSP 1 Score: 557.755 bits (1436), Expect = 3.719e-172
Identity = 331/776 (42.65%), Postives = 456/776 (58.76%), Query Frame = 1
Query: 1564 NSNRKESARFGRRSELDECS-GRDQLKELIXXXXXXXXXXXXXKNKSEN-LEKSWSSLKFFNKSQAGRLS-LDHTGDILDKYVDQ------------------IKRNQK-LDXXXXXXXXFVIPELPRGKEMVMNILSTWGDPHYVGLTGIEMFASTGERVTVRNISADPPDINILTGYGTDPRVVTNLLDGVNKTHDDVHMWLAPFTASQNHFIKIEFEKEIDLALLRIWNYNKSRIHSSRGAKDVEIKLNGTVIFKGEIARAFH--CSEIEEFGEVILFTSDDQILDRIGQNDQEF-VDSGHNNDASTDGQSPVGQSDETKELLDSLAMRPPTAKQSPTNERKTDE----TNKQSTNLYRPFTSTRPVRFCEEKQI---IKVKLNLADTWGDNFYIGLTGLEFVGDNGDAISVDMDNISTNTQAL------RDDVRRVENIFNGTNLTTNDEHMWLAPFNSNEDHCLTVXXXXXXXXXXXXXWNYNKSLEDSYRGVKILHVWINDKRVSSDEGYFIRRAPGHVQYDFVQEI----HIKTNVALPE------------ALIQYNH--LPCGFVYQFNILSSWNDLYYVGLNGIEIYDQHCQSISISPQQVYAYPDSVNSLTPKNQRTFSNLDVRTPDKLVDGINDSYDAKHMWLAPILPGCLNRIFFVFDRPVCVSMIKIWNYSKTPSRGVKDFSILVDDLLIYSGTLPSATSSSITRGILPNMNESIAPTNRHKTVLF--DRTSGALLNQEKLFLLEHSISSGQDVILINDNDI 3717
            N  R  S R G R +    S G DQ       + + T S    +++ E+ L +SWSSL  F++S  GR+S  +  GDILD+ + Q                  + R Q     E +   +F IP LP G+ +V++I STWGD HYVGL GIE+F+S GE V + NI ADPPDINIL  YG DPRVVTNL+DGVN+T DD+H+WLAPFT  ++H I I+F     +AL+RIWNYNKSRIHS RG KD+ + L+   IF+GEIA+A        E FG+ ILFT+DD IL+ I  +D+ F +D              VG  D    L D  AMR P+      +ER   +     +++   L  P +S  P     E  I   I ++LN   +WGD  Y+GLTGLE VG  G A+ + +  IS + + L       DD R ++ + +GTN+T  DEHMWL PF+   DH +T+ ++ A  I+ +R WNYNKS ED+YRG KI+HV ++   VS  EG+ IR+ PG+  +DF QEI    +++  + LP+            A + Y    +PCGF++QF +L+SW D YY+GL G+E+YD+  + I +S   + A+PDSVNSL           DVRTPDKL+D +ND+ D +HMWLAPILPG +NR++ +FD P  VSMIK+WNY+KTP RGVK+F +LVDDLL+Y+G L  A  S +  GILP    +  PT  + T+LF  DR    + +QEK   + +  +  QDV ++N+N I
Sbjct:  846 NRERPASGRRGSRKDAGSSSHGDDQPASREDTWSSRTPSRSRWRSEQEHTLHESWSSLSAFDRSHRGRISNTELPGDILDELLQQKSSRHSDLPPSKKGEQPGLSRGQDGYSGETDAGGDFKIPVLPYGQRLVIDIKSTWGDRHYVGLNGIEIFSSKGEPVQISNIKADPPDINILPAYGKDPRVVTNLIDGVNRTQDDMHVWLAPFTRGRSHSITIDFTHPCHVALIRIWNYNKSRIHSFRGVKDITMLLDTQCIFEGEIAKASGTLAGAPEHFGDTILFTTDDDILEAIFYSDEMFDLD--------------VGSLD---SLQDEEAMRRPSTADGEGDERPFTQAGLGADERIPELELPSSSPVPQVTTPEPGIYHGICLQLNFTASWGDLHYLGLTGLEVVGKEGQALPIHLHQISASPRDLNELPEYSDDSRALDKLIDGTNITMEDEHMWLIPFSPGLDHVVTIRLDRAESIAGLRFWNYNKSPEDTYRGAKIVHVSLDGLCVSPPEGFLIRKGPGNCHFDFAQEILFVDYLRAQL-LPQPARRLDMRSLECASMDYEAPLMPCGFIFQFQLLTSWGDPYYIGLTGLELYDERGEKIPLSENNIAAFPDSVNSL------EGVGGDVRTPDKLIDQVNDTSDGRHMWLAPILPGLVNRVYVIFDLPTTVSMIKLWNYAKTPHRGVKEFGLLVDDLLVYNGIL--AMVSHLVGGILP----TCEPTVPYHTILFTEDRD---IRHQEKHTTISNQ-AEDQDVQMMNENQI 1587          
BLAST of Protein KIAA0556 homolog vs. UniProt/SwissProt
Match: sp|Q8C753|K0556_MOUSE (Protein KIAA0556 OS=Mus musculus OX=10090 GN=Kiaa0556 PE=1 SV=2)

HSP 1 Score: 547.74 bits (1410), Expect = 1.648e-168
Identity = 313/742 (42.18%), Postives = 437/742 (58.89%), Query Frame = 1
Query: 1708 LEKSWSSLKFFNKSQAGRLS-LDHTGDILDKYVDQIKRNQ-------------KLDXXXXXXXXFVIPELPRGKEMVMNILSTWGDPHYVGLTGIEMFASTGERVTVRNISADPPDINILTGYGTDPRVVTNLLDGVNKTHDDVHMWLAPFTASQNHFIKIEFEKEIDLALLRIWNYNKSRIHSSRGAKDVEIKLNGTVIFKGEIARAFHC--SEIEEFGEVILFTSDDQILDRIGQNDQEFVDSGHNNDASTDGQSPVGQSDETKELLDSLAMRPPTAKQSPTNERKTDETN-----------KQSTNLYRPFTSTRPVRFCEEKQIIKVKLNLADTWGDNFYIGLTGLEFVGDNGDAISVDMDNISTNTQAL------RDDVRRVENIFNGTNLTTNDEHMWLAPFNSNEDHCLTVXXXXXXXXXXXXXWNYNKSLEDSYRGVKILHVWINDKRVSSDEGYFIRRAPGHVQYDFVQEI----HIKTNV-----------ALPEALIQYNH--LPCGFVYQFNILSSWNDLYYVGLNGIEIYDQHCQSISISPQQVYAYPDSVNSLTPKNQRTFSNLDVRTPDKLVDGINDSYDAKHMWLAPILPGCLNRIFFVFDRPVCVSMIKIWNYSKTPSRGVKDFSILVDDLLIYSGTLPSATSSSITRGILPNMNESIAPTNRHKTVLFDRTSGALLNQEKLFLLEHSISSGQDVILINDNDINSVH-----CANQKYRPMTSVK 3768
            L  SW SL  F+++  GR+S L+  GDILD+++ Q + ++             +   E   + +F IP LP G+ +V++I STWGD HYVGL GIE+F+S+GE V + +I+ADPPDINIL  YG DPRVV+NL+DGVN+T DD+H+WLAPFT    H I IEF     +AL+RIWNYNKSRIHS RG KD+ + L+   IF+GEIA+A        E FG+ ILFT D+ IL+ I   D  F           D +S  G   E  E L     RP TA     +ER   +              Q++      T+  P  F      + ++LNL  +WGD  YIGLTGLE VG +G+A+ +    +S + + L       DD R ++ + +G N+TT DEHMWL PF+   DH + +  + A  I+ +R+WNYNKS ED+YRGVKI HV ++   VS  EG+ IR+ PG+  +DF QEI    +++T +           +L  A + Y    +PCGF++QF +LSSW D YY+GL G+E+YD+H + I +S   + A+PDSVN+L           DVRTPDKL+D +ND+ D +HMWLAPILPG +NR++ +FD P  VSMIK+WNY+KTP RGVK+F +LVDDLL+Y+G L  A  S +  GILP    +  PT  H T+LF   +    +QEK  ++       QD+ ++N+N + +        A+   RP T ++
Sbjct:  892 LHASWDSLTAFDRAHRGRISALEPQGDILDEFLKQQRSSRHEEFPAPCREEEPEPSTEMGGDSDFKIPVLPYGQHLVIDIKSTWGDRHYVGLNGIEIFSSSGEPVQISSITADPPDINILPAYGKDPRVVSNLIDGVNRTQDDMHVWLAPFTPGMTHTISIEFTHPCQVALIRIWNYNKSRIHSFRGVKDITMLLDTQCIFEGEIAKASGTLMGAPEHFGDTILFTMDEDILEAIFCLDDTF---------DMDAESLCGLQPE--EAL----RRPSTADGEGQDERPFTQAGLGAQDQVPGLELQTSPPVSEVTTPEPGIFYG----LCLRLNLTASWGDLHYIGLTGLEVVGKDGEALPIQPHQLSASPRDLNDLPEYNDDSRTLDKLIDGMNITTEDEHMWLIPFSPGLDHVVMIHFDRAQSIAGLRLWNYNKSPEDTYRGVKIAHVSLDGLCVSPAEGFLIRKGPGNCHFDFAQEILFGDYLQTRLPPAPTRRLDAKSLERASMDYEAPLMPCGFIFQFQLLSSWGDPYYIGLTGLELYDEHGERIPLSQNNIAAFPDSVNAL------EGVCGDVRTPDKLIDQVNDTSDGRHMWLAPILPGLVNRVYVIFDLPTTVSMIKLWNYTKTPQRGVKEFGLLVDDLLVYNGIL--AMVSHLVGGILP----TCEPTVPHHTILFAEDTD-FCHQEKHAIISKP-EEDQDIQMMNENQVITTSRRKPGTADPALRPKTCIR 1600          
BLAST of Protein KIAA0556 homolog vs. UniProt/SwissProt
Match: sp|Q5XK85|K0556_XENLA (Protein KIAA0556 homolog OS=Xenopus laevis OX=8355 PE=2 SV=1)

HSP 1 Score: 396.356 bits (1017), Expect = 4.869e-115
Identity = 220/544 (40.44%), Postives = 320/544 (58.82%), Query Frame = 1
Query: 1705 NLEKSWSSLKFFNKSQAGRLS-LDHTGDILDKYVDQIKRNQK--------------------LDXXXXXXXXFVIPELPRGKEMVMNILSTWGDPHYVGLTGIEMFASTGERVTVRNISADPPDINILTGYGTDPRVVTNLLDGVNKTHDDVHMWLAPFTASQNHFIKIEFEKEIDLALLRIWNYNKSRIHSSRGAKDVEIKLNGTVIFKGEIARAFH--CSEIEEFGEVILFTSDDQILDRIGQNDQEFVDSGHNNDASTDGQSPVGQSDETKELLDSLAMRPPTA----KQSP-TNERKTDETNKQSTNLYRPFTSTRPVRFCEEKQIIKVKLNLADTWGDNFYIGLTGLEFVGDNGDAISVDMDNISTNTQAL------RDDVRRVENIFNGTNLTTNDEHMWLAPFNSNEDHCLTVXXXXXXXXXXXXXWNYNKSLEDSYRGVKILHVWINDKRVSSDEGYFIRRAPGHVQYDFVQEI----HIKTNVALPEALIQYNH-------------LPCGFVYQFNILSSWNDLYYVGLNGIEI 3183
            NL +SW+SL  FNKS  GR+S L+  GDI D+++ Q ++  K                    L+ E+E    F IP LP G+ + + I++TWGD HYVGL GIE+FASTG+ V +  I ADPPDINIL  YG DPRVV NL+DGVN+T DD+H+WLAPF+  + HFI ++F +   +A++RIWNYNKSRIHS RG K+VEI L+  +IFKGEIA+A        E+FG+ ILFT+DD+IL  +   D+ F +     +  T+ +            +DSL  RP TA    ++ P T    +++     T++   ++   P  +  +  +    LN   TWGD  Y+GLTG+E VG +G A+++ +D +S   Q L      +DD+R ++ + +G N+T  D HMWL PF S  DH +T+    +  I+ IR WNYNKS ED+YRG KI++V ++   +S   G+ IR+ PG+  +DF QEI    +I     L + L  ++              +PCGF++Q  +++SW D YY+GLNG+E+
Sbjct:  889 NLLESWTSLIKFNKSHRGRISNLEFEGDIFDEFLQQQQKAGKQSDSTKNGSSLMPKGATEIHLESEKEEGSNFEIPVLPYGQHLCIKIVTTWGDRHYVGLNGIEVFASTGKPVEISRIRADPPDINILPAYGKDPRVVVNLIDGVNRTQDDMHLWLAPFSPGKLHFINLDFVEPCRVAMIRIWNYNKSRIHSFRGVKEVEIFLDNELIFKGEIAKASGTLSGAAEQFGDTILFTTDDEILQAMSLFDETFSEELKATETPTEHE------------IDSL--RPSTADSIKEERPFTQAGLSEKLQSNLTDVSENYSDKLPGIYSGKCLL----LNFTMTWGDPHYLGLTGMEIVGRDGKALAITLDALSACPQDLSILPEYKDDLRTLDKLIDGVNITNEDTHMWLIPFASGADHTITINFNKSEDIAGIRFWNYNKSPEDTYRGAKIVYVTLDGHAISPPGGFLIRKGPGNCHFDFAQEILFVDYIHEQQILEKQLRSHSKCMELATMDYEAPLMPCGFIFQLQLITSWGDPYYIGLNGLEM 1414          

HSP 2 Score: 101.293 bits (251), Expect = 4.850e-20
Identity = 56/150 (37.33%), Postives = 84/150 (56.00%), Query Frame = 1
Query: 3100 LPCGFVYQFNILSSWNDLYYVGLNGIEIYDQHCQSISISPQQVYAYPDSVNSLTPKNQRTFSNLDVRTPDKLVDGINDSYDAKHMWLAPILPGCLNRIFFVFDRPVCVSMIKIWNYSKT---PSRGVKDFSILVDDLLIYSGTLPSATSS 3540
            LP G      I+++W D +YVGLNGIE++    + + IS  ++ A P  +N L    +      D R    L+DG+N + D  H+WLAP  PG L+ I   F  P  V+MI+IWNY+K+     RGVK+  I +D+ LI+ G +  A+ +
Sbjct:  966 LPYGQHLCIKIVTTWGDRHYVGLNGIEVFASTGKPVEIS--RIRADPPDINILPAYGK------DPRVVVNLIDGVNRTQDDMHLWLAPFSPGKLHFINLDFVEPCRVAMIRIWNYNKSRIHSFRGVKEVEIFLDNELIFKGEIAKASGT 1107          

HSP 3 Score: 81.6481 bits (200), Expect = 4.382e-14
Identity = 56/208 (26.92%), Postives = 100/208 (48.08%), Query Frame = 1
Query:  787 VDRVLKMNFNQQQKLLSTLDKIETVYETDIESE------------------VDLELTIESNWGHPSRVGLTEVEFWDSNKQRIMIMNVESNER---VEGKLNNIINDKKDTAKEKNMWSTNFTNARPITICFMLSTQSVA---DVQFIGIWNFNKSLDSLSIGVQKFSLRHSGKVICSGIVNKALGNQVFNPPTVLEIGSGIVNSKSI 1338
            ++++  M  +QQ+KLL  L  I+    T+  SE                  + + + I SNWG+   +GLTE++F+D   + I +   + + R   V G    ++N K  T KE  MW+  F    P+ + F++   + +   D+  + IWN+NK+L  L IG +   +     ++  G++ K  GNQ F+    +++ SG + S S 
Sbjct:  379 IEKINLMKISQQKKLLKVLQDIDNDSSTNSNSEGEILKWDSVYLDPAVKDVICITVEILSNWGNQYYIGLTEIQFFDLKNEEIYVSPHDVDIRNVDVPGDPTCLVNGKTLTTKEHFMWTCPF--HPPVQLYFIIRNATKSGDFDISKMKIWNYNKALSDLDIGAKLVKIYKDETLVFDGLLAKGSGNQDFDYSNTIDLHSGQIKSSSF 584          

HSP 4 Score: 76.2554 bits (186), Expect = 1.827e-12
Identity = 41/127 (32.28%), Postives = 71/127 (55.91%), Query Frame = 1
Query: 3124 FNILSSWNDLYYVGLNGIEIYDQHCQSISISPQQVYAYPDSVNSLTPKNQRTFSNLDVRTPDKLVDGINDSYDAKHMWLAPILPGCLNRIFFVFDRPVCVSMIKIWNYSKTPS---RGVKDFSILVD 3495
             N   +W D +Y+GL G+EI  +  ++++I+   + A P  + S+ P+ +      D+RT DKL+DG+N + +  HMWL P   G  + I   F++   ++ I+ WNY+K+P    RG K   + +D
Sbjct: 1205 LNFTMTWGDPHYLGLTGMEIVGRDGKALAITLDALSACPQDL-SILPEYKD-----DLRTLDKLIDGVNITNEDTHMWLIPFASGADHTITINFNKSEDIAGIRFWNYNKSPEDTYRGAKIVYVTLD 1325          

HSP 5 Score: 66.6254 bits (161), Expect = 1.795e-9
Identity = 43/136 (31.62%), Postives = 70/136 (51.47%), Query Frame = 1
Query: 1891 MVMNILSTWGDPHYVGLTGIEMFASTGERVTVRNISADPPDINILTGYGTDPRVVTNLLDGVNKTHDDVHMWLAPFTAS-QNHFIKIEFEK--EIDLALLRIWNYNKSRIHSSRGAKDVEIKLNGTVIFKGEIARA 2289
            + + ILS WG+ +Y+GLT I+ F    E + V     D  ++++       P   T L++G   T  +  MW  PF    Q +FI     K  + D++ ++IWNYNK+      GAK V+I  + T++F G +A+ 
Sbjct:  432 ITVEILSNWGNQYYIGLTEIQFFDLKNEEIYVSPHDVDIRNVDV-------PGDPTCLVNGKTLTTKEHFMWTCPFHPPVQLYFIIRNATKSGDFDISKMKIWNYNKALSDLDIGAKLVKIYKDETLVFDGLLAKG 560          

HSP 6 Score: 55.4546 bits (132), Expect = 4.414e-6
Identity = 41/144 (28.47%), Postives = 62/144 (43.06%), Query Frame = 1
Query: 3130 ILSSWNDLYYVGLNGIEIYDQHCQSISISPQQVYAYPDSVNSLTPKNQRTFSNLDVRT-PDKLVDGINDSYDAKHMWLAPILPGCLNRIFFVFDRPVC-----VSMIKIWNYSKTPSR---GVKDFSILVDDLLIYSGTLPSAT 3534
            ILS+W + YY+GL  I+ +D   + I +SP  V                   N+DV   P  LV+G   +     MW  P  P    +++F+           +S +KIWNY+K  S    G K   I  D+ L++ G L   +
Sbjct:  436 ILSNWGNQYYIGLTEIQFFDLKNEEIYVSPHDV----------------DIRNVDVPGDPTCLVNGKTLTTKEHFMWTCPFHPPV--QLYFIIRNATKSGDFDISKMKIWNYNKALSDLDIGAKLVKIYKDETLVFDGLLAKGS 561          
BLAST of Protein KIAA0556 homolog vs. UniProt/SwissProt
Match: sp|O44770|K0556_CAEEL (Protein KIAA0556 homolog OS=Caenorhabditis elegans OX=6239 GN=K04F10.2 PE=3 SV=2)

HSP 1 Score: 298.901 bits (764), Expect = 2.512e-87
Identity = 197/577 (34.14%), Postives = 299/577 (51.82%), Query Frame = 1
Query: 1864 IPELPRGKEMVMNILSTWGDPHYVGLTGIEMFASTGERVTVRNISADPPDINILTGYGTDPRVVTNLLDGVNKTH--DDVHMWLAPFTASQNHFIKIEFEKEIDLALLRIWNYNKSRIHSSRGAKDVEIKLNGTVIFKGEIARAFHCSEIEEF----GEVILFTSDDQILDRIGQNDQEFVDSGHNNDASTDGQSPVGQSDETKELLDSLA-MRPPT--AKQSPTNERKTDETNKQSTNLYRPFTSTRPVRFCEEKQIIK-----VKLNLADTWGDNFYIGLTGLEFVGDNGDAISVDMDNISTNTQALRDDVRRVENIFNGTNLTTNDEHMWLAPFNSNEDHCLTVXXXXXXXXXXXXXWNYNKSLEDSYRGVKILHVWINDKRVSSDEGYFIRRAPGHVQYDFVQEIHIKTNVA----LPEALIQYNHLPCGFVYQFNILSSWNDLYYVGLNGIEIYDQHCQSISISPQQVYAYPDSVNSLTPKNQRTFSNLDVRTPDKLVDGINDSYDAKHMWLAPILPGCLNRIFFVFDRPVCVSMIKIWNYSKTPSRGVKDFSILVDDLLIYSGTLPSATSS 3540
            IPELP G+ + + +LS WGD HY+GL  +E+F STGER  +  I+      N+    G+   ++      V + H  D   MW A  T  +   + +E ++   LAL+R WNYN SR+H+  G + +E+ L+G  IF+GE+  AF  S   EF    GE +LFT+ D IL+ I  +D   +         +  + P+  S       D L   RP T  AK +P+                 P T   P  F +     K     + + L   WG +  IGLTGLE V ++   I  D    +  T     D+ +   +FNG NLT +   MWL  F+S     +++       + +I +WNYN S E SY GVK   ++IN K +   +   +R+A G V +D+VQ++ +  N      +P+ + Q      GFV+Q  +LS+W D +Y+GLNGIE+Y++  + + I    + A+P+SVN L P  +      D+RT + L+   ND+  A++MWL  +LP    R+FFVFD    +S I I+NY KTP RGV+  S+ VDDL+I+SG +PS+T++
Sbjct:   35 IPELPEGRVLELRLLSNWGDSHYIGLNSVEIFTSTGERAVIDKIAT-----NVTEYTGSLESLI------VQRVHCKDAEKMWCAK-TTEEKIVLTLELKETCKLALIRFWNYNASRVHAQIGVRYLEMYLDGVGIFRGELECAF--SADSEFTPVMGETVLFTTSDNILELIALHDVCLI---------SLPEEPISNSSIEMLKADHLTPYRPSTCEAKDAPST----------------PVTIVPPPIFRQTGTAYKHDVKTLHIELLSNWGMDGLIGLTGLELVDEHSQLI--DESQYTVTTSDGNSDLSK--KLFNGRNLTRDPHDMWLVDFDSKNFTTISITFHDNVALKAISVWNYNASFELSYAGVKAAKIYINGKLI---KNVLLRKATGFVYFDYVQDVVLDPNNTERDFVPKGISQS---IGGFVFQIRLLSTWGDEFYIGLNGIELYNRKGELMKIREHNLAAFPESVNIL-PNIKN-----DLRTSNNLITQPNDTDIARNMWLTALLPNRCARVFFVFDVQTYISKIVIYNYRKTPERGVRHISVTVDDLIIFSGEIPSSTAT 556          
BLAST of Protein KIAA0556 homolog vs. TrEMBL
Match: A0A2T7PZP8 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_01514 PE=4 SV=1)

HSP 1 Score: 626.32 bits (1614), Expect = 0.000e+0
Identity = 335/725 (46.21%), Postives = 462/725 (63.72%), Query Frame = 1
Query: 1696 KSENLEKSWSSLKFFNKSQAGRLSLDHTGDILDKYVDQIKRNQ------KLDXXXXXXXXFVIPELPRGKEMVMNILSTWGDPHYVGLTGIEMFASTGERVTVRNISADPPDINILTGYGTDPRVVTNLLDGVNKTHDDVHMWLAPFTASQNHFIKIEFEKEIDLALLRIWNYNKSRIHSSRGAKDVEIKLNGTVIFKGEIARAFHCSE--IEEFGEVILFTSDDQILDRIGQNDQEFVDSGHNNDASTDGQSPVG-QSDETKELLDSLAMRPPTAKQSPTNERKTDETNKQSTNLYRPFTSTRPVRFCEEKQII---KVKLNLADTWGDNFYIGLTGLEFVGDNGDAISVDMDNISTNTQALRD------DVRRVENIFNGTNLTTNDEHMWLAPFNSNEDHCLTVXXXXXXXXXXXXXWNYNKSLEDSYRGVKILHVWINDKRVSSDEGYFIRRAPGHVQYDFVQEIHIKTNVALPEALIQYN-------HLPCGFVYQFNILSSWNDLYYVGLNGIEIYDQHCQSISISPQQVYAYPDSVNSLTPKNQRTFSNLDVRTPDKLVDGINDSYDAKHMWLAPILPGCLNRIFFVFDRPVCVSMIKIWNYSKTPSRGVKDFSILVDDLLIYSGTLPSATSSSITRGILPNMNESIAPTNRHKTVLFDRTSGALLNQEKLFLLEHSISSGQDVILINDNDINSVHC----------ANQKYRPMTSV 3765
            +SEN+E++W SL FFNKS  GRLS+D T DILD+Y+   K+++        D   + +E FVIPELP G+E+V+NILSTWGD HYVGLT I++FASTGE+V ++ I ADPPDINIL  Y  DPRVVTNLLDGV++T DD HMWL PFT  +NHFI I F K  ++AL+RIWNYNKSRIHS RGAKD+ + L+ TVIFKGEIARA   +E   E FG+ ILFT+D+++LD + +ND  F       D  ++G+  +  Q   T +  +S  MRP T        R   +  K+        T +  V F  +  +    K++LN   TWGD  Y+GLT LE VG +G+A+ ++M  +S   + +R       D R ++ + +GT +TT+DEHMWL PF   ++H +TV     + +S +RIWNYNK+ ED++RG +I+HV IN++ +S +EG+ +R+ PG+  +DF QEI+   N  +P    Q          +PCGF+YQ ++ S+W D YY+GLNG+E YD   + I ++   + A+P+SVN L   +       DVRTPDKL+DG ND+ D +HMWLAPILPG +NR++ +FD+P  VSMIKIWNYSKTP RGVKDF++LVDDLL+Y+GTL +  S++   GILP  +    P   H T+LF   +  +L +EK  ++ +  +  QDV L+ND  I + H            NQ  RP TSV
Sbjct:  988 QSENIEETWGSLSFFNKSHRGRLSIDMTDDILDEYLAPAKKSEISPLPIPEDGFTDDDESFVIPELPTGQELVINILSTWGDKHYVGLTTIQVFASTGEQVQIKKIHADPPDINILPEYDRDPRVVTNLLDGVSRTRDDTHMWLTPFTPGKNHFIFITFAKSYNVALIRIWNYNKSRIHSYRGAKDIVMTLDKTVIFKGEIARACGGTEGGTEAFGDTILFTTDEEVLDAVSRNDDAF-----EGDMLSEGEEDIPLQRPRTADNEESDEMRPFT--------RAAGQLEKKEK------TPSGMVTFAGDILVYKTHKLELNFTATWGDLHYLGLTALEVVGKDGEALPLNMSVLSAQPRDIRHLKGHERDDRTLDKLIDGTCITTSDEHMWLVPFTEGQNHTVTVTFPQETLVSGLRIWNYNKTPEDTFRGARIMHVSINERWISPEEGFLVRKGPGNCHFDFAQEINFTRNPEVPSQGNQNTNDEGEPMQMPCGFIYQLHLFSTWGDPYYIGLNGLEFYDTFFKKIILTESNIAAHPNSVNVLEQVHN------DVRTPDKLIDGENDTMDGRHMWLAPILPGVMNRVYIIFDQPTTVSMIKIWNYSKTPQRGVKDFALLVDDLLVYNGTLQAVKSTA--SGILPTCS---GPQQYH-TILFT-GNADVLRREKYTVINNQ-AEDQDVQLLNDKKIVTKHADPNKANSGKPVNQALRPKTSV 1679          

HSP 2 Score: 98.2117 bits (243), Expect = 1.144e-16
Identity = 65/197 (32.99%), Postives = 104/197 (52.79%), Query Frame = 1
Query:  748 INDTDNEKRLKAIVDRVLKMNFNQQQKLLSTLDKIE--------TVYETDIES-EVDLELTIE--SNWGHPSRVGLTEVEFWDSNKQRIMIMN----VESNERVEGKLNNIINDKKDTAKEKNMWSTNFTNARPITICFMLSTQSVADVQF--IGIWNFNKSLDSLSIGVQKFSLRHSGKVICSGIVNKALGNQVFN 1287
            I++  +   +  IV RVL+M   QQ+ LL  L KI+        + +   ++S E   ++TIE  SNWGHPSR+GLTE++  +  +  + + +    V   E + G  + + N K  T KE+NMWS  +T  RPI +C  +        Q   + IWN+NKS+  L  GV++  +    +++  G V+K  GN VF+
Sbjct:  424 IDNKQDSDHISVIVKRVLEMAPKQQRGLLKMLSKIDDSLTEANGSGFNKPLDSKEKGGKVTIEMVSNWGHPSRLGLTEIQLLNELEHLLPVSSSGVFVHGAETMSGSPSILFNGKTKTTKERNMWSCRWT-GRPIVLCIEVGNVKGQQSQLSALRIWNWNKSIQELDAGVRQVRVFVGDELVFDGDVDKGCGNHVFD 619          
BLAST of Protein KIAA0556 homolog vs. TrEMBL
Match: A0A1S3H6N0 (protein KIAA0556 isoform X6 OS=Lingula unguis OX=7574 GN=LOC106152181 PE=4 SV=1)

HSP 1 Score: 600.897 bits (1548), Expect = 0.000e+0
Identity = 325/739 (43.98%), Postives = 444/739 (60.08%), Query Frame = 1
Query: 1705 NLEKSWSSLKFFNKSQAGRLSLDHTGDILDKYVDQIKRNQKLDXXXXXXX----XFVIPELPRGKEMVMNILSTWGDPHYVGLTGIEMFASTGERVTVRNISADPPDINILTGYGTDPRVVTNLLDGVNKTHDDVHMWLAPFTASQNHFIKIEFEKEIDLALLRIWNYNKSRIHSSRGAKDVEIKLNGTVIFKGEIARAFHCSEI----EEFGEVILFTSDDQILDRIGQNDQEFVDSGHNNDASTDG---QSPVGQSDETKELLDSLAMRPPTAKQSPTNERKTDETNKQSTNLYRPFTSTRPVRFCEEKQIIK---VKLNLADTWGDNFYIGLTGLEFVGDNGDAISVDMDNISTNTQALR------DDVRRVENIFNGTNLTTNDEHMWLAPFNSNEDHCLTVXXXXXXXXXXXXXWNYNKSLEDSYRGVKILHVWINDKRVSSDEGYFIRRAPGHVQYDFVQEIHI-----------------KTNVALPEALIQYN--HLPCGFVYQFNILSSWNDLYYVGLNGIEIYDQHCQSISISPQQVYAYPDSVNSLTPKNQRTFSNLDVRTPDKLVDGINDSYDAKHMWLAPILPGCLNRIFFVFDRPVCVSMIKIWNYSKTPSRGVKDFSILVDDLLIYSGTLPSATSSSITRGILPNMNESIAPTNRHKTVLFDRTSGALLNQEKLFLLEHSISSGQDVILIND----------NDINSVHCANQKYRPMTSVKVR 3774
            +LE+SW+SL  F+KS  GR+S+D  GD LD+Y+ Q+++ Q  +   + E     +F+IPELP GKE+V+NI STWGD HYVGL GIE+F+S G  V V  ISA+PPDIN+L  YG DPRV  NL+DG+N+T DD+HMWLAPFT   NHFI I FE+   +A++RIWNYNKSRIHS RGAKDVE+ L+G+ IFKGEIARA  C  +    E FG+ ILFT D++IL+ +  ND+ +     + D   D    + P    +E ++       RP T        R   +   Q  +  +P      + +  E  +     ++LN   TWGD+ Y+GLTGLE VG +G+A+ + M+ I  N + L        D R ++ + +GTN+T +DEHMWL P+   EDH +TV     + + ++RIWNYNKS ED+YRG +ILH  ++ K +S   G+ +R+ PG+  +DF+QEI                   ++ V   E   +Y    +PCGF+YQ + LS+W D YYVGLNG+E YD     I +    + AYPDSVN+L        SN DVRTPDKL+DG+ND+ D +HMWLAPILP  +NRIF +FD P  +SMIK+WNYSKTP+RGVKDF++LVDDLL+Y+G +      S+ RGILP  +    P   H T+LF  T    + Q +   +    ++ QD+ L ND           +  S    NQ  RP TSV  R
Sbjct: 1081 SLEESWTSLDLFSKSHKGRISVDFEGDALDEYL-QLEKKQPFEPTIQEETGIEEDFMIPELPFGKELVINIKSTWGDKHYVGLNGIEIFSSKGVPVPVAKISANPPDINVLNDYGKDPRVAANLVDGINRTRDDIHMWLAPFTKGGNHFIYITFEEPCKVAMVRIWNYNKSRIHSYRGAKDVEMMLDGSFIFKGEIARA--CGGVMGGTEAFGDTILFTVDEEILEAVSLNDEAYEAEAFSEDEMEDDVPFERPKTADEENQD-------RPFTCA---VGTRGRGKIETQDVSTVQPQDDHSHISYEGELVVYTGQCLQLNFTSTWGDHHYLGLTGLEVVGKDGEALPITMNMIDANPRDLHVLPGYETDDRTLDKLIDGTNITMSDEHMWLVPYTEGEDHLVTVDFGQPTAMVALRIWNYNKSAEDTYRGAQILHCTLDGKVISPPSGHLVRKGPGNCFFDFMQEIPFSRQPEEVTFPMLDGKMRQSKVVTEEPSQEYEAVQMPCGFIYQLHFLSTWGDPYYVGLNGLEFYDAAGNKIDLVENNIAAYPDSVNALD-----GVSN-DVRTPDKLIDGVNDTTDGRHMWLAPILPSLMNRIFVIFDEPRTISMIKLWNYSKTPTRGVKDFALLVDDLLVYNGQI--GPVQSVARGILPTCD---LPQPYH-TILF--TDDKHIAQRERHTVIKKQAADQDIQLTNDMTVVSHFNNPKEATSQKTVNQALRPTTSVSNR 1792          

HSP 2 Score: 111.309 bits (277), Expect = 1.111e-20
Identity = 72/236 (30.51%), Postives = 113/236 (47.88%), Query Frame = 1
Query:  763 NEKRLKAIVDRVLKMNFNQQQKLLSTLDKIE---------------------------------------------------TVYETDIESE--VDLELTIESNWGHPSRVGLTEVEFWDSNKQRIMI----MNVESNERVEGKLNNIINDKKDTAKEKNMWSTNFTNARPITICFMLSTQSVADVQF----IGIWNFNKSLDSLSIGVQKFSLRHSGKVICSGIVNKALGNQVFN 1287
            +E++L  ++ +VL+M   QQ+KLL  L KIE                                                    V    ++SE  V+L L + SNWGHPSR+GLTE++ +DS   RI +    + V   +  +G L+N+ N +  T KE+NMWS +F   +P+ I   +     +  +F    + IWN+NKSL+ LS+GV+   +    ++I SG ++K  GNQVF+
Sbjct:  511 SEEKLTKVLKKVLQMEGKQQKKLLKALSKIEDTASAENSPRLSSEAMSKPNSQDVAGVEEQAISHSFDKKRGGSMKRQVAIDRVSPNPVQSEDIVELHLVLLSNWGHPSRIGLTEIQAFDSEGNRIDLTCGDVQVYGAKDCKGDLDNLFNGRFKTTKERNMWSCSFVPEKPVEITLNVKRGKDSSKEFGISKLRIWNYNKSLNELSVGVKAMQVFLGAELIFSGDIDKGCGNQVFD 746          

HSP 3 Score: 66.2402 bits (160), Expect = 5.982e-7
Identity = 49/162 (30.25%), Postives = 79/162 (48.77%), Query Frame = 1
Query: 1888 EMVMNILSTWGDPHYVGLTGIEMFASTGERVTVRNISADPPDINILTGYGTD--PRVVTNLLDGVNKTHDDVHMWLAPFTASQNHFIKIEFE------KEIDLALLRIWNYNKSRIHSSRGAKDVEIKLNGTVIFKGEIARAFHCS-EIEEFGEVILFTSDD 2346
            E+ + +LS WG P  +GLT I+ F S G R+ +        D+ +   YG       + NL +G  KT  + +MW   F   +   I +  +      KE  ++ LRIWNYNKS    S G K +++ L   +IF G+I +   C  ++ ++ + I+   DD
Sbjct:  606 ELHLVLLSNWGHPSRIGLTEIQAFDSEGNRIDLTCG-----DVQV---YGAKDCKGDLDNLFNGRFKTTKERNMWSCSFVPEKPVEITLNVKRGKDSSKEFGISKLRIWNYNKSLNELSVGVKAMQVFLGAELIFSGDIDKG--CGNQVFDYSKTIILREDD 757          
BLAST of Protein KIAA0556 homolog vs. TrEMBL
Match: A0A1S3H550 (protein KIAA0556 isoform X4 OS=Lingula unguis OX=7574 GN=LOC106152181 PE=4 SV=1)

HSP 1 Score: 600.512 bits (1547), Expect = 0.000e+0
Identity = 325/739 (43.98%), Postives = 444/739 (60.08%), Query Frame = 1
Query: 1705 NLEKSWSSLKFFNKSQAGRLSLDHTGDILDKYVDQIKRNQKLDXXXXXXX----XFVIPELPRGKEMVMNILSTWGDPHYVGLTGIEMFASTGERVTVRNISADPPDINILTGYGTDPRVVTNLLDGVNKTHDDVHMWLAPFTASQNHFIKIEFEKEIDLALLRIWNYNKSRIHSSRGAKDVEIKLNGTVIFKGEIARAFHCSEI----EEFGEVILFTSDDQILDRIGQNDQEFVDSGHNNDASTDG---QSPVGQSDETKELLDSLAMRPPTAKQSPTNERKTDETNKQSTNLYRPFTSTRPVRFCEEKQIIK---VKLNLADTWGDNFYIGLTGLEFVGDNGDAISVDMDNISTNTQALR------DDVRRVENIFNGTNLTTNDEHMWLAPFNSNEDHCLTVXXXXXXXXXXXXXWNYNKSLEDSYRGVKILHVWINDKRVSSDEGYFIRRAPGHVQYDFVQEIHI-----------------KTNVALPEALIQYN--HLPCGFVYQFNILSSWNDLYYVGLNGIEIYDQHCQSISISPQQVYAYPDSVNSLTPKNQRTFSNLDVRTPDKLVDGINDSYDAKHMWLAPILPGCLNRIFFVFDRPVCVSMIKIWNYSKTPSRGVKDFSILVDDLLIYSGTLPSATSSSITRGILPNMNESIAPTNRHKTVLFDRTSGALLNQEKLFLLEHSISSGQDVILIND----------NDINSVHCANQKYRPMTSVKVR 3774
            +LE+SW+SL  F+KS  GR+S+D  GD LD+Y+ Q+++ Q  +   + E     +F+IPELP GKE+V+NI STWGD HYVGL GIE+F+S G  V V  ISA+PPDIN+L  YG DPRV  NL+DG+N+T DD+HMWLAPFT   NHFI I FE+   +A++RIWNYNKSRIHS RGAKDVE+ L+G+ IFKGEIARA  C  +    E FG+ ILFT D++IL+ +  ND+ +     + D   D    + P    +E ++       RP T        R   +   Q  +  +P      + +  E  +     ++LN   TWGD+ Y+GLTGLE VG +G+A+ + M+ I  N + L        D R ++ + +GTN+T +DEHMWL P+   EDH +TV     + + ++RIWNYNKS ED+YRG +ILH  ++ K +S   G+ +R+ PG+  +DF+QEI                   ++ V   E   +Y    +PCGF+YQ + LS+W D YYVGLNG+E YD     I +    + AYPDSVN+L        SN DVRTPDKL+DG+ND+ D +HMWLAPILP  +NRIF +FD P  +SMIK+WNYSKTP+RGVKDF++LVDDLL+Y+G +      S+ RGILP  +    P   H T+LF  T    + Q +   +    ++ QD+ L ND           +  S    NQ  RP TSV  R
Sbjct: 1104 SLEESWTSLDLFSKSHKGRISVDFEGDALDEYL-QLEKKQPFEPTIQEETGIEEDFMIPELPFGKELVINIKSTWGDKHYVGLNGIEIFSSKGVPVPVAKISANPPDINVLNDYGKDPRVAANLVDGINRTRDDIHMWLAPFTKGGNHFIYITFEEPCKVAMVRIWNYNKSRIHSYRGAKDVEMMLDGSFIFKGEIARA--CGGVMGGTEAFGDTILFTVDEEILEAVSLNDEAYEAEAFSEDEMEDDVPFERPKTADEENQD-------RPFTCA---VGTRGRGKIETQDVSTVQPQDDHSHISYEGELVVYTGQCLQLNFTSTWGDHHYLGLTGLEVVGKDGEALPITMNMIDANPRDLHVLPGYETDDRTLDKLIDGTNITMSDEHMWLVPYTEGEDHLVTVDFGQPTAMVALRIWNYNKSAEDTYRGAQILHCTLDGKVISPPSGHLVRKGPGNCFFDFMQEIPFSRQPEEVTFPMLDGKMRQSKVVTEEPSQEYEAVQMPCGFIYQLHFLSTWGDPYYVGLNGLEFYDAAGNKIDLVENNIAAYPDSVNALD-----GVSN-DVRTPDKLIDGVNDTTDGRHMWLAPILPSLMNRIFVIFDEPRTISMIKLWNYSKTPTRGVKDFALLVDDLLVYNGQI--GPVQSVARGILPTCD---LPQPYH-TILF--TDDKHIAQRERHTVIKKQAADQDIQLTNDMTVVSHFNNPKEATSQKTVNQALRPTTSVSNR 1815          

HSP 2 Score: 111.309 bits (277), Expect = 1.097e-20
Identity = 72/236 (30.51%), Postives = 113/236 (47.88%), Query Frame = 1
Query:  763 NEKRLKAIVDRVLKMNFNQQQKLLSTLDKIE---------------------------------------------------TVYETDIESE--VDLELTIESNWGHPSRVGLTEVEFWDSNKQRIMI----MNVESNERVEGKLNNIINDKKDTAKEKNMWSTNFTNARPITICFMLSTQSVADVQF----IGIWNFNKSLDSLSIGVQKFSLRHSGKVICSGIVNKALGNQVFN 1287
            +E++L  ++ +VL+M   QQ+KLL  L KIE                                                    V    ++SE  V+L L + SNWGHPSR+GLTE++ +DS   RI +    + V   +  +G L+N+ N +  T KE+NMWS +F   +P+ I   +     +  +F    + IWN+NKSL+ LS+GV+   +    ++I SG ++K  GNQVF+
Sbjct:  511 SEEKLTKVLKKVLQMEGKQQKKLLKALSKIEDTASAENSPRLSSEAMSKPNSQDVAGVEEQAISHSFDKKRGGSMKRQVAIDRVSPNPVQSEDIVELHLVLLSNWGHPSRIGLTEIQAFDSEGNRIDLTCGDVQVYGAKDCKGDLDNLFNGRFKTTKERNMWSCSFVPEKPVEITLNVKRGKDSSKEFGISKLRIWNYNKSLNELSVGVKAMQVFLGAELIFSGDIDKGCGNQVFD 746          

HSP 3 Score: 66.2402 bits (160), Expect = 6.361e-7
Identity = 49/162 (30.25%), Postives = 79/162 (48.77%), Query Frame = 1
Query: 1888 EMVMNILSTWGDPHYVGLTGIEMFASTGERVTVRNISADPPDINILTGYGTD--PRVVTNLLDGVNKTHDDVHMWLAPFTASQNHFIKIEFE------KEIDLALLRIWNYNKSRIHSSRGAKDVEIKLNGTVIFKGEIARAFHCS-EIEEFGEVILFTSDD 2346
            E+ + +LS WG P  +GLT I+ F S G R+ +        D+ +   YG       + NL +G  KT  + +MW   F   +   I +  +      KE  ++ LRIWNYNKS    S G K +++ L   +IF G+I +   C  ++ ++ + I+   DD
Sbjct:  606 ELHLVLLSNWGHPSRIGLTEIQAFDSEGNRIDLTCG-----DVQV---YGAKDCKGDLDNLFNGRFKTTKERNMWSCSFVPEKPVEITLNVKRGKDSSKEFGISKLRIWNYNKSLNELSVGVKAMQVFLGAELIFSGDIDKG--CGNQVFDYSKTIILREDD 757          
BLAST of Protein KIAA0556 homolog vs. TrEMBL
Match: A0A1S3H4S7 (protein KIAA0556 isoform X5 OS=Lingula unguis OX=7574 GN=LOC106152181 PE=4 SV=1)

HSP 1 Score: 600.512 bits (1547), Expect = 0.000e+0
Identity = 325/739 (43.98%), Postives = 444/739 (60.08%), Query Frame = 1
Query: 1705 NLEKSWSSLKFFNKSQAGRLSLDHTGDILDKYVDQIKRNQKLDXXXXXXX----XFVIPELPRGKEMVMNILSTWGDPHYVGLTGIEMFASTGERVTVRNISADPPDINILTGYGTDPRVVTNLLDGVNKTHDDVHMWLAPFTASQNHFIKIEFEKEIDLALLRIWNYNKSRIHSSRGAKDVEIKLNGTVIFKGEIARAFHCSEI----EEFGEVILFTSDDQILDRIGQNDQEFVDSGHNNDASTDG---QSPVGQSDETKELLDSLAMRPPTAKQSPTNERKTDETNKQSTNLYRPFTSTRPVRFCEEKQIIK---VKLNLADTWGDNFYIGLTGLEFVGDNGDAISVDMDNISTNTQALR------DDVRRVENIFNGTNLTTNDEHMWLAPFNSNEDHCLTVXXXXXXXXXXXXXWNYNKSLEDSYRGVKILHVWINDKRVSSDEGYFIRRAPGHVQYDFVQEIHI-----------------KTNVALPEALIQYN--HLPCGFVYQFNILSSWNDLYYVGLNGIEIYDQHCQSISISPQQVYAYPDSVNSLTPKNQRTFSNLDVRTPDKLVDGINDSYDAKHMWLAPILPGCLNRIFFVFDRPVCVSMIKIWNYSKTPSRGVKDFSILVDDLLIYSGTLPSATSSSITRGILPNMNESIAPTNRHKTVLFDRTSGALLNQEKLFLLEHSISSGQDVILIND----------NDINSVHCANQKYRPMTSVKVR 3774
            +LE+SW+SL  F+KS  GR+S+D  GD LD+Y+ Q+++ Q  +   + E     +F+IPELP GKE+V+NI STWGD HYVGL GIE+F+S G  V V  ISA+PPDIN+L  YG DPRV  NL+DG+N+T DD+HMWLAPFT   NHFI I FE+   +A++RIWNYNKSRIHS RGAKDVE+ L+G+ IFKGEIARA  C  +    E FG+ ILFT D++IL+ +  ND+ +     + D   D    + P    +E ++       RP T        R   +   Q  +  +P      + +  E  +     ++LN   TWGD+ Y+GLTGLE VG +G+A+ + M+ I  N + L        D R ++ + +GTN+T +DEHMWL P+   EDH +TV     + + ++RIWNYNKS ED+YRG +ILH  ++ K +S   G+ +R+ PG+  +DF+QEI                   ++ V   E   +Y    +PCGF+YQ + LS+W D YYVGLNG+E YD     I +    + AYPDSVN+L        SN DVRTPDKL+DG+ND+ D +HMWLAPILP  +NRIF +FD P  +SMIK+WNYSKTP+RGVKDF++LVDDLL+Y+G +      S+ RGILP  +    P   H T+LF  T    + Q +   +    ++ QD+ L ND           +  S    NQ  RP TSV  R
Sbjct: 1091 SLEESWTSLDLFSKSHKGRISVDFEGDALDEYL-QLEKKQPFEPTIQEETGIEEDFMIPELPFGKELVINIKSTWGDKHYVGLNGIEIFSSKGVPVPVAKISANPPDINVLNDYGKDPRVAANLVDGINRTRDDIHMWLAPFTKGGNHFIYITFEEPCKVAMVRIWNYNKSRIHSYRGAKDVEMMLDGSFIFKGEIARA--CGGVMGGTEAFGDTILFTVDEEILEAVSLNDEAYEAEAFSEDEMEDDVPFERPKTADEENQD-------RPFTCA---VGTRGRGKIETQDVSTVQPQDDHSHISYEGELVVYTGQCLQLNFTSTWGDHHYLGLTGLEVVGKDGEALPITMNMIDANPRDLHVLPGYETDDRTLDKLIDGTNITMSDEHMWLVPYTEGEDHLVTVDFGQPTAMVALRIWNYNKSAEDTYRGAQILHCTLDGKVISPPSGHLVRKGPGNCFFDFMQEIPFSRQPEEVTFPMLDGKMRQSKVVTEEPSQEYEAVQMPCGFIYQLHFLSTWGDPYYVGLNGLEFYDAAGNKIDLVENNIAAYPDSVNALD-----GVSN-DVRTPDKLIDGVNDTTDGRHMWLAPILPSLMNRIFVIFDEPRTISMIKLWNYSKTPTRGVKDFALLVDDLLVYNGQI--GPVQSVARGILPTCD---LPQPYH-TILF--TDDKHIAQRERHTVIKKQAADQDIQLTNDMTVVSHFNNPKEATSQKTVNQALRPTTSVSNR 1802          

HSP 2 Score: 111.309 bits (277), Expect = 1.242e-20
Identity = 72/236 (30.51%), Postives = 113/236 (47.88%), Query Frame = 1
Query:  763 NEKRLKAIVDRVLKMNFNQQQKLLSTLDKIE---------------------------------------------------TVYETDIESE--VDLELTIESNWGHPSRVGLTEVEFWDSNKQRIMI----MNVESNERVEGKLNNIINDKKDTAKEKNMWSTNFTNARPITICFMLSTQSVADVQF----IGIWNFNKSLDSLSIGVQKFSLRHSGKVICSGIVNKALGNQVFN 1287
            +E++L  ++ +VL+M   QQ+KLL  L KIE                                                    V    ++SE  V+L L + SNWGHPSR+GLTE++ +DS   RI +    + V   +  +G L+N+ N +  T KE+NMWS +F   +P+ I   +     +  +F    + IWN+NKSL+ LS+GV+   +    ++I SG ++K  GNQVF+
Sbjct:  497 SEEKLTKVLKKVLQMEGKQQKKLLKALSKIEDTASAENSPRLSSEAMSKPNSQDVAGVEEQAISHSFDKKRGGSMKRQVAIDRVSPNPVQSEDIVELHLVLLSNWGHPSRIGLTEIQAFDSEGNRIDLTCGDVQVYGAKDCKGDLDNLFNGRFKTTKERNMWSCSFVPEKPVEITLNVKRGKDSSKEFGISKLRIWNYNKSLNELSVGVKAMQVFLGAELIFSGDIDKGCGNQVFD 732          

HSP 3 Score: 66.2402 bits (160), Expect = 6.353e-7
Identity = 49/162 (30.25%), Postives = 79/162 (48.77%), Query Frame = 1
Query: 1888 EMVMNILSTWGDPHYVGLTGIEMFASTGERVTVRNISADPPDINILTGYGTD--PRVVTNLLDGVNKTHDDVHMWLAPFTASQNHFIKIEFE------KEIDLALLRIWNYNKSRIHSSRGAKDVEIKLNGTVIFKGEIARAFHCS-EIEEFGEVILFTSDD 2346
            E+ + +LS WG P  +GLT I+ F S G R+ +        D+ +   YG       + NL +G  KT  + +MW   F   +   I +  +      KE  ++ LRIWNYNKS    S G K +++ L   +IF G+I +   C  ++ ++ + I+   DD
Sbjct:  592 ELHLVLLSNWGHPSRIGLTEIQAFDSEGNRIDLTCG-----DVQV---YGAKDCKGDLDNLFNGRFKTTKERNMWSCSFVPEKPVEITLNVKRGKDSSKEFGISKLRIWNYNKSLNELSVGVKAMQVFLGAELIFSGDIDKG--CGNQVFDYSKTIILREDD 743          
BLAST of Protein KIAA0556 homolog vs. TrEMBL
Match: A0A1S3H7N8 (protein KIAA0556 isoform X3 OS=Lingula unguis OX=7574 GN=LOC106152181 PE=4 SV=1)

HSP 1 Score: 600.512 bits (1547), Expect = 0.000e+0
Identity = 325/739 (43.98%), Postives = 444/739 (60.08%), Query Frame = 1
Query: 1705 NLEKSWSSLKFFNKSQAGRLSLDHTGDILDKYVDQIKRNQKLDXXXXXXX----XFVIPELPRGKEMVMNILSTWGDPHYVGLTGIEMFASTGERVTVRNISADPPDINILTGYGTDPRVVTNLLDGVNKTHDDVHMWLAPFTASQNHFIKIEFEKEIDLALLRIWNYNKSRIHSSRGAKDVEIKLNGTVIFKGEIARAFHCSEI----EEFGEVILFTSDDQILDRIGQNDQEFVDSGHNNDASTDG---QSPVGQSDETKELLDSLAMRPPTAKQSPTNERKTDETNKQSTNLYRPFTSTRPVRFCEEKQIIK---VKLNLADTWGDNFYIGLTGLEFVGDNGDAISVDMDNISTNTQALR------DDVRRVENIFNGTNLTTNDEHMWLAPFNSNEDHCLTVXXXXXXXXXXXXXWNYNKSLEDSYRGVKILHVWINDKRVSSDEGYFIRRAPGHVQYDFVQEIHI-----------------KTNVALPEALIQYN--HLPCGFVYQFNILSSWNDLYYVGLNGIEIYDQHCQSISISPQQVYAYPDSVNSLTPKNQRTFSNLDVRTPDKLVDGINDSYDAKHMWLAPILPGCLNRIFFVFDRPVCVSMIKIWNYSKTPSRGVKDFSILVDDLLIYSGTLPSATSSSITRGILPNMNESIAPTNRHKTVLFDRTSGALLNQEKLFLLEHSISSGQDVILIND----------NDINSVHCANQKYRPMTSVKVR 3774
            +LE+SW+SL  F+KS  GR+S+D  GD LD+Y+ Q+++ Q  +   + E     +F+IPELP GKE+V+NI STWGD HYVGL GIE+F+S G  V V  ISA+PPDIN+L  YG DPRV  NL+DG+N+T DD+HMWLAPFT   NHFI I FE+   +A++RIWNYNKSRIHS RGAKDVE+ L+G+ IFKGEIARA  C  +    E FG+ ILFT D++IL+ +  ND+ +     + D   D    + P    +E ++       RP T        R   +   Q  +  +P      + +  E  +     ++LN   TWGD+ Y+GLTGLE VG +G+A+ + M+ I  N + L        D R ++ + +GTN+T +DEHMWL P+   EDH +TV     + + ++RIWNYNKS ED+YRG +ILH  ++ K +S   G+ +R+ PG+  +DF+QEI                   ++ V   E   +Y    +PCGF+YQ + LS+W D YYVGLNG+E YD     I +    + AYPDSVN+L        SN DVRTPDKL+DG+ND+ D +HMWLAPILP  +NRIF +FD P  +SMIK+WNYSKTP+RGVKDF++LVDDLL+Y+G +      S+ RGILP  +    P   H T+LF  T    + Q +   +    ++ QD+ L ND           +  S    NQ  RP TSV  R
Sbjct: 1104 SLEESWTSLDLFSKSHKGRISVDFEGDALDEYL-QLEKKQPFEPTIQEETGIEEDFMIPELPFGKELVINIKSTWGDKHYVGLNGIEIFSSKGVPVPVAKISANPPDINVLNDYGKDPRVAANLVDGINRTRDDIHMWLAPFTKGGNHFIYITFEEPCKVAMVRIWNYNKSRIHSYRGAKDVEMMLDGSFIFKGEIARA--CGGVMGGTEAFGDTILFTVDEEILEAVSLNDEAYEAEAFSEDEMEDDVPFERPKTADEENQD-------RPFTCA---VGTRGRGKIETQDVSTVQPQDDHSHISYEGELVVYTGQCLQLNFTSTWGDHHYLGLTGLEVVGKDGEALPITMNMIDANPRDLHVLPGYETDDRTLDKLIDGTNITMSDEHMWLVPYTEGEDHLVTVDFGQPTAMVALRIWNYNKSAEDTYRGAQILHCTLDGKVISPPSGHLVRKGPGNCFFDFMQEIPFSRQPEEVTFPMLDGKMRQSKVVTEEPSQEYEAVQMPCGFIYQLHFLSTWGDPYYVGLNGLEFYDAAGNKIDLVENNIAAYPDSVNALD-----GVSN-DVRTPDKLIDGVNDTTDGRHMWLAPILPSLMNRIFVIFDEPRTISMIKLWNYSKTPTRGVKDFALLVDDLLVYNGQI--GPVQSVARGILPTCD---LPQPYH-TILF--TDDKHIAQRERHTVIKKQAADQDIQLTNDMTVVSHFNNPKEATSQKTVNQALRPTTSVSNR 1815          

HSP 2 Score: 111.309 bits (277), Expect = 1.097e-20
Identity = 72/236 (30.51%), Postives = 113/236 (47.88%), Query Frame = 1
Query:  763 NEKRLKAIVDRVLKMNFNQQQKLLSTLDKIE---------------------------------------------------TVYETDIESE--VDLELTIESNWGHPSRVGLTEVEFWDSNKQRIMI----MNVESNERVEGKLNNIINDKKDTAKEKNMWSTNFTNARPITICFMLSTQSVADVQF----IGIWNFNKSLDSLSIGVQKFSLRHSGKVICSGIVNKALGNQVFN 1287
            +E++L  ++ +VL+M   QQ+KLL  L KIE                                                    V    ++SE  V+L L + SNWGHPSR+GLTE++ +DS   RI +    + V   +  +G L+N+ N +  T KE+NMWS +F   +P+ I   +     +  +F    + IWN+NKSL+ LS+GV+   +    ++I SG ++K  GNQVF+
Sbjct:  511 SEEKLTKVLKKVLQMEGKQQKKLLKALSKIEDTASAENSPRLSSEAMSKPNSQDVAGVEEQAISHSFDKKRGGSMKRQVAIDRVSPNPVQSEDIVELHLVLLSNWGHPSRIGLTEIQAFDSEGNRIDLTCGDVQVYGAKDCKGDLDNLFNGRFKTTKERNMWSCSFVPEKPVEITLNVKRGKDSSKEFGISKLRIWNYNKSLNELSVGVKAMQVFLGAELIFSGDIDKGCGNQVFD 746          

HSP 3 Score: 66.2402 bits (160), Expect = 6.361e-7
Identity = 49/162 (30.25%), Postives = 79/162 (48.77%), Query Frame = 1
Query: 1888 EMVMNILSTWGDPHYVGLTGIEMFASTGERVTVRNISADPPDINILTGYGTD--PRVVTNLLDGVNKTHDDVHMWLAPFTASQNHFIKIEFE------KEIDLALLRIWNYNKSRIHSSRGAKDVEIKLNGTVIFKGEIARAFHCS-EIEEFGEVILFTSDD 2346
            E+ + +LS WG P  +GLT I+ F S G R+ +        D+ +   YG       + NL +G  KT  + +MW   F   +   I +  +      KE  ++ LRIWNYNKS    S G K +++ L   +IF G+I +   C  ++ ++ + I+   DD
Sbjct:  606 ELHLVLLSNWGHPSRIGLTEIQAFDSEGNRIDLTCG-----DVQV---YGAKDCKGDLDNLFNGRFKTTKERNMWSCSFVPEKPVEITLNVKRGKDSSKEFGISKLRIWNYNKSLNELSVGVKAMQVFLGAELIFSGDIDKG--CGNQVFDYSKTIILREDD 757          
BLAST of Protein KIAA0556 homolog vs. Ensembl Cavefish
Match: ENSAMXT00000040513.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001130.1:316220:341185:-1 gene:ENSAMXG00000037951.1 transcript:ENSAMXT00000040513.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 271.166 bits (692), Expect = 1.163e-74
Identity = 156/385 (40.52%), Postives = 223/385 (57.92%), Query Frame = 1
Query: 1696 KSENLEKSWSSLKFFNKSQAGRLS-LDHTGDILDKYV-----------------DQIKRNQKLDXXXXXXXXFVIPELPRGKEMVMNILSTWGDPHYVGLTGIEMFASTGERVTVRNISADPPDINILTGYGTDPRVVTNLLDGVNKTHDDVHMWLAPFTASQNHFIKIEFEKEIDLALLRIWNYNKSRIHSSRGAKDVEIKLNGTVIFKGEIARAFH--CSEIEEFGEVILFTSDDQILDRIGQNDQEFVDSGHNNDASTDG------QSPVGQSDETKELLDSLAMRPPTA------KQSPTNERKTDETNKQSTNLYRPFTSTRPVRFCEEKQIIKVKLNLADTWGDNFYIGLTGLEFVGDNGDAISVDMDNISTNTQALRD 2754
            + + L +SW SL  FN+SQ GR+S +   GDI D+++                 D +  + + D     +E+F IP LP+G+ ++++ILSTWGD HYVGL GIE+++S+GE  +  +++ADPPDIN+L  YG DPRVV+NL DGVN+T DD+H+WLAPFT  + H I ++    + LA++RIWNYNKSRIHS RG ++VE+ L+G  IF+GEIA+A       +++FG+ ILFT+DD IL+ + + D  F   G N + +  G      Q P     E +E       RP T       K  P  E   D    QS  LYR  T               ++L L  TWGD+ Y+GLTGLE VG  G++I VD+  ++ + + L D
Sbjct:  716 QDDTLMQSWDSLTKFNQSQRGRISNMSLEGDIFDEFLQRQSRRPAAVPSDPAASDPVTSDPEDDPRDPPDEDFEIPVLPQGRHLLISILSTWGDRHYVGLNGIEIYSSSGEPASPVSVTADPPDINVLPAYGRDPRVVSNLTDGVNRTQDDMHLWLAPFTPGRKHLISLDLGSTLRLAMIRIWNYNKSRIHSFRGVREVEMMLDGRCIFRGEIAKASGTLTGGLDQFGDTILFTTDDDILEAMSRFDDTF---GGNVEGAEPGLEEEELQRPRTADGEGEE-------RPFTQAGFRELKLEPVVEVSAD-PELQSCGLYRGRT---------------LRLGLFSTWGDSHYLGLTGLEVVGKEGESIPVDVSMVTASPRDLND 1074          

HSP 2 Score: 96.2857 bits (238), Expect = 1.323e-19
Identity = 59/156 (37.82%), Postives = 84/156 (53.85%), Query Frame = 1
Query: 3100 LPCGFVYQFNILSSWNDLYYVGLNGIEIYDQHCQSISISPQQVYAYPDSVNSLTPKNQRTFSNLDVRTPDKLVDGINDSYDAKHMWLAPILPGCLNRIFFVFDRPVCVSMIKIWNYSKT---PSRGVKDFSILVDDLLIYSGTLPSATSSSITRGI 3558
            LP G     +ILS+W D +YVGLNGIEIY    +  S  P  V A P  +N L P   R     D R    L DG+N + D  H+WLAP  PG  + I       + ++MI+IWNY+K+     RGV++  +++D   I+ G +  A S ++T G+
Sbjct:  793 LPQGRHLLISILSTWGDRHYVGLNGIEIYSSSGEPAS--PVSVTADPPDINVL-PAYGR-----DPRVVSNLTDGVNRTQDDMHLWLAPFTPGRKHLISLDLGSTLRLAMIRIWNYNKSRIHSFRGVREVEMMLDGRCIFRGEIAKA-SGTLTGGL 939          

HSP 3 Score: 92.4337 bits (228), Expect = 1.972e-18
Identity = 56/205 (27.32%), Postives = 107/205 (52.20%), Query Frame = 1
Query:  772 RLKAIVDRVLKMNFNQQQKLLSTLDKIE---TVYET----------------DIESEVDLELTIESNWGHPSRVGLTEVEFWDSNKQRIMI----MNVESNERVEGKLNNIINDKKDTAKEKNMWSTNFTNARPITICFMLSTQSVA---DVQFIGIWNFNKSLDSLSIGVQKFSLRHSGKVICSGIVNKALGNQVFNPPTVLEI 1308
            R+   + R+  M  +QQ++LL  L++IE   +V+ +                ++ S +   + I SNWG+P RVGLTEV+F+    +R+ +    +++ + ++  G L  ++N K  T KE+NMW+  F    P+ +  ++     +    +  I IWN+N+SL+ L +G +   +  +  ++  G + K  GNQVF+  T +++
Sbjct:  214 RVTKAMQRITLMEPSQQKRLLKALERIEAESSVFHSRVSSSPPAWQRRAAVSEVTSTLYFTMEILSNWGNPGRVGLTEVQFFCRRNRRLYVSPHDLDIRNTDQ-PGNLAALVNGKTKTTKERNMWACTFHA--PVQLYVVVRNAERSPDFSISRIKIWNYNRSLNDLDVGARDVRVYLNSTLVYEGQLQKGCGNQVFDYSTTIDL 415          

HSP 4 Score: 80.1073 bits (196), Expect = 1.391e-14
Identity = 45/121 (37.19%), Postives = 70/121 (57.85%), Query Frame = 1
Query: 2623 LNLADTWGDNFYIGLTGLEFVGDNGDA---ISVDMDNISTNT-QALRDDVRRVENIFNGTNLTTNDEHMWLAPFNSNEDHCLTVXXXXXXXXXXXXXWNYNKSLEDSYRGVKILHVWINDK 2973
            +++  TWGD  Y+GL G+E    +G+    +SV  D    N   A   D R V N+ +G N T +D H+WLAPF     H +++ + S  R++ IRIWNYNKS   S+RGV+ + + ++ +
Sbjct:  801 ISILSTWGDRHYVGLNGIEIYSSSGEPASPVSVTADPPDINVLPAYGRDPRVVSNLTDGVNRTQDDMHLWLAPFTPGRKHLISLDLGSTLRLAMIRIWNYNKSRIHSFRGVREVEMMLDGR 921          

HSP 5 Score: 73.1738 bits (178), Expect = 1.540e-12
Identity = 43/137 (31.39%), Postives = 72/137 (52.55%), Query Frame = 1
Query: 1891 MVMNILSTWGDPHYVGLTGIEMFASTGERVTVRNISADPPDINILTGYGTD-PRVVTNLLDGVNKTHDDVHMWLAPFTASQNHFIKI---EFEKEIDLALLRIWNYNKSRIHSSRGAKDVEIKLNGTVIFKGEIARA 2289
              M ILS WG+P  VGLT ++ F     R+ V      P D++I     TD P  +  L++G  KT  + +MW   F A    ++ +   E   +  ++ ++IWNYN+S      GA+DV + LN T++++G++ + 
Sbjct:  273 FTMEILSNWGNPGRVGLTEVQFFCRRNRRLYV-----SPHDLDI---RNTDQPGNLAALVNGKTKTTKERNMWACTFHAPVQLYVVVRNAERSPDFSISRIKIWNYNRSLNDLDVGARDVRVYLNSTLVYEGQLQKG 401          
BLAST of Protein KIAA0556 homolog vs. Ensembl Cavefish
Match: ENSAMXT00000032102.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001130.1:319344:341862:-1 gene:ENSAMXG00000037951.1 transcript:ENSAMXT00000032102.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 271.552 bits (693), Expect = 1.462e-74
Identity = 156/385 (40.52%), Postives = 223/385 (57.92%), Query Frame = 1
Query: 1696 KSENLEKSWSSLKFFNKSQAGRLS-LDHTGDILDKYV-----------------DQIKRNQKLDXXXXXXXXFVIPELPRGKEMVMNILSTWGDPHYVGLTGIEMFASTGERVTVRNISADPPDINILTGYGTDPRVVTNLLDGVNKTHDDVHMWLAPFTASQNHFIKIEFEKEIDLALLRIWNYNKSRIHSSRGAKDVEIKLNGTVIFKGEIARAFH--CSEIEEFGEVILFTSDDQILDRIGQNDQEFVDSGHNNDASTDG------QSPVGQSDETKELLDSLAMRPPTA------KQSPTNERKTDETNKQSTNLYRPFTSTRPVRFCEEKQIIKVKLNLADTWGDNFYIGLTGLEFVGDNGDAISVDMDNISTNTQALRD 2754
            + + L +SW SL  FN+SQ GR+S +   GDI D+++                 D +  + + D     +E+F IP LP+G+ ++++ILSTWGD HYVGL GIE+++S+GE  +  +++ADPPDIN+L  YG DPRVV+NL DGVN+T DD+H+WLAPFT  + H I ++    + LA++RIWNYNKSRIHS RG ++VE+ L+G  IF+GEIA+A       +++FG+ ILFT+DD IL+ + + D  F   G N + +  G      Q P     E +E       RP T       K  P  E   D    QS  LYR  T               ++L L  TWGD+ Y+GLTGLE VG  G++I VD+  ++ + + L D
Sbjct:  745 QDDTLMQSWDSLTKFNQSQRGRISNMSLEGDIFDEFLQRQSRRPAAVPSDPAASDPVTSDPEDDPRDPPDEDFEIPVLPQGRHLLISILSTWGDRHYVGLNGIEIYSSSGEPASPVSVTADPPDINVLPAYGRDPRVVSNLTDGVNRTQDDMHLWLAPFTPGRKHLISLDLGSTLRLAMIRIWNYNKSRIHSFRGVREVEMMLDGRCIFRGEIAKASGTLTGGLDQFGDTILFTTDDDILEAMSRFDDTF---GGNVEGAEPGLEEEELQRPRTADGEGEE-------RPFTQAGFRELKLEPVVEVSAD-PELQSCGLYRGRT---------------LRLGLFSTWGDSHYLGLTGLEVVGKEGESIPVDVSMVTASPRDLND 1103          

HSP 2 Score: 96.2857 bits (238), Expect = 1.278e-19
Identity = 59/156 (37.82%), Postives = 84/156 (53.85%), Query Frame = 1
Query: 3100 LPCGFVYQFNILSSWNDLYYVGLNGIEIYDQHCQSISISPQQVYAYPDSVNSLTPKNQRTFSNLDVRTPDKLVDGINDSYDAKHMWLAPILPGCLNRIFFVFDRPVCVSMIKIWNYSKT---PSRGVKDFSILVDDLLIYSGTLPSATSSSITRGI 3558
            LP G     +ILS+W D +YVGLNGIEIY    +  S  P  V A P  +N L P   R     D R    L DG+N + D  H+WLAP  PG  + I       + ++MI+IWNY+K+     RGV++  +++D   I+ G +  A S ++T G+
Sbjct:  822 LPQGRHLLISILSTWGDRHYVGLNGIEIYSSSGEPAS--PVSVTADPPDINVL-PAYGR-----DPRVVSNLTDGVNRTQDDMHLWLAPFTPGRKHLISLDLGSTLRLAMIRIWNYNKSRIHSFRGVREVEMMLDGRCIFRGEIAKA-SGTLTGGL 968          

HSP 3 Score: 92.4337 bits (228), Expect = 1.968e-18
Identity = 58/205 (28.29%), Postives = 107/205 (52.20%), Query Frame = 1
Query:  772 RLKAIVDRVLKMNFNQQQKLLSTLDKIE---TVYETDIESEVD--------------LELTIE--SNWGHPSRVGLTEVEFWDSNKQRIMI----MNVESNERVEGKLNNIINDKKDTAKEKNMWSTNFTNARPITICFMLSTQSVA---DVQFIGIWNFNKSLDSLSIGVQKFSLRHSGKVICSGIVNKALGNQVFNPPTVLEI 1308
            R+   + R+  M  +QQ++LL  L++IE   +V+ + + S                 L  T+E  SNWG+P RVGLTEV+F+    +R+ +    +++ + ++  G L  ++N K  T KE+NMW+  F    P+ +  ++     +    +  I IWN+N+SL+ L +G +   +  +  ++  G + K  GNQVF+  T +++
Sbjct:  243 RVTKAMQRITLMEPSQQKRLLKALERIEAESSVFHSRVSSSPPAWQRRAAVSEVTSTLYFTMEILSNWGNPGRVGLTEVQFFCRRNRRLYVSPHDLDIRNTDQ-PGNLAALVNGKTKTTKERNMWACTFHA--PVQLYVVVRNAERSPDFSISRIKIWNYNRSLNDLDVGARDVRVYLNSTLVYEGQLQKGCGNQVFDYSTTIDL 444          

HSP 4 Score: 79.7221 bits (195), Expect = 1.520e-14
Identity = 45/121 (37.19%), Postives = 70/121 (57.85%), Query Frame = 1
Query: 2623 LNLADTWGDNFYIGLTGLEFVGDNGDA---ISVDMDNISTNT-QALRDDVRRVENIFNGTNLTTNDEHMWLAPFNSNEDHCLTVXXXXXXXXXXXXXWNYNKSLEDSYRGVKILHVWINDK 2973
            +++  TWGD  Y+GL G+E    +G+    +SV  D    N   A   D R V N+ +G N T +D H+WLAPF     H +++ + S  R++ IRIWNYNKS   S+RGV+ + + ++ +
Sbjct:  830 ISILSTWGDRHYVGLNGIEIYSSSGEPASPVSVTADPPDINVLPAYGRDPRVVSNLTDGVNRTQDDMHLWLAPFTPGRKHLISLDLGSTLRLAMIRIWNYNKSRIHSFRGVREVEMMLDGR 950          

HSP 5 Score: 73.1738 bits (178), Expect = 1.530e-12
Identity = 43/137 (31.39%), Postives = 72/137 (52.55%), Query Frame = 1
Query: 1891 MVMNILSTWGDPHYVGLTGIEMFASTGERVTVRNISADPPDINILTGYGTD-PRVVTNLLDGVNKTHDDVHMWLAPFTASQNHFIKI---EFEKEIDLALLRIWNYNKSRIHSSRGAKDVEIKLNGTVIFKGEIARA 2289
              M ILS WG+P  VGLT ++ F     R+ V      P D++I     TD P  +  L++G  KT  + +MW   F A    ++ +   E   +  ++ ++IWNYN+S      GA+DV + LN T++++G++ + 
Sbjct:  302 FTMEILSNWGNPGRVGLTEVQFFCRRNRRLYV-----SPHDLDI---RNTDQPGNLAALVNGKTKTTKERNMWACTFHAPVQLYVVVRNAERSPDFSISRIKIWNYNRSLNDLDVGARDVRVYLNSTLVYEGQLQKG 430          
BLAST of Protein KIAA0556 homolog vs. Ensembl Cavefish
Match: si:dkey-161j23.7 (si:dkey-161j23.7 [Source:ZFIN;Acc:ZDB-GENE-091204-391])

HSP 1 Score: 228.409 bits (581), Expect = 3.687e-67
Identity = 114/255 (44.71%), Postives = 165/255 (64.71%), Query Frame = 1
Query: 2803 NDEHMWLAPFNSNEDHCLTVXXXXXXXXXXXXXWNYNKSLEDSYRGVKILHVWINDKRVSSDEGYFIRRAPGHVQYDFVQEIHIKTNVALP---------------------EALIQYNH--LPCGFVYQFNILSSWNDLYYVGLNGIEIYDQHCQSISISPQQVYAYPDSVNSLTPKNQRTFSNLDVRTPDKLVDGINDSYDAKHMWLAPILPGCLNRIFFVFDRPVCVSMIKIWNYSKTPSRGVKDFSILVDD 3498
            +DEHMWL PF+   DH LT+    +  I+ +RIWNYNKS EDSYRG++ L V ++   +S  +G+ IR+ PG+  +DF QEI     +  P                     +A ++Y    +PCG ++Q  +L++W D YY+GLNG+E+YDQ+ Q I+++ + + A+PDSVN L           DVRTPDKL+DG+N ++D +HMWLAP+LPG +NR++ +FD+P+ VSMIK+WNYSKTP RGVK+F   V+D
Sbjct:    1 DDEHMWLIPFSPGSDHTLTIDFSQSQTIAGLRIWNYNKSPEDSYRGLQTLRVCVDGVCISPPDGFLIRKGPGNCHFDFAQEILFMDYLQSPTSTTGGSRNSQDSHVVSRTEEQASMEYEAPLMPCG-IFQLQLLTTWGDPYYIGLNGLELYDQNDQKITLT-ENIAAFPDSVNVLDSVCG------DVRTPDKLIDGVNSTHDGRHMWLAPVLPGLVNRVYVIFDQPMTVSMIKLWNYSKTPQRGVKEFGNHVED 247          

HSP 2 Score: 95.9005 bits (237), Expect = 2.785e-21
Identity = 45/127 (35.43%), Postives = 78/127 (61.42%), Query Frame = 1
Query: 1858 FVIPELPRGKEMVMNILSTWGDPHYVGLTGIEMFASTGERVTV-RNISADPPDINILTGYGTDPRVVTNLLDGVNKTHDDVHMWLAPFTASQNHFIKIEFEKEIDLALLRIWNYNKSRIHSSRGAKD 2235
            +  P +P G    + +L+TWGDP+Y+GL G+E++    +++T+  NI+A P  +N+L     D R    L+DGVN THD  HMWLAP      + + + F++ + ++++++WNY+K+     RG K+
Sbjct:  118 YEAPLMPCGI-FQLQLLTTWGDPYYIGLNGLELYDQNDQKITLTENIAAFPDSVNVLDSVCGDVRTPDKLIDGVNSTHDGRHMWLAPVLPGLVNRVYVIFDQPMTVSMIKLWNYSKT---PQRGVKE 240          

HSP 3 Score: 93.5893 bits (231), Expect = 2.229e-20
Identity = 86/305 (28.20%), Postives = 133/305 (43.61%), Query Frame = 1
Query: 2089 DDVHMWLAPFTASQNHFIKIEFEKEIDLALLRIWNYNKSRIHSSRGAKDVEIKLNGTVIFK--GEIARAFHCSEIEEFGEVILFTSDDQILDRIGQNDQEFVDSGHNNDASTDGQSPVGQSDETKELLDSLAMRPPTAKQSPTNERKTDETNKQSTNLYRPFTSTRPVRFCEEKQIIKVKLNLADTWGDNFYIGLTGLEFVGDNGDAISVDMDNISTNTQALR------DDVRRVENIFNGTNLTTNDEHMWLAPFNSNEDHCLTVXXXXXXXXXXXXXWNYNKSLEDSYRGVKILHVWINDKRV 2979
            DD HMWL PF+   +H + I+F +   +A LRIWNYNKS   S RG + + + ++G  I    G + R    +   +F + ILF      +D +                    QSP   +  ++   DS  +                 T +Q++  Y       P+  C   Q     L L  TWGD +YIGL GLE    N   I++  +NI+    ++        DVR  + + +G N T +  HMWLAP      + + V  +    +S I++WNY+K+ +   RGVK     + D+ V
Sbjct:    1 DDEHMWLIPFSPGSDHTLTIDFSQSQTIAGLRIWNYNKSPEDSYRGLQTLRVCVDGVCISPPDGFLIRKGPGNCHFDFAQEILF------MDYL--------------------QSPTSTTGGSRNSQDSHVVS---------------RTEEQASMEYE-----APLMPCGIFQ-----LQLLTTWGDPYYIGLNGLELYDQNDQKITL-TENIAAFPDSVNVLDSVCGDVRTPDKLIDGVNSTHDGRHMWLAPVLPGLVNRVYVIFDQPMTVSMIKLWNYSKTPQ---RGVKEFGNHVEDQDV 250          
BLAST of Protein KIAA0556 homolog vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005658.1 (pep scaffold:Pmarinus_7.0:GL480087:32655:43207:1 gene:ENSPMAG00000005122.1 transcript:ENSPMAT00000005658.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 523.472 bits (1347), Expect = 1.560e-171
Identity = 291/674 (43.18%), Postives = 406/674 (60.24%), Query Frame = 1
Query: 1858 FVIPELPRGKEMVMNILSTWGDPHYVGLTGIEMFASTGERVTVRNISADPPDINILTGYGTDPRVVTNLLDGVNKTHDDVHMWLAPFTASQNHFIKIEFEKEIDLALLRIWNYNKSRIHSSRGAKDVEIKLNGTVIFKGEIARAFHC--SEIEEFGEVILFTSDDQILDRIGQNDQEFVDSGHNNDASTDGQSPVGQSDETKELLDSLAMRPPTAK-QSPTNERKTDETNKQSTNLYRPFTSTRPVRFCEEKQIIKVKLNLADTWGDNFYIGLTGLEFVGDNGDAISVDMDNISTNTQALR------DDVRRVENIFNGTNLTTNDEHMWLAPFNSNEDHCLTVXXXXXXXXXXXXXWNYNKSLEDSYRGVKILHVWINDKRVSSDEGYFIRRAPGHVQYDFVQEI--------------HIKTNVALPE-ALIQYNH--LPCGFVYQFNILSSWNDLYYVGLNGIEIYDQHCQSISI--SPQQVYAYPDSVNSLTPKNQRTFSNLDVRTPDKLVDGINDSYDAKHMWLAPILPGCLNRIFFVFDRPVCVSMIKIWNYSKTPSRGVKDFSILVDDLLIYSGTLPSATSSSITRGILPNMNESIAPTNRHKTVLFDRTSGALLNQEKLFLLEHSISSGQDVILINDNDI----NSVHCANQKYRPMTSVKVRAMV 3783
            F IPELP G+ +V+NI STWGD HYVGL G+E+F STG    V  I A+P D+N+L GYG DPRVV+NLLD VN++ DD HMWLAPFT   +H + +E  +   LA+LR+WNYNKSR+H SRGA+ + I L+G  +F+GEIARA      ++E+FG+ ILFT DD IL+ +  +D  F  +  + +    G S  G  +E        A RP TA   SP  E   D     + ++ RP  +TR   F     +I +KL+ + TWGD  Y+GLTGLE +G +G  I + +  +    + L       DD R ++ + +G N+TT+DEHMWL PF   E H LTV +  +  ++ +R+WNYNKS ED+YRG K +HV ++ K VS  EG+ +R+ PG+  +DF+QE+              H     A+ E A + Y    +PCGF++QF +LSSW D YY+GLN ++ Y++    I++  + Q + AYPDSVN L   +       DVRTPDKLVDG+ D  D +  WLAP+LPG +NR++ +FD P  VSMIK+WNYSKTP RGVK+F +LVDDLL+Y+G L + + ++  RGILP       PT  H T+LF   S  +L +E+  +L +     Q+V L+NDN I          +Q  RP T +  R + 
Sbjct:    1 FEIPELPYGRRLVINIRSTWGDGHYVGLNGLEVFTSTGAPAKVARIWAEPADVNVLPGYGNDPRVVSNLLDNVNRSRDDAHMWLAPFTVGGDHLVTLELAEPCHLAMLRVWNYNKSRVHVSRGARHLHIALDGREVFRGEIARASGTLMRDLEQFGDTILFTMDDSILEAMAAHDVTFTAASPDANGPATGVSGEGPGEE--------AERPRTAHVDSP--EDVPDSPCVPNPSVERP--TTRAGLFF--LMLIGLKLSFSATWGDPHYLGLTGLEVMGPDGVTIPLQLAMLDAKPRDLNDLPEYTDDNRTLDKLIDGVNVTTSDEHMWLIPFAVGESHTLTVTLPRSQPLAGLRLWNYNKSAEDTYRGAKTVHVTVDGKAVSPPEGFLVRKGPGNCHFDFMQEVLFADEAQTRLTMNRHKDQRAAVMERASMDYEAPLMPCGFLFQFQLLSSWGDPYYIGLNSLQFYNEEGDPIALTRTRQDIAAYPDSVNVLDRVSG------DVRTPDKLVDGVTDGGDGRQAWLAPVLPGLVNRVYVMFDCPTTVSMIKLWNYSKTPQRGVKEFGLLVDDLLVYNGVLDAVSQAA--RGILPTCT---GPTPYH-TILFT-DSADVLRRERHTVLRNRAEE-QEVSLLNDNRILQSSKKTSSVDQALRPKTCLIERKVA 646          
BLAST of Protein KIAA0556 homolog vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006733.1 (pep scaffold:Pmarinus_7.0:GL479302:506917:529460:-1 gene:ENSPMAG00000006070.1 transcript:ENSPMAT00000006733.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 481.1 bits (1237), Expect = 4.662e-155
Identity = 264/680 (38.82%), Postives = 383/680 (56.32%), Query Frame = 1
Query: 1858 FVIPELPRGKEMVMNILSTWGDPHYVGLTGIEMFASTGERVTVRNISADPPDINILTGYGTDPRVVTNLLDGVNKTHDDVHMWLAPFTASQNHFIKIEFEKEIDLALLRIWNYNKSRIHSSRGAKDVEIKLNGTVIFKGEIARAFHC--SEIEEFGEVILFTSDDQILDRIGQNDQEFVDSGHNNDASTDGQSPVGQSDETKELLDSLAMRPPTAKQSPTNER-KTDETNKQSTNLYRPFTSTRPVRFCEEKQIIKVKLNLADTWGDNFYIGLTGLEFVGDNGDAISVDMDNIST------NTQALRDDVRR------VENIFNGTNLTTNDEHMWLAPFNSNEDHCLTVXXXXXXXXXXXXXWNYNKSLEDSYRGVKILHVWINDKRVSSDEGYFIRRAPGHVQYDFVQEI--------------------HIKTNVALPEALIQYNHLPCGFVYQFNILSSWNDLYYVGLNGIEIYDQHCQSISISPQQVYAYPDSVNSLTPKNQRTFSNLDVRTPDKLVDGINDSYDAKHMWLAPILPGCLNRIFFVFDRPVCVSMIKIWNYSKTPSRGVKDFSILVDDLLIYSGTLPSATSSSITRGIL----PNMNESIAPTNRHKTVLFDRTSGALLNQEKLFLLEHSISSGQDVILINDNDINS-VHCANQKYRPMTSVKVRA 3777
            F IP LPRG+ +++NI STWGD HYVGL GIE+FA TGE V +  + A+P DIN+L  YG DPRV  NL+DGV +T DD H+W APFT    H + + F +   +A++R+WNYNKSRIH+ RGA+ ++I L+G ++F GEIA+A       +E+FG+ ILFT+DD IL+ + ++DQ F +     ++  D  +    SD   +       RP T    P+ E+ K    +   +       S   +  C     + ++LN+  TWGD    GLTGLE VG +GDA+ V    +S        + A   + R       ++ + +G N+TT  EHMW  PF     H L + +  A  I+ +R WNYN+S ED+ +GV+ +HV ++ + VS  EG  +R+ PG+  +DF QEI                     I   +  P    +   +PCGF++Q  +L+SW D YY+GLNG+EIYD   + I ++   + A+PDSVN L           DVRTPDKL+DG+ND+++ +HMWLAPILPG +NR++ +FD P  VSM+K+WNYSKTP+RGVK+F +LVDDLL+Y+GTL  A+ +S  RG      P  + S  P +   TVLF      +  + +              +  +  ++   V   +Q  RPMT + VR 
Sbjct:    1 FDIPVLPRGQHLLINICSTWGDRHYVGLNGIEVFADTGEPVPIAEVLANPADINVLPEYGRDPRVAANLVDGVYRTQDDGHLW-APFTPGAAHLVHLAFAEPCRVAMIRVWNYNKSRIHA-RGARHLDISLDGVLVFSGEIAKASGTLRGGVEQFGDTILFTTDDSILEAMARHDQTFQEEWKEEESREDLPNRPRTSDRDAD------ERPITCAALPSCEQQKVPRLDVXPSTAVTWGASPARLSLCGG---LGLQLNVTHTWGDELQFGLTGLEVVGASGDALPVSAGMLSAPSASAPGSPATAAEARHESPSSGLDRLLDGENVTTCAEHMWCLPFTPGRSHLLVITLARAHTITGLRFWNYNRSPEDTSKGVRTVHVALDGRVVSPPEGILLRKGPGNCHFDFAQEIIFREFAPGSAQARAQQTSCRQIHKTIEQPSMAYEAPAMPCGFIFQLQLLTSWGDPYYIGLNGLEIYDAEGELIPLTENHMTAFPDSVNVLEGVCG------DVRTPDKLIDGVNDTHNGRHMWLAPILPGVVNRVYIIFDHPTSVSMLKLWNYSKTPTRGVKEFGVLVDDLLVYNGTLEQASGAS-RRGSPYRGSPRPSRSPVPCH---TVLFTDEPSPVTRERRAVPDAEEEDDDDIQLFDSGRELRQRVKPVDQALRPMTCIAVRG 659          
BLAST of Protein KIAA0556 homolog vs. Ensembl Nematostella
Match: EDO47948 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKQ8])

HSP 1 Score: 443.351 bits (1139), Expect = 6.827e-141
Identity = 269/649 (41.45%), Postives = 369/649 (56.86%), Query Frame = 1
Query: 1864 IPELPRGKEMVMNILSTWGDPHYVGLTGIEMFASTGERVTVRNISADPPDINILTGYGTDPRVVTNLLDGVNKTH-DDVHMWLAPFTASQNHFIKIEFEKEIDLALLRIWNYNKSRIHSSRGAKDVEIKLNGTVIFKGEIARAFHCSEIEE-FGE---VILFTSDDQILDRIGQNDQ--EFVDSGHNNDASTDGQSPVGQSDETKELLDSLAMRPPTAKQSPTNERKTDETNKQSTNLYRPFTSTRPVRFCEEKQIIKVKLNLADTWGDNFYIGLTGLEFVGDNGDAISVDMDNISTNTQALRD------DVRRVENIFNGTNLTTNDEHMWLAPFNSNEDHCLTVXXXXXXXXXXXXXWNYNKSLEDSYRGVKILHVWINDKRVSSDEGYFIRRAPGHVQYDFVQEIHIKTNVALPEALIQYNH------------------LPCGFVYQFNILSSWNDLYYVGLNGIEIYDQHCQSISISPQQVYAYPDSVNSLTPKNQRTFSNLDVRTPDKLVDGINDSYDAKHMWLAPILPGCLNRIFFVFDRPVCVSMIKIWNYSKTPSRGVKDFSILVDDLLIYSGTLPSATSSSITRGILPNMNESIAPTNRHKTVLFDRTSGALLNQEKLFLLEHSISSGQDVILINDNDI 3717
            IP LP GK++V+N+ STWGD HYVGL GIE+F   G    + +I ADPPDIN+L  YG DPRVVTNL+DGV +T    + +W+ P T   +    +       +A++RIWNYNKSRIHS RGA+DVE  L+G++IF+GEIARA      +E FG+      FT   Q   +  ++++   F++ G +    +   SP   S +  ++ +             T + K          LY      R  +     +I  V+LN A TWGD +Y+GLTGLE +      I +++D +  N + L D      D R ++ I +GTN+TT+DEHMWL PF   EDH LT+ +   + +  +R+WNYNKSL+ ++RG KI+HV ++ K +S  EGY +R+ PG+V +DF Q+++     +    L++ N                   +P GFV+QF +LSSW D YYVGLNGIE YD     I +    V AYP SVN L           DVRTPDKLVDG+ND+ D KHMWLAP  PG +N I+ +FD P  VSMIK+WNYSKTP RG   F ILVDDLL+Y G LP    +   RGILPN++  +     H TVLF  +   +   E+  L++ +    QDV L NDN +
Sbjct:   18 IPTLPLGKKLVVNLKSTWGDRHYVGLNGIEVFTDEGRPAEIADILADPPDINVLPEYGNDPRVVTNLIDGVYRTSIAMIRIWIRP-TLQYSDDTDVGKTHTSVIAMIRIWNYNKSRIHSYRGARDVEFSLDGSLIFQGEIARASGTLGADEPFGDDKGERPFTCARQRKQKQAEHEEVDAFIEQGLHCTQVSMAMSPYADSADEADICNGYY----------TGQGK----------LYH-----REPKIIFRSRIPLVQLNFASTWGDPYYLGLTGLELLTPQMVPIPLNIDMLQANPRDLNDLPDYGDDDRTLDKIVDGTNVTTSDEHMWLIPFTDGEDHTLTIDLGLKTELLGMRVWNYNKSLDGTFRGAKIVHVSLDGKLISPPEGYLLRKGPGNVHFDFAQDVYFSGRTSTGGILVRPNRSQSRVNIRKLIPDYEPALMPTGFVFQFQLLSSWGDPYYVGLNGIEFYDSEGYRIRLRASDVTAYPHSVNVLDGVTD------DVRTPDKLVDGVNDTMDGKHMWLAPTFPGQINLIYVIFDEPKTVSMIKMWNYSKTPIRGAHQFGILVDDLLVYHGFLPQVPRTG-CRGILPNLDMQVP----HHTVLFTDSPENVAISERGNLVKQT-ELEQDVQLTNDNTV 628          
BLAST of Protein KIAA0556 homolog vs. Ensembl Medaka
Match: ENSORLT00000010238.2 (KIAA0556 ortholog [Source:NCBI gene;Acc:101168746])

HSP 1 Score: 553.132 bits (1424), Expect = 1.989e-171
Identity = 313/751 (41.68%), Postives = 462/751 (61.52%), Query Frame = 1
Query: 1693 NKSENLEKSWSSLKFFNKSQAGRLS-LDHTGDILDKYVDQIKR----------------------NQKL-------DXXXXXXXXFVIPELPRGKEMVMNILSTWGDPHYVGLTGIEMFASTGERVTVRNISADPPDINILTGYGTDPRVVTNLLDGVNKTHDDVHMWLAPFTASQNHFIKIEFEKEIDLALLRIWNYNKSRIHSSRGAKDVEIKLNGTVIFKGEIARAFH--CSEIEEFGEVILFTSDDQILDRIGQNDQEFVD--SGHNNDASTDG-QSPVGQSDETKELLDSLAMRPPTAKQSPTNERKTDETNKQSTNL----YRPFTSTRPVRFCEEKQIIKVKLNLADTWGDNFYIGLTGLEFVGDNGDAISVDMDNISTNTQALRD------DVRRVENIFNGTNLTTNDEHMWLAPFNSNEDHCLTVXXXXXXXXXXXXXWNYNKSLEDSYRGVKILHVWINDKRVSSDEGYFIRRAPGHVQYDFVQEIHIKTNVALPE------------------ALIQYNH--LPCGFVYQFNILSSWNDLYYVGLNGIEIYDQHCQSISISPQQVYAYPDSVNSLTPKNQRTFSNL--DVRTPDKLVDGINDSYDAKHMWLAPILPGCLNRIFFVFDRPVCVSMIKIWNYSKTPSRGVKDFSILVDDLLIYSGTLPSATSSSITRGILPNMNESIAPTNRHKTVLFDRTSGALLNQEKLFLLEHSISSGQDVILINDNDINSVHCANQK 3744
            ++ + L +SW SL  FN+ Q GR+S +   GDILD+++ Q KR                      +Q L       D   E E+EF IP LP+G+++V+NILSTWGD HYVGL GIE+F+S+G+ +   +I A+PPDINIL  YG DPRVVTNL+DGVN+T DD+H+WLAPFT  +NH I ++F     +A++RIWNYNKSRIHS RG ++VE+ L+G  IF+ EIA+A    C E+++FG+ ILFT+DD+IL+ + + D+ F+    GH + AS +  Q P     E +E       RP T        R+ D   K    L    Y       P  +    + ++V+L +  TWGD+ Y+GLTGLE VG +GD++ +D+  ++ + + L D      D+R ++ + +G N+TT+DEHMWL PF+  E H L++       I+ +RIWNYNKS EDSYRGVK++H++++D  +S  EG+ IR+ PG+  +DF QEI     +  P                   A + Y    +PCGF++Q  +L++W D YY+GLNG+E YDQ+ + I++S   + A+PDSVN L         N+  DVRTP+KL+DG+N+++D +HMWLAP+LPG +NR++ +FD+PV VSMIK+WNYSKTP RGVK+F +LVDDLL+Y+G L   +  +  +GILP  +    P   + T+LF   +  + ++E+  ++ + +   QDV + N+N I  VH + +K
Sbjct:  881 HQDDTLRESWDSLIKFNQCQRGRISNMSFEGDILDEFL-QYKRLDTPTVQNNLSTAPRSPLTSLTSQGLTSEVSEDDPSVEREDEFEIPVLPQGQKLVINILSTWGDRHYVGLNGIEVFSSSGKPLRPVHIHANPPDINILPAYGKDPRVVTNLIDGVNRTQDDMHLWLAPFTPGRNHSIFMDFGGVCQIAMIRIWNYNKSRIHSFRGVREVEMLLDGRCIFREEIAKASGTLCGELDQFGDTILFTTDDEILEAMSRYDETFLGEFEGHQSLASEEELQRPRTADGEGEE-------RPFTQ----AGFREEDLCLKHPLKLPLSNYEENVEHIPGMYT--GKCLRVELVM--TWGDSHYVGLTGLEIVGKSGDSLPLDLGMMAASPRDLNDLEEYENDLRTLDKLIDGHNVTTDDEHMWLIPFSYGEPHILSITFTKPQVIAGLRIWNYNKSPEDSYRGVKVVHLFLDDVAISPVEGFLIRKGPGNCHFDFAQEILFINFLQTPTDNKKNKESHRVSSKKQELASMDYEAPIMPCGFIFQLQLLTTWGDPYYIGLNGLEFYDQNHEKINLSENNIAAFPDSVNVL--------DNISGDVRTPEKLIDGVNNTHDGRHMWLAPVLPGLVNRVYIIFDQPVTVSMIKLWNYSKTPQRGVKEFGLLVDDLLVYNGILECVSPRA--QGILPTCD----PVVPYHTILFTDDT-YIAHRERNTVISNHVED-QDVKMTNENQI--VHHSKKK 1597          

HSP 2 Score: 88.1965 bits (217), Expect = 4.440e-17
Identity = 75/283 (26.50%), Postives = 127/283 (44.88%), Query Frame = 1
Query:  577 EISLQVNKKPTTSEKELNK-QMKINKSKHLEEKCLENMEDEDTKIVTLELKMDADLVDINDTDNEKRLKAIVDRVLKMNFNQQQKLLSTLDKIE------------------TVYETDIESEVDLELTIE--SNWGHPSRVGLTEVEFWDSNKQRIMI----MNVESNERVEGKLNNIINDKKDTAKEKNMWSTNFTNARPITICFMLSTQSVA---DVQFIGIWNFNKSLDSLSIGVQKFSLRHSGKVICSGIVNKALGNQVFNPPTVLEIGSGIVNSKSIS 1341
            E SL   +K +  E++  + +  + ++   E   ++N E     +      MD    DI    +E  +   + R+  M   QQQ LL  L+K+E                  T  ++  E    L +T+E  SNWG+  +VGLTEV+F+    ++I +    ++V  N    G L  ++N K  T KE+ MW+  F    PI + F++     +    +  I IWN+N+SL  L IG +   L  +  ++  G + K  G+QVF+  T + +    +   S S
Sbjct:  340 ERSLSATRKASVEERDSEETRYMVCQAIQKENASIQNAELFSHGMTRGHQMMDGLKPDIKHDKDENNVTVAMQRITLMAPRQQQTLLKALEKLEAGPSHNISHNVRTDHSKQTRGQSPAEVTPALYVTMEILSNWGNLLQVGLTEVQFFCRRNKKIYVSPHDLDVR-NADFPGNLGALVNGKMKTTKERYMWTCPFHP--PIQLYFIIRNMERSLDFGISCIKIWNYNRSLKDLDIGARHVKLYLNSTLVFEGELEKGCGSQVFDYSTTINLQDSQIPESSFS 619          

HSP 3 Score: 71.633 bits (174), Expect = 5.065e-12
Identity = 55/180 (30.56%), Postives = 91/180 (50.56%), Query Frame = 1
Query: 1891 MVMNILSTWGDPHYVGLTGIEMFASTGERVTVRNISADPPDINILTGYGTDPRVVTNLLDGVNKTHDDVHMWLAPFTAS-QNHFIKIEFEKEIDLAL--LRIWNYNKSRIHSSRGAKDVEIKLNGTVIFKGEIARAFHC-SEIEEFGEVILFTSDDQILDRIGQNDQEFVDSGHNNDAST 2418
            + M ILS WG+   VGLT ++ F    +++ V      P D+++       P  +  L++G  KT  + +MW  PF    Q +FI    E+ +D  +  ++IWNYN+S      GA+ V++ LN T++F+GE+ +   C S++ ++   I    D QI +         V SGHN   +T
Sbjct:  466 VTMEILSNWGNLLQVGLTEVQFFCRRNKKIYV-----SPHDLDVRNA--DFPGNLGALVNGKMKTTKERYMWTCPFHPPIQLYFIIRNMERSLDFGISCIKIWNYNRSLKDLDIGARHVKLYLNSTLVFEGELEKG--CGSQVFDYSTTINL-QDSQIPESSFSTP---VCSGHNLRGAT 632          
BLAST of Protein KIAA0556 homolog vs. Ensembl Medaka
Match: ENSORLT00000010234.2 (KIAA0556 ortholog [Source:NCBI gene;Acc:101168746])

HSP 1 Score: 552.747 bits (1423), Expect = 3.278e-171
Identity = 317/758 (41.82%), Postives = 460/758 (60.69%), Query Frame = 1
Query: 1693 NKSENLEKSWSSLKFFNKSQAGRLS-LDHTGDILDKYVDQIKR----------------------NQKL-------DXXXXXXXXFVIPELPRGKEMVMNILSTWGDPHYVGLTGIEMFASTGERVTVRNISADPPDINILTGYGTDPRVVTNLLDGVNKTHDDVHMWLAPFTASQNHFIKIEFEKEIDLALLRIWNYNKSRIHSSRGAKDVEIKLNGTVIFKGEIARAFH--CSEIEEFGEVILFTSDDQILDRIGQNDQEFVD--SGHNNDASTDG-QSPVGQSDETKELLDSLAMRPPTAKQSPTNERKTDETNKQSTNL----YRPFTSTRPVRFCEEKQIIKVKLNLADTWGDNFYIGLTGLEFVGDNGDAISVDMDNISTNTQALRD------DVRRVENIFNGTNLTTNDEHMWLAPFNSNEDHCLTVXXXXXXXXXXXXXWNYNKSLEDSYRGVKILHVWINDKRVSSDEGYFIRRAPGHVQYDFVQEIHIKTNVALPE------------------ALIQYNH--LPCGFVYQFNILSSWNDLYYVGLNGIEIYDQHCQSISISPQQVYAYPDSVNSLTPKNQRTFSNL--DVRTPDKLVDGINDSYDAKHMWLAPILPGCLNRIFFVFDRPVCVSMIKIWNYSKTPSRGVKDFSILVDDLLIYSGTLPSATSSSITRGILPNMNESIAPTNRHKTVLF-DRTSGALLNQEKLFLL------EHSISSGQDVILINDNDINSVHCANQK 3744
            ++ + L +SW SL  FN+ Q GR+S +   GDILD+++ Q KR                      +Q L       D   E E+EF IP LP+G+++V+NILSTWGD HYVGL GIE+F+S+G+ +   +I A+PPDINIL  YG DPRVVTNL+DGVN+T DD+H+WLAPFT  +NH I ++F     +A++RIWNYNKSRIHS RG ++VE+ L+G  IF+ EIA+A    C E+++FG+ ILFT+DD+IL+ + + D+ F+    GH + AS +  Q P     E +E       RP T        R+ D   K    L    Y       P  +    + ++V+L +  TWGD+ Y+GLTGLE VG +GD++ +D+  ++ + + L D      D+R ++ + +G N+TT+DEHMWL PF+  E H L++       I+ +RIWNYNKS EDSYRGVK++H++++D  +S  EG+ IR+ PG+  +DF QEI     +  P                   A + Y    +PCGF++Q  +L++W D YY+GLNG+E YDQ+ + I++S   + A+PDSVN L         N+  DVRTP+KL+DG+N+++D +HMWLAP+LPG +NR++ +FD+PV VSMIK+WNYSKTP RGVK+F +LVDDLL+Y+G L   +  +  +GILP  +    P   + T+LF D T  A   +  +  L       H+    QDV + N+N I  VH + +K
Sbjct:  881 HQDDTLRESWDSLIKFNQCQRGRISNMSFEGDILDEFL-QYKRLDTPTVQNNLSTAPRSPLTSLTSQGLTSEVSEDDPSVEREDEFEIPVLPQGQKLVINILSTWGDRHYVGLNGIEVFSSSGKPLRPVHIHANPPDINILPAYGKDPRVVTNLIDGVNRTQDDMHLWLAPFTPGRNHSIFMDFGGVCQIAMIRIWNYNKSRIHSFRGVREVEMLLDGRCIFREEIAKASGTLCGELDQFGDTILFTTDDEILEAMSRYDETFLGEFEGHQSLASEEELQRPRTADGEGEE-------RPFTQ----AGFREEDLCLKHPLKLPLSNYEENVEHIPGMYT--GKCLRVELVM--TWGDSHYVGLTGLEIVGKSGDSLPLDLGMMAASPRDLNDLEEYENDLRTLDKLIDGHNVTTDDEHMWLIPFSYGEPHILSITFTKPQVIAGLRIWNYNKSPEDSYRGVKVVHLFLDDVAISPVEGFLIRKGPGNCHFDFAQEILFINFLQTPTDNKKNKESHRVSSKKQELASMDYEAPIMPCGFIFQLQLLTTWGDPYYIGLNGLEFYDQNHEKINLSENNIAAFPDSVNVL--------DNISGDVRTPEKLIDGVNNTHDGRHMWLAPVLPGLVNRVYIIFDQPVTVSMIKLWNYSKTPQRGVKEFGLLVDDLLVYNGILECVSPRA--QGILPTCD----PVVPYHTILFTDDTYIAHRERNTVISLRGSRHHRHNHVEDQDVKMTNENQI--VHHSKKK 1606          

HSP 2 Score: 88.5817 bits (218), Expect = 3.885e-17
Identity = 75/283 (26.50%), Postives = 127/283 (44.88%), Query Frame = 1
Query:  577 EISLQVNKKPTTSEKELNK-QMKINKSKHLEEKCLENMEDEDTKIVTLELKMDADLVDINDTDNEKRLKAIVDRVLKMNFNQQQKLLSTLDKIE------------------TVYETDIESEVDLELTIE--SNWGHPSRVGLTEVEFWDSNKQRIMI----MNVESNERVEGKLNNIINDKKDTAKEKNMWSTNFTNARPITICFMLSTQSVA---DVQFIGIWNFNKSLDSLSIGVQKFSLRHSGKVICSGIVNKALGNQVFNPPTVLEIGSGIVNSKSIS 1341
            E SL   +K +  E++  + +  + ++   E   ++N E     +      MD    DI    +E  +   + R+  M   QQQ LL  L+K+E                  T  ++  E    L +T+E  SNWG+  +VGLTEV+F+    ++I +    ++V  N    G L  ++N K  T KE+ MW+  F    PI + F++     +    +  I IWN+N+SL  L IG +   L  +  ++  G + K  G+QVF+  T + +    +   S S
Sbjct:  340 ERSLSATRKASVEERDSEETRYMVCQAIQKENASIQNAELFSHGMTRGHQMMDGLKPDIKHDKDENNVTVAMQRITLMAPRQQQTLLKALEKLEAGPSHNISHNVRTDHSKQTRGQSPAEVTPALYVTMEILSNWGNLLQVGLTEVQFFCRRNKKIYVSPHDLDVR-NADFPGNLGALVNGKMKTTKERYMWTCPFHP--PIQLYFIIRNMERSLDFGISCIKIWNYNRSLKDLDIGARHVKLYLNSTLVFEGELEKGCGSQVFDYSTTINLQDSQIPESSFS 619          

HSP 3 Score: 71.633 bits (174), Expect = 5.245e-12
Identity = 43/136 (31.62%), Postives = 73/136 (53.68%), Query Frame = 1
Query: 1891 MVMNILSTWGDPHYVGLTGIEMFASTGERVTVRNISADPPDINILTGYGTDPRVVTNLLDGVNKTHDDVHMWLAPFTAS-QNHFIKIEFEKEIDLAL--LRIWNYNKSRIHSSRGAKDVEIKLNGTVIFKGEIARA 2289
            + M ILS WG+   VGLT ++ F    +++ V      P D+++       P  +  L++G  KT  + +MW  PF    Q +FI    E+ +D  +  ++IWNYN+S      GA+ V++ LN T++F+GE+ + 
Sbjct:  466 VTMEILSNWGNLLQVGLTEVQFFCRRNKKIYV-----SPHDLDVRNA--DFPGNLGALVNGKMKTTKERYMWTCPFHPPIQLYFIIRNMERSLDFGISCIKIWNYNRSLKDLDIGARHVKLYLNSTLVFEGELEKG 594          
BLAST of Protein KIAA0556 homolog vs. Planmine SMEST
Match: SMESG000009541.1 (SMESG000009541.1)

HSP 1 Score: 2417.88 bits (6265), Expect = 0.000e+0
Identity = 1243/1255 (99.04%), Postives = 1247/1255 (99.36%), Query Frame = 1
Query:   22 MDDSLLNESLNQPLKYPVEKIPNRYQNYLTNSKLRNQKLQEIIKKQNLKRNKVGKLEEGFTLYFNGANDKKDFTTAIAPRKSKTCEERGKAFTERAKSGIERSKWGSATKVGFLTERGDKMFVRPNNYYXXXXXXXXXXXXXXXNEFEFDKNNFNGFSMELSLNEMRCLRESLIINSNINLEAKNEISLQVNKKPTTSEKELNKQMKINKSKHLEEKCLENMEDEDTKIVTLELKMDADLVDINDTDNEKRLKAIVDRVLKMNFNQQQKLLSTLDKIETVYETDIESEVDLELTIESNWGHPSRVGLTEVEFWDSNKQRIMIMNVESNERVEGKLNNIINDKKDTAKEKNMWSTNFTNARPITICFMLSTQSVADVQFIGIWNFNKSLDSLSIGVQKFSLRHSGKVICSGIVNKALGNQVFNPPTVLEIGSGIVNSKSISXXXXXXXXXXXXXXCLMEKLRNAQNLTFRMGMSERKLEDKLEEMVTTERKPENKLEMKLEGISNNLLMEESEKCNSNRKESARFGRRSELDECSGRDQLKELIXXXXXXXXXXXXXKNKSENLEKSWSSLKFFNKSQAGRLSLDHTGDILDKYVDQIKRNQKLDXXXXXXXXFVIPELPRGKEMVMNILSTWGDPHYVGLTGIEMFASTGERVTVRNISADPPDINILTGYGTDPRVVTNLLDGVNKTHDDVHMWLAPFTASQNHFIKIEFEKEIDLALLRIWNYNKSRIHSSRGAKDVEIKLNGTVIFKGEIARAFHCSEIEEFGEVILFTSDDQILDRIGQNDQEFVDSGHNNDASTDGQSPVGQSDETKELLDSLAMRPPTAKQSPTNERKTDETNKQSTNLYRPFTSTRPVRFCEEKQIIKVKLNLADTWGDNFYIGLTGLEFVGDNGDAISVDMDNISTNTQALRDDVRRVENIFNGTNLTTNDEHMWLAPFNSNEDHCLTVXXXXXXXXXXXXXWNYNKSLEDSYRGVKILHVWINDKRVSSDEGYFIRRAPGHVQYDFVQEIHIKTNVALPEALIQYNHLPCGFVYQFNILSSWNDLYYVGLNGIEIYDQHCQSISISPQQVYAYPDSVNSLTPKNQRTFSNLDVRTPDKLVDGINDSYDAKHMWLAPILPGCLNRIFFVFDRPVCVSMIKIWNYSKTPSRGVKDFSILVDDLLIYSGTLPSATSSSITRGILPNMNESIAPTNRHKTVLFDRTSGALLNQEKLFLLEHSISSGQDVILINDNDINSVHCANQKYRPMTSVKVRAMVK 3786
            MDDSLLNESLNQPLKYPVEKIPNRYQNYLTNSKLRNQKLQEIIKKQNLKRNKVGKLEEGFTLYFNGANDKKDF TAIAPRKSKTCEERGKAFTERAKSGIERSKWGSATKVGFLTERGDKMFVRPNNYYSDDFEEFEDVIDESVNEFEFDKNNFNGFSMELSLNEMRCLRESLIINSNINLEAKNEISLQVNKK TTSEKELNKQMKINKSK LEEKCLENMEDEDTKIVTLELKMDADLVDINDTDNEKRLKAIVDRVLKMNFNQQQKLLSTLDKIETVYETDIESEVDLELTIESNWGHPSRVGLTEVEFWDSNKQRIMIMNVESNERVEGKLNNIINDKKDTAKEKNMWSTNFT+ARPITICFMLSTQSVADVQFIGIWNFNKSLDSLSIGVQKFSLR+SGKVICSGIVNKALGNQVFNPPTVLEIGSGIVNSKSIS NVEEDLTDEDDDECLMEKLRNAQNLTFRMGMSERKLEDKLEEMVT ERKPENKLEMKLEGISNNLLMEESEKCNSNRKESARFGRRSELDECSGRDQLKELIAEFETTTTSAFETKNKSENLEKSWSSLKFFNKSQAGRLSLD+TGDILDKYVDQIKRNQKLDEEQEIEEEFVIPELPRGKEMVMNILSTWGDPHYVGLTGIEMFASTGERVTVRNISADPPDINIL GYGTDPRVVTNLLDGVNKTHDDVHMWLAPFTASQNHFIKIEFEKEIDLALLRIWNYNKSRIHSSRGAKDVEIKLNGTVIFKGEIARAFHCSEIEEFGEVILFTSDDQILDRIGQNDQEFVDSGHNNDASTDGQSPVGQSDETKELLDSLAMRPPTAKQSPTNERKTDETNKQSTNLYRPFTSTRPVRFCEEKQIIKVKLNLADTWGDNFYIGLTGLEFVGDNGDAISVDMDNISTNTQALRDDVRRVENIFNGTNLTTNDEHMWLAPFNSNEDHCLTVAIESASRISSIRIWNYNKSLEDSYRGVKILH+WINDKRVSSDEGYFIRRAPGHVQYDFVQEIHIKTNVALPE LIQYNHLPCGFVYQFNILSSWNDLYYVGLNGIEIYDQHCQSISISPQQVYAYPDSVNSLTPKNQRTFSNLDVRTPDKLVDGINDSYDAKHMWLAPILPGCLNRIFFVFDRPVCVSMIKIWNYSKTPSRGVKDFSILVDDLLIYSGTLPSATSSSITRGILPNMNESIAPTNRHKTVLFDRTSGALLNQEKLFLLEHSISSGQDVILINDNDINSVHCANQKYRPMTSVK RAMVK
Sbjct:    1 MDDSLLNESLNQPLKYPVEKIPNRYQNYLTNSKLRNQKLQEIIKKQNLKRNKVGKLEEGFTLYFNGANDKKDFITAIAPRKSKTCEERGKAFTERAKSGIERSKWGSATKVGFLTERGDKMFVRPNNYYSDDFEEFEDVIDESVNEFEFDKNNFNGFSMELSLNEMRCLRESLIINSNINLEAKNEISLQVNKKQTTSEKELNKQMKINKSKQLEEKCLENMEDEDTKIVTLELKMDADLVDINDTDNEKRLKAIVDRVLKMNFNQQQKLLSTLDKIETVYETDIESEVDLELTIESNWGHPSRVGLTEVEFWDSNKQRIMIMNVESNERVEGKLNNIINDKKDTAKEKNMWSTNFTSARPITICFMLSTQSVADVQFIGIWNFNKSLDSLSIGVQKFSLRYSGKVICSGIVNKALGNQVFNPPTVLEIGSGIVNSKSISVNVEEDLTDEDDDECLMEKLRNAQNLTFRMGMSERKLEDKLEEMVT-ERKPENKLEMKLEGISNNLLMEESEKCNSNRKESARFGRRSELDECSGRDQLKELIAEFETTTTSAFETKNKSENLEKSWSSLKFFNKSQAGRLSLDYTGDILDKYVDQIKRNQKLDEEQEIEEEFVIPELPRGKEMVMNILSTWGDPHYVGLTGIEMFASTGERVTVRNISADPPDINILAGYGTDPRVVTNLLDGVNKTHDDVHMWLAPFTASQNHFIKIEFEKEIDLALLRIWNYNKSRIHSSRGAKDVEIKLNGTVIFKGEIARAFHCSEIEEFGEVILFTSDDQILDRIGQNDQEFVDSGHNNDASTDGQSPVGQSDETKELLDSLAMRPPTAKQSPTNERKTDETNKQSTNLYRPFTSTRPVRFCEEKQIIKVKLNLADTWGDNFYIGLTGLEFVGDNGDAISVDMDNISTNTQALRDDVRRVENIFNGTNLTTNDEHMWLAPFNSNEDHCLTVAIESASRISSIRIWNYNKSLEDSYRGVKILHLWINDKRVSSDEGYFIRRAPGHVQYDFVQEIHIKTNVALPEDLIQYNHLPCGFVYQFNILSSWNDLYYVGLNGIEIYDQHCQSISISPQQVYAYPDSVNSLTPKNQRTFSNLDVRTPDKLVDGINDSYDAKHMWLAPILPGCLNRIFFVFDRPVCVSMIKIWNYSKTPSRGVKDFSILVDDLLIYSGTLPSATSSSITRGILPNMNESIAPTNRHKTVLFDRTSGALLNQEKLFLLEHSISSGQDVILINDNDINSVHCANQKYRPMTSVKGRAMVK 1254          
The following BLAST results are available for this feature:
BLAST of Protein KIAA0556 homolog vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
KIAA05567.744e-17342.65KIAA0556 [Source:HGNC Symbol;Acc:HGNC:29068][more]
back to top
BLAST of Protein KIAA0556 homolog vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
K04F10.21.975e-8834.14pep chromosome:WBcel235:I:6360844:6364172:1 gene:W... [more]
back to top
BLAST of Protein KIAA0556 homolog vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein KIAA0556 homolog vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
si:dkey-161j23.79.907e-8142.00si:dkey-161j23.7 [Source:ZFIN;Acc:ZDB-GENE-091204-... [more]
si:dkey-161j23.62.491e-6747.06si:dkey-161j23.6 [Source:ZFIN;Acc:ZDB-GENE-091204-... [more]
back to top
BLAST of Protein KIAA0556 homolog vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tfip111.119e-16637.50tuftelin interacting protein 11 [Source:Xenbase;Ac... [more]
tfip115.315e-16640.24tuftelin interacting protein 11 [Source:Xenbase;Ac... [more]
tfip112.675e-16541.01tuftelin interacting protein 11 [Source:Xenbase;Ac... [more]
tfip113.540e-16541.01tuftelin interacting protein 11 [Source:Xenbase;Ac... [more]
tfip111.643e-11735.71tuftelin interacting protein 11 [Source:Xenbase;Ac... [more]
back to top
BLAST of Protein KIAA0556 homolog vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
D430042O09Rik1.935e-17142.18RIKEN cDNA D430042O09 gene [Source:MGI Symbol;Acc:... [more]
D430042O09Rik2.222e-17142.18RIKEN cDNA D430042O09 gene [Source:MGI Symbol;Acc:... [more]
D430042O09Rik7.966e-5540.61RIKEN cDNA D430042O09 gene [Source:MGI Symbol;Acc:... [more]
back to top
BLAST of Protein KIAA0556 homolog vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 4
Match NameE-valueIdentityDescription
sp|O60303|K0556_HUMAN3.719e-17242.65Protein KIAA0556 OS=Homo sapiens OX=9606 GN=KIAA05... [more]
sp|Q8C753|K0556_MOUSE1.648e-16842.18Protein KIAA0556 OS=Mus musculus OX=10090 GN=Kiaa0... [more]
sp|Q5XK85|K0556_XENLA4.869e-11540.44Protein KIAA0556 homolog OS=Xenopus laevis OX=8355... [more]
sp|O44770|K0556_CAEEL2.512e-8734.14Protein KIAA0556 homolog OS=Caenorhabditis elegans... [more]
back to top
BLAST of Protein KIAA0556 homolog vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2T7PZP81.144e-1646.21Uncharacterized protein OS=Pomacea canaliculata OX... [more]
A0A1S3H6N01.111e-2043.98protein KIAA0556 isoform X6 OS=Lingula unguis OX=7... [more]
A0A1S3H5501.097e-2043.98protein KIAA0556 isoform X4 OS=Lingula unguis OX=7... [more]
A0A1S3H4S71.242e-2043.98protein KIAA0556 isoform X5 OS=Lingula unguis OX=7... [more]
A0A1S3H7N81.097e-2043.98protein KIAA0556 isoform X3 OS=Lingula unguis OX=7... [more]
back to top
BLAST of Protein KIAA0556 homolog vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSAMXT00000040513.11.163e-7440.52pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000032102.11.462e-7440.52pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
si:dkey-161j23.73.687e-6744.71si:dkey-161j23.7 [Source:ZFIN;Acc:ZDB-GENE-091204-... [more]
back to top
BLAST of Protein KIAA0556 homolog vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000005658.11.560e-17143.18pep scaffold:Pmarinus_7.0:GL480087:32655:43207:1 g... [more]
ENSPMAT00000006733.14.662e-15538.82pep scaffold:Pmarinus_7.0:GL479302:506917:529460:-... [more]
back to top
BLAST of Protein KIAA0556 homolog vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein KIAA0556 homolog vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO479486.827e-14141.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein KIAA0556 homolog vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSORLT00000010238.21.989e-17141.68KIAA0556 ortholog [Source:NCBI gene;Acc:101168746][more]
ENSORLT00000010234.23.278e-17141.82KIAA0556 ortholog [Source:NCBI gene;Acc:101168746][more]
back to top
BLAST of Protein KIAA0556 homolog vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000009541.10.000e+099.04SMESG000009541.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30028292 ID=SMED30028292|Name=Protein KIAA0556 homolog|organism=Schmidtea mediterranea sexual|type=transcript|length=3919bp
TATATAAATCTTATATGATTAATGGATGACTCTTTATTAAATGAATCTCT
GAACCAACCTCTGAAATATCCAGTTGAGAAAATACCGAACAGATATCAGA
ATTATTTAACAAATAGTAAACTACGTAATCAAAAATTACAAGAAATAATT
AAAAAGCAAAATCTTAAACGTAATAAAGTTGGGAAATTAGAGGAAGGGTT
TACTTTATATTTCAATGGCGCAAATGATAAGAAAGATTTTACCACAGCAA
TAGCTCCCCGAAAATCTAAAACGTGTGAAGAACGGGGAAAAGCTTTTACT
GAACGAGCCAAGTCTGGTATTGAGCGTTCTAAATGGGGTTCAGCGACAAA
AGTCGGATTCTTAACAGAAAGAGGGGATAAGATGTTTGTTAGACCAAACA
ATTACTATTCAGATGATTTCGAGGAATTTGAAGATGTTATCGATGAATCT
GTTAATGAATTCGAGTTTGATAAAAATAATTTCAATGGATTTTCAATGGA
ATTGTCGTTGAACGAAATGAGGTGCCTAAGAGAAAGTTTAATCATAAATA
GCAATATAAATCTTGAAGCGAAAAATGAAATTTCTTTACAAGTCAATAAG
AAACCGACAACATCTGAAAAGGAATTAAATAAACAAATGAAAATAAACAA
AAGCAAACACTTAGAAGAAAAGTGTTTAGAAAATATGGAAGATGAAGATA
CAAAAATTGTGACATTAGAATTGAAAATGGATGCTGATTTGGTCGACATA
AATGATACAGATAACGAGAAACGACTTAAAGCGATCGTCGATCGAGTTTT
GAAAATGAATTTCAATCAACAACAAAAGTTGTTGAGTACTCTGGATAAAA
TCGAAACCGTCTACGAAACTGACATTGAAAGTGAAGTCGACCTCGAATTA
ACTATTGAGAGTAATTGGGGCCATCCGTCTCGTGTCGGATTGACAGAGGT
TGAATTCTGGGACTCCAATAAACAACGAATAATGATTATGAACGTCGAAT
CAAATGAACGAGTTGAGGGAAAACTGAATAACATAATCAATGACAAAAAA
GACACTGCAAAAGAGAAAAATATGTGGTCTACCAATTTTACCAATGCACG
TCCGATAACTATCTGTTTTATGTTGTCAACTCAATCTGTTGCTGATGTCC
AGTTCATTGGGATTTGGAATTTCAACAAATCACTCGATTCTTTATCAATT
GGCGTTCAGAAATTCTCACTGAGACATTCTGGCAAAGTTATTTGTTCGGG
AATCGTCAATAAAGCACTTGGAAATCAGGTTTTCAATCCACCGACAGTAT
TGGAAATCGGCTCGGGAATCGTCAATAGCAAAAGTATCAGTGAGAACGTT
GAGGAGGACTTGACGGATGAAGATGACGATGAATGTCTAATGGAGAAGCT
GAGGAATGCCCAGAATTTGACATTTAGAATGGGAATGTCAGAAAGGAAAT
TAGAGGATAAACTCGAAGAAATGGTAACAACAGAAAGGAAGCCAGAGAAT
AAGTTGGAAATGAAATTAGAGGGAATAAGCAATAATTTATTGATGGAGGA
GAGTGAAAAATGCAATTCAAATCGAAAAGAAAGTGCGAGATTTGGTCGCA
GGTCGGAATTGGACGAATGCAGTGGAAGAGATCAATTGAAAGAATTGATT
GCCGAATTCGAAACCACAACGACATCAGCATTTGAAACTAAGAATAAATC
AGAAAATCTAGAGAAATCTTGGTCGTCGTTGAAATTTTTCAACAAATCCC
AAGCGGGTCGATTATCATTGGACCATACTGGAGACATTCTGGACAAATAT
GTTGATCAGATCAAAAGAAATCAGAAATTAGATGAAGAGCAGGAGATAGA
GGAGGAATTTGTGATCCCGGAATTGCCGAGAGGAAAGGAAATGGTCATGA
ACATCCTATCGACATGGGGTGATCCTCATTATGTAGGGCTGACGGGAATT
GAAATGTTCGCATCAACTGGGGAACGAGTGACAGTCAGAAACATCTCAGC
CGATCCTCCTGATATCAATATCTTGACCGGATATGGCACTGATCCCAGAG
TCGTGACGAATCTGCTTGACGGTGTTAATAAGACCCACGATGATGTTCAC
ATGTGGTTAGCTCCGTTCACTGCCAGCCAGAATCACTTCATAAAGATTGA
ATTTGAGAAGGAAATCGATTTGGCTCTATTACGAATCTGGAATTATAACA
AATCTCGTATCCATTCATCCAGGGGAGCAAAAGATGTTGAGATCAAATTG
AATGGAACCGTTATATTCAAAGGGGAAATAGCAAGAGCATTCCATTGCAG
TGAGATTGAAGAATTCGGGGAAGTGATTTTGTTTACATCGGATGATCAGA
TATTGGATAGAATCGGTCAGAATGATCAGGAGTTTGTCGACTCGGGTCAT
AATAATGACGCAAGCACCGACGGCCAATCACCAGTTGGCCAGTCTGACGA
GACAAAGGAATTACTAGACAGTCTCGCCATGCGACCACCAACTGCTAAAC
AGTCACCGACAAACGAGAGAAAAACAGACGAAACCAACAAGCAATCCACC
AATCTCTATAGGCCATTCACAAGCACAAGACCGGTTCGATTCTGCGAAGA
AAAACAGATCATTAAGGTTAAATTGAACCTTGCCGACACATGGGGTGACA
ATTTCTATATCGGATTAACAGGACTGGAGTTCGTAGGCGATAACGGAGAT
GCCATCAGCGTCGACATGGATAACATTTCCACCAACACGCAAGCATTGAG
AGATGACGTGAGACGAGTTGAAAATATTTTCAATGGAACGAATTTGACAA
CTAACGATGAACATATGTGGCTCGCTCCATTTAATAGCAATGAGGACCAC
TGCCTGACGGTTGCTATTGAATCTGCATCTAGGATATCTTCCATTCGCAT
TTGGAATTATAATAAATCGCTGGAAGATTCTTATAGAGGCGTTAAGATCC
TTCATGTATGGATTAATGATAAACGAGTTTCCTCGGATGAAGGATATTTC
ATTCGTCGAGCACCTGGGCATGTTCAATATGATTTTGTTCAGGAAATACA
CATTAAAACCAACGTGGCGCTTCCTGAAGCTCTTATTCAATATAACCATT
TACCATGTGGTTTTGTTTATCAATTCAACATTCTCAGTTCTTGGAACGAC
TTGTATTATGTCGGCTTGAATGGTATTGAGATCTATGACCAGCATTGTCA
GAGCATTTCTATCAGCCCTCAACAGGTGTATGCTTACCCAGACTCCGTGA
ATTCTCTCACTCCCAAAAATCAGCGCACATTCAGCAATTTAGATGTGAGG
ACTCCAGATAAGTTGGTAGATGGGATTAATGATTCGTACGATGCCAAGCA
TATGTGGCTAGCACCCATTCTGCCAGGTTGCCTCAACCGAATCTTTTTCG
TGTTTGATCGTCCTGTTTGTGTTTCGATGATAAAGATTTGGAATTACAGC
AAAACTCCGTCTCGAGGAGTCAAGGATTTTTCTATATTAGTTGATGACCT
TCTGATATACAGCGGAACATTGCCATCTGCCACAAGCTCCTCAATAACTC
GAGGAATATTACCAAATATGAATGAATCTATTGCTCCTACAAATCGTCAC
AAAACTGTTTTATTCGATCGAACCAGTGGAGCTTTGTTGAACCAAGAGAA
ACTGTTCCTTCTTGAACACAGCATATCCAGTGGTCAGGATGTGATCCTTA
TCAATGACAATGATATCAACTCAGTTCATTGTGCTAATCAGAAATACCGT
CCAATGACCAGTGTCAAAGTCAGAGCCATGGTCAAATAGACAAATCAATC
ATTGCGAACTTTCTTTTTATGTTCTATTCTACCTGACGCCACCAGATCGC
TCACTTGTACATATCTATACTCTGGACTACTGTCAGACAGCTTTCGTGAT
CCTAATGTAACCATTCTTG
back to top

protein sequence of SMED30028292-orf-1

>SMED30028292-orf-1 ID=SMED30028292-orf-1|Name=SMED30028292-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1256bp
MDDSLLNESLNQPLKYPVEKIPNRYQNYLTNSKLRNQKLQEIIKKQNLKR
NKVGKLEEGFTLYFNGANDKKDFTTAIAPRKSKTCEERGKAFTERAKSGI
ERSKWGSATKVGFLTERGDKMFVRPNNYYSDDFEEFEDVIDESVNEFEFD
KNNFNGFSMELSLNEMRCLRESLIINSNINLEAKNEISLQVNKKPTTSEK
ELNKQMKINKSKHLEEKCLENMEDEDTKIVTLELKMDADLVDINDTDNEK
RLKAIVDRVLKMNFNQQQKLLSTLDKIETVYETDIESEVDLELTIESNWG
HPSRVGLTEVEFWDSNKQRIMIMNVESNERVEGKLNNIINDKKDTAKEKN
MWSTNFTNARPITICFMLSTQSVADVQFIGIWNFNKSLDSLSIGVQKFSL
RHSGKVICSGIVNKALGNQVFNPPTVLEIGSGIVNSKSISENVEEDLTDE
DDDECLMEKLRNAQNLTFRMGMSERKLEDKLEEMVTTERKPENKLEMKLE
GISNNLLMEESEKCNSNRKESARFGRRSELDECSGRDQLKELIAEFETTT
TSAFETKNKSENLEKSWSSLKFFNKSQAGRLSLDHTGDILDKYVDQIKRN
QKLDEEQEIEEEFVIPELPRGKEMVMNILSTWGDPHYVGLTGIEMFASTG
ERVTVRNISADPPDINILTGYGTDPRVVTNLLDGVNKTHDDVHMWLAPFT
ASQNHFIKIEFEKEIDLALLRIWNYNKSRIHSSRGAKDVEIKLNGTVIFK
GEIARAFHCSEIEEFGEVILFTSDDQILDRIGQNDQEFVDSGHNNDASTD
GQSPVGQSDETKELLDSLAMRPPTAKQSPTNERKTDETNKQSTNLYRPFT
STRPVRFCEEKQIIKVKLNLADTWGDNFYIGLTGLEFVGDNGDAISVDMD
NISTNTQALRDDVRRVENIFNGTNLTTNDEHMWLAPFNSNEDHCLTVAIE
SASRISSIRIWNYNKSLEDSYRGVKILHVWINDKRVSSDEGYFIRRAPGH
VQYDFVQEIHIKTNVALPEALIQYNHLPCGFVYQFNILSSWNDLYYVGLN
GIEIYDQHCQSISISPQQVYAYPDSVNSLTPKNQRTFSNLDVRTPDKLVD
GINDSYDAKHMWLAPILPGCLNRIFFVFDRPVCVSMIKIWNYSKTPSRGV
KDFSILVDDLLIYSGTLPSATSSSITRGILPNMNESIAPTNRHKTVLFDR
TSGALLNQEKLFLLEHSISSGQDVILINDNDINSVHCANQKYRPMTSVKV
RAMVK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR026704KIAA0556
IPR027859DUF4457
Vocabulary: cellular component
TermDefinition
GO:0005615extracellular space
GO:0005737cytoplasm
GO:0005856cytoskeleton
GO:0042995cell projection
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 32..52
NoneNo IPR availableCOILSCoilCoilcoord: 329..349
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 817..846
IPR027859Domain of unknown function DUF4457PFAMPF14652DUF4457coord: 596..655
e-value: 6.8E-10
score: 38.7
coord: 868..1169
e-value: 1.6E-109
score: 366.1
coord: 626..807
e-value: 2.0E-40
score: 139.1
coord: 294..424
e-value: 4.2E-13
score: 49.2
IPR026704Protein KIAA0556PANTHERPTHR21534UNCHARACTERIZEDcoord: 180..1252