Innexin

Overview
NameInnexin
Smed IDSMED30028261
Length (bp)1552
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Innexin (SMED30028261) t-SNE clustered cells

Violin plots show distribution of expression levels for Innexin (SMED30028261) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Innexin (SMED30028261) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Innexin (SMED30028261) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30028261

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30028261SMESG000030970.1 dd_Smed_v4_6798_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30028261SMESG000030970.1 dd_Smed_v4_6798_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30028261SMESG000030970.1 dd_Smed_v4_6798_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Category 3 cellSMED30028261SMESG000030970.1 dd_Smed_v4_6798_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30028261SMESG000030970.1 dd_Smed_v4_6798_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Innexin vs. Ensembl Celegans
Match: inx-1 (Innexin [Source:UniProtKB/TrEMBL;Acc:Q17394])

HSP 1 Score: 179.874 bits (455), Expect = 2.251e-51
Identity = 115/386 (29.79%), Postives = 188/386 (48.70%), Query Frame = 2
Query:  212 LVSRFKLFQNGGMEDFSDRLSSKFSCLIFLTLGSVILFKQYWIRPISCYFAVDPGGSNLIQYIESYCYVHGIIPISFNGTMPTKEKDWIAIDKTRTL-YYQWVPFALYGQAVMCYIPHIIWRFFRKRQNNADFNHIIQRANRAIELDDEKRKNEVIHLAQALKNILFQNRTCDSTS---VLRREANRIHSKIIEWIKMGIPLVIYYLVIKILYVTNAVGQIYLMKSFLRLNSSDYKFFGSKILNDIIHGKNWQVSKIFPRVGFCLGKFRHLGATNYVTAQCALPLNMLNEKVYIFLWFWMLILSVISITSLFMWLIRMLISRNKTDFLNMYLKLSGDYTHRXXXXXXXXXXXXXXXXRNDGMFFLRILATNVGDLITAEVVSQLWK 1357
            L + FK       +DF D+L+  ++  I      ++  KQY   PI C+       +   QY E+YC+V     +      P +  D     + R + YYQWVPF L  +A+  YIP I+WR      +  +   + Q A  A  +D + R   V  +A  +++ L   R     S   V +R AN +               + Y+ IK+LY+ N V Q++++ SFL    +D  F+G  IL D+++G+ W+VS  FPRV  C  + R LG  ++ T QC L +NM NEK+++FLWFW  +++ +S  S+F W+I   +      F+  YL+ +   T R+   K             DG+F +R+++ + GD++  E++  LW 
Sbjct:    6 LAAIFKGLHPRVDDDFVDKLNYHYTSAIIFAFAIIVSAKQYVGYPIQCWVPAQFTDA-WEQYTENYCWVENTYYLPLTSAFPLEYGD----RRARQISYYQWVPFVLALEALCFYIPCIMWRGLLHWHSGINVQSLTQMACDARMMDADARAATVQTIAGHMEDALEIQREVTDVSGMCVQKRWANYV--------------TLLYVFIKMLYLGNVVLQVFMLNSFL---GTDNLFYGFHILRDLLNGREWEVSGNFPRVTMCDFEVRVLGNVHHHTVQCVLMINMFNEKIFLFLWFWYFMVAFVSAVSMFHWIIISFLPGQHMKFIRKYLRATDLATDRQSVKKFVHKFLGY-----DGVFCMRMISAHAGDILATELIVALWH 364          
BLAST of Innexin vs. Ensembl Celegans
Match: inx-1 (Innexin [Source:UniProtKB/TrEMBL;Acc:Q17394])

HSP 1 Score: 179.874 bits (455), Expect = 2.251e-51
Identity = 115/386 (29.79%), Postives = 188/386 (48.70%), Query Frame = 2
Query:  212 LVSRFKLFQNGGMEDFSDRLSSKFSCLIFLTLGSVILFKQYWIRPISCYFAVDPGGSNLIQYIESYCYVHGIIPISFNGTMPTKEKDWIAIDKTRTL-YYQWVPFALYGQAVMCYIPHIIWRFFRKRQNNADFNHIIQRANRAIELDDEKRKNEVIHLAQALKNILFQNRTCDSTS---VLRREANRIHSKIIEWIKMGIPLVIYYLVIKILYVTNAVGQIYLMKSFLRLNSSDYKFFGSKILNDIIHGKNWQVSKIFPRVGFCLGKFRHLGATNYVTAQCALPLNMLNEKVYIFLWFWMLILSVISITSLFMWLIRMLISRNKTDFLNMYLKLSGDYTHRXXXXXXXXXXXXXXXXRNDGMFFLRILATNVGDLITAEVVSQLWK 1357
            L + FK       +DF D+L+  ++  I      ++  KQY   PI C+       +   QY E+YC+V     +      P +  D     + R + YYQWVPF L  +A+  YIP I+WR      +  +   + Q A  A  +D + R   V  +A  +++ L   R     S   V +R AN +               + Y+ IK+LY+ N V Q++++ SFL    +D  F+G  IL D+++G+ W+VS  FPRV  C  + R LG  ++ T QC L +NM NEK+++FLWFW  +++ +S  S+F W+I   +      F+  YL+ +   T R+   K             DG+F +R+++ + GD++  E++  LW 
Sbjct:    6 LAAIFKGLHPRVDDDFVDKLNYHYTSAIIFAFAIIVSAKQYVGYPIQCWVPAQFTDA-WEQYTENYCWVENTYYLPLTSAFPLEYGD----RRARQISYYQWVPFVLALEALCFYIPCIMWRGLLHWHSGINVQSLTQMACDARMMDADARAATVQTIAGHMEDALEIQREVTDVSGMCVQKRWANYV--------------TLLYVFIKMLYLGNVVLQVFMLNSFL---GTDNLFYGFHILRDLLNGREWEVSGNFPRVTMCDFEVRVLGNVHHHTVQCVLMINMFNEKIFLFLWFWYFMVAFVSAVSMFHWIIISFLPGQHMKFIRKYLRATDLATDRQSVKKFVHKFLGY-----DGVFCMRMISAHAGDILATELIVALWH 364          
BLAST of Innexin vs. Ensembl Celegans
Match: inx-18 (Innexin [Source:UniProtKB/TrEMBL;Acc:Q8MXG8])

HSP 1 Score: 180.259 bits (456), Expect = 5.337e-51
Identity = 122/420 (29.05%), Postives = 203/420 (48.33%), Query Frame = 2
Query:  212 LVSRFKLFQNGGMEDFSDRLSSKFSCLIFLTLGSVILFKQYWIRPISCYFAVDPGGSNLIQYIESYCYVHGIIPISFNGTMPTKEKDWIAIDKTRTLYYQWVPFALYGQAVMCYIPHIIWRFFRKRQNNADFNHIIQRANRAIELDDEKRKNEVIHLAQALKNILFQNRTCDSTSVLRREANRIHSKIIEWIKMGIPLVIYYLVIKILYVTNAVGQIYLMKSFLRLNSSDYKFFGSKILNDIIHGKNWQVSKIFPRVGFCLGKFRHLGATNYVTAQCALPLNMLNEKVYIFLWFWMLILSVISITSLFMWLIRMLISRNKTDFLNMYLKLSGDYTHRXXXXXXXXXXXXXXXXRNDGMFFLRILATNVGDLITAEVVSQLWKIYA-----PCYENTELDMEKLKKSCNKRGNSCSDGTES 1456
            L S  +  +    +DF DRL   ++  + L    ++  KQY   PI C+       + + QY E+YC+V     + F   +P +  D    ++ +  YYQWVPF L   A+  +IP  +WR     Q+  +   ++Q       +D   R   V  +A+ + + L   R   +    RR +  I +        G  +   Y+ IK L++ N + Q  L+ SFL+  +SDY  FG+ +L D+  G+ W+ S  FPRV  C  + R LG  +  T QC L +NML EK++IFLW W+ +L++++  +L  W I ++ +  +  F++ +L +  D   R          F   FLR DG+F L+++A++ G+L+ A+V  QLW I+      P  E+   D   ++ +      S  DG  S
Sbjct:   12 LASALRFLEPRVDDDFVDRLHYLYTSTMVLMFAVLVSAKQYVGHPIECFVPAQFTRA-MEQYTENYCWVQNTYWVPFQDLIPHRLDD---RERRQIGYYQWVPFVLAVAALTFHIPSSVWRMLAG-QSGLNAGLVLQLVCGDENVDPVVRDKTVDIVARHIDDALMYQRDHGA----RRHSVYIFAIFKLGKFYGAYVSSVYIFIKALHLANVILQFMLLNSFLQ--TSDYPMFGAHVLYDLFMGREWRDSGKFPRVTLCDFEIRVLGNVHRHTVQCVLVINMLTEKIFIFLWLWLTVLAIVTALNLIFWFIALVSNSCREHFVSKHLDIQSDQISR----------FVHRFLRADGVFLLQMIASHSGNLMAAKVTEQLWMIFVRRSGKPVIEDKIEDRGSVRSTNGNDWESHDDGKTS 410          
BLAST of Innexin vs. Ensembl Celegans
Match: inx-1 (Innexin [Source:UniProtKB/TrEMBL;Acc:Q17394])

HSP 1 Score: 179.489 bits (454), Expect = 1.012e-50
Identity = 116/399 (29.07%), Postives = 193/399 (48.37%), Query Frame = 2
Query:  212 LVSRFKLFQNGGMEDFSDRLSSKFSCLIFLTLGSVILFKQYWIRPISCYFAVDPGGSNLIQYIESYCYVHGIIPISFNGTMPTKEKDWIAIDKTRTL-YYQWVPFALYGQAVMCYIPHIIWRFFRKRQNNADFNHIIQRANRAIELDDEKRKNEVIHLAQALKNILFQNRTCDSTS---VLRREANRIHSKIIEWIKMGIPLVIYYLVIKILYVTNAVGQIYLMKSFLRLNSSDYKFFGSKILNDIIHGKNWQVSKIFPRVGFCLGKFRHLGATNYVTAQCALPLNMLNEKVYIFLWFWMLILSVISITSLFMWLIRMLISRNKTDFLNMYLKLSGDYTHRXXXXXXXXXXXXXXXXRNDGMFFLRILATNVGDLITAEVVSQLWKIYAPCYENTELDM 1396
            L + FK       +DF D+L+  ++  I      ++  KQY   PI C+       +   QY E+YC+V     +      P +  D     + R + YYQWVPF L  +A+  YIP I+WR      +  +   + Q A  A  +D + R   V  +A  +++ L   R     S   V +R AN +               + Y+ IK+LY+ N V Q++++ SFL    +D  F+G  IL D+++G+ W+VS  FPRV  C  + R LG  ++ T QC L +NM NEK+++FLWFW  +++ +S  S+F W+I   +      F+  YL+ +   T R+   K             DG+F +R+++ + GD++  E++  LW  +      + ++M
Sbjct:    6 LAAIFKGLHPRVDDDFVDKLNYHYTSAIIFAFAIIVSAKQYVGYPIQCWVPAQFTDA-WEQYTENYCWVENTYYLPLTSAFPLEYGD----RRARQISYYQWVPFVLALEALCFYIPCIMWRGLLHWHSGINVQSLTQMACDARMMDADARAATVQTIAGHMEDALEIQREVTDVSGMCVQKRWANYV--------------TLLYVFIKMLYLGNVVLQVFMLNSFL---GTDNLFYGFHILRDLLNGREWEVSGNFPRVTMCDFEVRVLGNVHHHTVQCVLMINMFNEKIFLFLWFWYFMVAFVSAVSMFHWIIISFLPGQHMKFIRKYLRATDLATDRQSVKKFVHKFLGY-----DGVFCMRMISAHAGDILATELIVALWHNFNDRVRKSPIEM 377          
BLAST of Innexin vs. Ensembl Celegans
Match: inx-18 (Innexin [Source:UniProtKB/TrEMBL;Acc:Q8MXG8])

HSP 1 Score: 175.637 bits (444), Expect = 1.826e-49
Identity = 118/406 (29.06%), Postives = 199/406 (49.01%), Query Frame = 2
Query:  212 LVSRFKLFQNGGMEDFSDRLSSKFSCLIFLTLGSVILFKQYWIRPISCYFAVDPGGSNLIQYIESYCYVHGIIPISFNGTMPTKEKDWIAIDKTRTLYYQWVPFALYGQAVMCYIPHIIWRFFRKRQNNADFNHIIQRANRAIELDDEKRKNEVIHLAQALKNILFQNRTCDSTSVLRREANRIHSKIIEWIKMGIPLVIYYLVIKILYVTNAVGQIYLMKSFLRLNSSDYKFFGSKILNDIIHGKNWQVSKIFPRVGFCLGKFRHLGATNYVTAQCALPLNMLNEKVYIFLWFWMLILSVISITSLFMWLIRMLISRNKTDFLNMYLKLSGDYTHRXXXXXXXXXXXXXXXXRNDGMFFLRILATNVGDLITAEVVSQLWKIYA-----PCYENTELDMEKLKKS 1414
            L S  +  +    +DF DRL   ++  + L    ++  KQY   PI C+       + + QY E+YC+V     + F   +P +  D    ++ +  YYQWVPF L   A+  +IP  +WR     Q+  +   ++Q       +D   R   V  +A+ + + L   R   +    RR +  I +        G  +   Y+ IK L++ N + Q  L+ SFL+  +SDY  FG+ +L D+  G+ W+ S  FPRV  C  + R LG  +  T QC L +NML EK++IFLW W+ +L++++  +L  W I ++ +  +  F++ +L +  D   R          F   FLR DG+F L+++A++ G+L+ A+V  QLW I+      P  E+   D   ++ +
Sbjct:   12 LASALRFLEPRVDDDFVDRLHYLYTSTMVLMFAVLVSAKQYVGHPIECFVPAQFTRA-MEQYTENYCWVQNTYWVPFQDLIPHRLDDR---ERRQIGYYQWVPFVLAVAALTFHIPSSVWRMLAG-QSGLNAGLVLQLVCGDENVDPVVRDKTVDIVARHIDDALMYQRDHGA----RRHSVYIFAIFKLGKFYGAYVSSVYIFIKALHLANVILQFMLLNSFLQ--TSDYPMFGAHVLYDLFMGREWRDSGKFPRVTLCDFEIRVLGNVHRHTVQCVLVINMLTEKIFIFLWLWLTVLAIVTALNLIFWFIALVSNSCREHFVSKHLDIQSDQISR----------FVHRFLRADGVFLLQMIASHSGNLMAAKVTEQLWMIFVRRSGKPVIEDKIEDRGSVRST 396          
BLAST of Innexin vs. Ensembl Fly
Match: Inx2 (gene:FBgn0027108 transcript:FBtr0301860)

HSP 1 Score: 87.0409 bits (214), Expect = 2.736e-18
Identity = 74/302 (24.50%), Postives = 126/302 (41.72%), Query Frame = 2
Query:  266 RLSSKFSCLIFLTLGSVILFKQYWIRPISCYFAVDPGGSNLIQYIESYCYVHGI--IPISFNG------TMPTKEKDWIAIDKTR-TLYYQWVPFALYGQAVMCYIPHIIWRFFRKRQNNADFNHIIQRANRAIELDDEKRKNEVIHLAQALKNILFQNRTCDSTSVLRREANRIHSKIIEWIKMGIPLVIYYLVIKILYVTNAVGQIYLMKSFLRLNSSDYKFFGSKILNDIIHGKNWQV---SKIFPRVGFC-LGKFRHLGATNYVTAQCALPLNMLNEKVYIFLWFWMLILSVISITSL 1132
            R+  K + +I +    ++  +QY   PI C     P G      +++YC+++    +P    G        P         D+ +   YYQWV F L+ QA++ Y+P  +W    K         ++   N  I  D+ K   + I +   + N+   N                                 + V + L   N +GQIY +  FL     ++  +GS +L       + ++   +++FP+V  C   K+   G+       C LPLN++NEK+Y+FLWFW +ILS++S  SL
Sbjct:   25 RMHYKATVIILIAFSLLVTSRQYIGDPIDCIVDEIPLGV-----MDTYCWIYSTFTVPERLTGITGRDVVQPGVGSHVEGEDEVKYHKYYQWVCFVLFFQAILFYVPRYLW----KSWEGGRLKMLVMDLNSPIVNDECKNDRKKILVDYFIGNLNRHNF----------------------------YAFRFFVCEALNFVNVIGQIYFVDFFL---DGEFSTYGSDVLKFTELEPDERIDPMARVFPKVTKCTFHKYGPSGSVQTHDGLCVLPLNIVNEKIYVFLWFWFIILSIMSGISL 286          
BLAST of Innexin vs. Ensembl Fly
Match: Inx2 (gene:FBgn0027108 transcript:FBtr0071005)

HSP 1 Score: 87.0409 bits (214), Expect = 2.736e-18
Identity = 74/302 (24.50%), Postives = 126/302 (41.72%), Query Frame = 2
Query:  266 RLSSKFSCLIFLTLGSVILFKQYWIRPISCYFAVDPGGSNLIQYIESYCYVHGI--IPISFNG------TMPTKEKDWIAIDKTR-TLYYQWVPFALYGQAVMCYIPHIIWRFFRKRQNNADFNHIIQRANRAIELDDEKRKNEVIHLAQALKNILFQNRTCDSTSVLRREANRIHSKIIEWIKMGIPLVIYYLVIKILYVTNAVGQIYLMKSFLRLNSSDYKFFGSKILNDIIHGKNWQV---SKIFPRVGFC-LGKFRHLGATNYVTAQCALPLNMLNEKVYIFLWFWMLILSVISITSL 1132
            R+  K + +I +    ++  +QY   PI C     P G      +++YC+++    +P    G        P         D+ +   YYQWV F L+ QA++ Y+P  +W    K         ++   N  I  D+ K   + I +   + N+   N                                 + V + L   N +GQIY +  FL     ++  +GS +L       + ++   +++FP+V  C   K+   G+       C LPLN++NEK+Y+FLWFW +ILS++S  SL
Sbjct:   25 RMHYKATVIILIAFSLLVTSRQYIGDPIDCIVDEIPLGV-----MDTYCWIYSTFTVPERLTGITGRDVVQPGVGSHVEGEDEVKYHKYYQWVCFVLFFQAILFYVPRYLW----KSWEGGRLKMLVMDLNSPIVNDECKNDRKKILVDYFIGNLNRHNF----------------------------YAFRFFVCEALNFVNVIGQIYFVDFFL---DGEFSTYGSDVLKFTELEPDERIDPMARVFPKVTKCTFHKYGPSGSVQTHDGLCVLPLNIVNEKIYVFLWFWFIILSIMSGISL 286          
BLAST of Innexin vs. Ensembl Fly
Match: Inx2 (gene:FBgn0027108 transcript:FBtr0332314)

HSP 1 Score: 87.0409 bits (214), Expect = 2.736e-18
Identity = 74/302 (24.50%), Postives = 126/302 (41.72%), Query Frame = 2
Query:  266 RLSSKFSCLIFLTLGSVILFKQYWIRPISCYFAVDPGGSNLIQYIESYCYVHGI--IPISFNG------TMPTKEKDWIAIDKTR-TLYYQWVPFALYGQAVMCYIPHIIWRFFRKRQNNADFNHIIQRANRAIELDDEKRKNEVIHLAQALKNILFQNRTCDSTSVLRREANRIHSKIIEWIKMGIPLVIYYLVIKILYVTNAVGQIYLMKSFLRLNSSDYKFFGSKILNDIIHGKNWQV---SKIFPRVGFC-LGKFRHLGATNYVTAQCALPLNMLNEKVYIFLWFWMLILSVISITSL 1132
            R+  K + +I +    ++  +QY   PI C     P G      +++YC+++    +P    G        P         D+ +   YYQWV F L+ QA++ Y+P  +W    K         ++   N  I  D+ K   + I +   + N+   N                                 + V + L   N +GQIY +  FL     ++  +GS +L       + ++   +++FP+V  C   K+   G+       C LPLN++NEK+Y+FLWFW +ILS++S  SL
Sbjct:   25 RMHYKATVIILIAFSLLVTSRQYIGDPIDCIVDEIPLGV-----MDTYCWIYSTFTVPERLTGITGRDVVQPGVGSHVEGEDEVKYHKYYQWVCFVLFFQAILFYVPRYLW----KSWEGGRLKMLVMDLNSPIVNDECKNDRKKILVDYFIGNLNRHNF----------------------------YAFRFFVCEALNFVNVIGQIYFVDFFL---DGEFSTYGSDVLKFTELEPDERIDPMARVFPKVTKCTFHKYGPSGSVQTHDGLCVLPLNIVNEKIYVFLWFWFIILSIMSGISL 286          
BLAST of Innexin vs. Ensembl Fly
Match: Inx2 (gene:FBgn0027108 transcript:FBtr0071006)

HSP 1 Score: 87.0409 bits (214), Expect = 2.736e-18
Identity = 74/302 (24.50%), Postives = 126/302 (41.72%), Query Frame = 2
Query:  266 RLSSKFSCLIFLTLGSVILFKQYWIRPISCYFAVDPGGSNLIQYIESYCYVHGI--IPISFNG------TMPTKEKDWIAIDKTR-TLYYQWVPFALYGQAVMCYIPHIIWRFFRKRQNNADFNHIIQRANRAIELDDEKRKNEVIHLAQALKNILFQNRTCDSTSVLRREANRIHSKIIEWIKMGIPLVIYYLVIKILYVTNAVGQIYLMKSFLRLNSSDYKFFGSKILNDIIHGKNWQV---SKIFPRVGFC-LGKFRHLGATNYVTAQCALPLNMLNEKVYIFLWFWMLILSVISITSL 1132
            R+  K + +I +    ++  +QY   PI C     P G      +++YC+++    +P    G        P         D+ +   YYQWV F L+ QA++ Y+P  +W    K         ++   N  I  D+ K   + I +   + N+   N                                 + V + L   N +GQIY +  FL     ++  +GS +L       + ++   +++FP+V  C   K+   G+       C LPLN++NEK+Y+FLWFW +ILS++S  SL
Sbjct:   25 RMHYKATVIILIAFSLLVTSRQYIGDPIDCIVDEIPLGV-----MDTYCWIYSTFTVPERLTGITGRDVVQPGVGSHVEGEDEVKYHKYYQWVCFVLFFQAILFYVPRYLW----KSWEGGRLKMLVMDLNSPIVNDECKNDRKKILVDYFIGNLNRHNF----------------------------YAFRFFVCEALNFVNVIGQIYFVDFFL---DGEFSTYGSDVLKFTELEPDERIDPMARVFPKVTKCTFHKYGPSGSVQTHDGLCVLPLNIVNEKIYVFLWFWFIILSIMSGISL 286          
BLAST of Innexin vs. Ensembl Fly
Match: ogre (gene:FBgn0004646 transcript:FBtr0071037)

HSP 1 Score: 82.4185 bits (202), Expect = 8.751e-17
Identity = 77/290 (26.55%), Postives = 122/290 (42.07%), Query Frame = 2
Query:  266 RLSSKFSCLIFLTLGSVILFKQYWIRPISCYFAVDPGGSNLIQYIESYCYVHGI--IPISFNGTM------PTKEKDWIAID-KTRTLYYQWVPFALYGQAVMCYIPHIIWRFFRKRQNNADFNHIIQRANRAIELDDEKRKNEVIHLAQALKNILFQNRTCDSTSVLRREANRIHSKIIEWIKMGIPLVIYYLVIKILYVTNAVGQIYLMKSFLRLNSSDYKFFGSKI--LNDIIHGKNWQ-VSKIFPRVGFC-LGKFRHLGATNYVTAQCALPLNMLNEKVYIFLWFW 1096
            RL + F+ ++ LT   +I   QY  +PISC     P        + ++C++H    +P +F   +      P    D+   D K    YYQWV F L+ QA+ CY P  +W  F           I+   N  I   +EK                            +R+A  +   +I+ +K      I Y   + L   N + Q+YLM  F      ++  +G+ I  L+D+   +    +  +FPRV  C   K+   G+     + C LPLN++NEK Y+F+WFW
Sbjct:   25 RLHNSFTTVLLLTCSLIITATQYVGQPISCIVNGVPP-----HVVNTFCWIHSTFTMPDAFRRQVGREVAHPGVANDFGDEDAKKYYTYYQWVCFVLFFQAMACYTPKFLWNKF----EGGLMRMIVMGLNITICTREEKEA--------------------------KRDA--LLDYLIKHVKRHKLYAIRYWACEFLCCINIIVQMYLMNRFF---DGEFLSYGTNIMKLSDVPQEQRVDPMVYVFPRVTKCTFHKYGPSGSLQKHDSLCILPLNIVNEKTYVFIWFW 274          
BLAST of Innexin vs. UniProt/SwissProt
Match: sp|O01393|UNC9_CAEEL (Innexin unc-9 OS=Caenorhabditis elegans OX=6239 GN=unc-9 PE=1 SV=1)

HSP 1 Score: 173.326 bits (438), Expect = 9.027e-48
Identity = 117/382 (30.63%), Postives = 195/382 (51.05%), Query Frame = 2
Query:  251 EDFSDRLSSKFSCLIFLTLGSVILFKQYWIRPISCYFAVDPGGSNLIQYIESYCYVHGIIPISFNGTMPTKEKDWIAIDKTRTLYYQWVPFALYGQAVMCYIPHIIWRFFRKRQNNADFNHIIQRANRAIELDDEKRKNEVIHLAQALKNILFQNRTCDSTSVLRREANRIHSKIIEWIKMGIPLVIYYLVIKILYVTNAVGQIYLMKSFLRLNSSDYKFFGSKILNDIIHGKNWQVSKIFPRVGFCLGKFRHLGATNYVTAQCALPLNMLNEKVYIFLWFWMLILSVISITSLFMWLIRMLISRNKTDFLNMYLKLSGDYTHRXXXXXXXXXXXXXXXXRNDGMFFLRILATNVGDLITAEVVSQLWKIYAPCYENTELDM 1396
            +D  D+L+  ++  I      ++  KQY   PI C+         + QY E+YC+V     +  +  +P    ++   +  +  YYQWVPF L  +A++ Y+P I+WR     Q+      ++Q A  +  LD E R   +  +A  ++  L       S + L+     + + II     G  +   Y+ +KILY  N VGQI+L+ +FL   S   K++G ++LND+++G+ W+ S  FPRV  C  + + LG  +  T QC L +NM NEK+++FLWFW  +L+  ++ SLF W+   ++   + +F+  YL     Y    + D + + +F   FLR DG+F LR++AT+ G+L   E+   LW  Y    E    D+
Sbjct:   21 DDIIDKLNYYYTTAIITVFAILVSAKQYVGFPIQCWVPAT-FTEPMEQYTENYCWVQNTYFLPLHDYIP---HNYAERENRQIGYYQWVPFVLALEALLFYVPTIVWRLL-SWQSGIHVQSLVQMACDSRLLDLESRNRALQTIATNVEEALHVKHQVMSGNRLK-----LLNLIICTRSSGAAVTFLYISVKILYTVNIVGQIFLLNTFLGNRS---KWYGLQVLNDLMNGREWEESGHFPRVTLCDFEVKVLGNVHRHTVQCVLMINMFNEKIFLFLWFWYFLLAGATLCSLFYWIYISVVPSRQLNFVGKYLTGIEGYK---MVDSQSLRRFVFHFLRQDGVFLLRMVATHAGELPCYELAKTLWNNYCDNKEGKMHDV 386          
BLAST of Innexin vs. UniProt/SwissProt
Match: sp|Q03412|UNC7_CAEEL (Innexin unc-7 OS=Caenorhabditis elegans OX=6239 GN=unc-7 PE=1 SV=1)

HSP 1 Score: 174.096 bits (440), Expect = 8.938e-47
Identity = 117/391 (29.92%), Postives = 196/391 (50.13%), Query Frame = 2
Query:  212 LVSRFKLFQNGGMEDFSDRLSSKFSCLIFLTLGSVILFKQYWIRPISCYFAVDPGGSNLIQYIESYCYVHGIIPISFNGTMPTKEKDWIAIDKTRTL-YYQWVPFALYGQAVMCYIPHIIWRFFRKRQNNADFNHIIQRANRAIELDDEKRKNEVIHLAQ------ALKNILFQ--NRTCDSTSVLRREANRIHSKIIEWIKMGIPLVIYYLVIKILYVTNAVGQIYLMKSFLRLNSSDYKFFGSKILNDIIHGKNWQVSKIFPRVGFCLGKFRHLGATNYVTAQCALPLNMLNEKVYIFLWFWMLILSVISITSLFMWLIRMLISRNKTDFLNMYLKLSGDYTHRXXXXXXXXXXXXXXXXRNDGMFFLRILATNVGDLITAEVVSQLWK 1357
            L S F+       +DF D+L+  ++  I  +   ++  KQY   PI C+       + + QY E+YC+V     +     +P +    I   + R + YYQWVPF L  +A++ Y+P I+WR      +  +   ++Q A  A  +D E +   V  +A+       L NI  Q  +R+C S   L     R           G  + + Y+ IK+LY  N + Q +L+   L  N   Y F    +L D++H   W+ + +FPRV  C  + R LG  +  T QC L +NM NEK+++FLWFW L   ++++ +   W++ M I      F+  YL++  D+  + + D   + KF   FLR DG+F LR+++T+ G+L+++E++  LW+
Sbjct:  126 LASAFRALYPRLDDDFVDKLNYYYTTTILASFALLVSAKQYVGFPIQCWVPATFTDA-MEQYTENYCWVQNTYWVPMQEDIPRE----IYSRRNRQIGYYQWVPFILAIEALLFYVPCILWRGLLYWHSGINLQGLVQMACDARLMDSEIKTRTVYTMARHMQDEVQLTNIDRQGHSRSCFSNLQLGANCGR---------HCGCYVTMLYIGIKVLYSANVLLQFFLLNHLLGSNDLAYGF---SLLKDLMHAIEWEQTGMFPRVTLCDFEVRVLGNIHRHTVQCVLMINMFNEKIFLFLWFWFLTCGIVTVCNTMYWILIMFIPSQGMSFVRKYLRVLPDHPAKPIADDVTLRKFTNNFLRKDGVFMLRMISTHAGELMSSELILALWQ 499          
BLAST of Innexin vs. UniProt/SwissProt
Match: sp|A8WVX4|INX19_CAEBR (Innexin-19 OS=Caenorhabditis briggsae OX=6238 GN=inx-19 PE=3 SV=3)

HSP 1 Score: 166.007 bits (419), Expect = 1.743e-44
Identity = 116/391 (29.67%), Postives = 194/391 (49.62%), Query Frame = 2
Query:  245 GMEDFSDRLSSKFSCLIFLTLGSVILFKQYWIRPISCYFAVDPGG-SNLIQYIESYCYVHGIIPISFNGTMPTKEKDWIAIDKTRTLYYQWVPFALYGQAVMCYIPHIIWRFFRKRQNNADFNHIIQRANRAIELDDEKRKNEVIHLAQALKNILFQNRTCDSTSVLRREANRIHSKIIEWIKMGIPLVIYYLVIKILYVTNAVGQIYLMKSFLRLNSSDYKFFGSKILNDIIHGKNWQVSKIFPRVGFCLGKFRHLGATNYVTAQCALPLNMLNEKVYIFLWFWMLILSVISITSLFMWLIRMLISRNKTDFLNMYLKLSGDYTHRXXXXXXXXXXXXXXXX-----------------RNDGMFFLRILATNVGDLITAEVVSQLWKIY 1363
            G +D  DRL+  ++ LI      VI  KQY   PI C+  V+P    ++ +YIESYC++     I     +P    D  A ++ +  YYQWVPF L  +A+M  +P I WR     Q+  +   +I  A  A  L D   + + +   +A+      N    S +   R    I          G  + I Y   K+LY  N V Q +++ + L+  SS++ FFG ++L+DI  G+ W  +  FPRV  C  + R+L   N  T QCAL +N++NEKV+ FLW W +IL++I+  S   W+    I   K D++  +++++    +++L+  +K    E+++                  ++DG+  LR+++ + GD+I  ++V  LW+ Y
Sbjct:   19 GDDDAVDRLNYYYTPLILAVCCLVISAKQYGGTPIECW--VNPHSRESMEEYIESYCWIQNTYWIPMYENVP---DDHTAREEKQIGYYQWVPFILIAEALMFSLPCIFWRLC-SFQSGLNIQTLINAACDAQALLDYSDRQKAV---EAITCNFVDNLDLQSPNGRIRARGWIARIKFSRFLSGQCISIVYSFTKLLYSVNVVAQFFILNACLK--SSEFVFFGFQVLSDIWAGRPWTETGHFPRVTLCDFEVRYLANLNRYTVQCALLINIINEKVFAFLWCWYMILAIITTCSFIYWIANSFIHSEKVDYVMKFIQIAESSEYKKLQKFEKDATVERLYTVIAFAPHLLDSFVSDFLKSDGILMLRMISNHAGDMIVVQLVRNLWQEY 398          
BLAST of Innexin vs. UniProt/SwissProt
Match: sp|O61715|INX19_CAEEL (Innexin-19 OS=Caenorhabditis elegans OX=6239 GN=inx-19 PE=1 SV=2)

HSP 1 Score: 164.466 bits (415), Expect = 7.068e-44
Identity = 116/389 (29.82%), Postives = 190/389 (48.84%), Query Frame = 2
Query:  245 GMEDFSDRLSSKFSCLIFLTLGSVILFKQYWIRPISCYFAVDPGG-SNLIQYIESYCYVHGIIPISFNGTMPTKEKDWIAIDKTRTLYYQWVPFALYGQAVMCYIPHIIWRFFRKRQNNADFNHIIQRANRAIELDDEKRKNEVIHLAQALKNILFQNRTCDSTSVLRREANRIHSKIIEWIKMGIPLVIYYLVIKILYVTNAVGQIYLMKSFLRLNSSDYKFFGSKILNDIIHGKNWQVSKIFPRVGFCLGKFRHLGATNYVTAQCALPLNMLNEKVYIFLWFWMLILSVISITSLFMWLIRMLISRNKTDFLNMYLKLSGDYTHRXXXXXXXXXXXXXXXX-----------------RNDGMFFLRILATNVGDLITAEVVSQLWK 1357
            G +D  DRL+  ++ LI      VI  KQY   PI C+  V+P    ++ +YIESYC++     I     +P    D  A ++ +  YYQWVPF L  +A+M  +P I WR     Q+  +   +I  A     L D   + + +   +A+      N    S +   R    I          G  L I +   K+LY  N V Q  ++ + L+  SSD+ FFG ++LNDI  G+ W  +  FPRV  C  + R+L   N  T QCAL +N++NEKV+ FLW W +IL++I+  S   W+    I   K D++  +++++     ++L+  +K    E+++                  ++DG+  LR+++ + GD+I  ++V  LW+
Sbjct:   35 GDDDAVDRLNYYYTPLILAVCCLVISAKQYGGTPIECW--VNPHSRESMEEYIESYCWIQNTYWIPMYENVP---DDHTAREEKQIGYYQWVPFILIAEALMFSLPCIFWRLC-SFQSGLNIQTLINAACDGQALLDASDRQKAV---EAITTNFVDNLDLQSPNGRIRARGWIARIKFSRFLSGQCLSILHSFTKLLYSMNVVAQFLILNACLK--SSDFLFFGFQVLNDIWAGRPWTETGHFPRVTLCDFEVRYLANLNRYTVQCALLINIINEKVFAFLWCWYMILAIITTCSFIYWIANSFIHSEKVDYVMKFIQIAESSEFKKLQKFEKDATVERLYTVIAFAPHLLDTFVSDFLKSDGVLMLRMISNHAGDMIVVQLVRNLWQ 412          
BLAST of Innexin vs. UniProt/SwissProt
Match: sp|Q23157|INX11_CAEEL (Innexin-11 OS=Caenorhabditis elegans OX=6239 GN=inx-11 PE=3 SV=1)

HSP 1 Score: 156.762 bits (395), Expect = 6.988e-41
Identity = 116/420 (27.62%), Postives = 195/420 (46.43%), Query Frame = 2
Query:  251 EDFSDRLSSKFSCLIFLTLGSVILFKQYWIRPISCYFAVDPGGSNLIQYIESYCYVHGIIPISFNGTMPTKEKDWIAIDKTRTLYYQWVPFALYGQAVMCYIPHIIWRFFRKRQNNADFNHIIQRANRAIELDDEKRKNEVI----HLAQALKNILFQNRTCDSTSVLRREANRIH-----------SKIIEWIKMGIPLVIYYLVIKILYVTNAVGQIYLMKSFLRLNSSDYKFFGSKILNDIIHGKNWQVSKIFPRVGFCLGKFRHLGATNYVTAQCALPLNMLNEKVYIFLWFWMLILSVISITSLFMWLIRMLISRNKTDFLNMYLKLSG--DYTHRXXXXXXXXXXX-XXXXXRNDGMFFLRILATNVGDLITAEVVSQLWKIYAPCYENTELDMEKLKKSCNKRGNSCSDGTES 1456
            +D+SDRL+   +  I L    +I FKQ+  RPI C F     GS   QY E+YC+      +     +   +K+       +  YYQWVPF L  QA     P  +W++F    +    + ++++A  +  +++E R+  ++    HL+ AL+   FQ       + + R+  ++H           S  I WI         YL  K+LY  N   Q+YLM  FL  N   +  FG  ++ DI+ G+ W+ S  FPR   C  + R +      + QC L +N+ NEK+++ LWFW +IL + S  SL  W I ++       F+  +L LS   ++  R  + +   V      +L  DG+F LR+++++ G +   ++V  L++ Y    +N ++    +         + S G ES
Sbjct:   20 DDWSDRLNYLMTPNILLAFSVLISFKQFGGRPIECMFPNKFPGS-WEQYAENYCWSQDTYFVEPTQDVSLLKKEERYTPDRQLSYYQWVPFFLLLQAAFFRAPSYLWKYF-SNHSGIRIHEVVEKAKDSANVEEEVREKNILILKRHLSSALR---FQ-------ANMERKKVQVHKTVTFLNFQYSSGFISWI---------YLFTKVLYFLNVFAQLYLMNYFLGTNRHHWYGFG--VVQDIVQGEPWERSGYFPRAAVCDFEVRQVANIQRYSVQCVLVINIFNEKIFVLLWFWYVILLLSSTVSLVQWFIVLVFPCFSKWFVKQHLALSTLQNFNQRNSRREDSDVSKFVTQYLHKDGVFVLRMVSSHAGIIFATDLVQALYEAYDFQDKNKDVQGSPVSDDL----QTISTGAES 412          
BLAST of Innexin vs. TrEMBL
Match: G7YJJ0 (Innexin OS=Clonorchis sinensis OX=79923 GN=inx PE=3 SV=1)

HSP 1 Score: 342.043 bits (876), Expect = 3.255e-109
Identity = 169/412 (41.02%), Postives = 262/412 (63.59%), Query Frame = 2
Query:  197 SNQIQLVSRFKLFQNGGMEDFSDRLSSKFSCLIFLTLGSVILFKQYWIRPISCYFAVDPGGSNLIQYIESYCYVHGIIPISFNGTMPTKEKDWIAIDKTRTLYYQWVPFALYGQAVMCYIPHIIWRFFRKRQNNADFNHIIQRANRAIELDDEKRKNEVIHLAQALKNILFQNRTC--DSTSVLRREANRIHSKIIEWIKMGIPLVIYYLVIKILYVTNAVGQIYLMKSFLRLNSSDYKFFGSKILNDIIHGKNWQVSKIFPRVGFCLGKFRHLGATNYVTAQCALPLNMLNEKVYIFLWFWMLILSVISITSLFMWLIRMLISRNKTDFLNMYLKLSGDYTHRXXXXXXXXXXXXXXXXRNDGMFFLRILATNVGDLITAEVVSQLWKIYAPCYENTELDMEKLKKSCNKR 1426
            S  +  +S+F++    G+EDF+D+ +   + +I L   +V+  KQY ++PISCY A D GG NL+ Y+E+YC+V G IPI++ G MP  +  W  ++K + LYYQWVPF L  Q +M Y+P +IW+     +   D  H++  AN+A+   D++R   + H+A+ L+ +LFQ+R    D  S +RR   +  S ++   ++G  L   YL IK LY+ NAVGQ+++M++FL L   +Y FFG  I  DI+ GK+WQ + +FPRVG+CL   RH+GA+NYVT QC LP+NMLNE++Y+FLWFW+++ + ++  S+  W +RM   +++T F+  YLKL    T +   D+  + KF++ FLR DG+F LR++A N GDLI +++V QLWKI+   Y   +L M   ++    R
Sbjct:    4 SEFLDYISKFQVATYVGVEDFADKFNFLVTVMILLLCTTVVTVKQYMMKPISCYMATDIGGKNLLDYVENYCWVQGTIPIAYAGKMPETDAAWEEMEKHKLLYYQWVPFVLGLQCIMFYVPRVIWQMICYNRTGTDIQHLVLSANQAVHATDDQRTKMIQHVARTLEQMLFQHREYRNDVWSHIRRRLWKTCSLLVVSKRLGTRLFAIYLFIKCLYLVNAVGQVFMMQTFLGLRYDNYSFFGIAIARDILSGKDWQRTLVFPRVGYCLVPVRHMGASNYVTGQCVLPVNMLNERIYVFLWFWIVLAATLTAISIPTWFMRMSYQKSRTCFIKKYLKLGEVLTKK---DRGMVEKFKRQFLRQDGIFLLRMIAINAGDLICSDIVCQLWKIFKTRYFFRDLTMSDEEQEEEHR 412          
BLAST of Innexin vs. TrEMBL
Match: A0A4S2LNY2 (Innexin OS=Opisthorchis felineus OX=147828 GN=inx PE=3 SV=1)

HSP 1 Score: 342.043 bits (876), Expect = 3.399e-109
Identity = 168/402 (41.79%), Postives = 259/402 (64.43%), Query Frame = 2
Query:  197 SNQIQLVSRFKLFQNGGMEDFSDRLSSKFSCLIFLTLGSVILFKQYWIRPISCYFAVDPGGSNLIQYIESYCYVHGIIPISFNGTMPTKEKDWIAIDKTRTLYYQWVPFALYGQAVMCYIPHIIWRFFRKRQNNADFNHIIQRANRAIELDDEKRKNEVIHLAQALKNILFQNRTC--DSTSVLRREANRIHSKIIEWIKMGIPLVIYYLVIKILYVTNAVGQIYLMKSFLRLNSSDYKFFGSKILNDIIHGKNWQVSKIFPRVGFCLGKFRHLGATNYVTAQCALPLNMLNEKVYIFLWFWMLILSVISITSLFMWLIRMLISRNKTDFLNMYLKLSGDYTHRXXXXXXXXXXXXXXXXRNDGMFFLRILATNVGDLITAEVVSQLWKIYAPCYENTELDM 1396
            S  +  +S+F++    G+EDF+D+ +   + +I L   +V+  KQY ++PISCY A D GG NL+ Y+E+YC+V G IPI++ G MP  +  W  ++K + LYYQWVPF L  Q +M Y+P +IW+     +   D  H++  AN+A+   D++R   + H+A+ L+ +LFQ+R    D  S +RR   +  S ++   ++G  L   YL IK LY+ NAVGQ+++M++FL L   +Y FFG  I  DI+ GK+WQ + +FPRVG+CL   RH+GA+NYVT QC LP+NMLNE++Y+FLWFW+++ + ++  S+  W +RM   +++T F+  YLKL    T +   D+  + KF++ FLR DG+F LR++A N GDLI +++V QLWKI+   Y   +L M
Sbjct:    4 SEFLDYISKFQVATYVGVEDFADKFNFLITVMILLLCTTVVTVKQYMMKPISCYMATDIGGKNLLDYVENYCWVQGTIPIAYAGKMPETDAAWEEMEKHKLLYYQWVPFVLGLQCIMFYVPRVIWQMICYNRTGTDIQHLVLSANQAVHATDDQRTKMIQHVARTLEQMLFQHREYRNDVWSHIRRRLWKTCSLLVVSKRLGTRLFAIYLFIKCLYLVNAVGQVFMMQTFLGLRYDNYSFFGIAIARDILSGKDWQRTLVFPRVGYCLVPVRHMGASNYVTGQCVLPVNMLNERIYVFLWFWIVLAATLTAISIPTWFMRMSYQKSRTCFIKKYLKLGEVLTKK---DRGMVEKFKRQFLRQDGIFLLRMIAINAGDLICSDIVCQLWKIFKTRYFFRDLTM 402          
BLAST of Innexin vs. TrEMBL
Match: A0A0X3PXF2 (Innexin OS=Schistocephalus solidus OX=70667 GN=inx PE=3 SV=1)

HSP 1 Score: 332.028 bits (850), Expect = 8.320e-105
Identity = 163/407 (40.05%), Postives = 256/407 (62.90%), Query Frame = 2
Query:  245 GMEDFSDRLSSKFSCLIFLTLGSVILFKQYWIRPISCYFAVDPGGSNLIQYIESYCYVHGIIPISFNGTMPTKEKDWIAIDKTRTLYYQWVPFALYGQAVMCYIPHIIWRFFRKRQNNADFNHIIQRANRAIELDDEKRKNEVIHLAQALKNILFQNRTCDS--TSVLRREANRIHSKIIEWIKMGIPLVIYYLVIKILYVTNAVGQIYLMKSFLRLNSSDYKFFGSKILNDIIHGKNWQVSKIFPRVGFCLGKFRHLGATNYVTAQCALPLNMLNEKVYIFLWFWMLILSVISITSLFMWLIRMLISRNKTDFLNMYLKLSGDYTHRXXXXXX-XXXXXXXXXXRNDGMFFLRILATNVGDLITAEVVSQLWKIYAPCYENTELDMEKLKKSCNKR---GNSCSDG 1447
            G+EDF+D+ +   + ++ L   +V+  KQY ++PISCY A + GG NL+ Y+E+YC+V G IPIS+ G +P  ++ W  ++  + LYYQWVPF L  Q ++ YIP IIW+     +   D  H+I  A+ A     +KR   V HLA++L+ +LFQ+R   +   + +R+   ++        ++G  L   YL IK+LY+ N+VGQ+YLM++FL LNSS Y + G+ I  +I+ G++WQV+ +FPRVGFC+   RHL    Y TAQCALP+NMLNE++Y+FLWFW+L+ + ++  S+ MW +RM   +++T+F+  +L++  D  +R     +  + KF + FLR+DG+F LR++A N G+LI AE+V +LW+IY   Y N + ++    +  N     G   SD 
Sbjct:   20 GVEDFADKFNFLITVMVLLLCATVVTVKQYMLKPISCYIATEVGGRNLLDYVENYCWVQGTIPISYAGNVPENDEQWAKLESQKLLYYQWVPFVLGLQCILFYIPRIIWQMICYNRTGTDLQHLINLASEAAHATSDKRAETVKHLAKSLEQLLFQHREYRTGWATKVRKVCYKVCRLFYISKRLGTHLFGTYLFIKLLYLANSVGQLYLMQNFLGLNSSQYTYLGAAIATNILTGRDWQVTLVFPRVGFCVVPIRHLVGPVYATAQCALPMNMLNERIYMFLWFWVLLSAFLTAISIPMWFMRMAYEKSRTNFVRRFLRVGYDEENRYSSKDRCMVAKFTRQFLRHDGIFLLRMVAINAGELIAAEIVHKLWEIYKQKYYNRDFNVPDANEEENDSAWGGGGDSDA 426          
BLAST of Innexin vs. TrEMBL
Match: A0A3Q0KLG6 (Innexin OS=Schistosoma mansoni OX=6183 GN=inx PE=3 SV=1)

HSP 1 Score: 322.783 bits (826), Expect = 2.900e-101
Identity = 162/405 (40.00%), Postives = 255/405 (62.96%), Query Frame = 2
Query:  215 VSRFKLFQNGGMEDFSDRLSSKFSCLIFLTLGSVILFKQYWIRPISCYFAVDPGGSNLIQYIESYCYVHGIIPISFNGTMPTKEKDWIAIDKTRTLYYQWVPFALYGQAVMCYIPHIIWRFFRKRQNNADFNHIIQRANRAIELDDEKRKNEVIHLAQALKNILFQNRTCDST--SVLRREANRIHSKIIEWIKMGIPLVIYYLVIKILYVTNAVGQIYLMKSFLRLNSSDYKFFGSKILNDIIHGKNWQVSKIFPRVGFCLGKFRHLGATNYVTAQCALPLNMLNEKVYIFLWFWMLILSVISITSLFMWLIRMLISRNKTDFLNMYLKLSGDYTHRXXXXXXXXXXXXXXXXRNDGMFFLRILATNVGDLITAEVVSQLWKIYAPCYENTELDMEKLKKSCNK 1423
            +S+F++    G+EDF+D+ +   + ++ +   +++  KQY ++PISCY A D GG NL+ Y+E+YC+V G +PI+++G +P  ++ W  ++K + LYYQWVPF L  Q ++ Y+P +IW+     +   D  H++  AN+A+  +DE+R   V HLA+ L+ +LFQ R         +RR   +         ++G  L   YL IK LY+ NA+GQI++M+SFL L  S+Y  FG  I  +I+ G +W+V+ IFPRVGFCL   +H G+ NY TAQC LP+NMLNE++Y+FLWFW+++ + I+  S+  W  RM   +++T F+  YLKL    + +   DK  + KF  +FLRNDG+F LR++A N G+LI +E+V QLW I+   Y     D+ + K+ C++
Sbjct:   10 LSKFQVATYVGVEDFADKFNFLITVMVLMLCTTIVTVKQYMMKPISCYMATDLGGKNLLDYVENYCWVQGTVPIAYSGRVPETDEGWAELEKHKLLYYQWVPFVLGLQCILFYLPRLIWQMICYNRVGTDVQHLVLCANQAVHANDEQRTKMVQHLAKTLEQLLFQQREYHHGLWPRVRRRMKKWGYLFFVSKRLGTRLFGIYLFIKCLYLLNAIGQIFMMQSFLGLK-SNYTLFGVAISRNILAGLDWEVTMIFPRVGFCLVPLKHFGSNNYATAQCVLPVNMLNERIYMFLWFWIVLAATITAISIPTWFTRMSYEKSRTHFIKKYLKLGEKVSRK---DKYMVEKFTLLFLRNDGVFLLRMIAINAGELICSEIVCQLWHIFREKYFYR--DLTRCKRDCDQ 408          
BLAST of Innexin vs. TrEMBL
Match: G4V9H2 (Innexin OS=Schistosoma mansoni OX=6183 GN=inx PE=3 SV=1)

HSP 1 Score: 322.013 bits (824), Expect = 5.962e-101
Identity = 162/405 (40.00%), Postives = 255/405 (62.96%), Query Frame = 2
Query:  215 VSRFKLFQNGGMEDFSDRLSSKFSCLIFLTLGSVILFKQYWIRPISCYFAVDPGGSNLIQYIESYCYVHGIIPISFNGTMPTKEKDWIAIDKTRTLYYQWVPFALYGQAVMCYIPHIIWRFFRKRQNNADFNHIIQRANRAIELDDEKRKNEVIHLAQALKNILFQNRTCDST--SVLRREANRIHSKIIEWIKMGIPLVIYYLVIKILYVTNAVGQIYLMKSFLRLNSSDYKFFGSKILNDIIHGKNWQVSKIFPRVGFCLGKFRHLGATNYVTAQCALPLNMLNEKVYIFLWFWMLILSVISITSLFMWLIRMLISRNKTDFLNMYLKLSGDYTHRXXXXXXXXXXXXXXXXRNDGMFFLRILATNVGDLITAEVVSQLWKIYAPCYENTELDMEKLKKSCNK 1423
            +S+F++    G+EDF+D+ +   + ++ +   +++  KQY ++PISCY A D GG NL+ Y+E+YC+V G +PI+++G +P  ++ W  ++K + LYYQWVPF L  Q ++ Y+P +IW+     +   D  H++  AN+A+  +DE+R   V HLA+ L+ +LFQ R         +RR   +         ++G  L   YL IK LY+ NA+GQI++M+SFL L  S+Y  FG  I  +I+ G +W+V+ IFPRVGFCL   +H G+ NY TAQC LP+NMLNE++Y+FLWFW+++ + I+  S+  W  RM   +++T F+  YLKL    + +   DK  + KF  +FLRNDG+F LR++A N G+LI +E+V QLW I+   Y     D+ + K+ C++
Sbjct:   10 LSKFQVATYVGVEDFADKFNFLITVMVLMLCTTIVTVKQYMMKPISCYMATDLGGKNLLDYVENYCWVQGTVPIAYSGRVPETDEGWAELEKHKLLYYQWVPFVLGLQCILFYLPRLIWQMICYNRVGTDVQHLVLCANQAVHANDEQRTKMVQHLAKTLEQLLFQQREYHHGLWPRVRRRMKKWGYLFFVSKRLGTRLFGIYLFIKCLYLLNAIGQIFMMQSFLGLK-SNYTLFGVAISRNILVGLDWEVTMIFPRVGFCLVPLKHFGSNNYATAQCVLPVNMLNERIYMFLWFWIVLAATITAISIPTWFTRMSYEKSRTHFIKKYLKLGEKVSRK---DKYMVEKFTLLFLRNDGVFLLRMIAINAGELICSEIVCQLWHIFREKYFYR--DLTRCKRDCDQ 408          
BLAST of Innexin vs. Planmine SMEST
Match: SMESG000030970.1 (SMESG000030970.1)

HSP 1 Score: 844.729 bits (2181), Expect = 0.000e+0
Identity = 426/427 (99.77%), Postives = 426/427 (99.77%), Query Frame = 2
Query:  191 MLSNQIQLVSRFKLFQNGGMEDFSDRLSSKFSCLIFLTLGSVILFKQYWIRPISCYFAVDPGGSNLIQYIESYCYVHGIIPISFNGTMPTKEKDWIAIDKTRTLYYQWVPFALYGQAVMCYIPHIIWRFFRKRQNNADFNHIIQRANRAIELDDEKRKNEVIHLAQALKNILFQNRTCDSTSVLRREANRIHSKIIEWIKMGIPLVIYYLVIKILYVTNAVGQIYLMKSFLRLNSSDYKFFGSKILNDIIHGKNWQVSKIFPRVGFCLGKFRHLGATNYVTAQCALPLNMLNEKVYIFLWFWMLILSVISITSLFMWLIRMLISRNKTDFLNMYLKLSGDYTHRXXXXXXXXXXXXXXXXRNDGMFFLRILATNVGDLITAEVVSQLWKIYAPCYENTELDMEKLKKSCNKRGNSCSDGTESRRVSV 1471
            MLSNQIQLVSRFKLFQNGGMEDFSDRLSSKFSCLIFLTLGSVILFKQYWIRPISCYFAVDPGGSNLIQYIESYCYVHGIIPISFNGTMPTKEKDWIAIDKTRTLYYQWVPFALYGQAVMCYIPHIIWRFFRKRQNNADFNHIIQRANRAIELDDEKRKNEVIHLAQALKNILFQNRTCDSTSVLRREANRIHSKIIEWIKMGIPLVIYYLVIKILYVTNAVGQIYLMKSFLRLNSSDYKFFGSKILNDIIHGKNWQVSKIFPRVGFCLGKFRHLGATNYVTAQCALPLNMLNEKVYIFLWFWMLILSVISITSLFMWLIRMLISRNKTDFLNMYLKLSGDYTHRELKDKKKIVKFEKIFLRNDGMFFLRILATNVGDLITAEVVSQLWKIYAPCYENTELDMEKLKK CNKRGNSCSDGTESRRVSV
Sbjct:    1 MLSNQIQLVSRFKLFQNGGMEDFSDRLSSKFSCLIFLTLGSVILFKQYWIRPISCYFAVDPGGSNLIQYIESYCYVHGIIPISFNGTMPTKEKDWIAIDKTRTLYYQWVPFALYGQAVMCYIPHIIWRFFRKRQNNADFNHIIQRANRAIELDDEKRKNEVIHLAQALKNILFQNRTCDSTSVLRREANRIHSKIIEWIKMGIPLVIYYLVIKILYVTNAVGQIYLMKSFLRLNSSDYKFFGSKILNDIIHGKNWQVSKIFPRVGFCLGKFRHLGATNYVTAQCALPLNMLNEKVYIFLWFWMLILSVISITSLFMWLIRMLISRNKTDFLNMYLKLSGDYTHRELKDKKKIVKFEKIFLRNDGMFFLRILATNVGDLITAEVVSQLWKIYAPCYENTELDMEKLKKFCNKRGNSCSDGTESRRVSV 427          
BLAST of Innexin vs. Planmine SMEST
Match: SMESG000030970.1 (SMESG000030970.1)

HSP 1 Score: 639.032 bits (1647), Expect = 0.000e+0
Identity = 307/307 (100.00%), Postives = 307/307 (100.00%), Query Frame = 2
Query:  191 MLSNQIQLVSRFKLFQNGGMEDFSDRLSSKFSCLIFLTLGSVILFKQYWIRPISCYFAVDPGGSNLIQYIESYCYVHGIIPISFNGTMPTKEKDWIAIDKTRTLYYQWVPFALYGQAVMCYIPHIIWRFFRKRQNNADFNHIIQRANRAIELDDEKRKNEVIHLAQALKNILFQNRTCDSTSVLRREANRIHSKIIEWIKMGIPLVIYYLVIKILYVTNAVGQIYLMKSFLRLNSSDYKFFGSKILNDIIHGKNWQVSKIFPRVGFCLGKFRHLGATNYVTAQCALPLNMLNEKVYIFLWFWMLILS 1111
            MLSNQIQLVSRFKLFQNGGMEDFSDRLSSKFSCLIFLTLGSVILFKQYWIRPISCYFAVDPGGSNLIQYIESYCYVHGIIPISFNGTMPTKEKDWIAIDKTRTLYYQWVPFALYGQAVMCYIPHIIWRFFRKRQNNADFNHIIQRANRAIELDDEKRKNEVIHLAQALKNILFQNRTCDSTSVLRREANRIHSKIIEWIKMGIPLVIYYLVIKILYVTNAVGQIYLMKSFLRLNSSDYKFFGSKILNDIIHGKNWQVSKIFPRVGFCLGKFRHLGATNYVTAQCALPLNMLNEKVYIFLWFWMLILS
Sbjct:    1 MLSNQIQLVSRFKLFQNGGMEDFSDRLSSKFSCLIFLTLGSVILFKQYWIRPISCYFAVDPGGSNLIQYIESYCYVHGIIPISFNGTMPTKEKDWIAIDKTRTLYYQWVPFALYGQAVMCYIPHIIWRFFRKRQNNADFNHIIQRANRAIELDDEKRKNEVIHLAQALKNILFQNRTCDSTSVLRREANRIHSKIIEWIKMGIPLVIYYLVIKILYVTNAVGQIYLMKSFLRLNSSDYKFFGSKILNDIIHGKNWQVSKIFPRVGFCLGKFRHLGATNYVTAQCALPLNMLNEKVYIFLWFWMLILS 307          
BLAST of Innexin vs. Planmine SMEST
Match: SMESG000030970.1 (SMESG000030970.1)

HSP 1 Score: 597.43 bits (1539), Expect = 0.000e+0
Identity = 308/309 (99.68%), Postives = 308/309 (99.68%), Query Frame = 2
Query:  545 MCYIPHIIWRFFRKRQNNADFNHIIQRANRAIELDDEKRKNEVIHLAQALKNILFQNRTCDSTSVLRREANRIHSKIIEWIKMGIPLVIYYLVIKILYVTNAVGQIYLMKSFLRLNSSDYKFFGSKILNDIIHGKNWQVSKIFPRVGFCLGKFRHLGATNYVTAQCALPLNMLNEKVYIFLWFWMLILSVISITSLFMWLIRMLISRNKTDFLNMYLKLSGDYTHRXXXXXXXXXXXXXXXXRNDGMFFLRILATNVGDLITAEVVSQLWKIYAPCYENTELDMEKLKKSCNKRGNSCSDGTESRRVSV 1471
            MCYIPHIIWRFFRKRQNNADFNHIIQRANRAIELDDEKRKNEVIHLAQALKNILFQNRTCDSTSVLRREANRIHSKIIEWIKMGIPLVIYYLVIKILYVTNAVGQIYLMKSFLRLNSSDYKFFGSKILNDIIHGKNWQVSKIFPRVGFCLGKFRHLGATNYVTAQCALPLNMLNEKVYIFLWFWMLILSVISITSLFMWLIRMLISRNKTDFLNMYLKLSGDYTHRELKDKKKIVKFEKIFLRNDGMFFLRILATNVGDLITAEVVSQLWKIYAPCYENTELDMEKLKK CNKRGNSCSDGTESRRVSV
Sbjct:    1 MCYIPHIIWRFFRKRQNNADFNHIIQRANRAIELDDEKRKNEVIHLAQALKNILFQNRTCDSTSVLRREANRIHSKIIEWIKMGIPLVIYYLVIKILYVTNAVGQIYLMKSFLRLNSSDYKFFGSKILNDIIHGKNWQVSKIFPRVGFCLGKFRHLGATNYVTAQCALPLNMLNEKVYIFLWFWMLILSVISITSLFMWLIRMLISRNKTDFLNMYLKLSGDYTHRELKDKKKIVKFEKIFLRNDGMFFLRILATNVGDLITAEVVSQLWKIYAPCYENTELDMEKLKKFCNKRGNSCSDGTESRRVSV 309          
BLAST of Innexin vs. Planmine SMEST
Match: SMESG000030964.1 (SMESG000030964.1)

HSP 1 Score: 323.939 bits (829), Expect = 1.311e-105
Identity = 173/398 (43.47%), Postives = 260/398 (65.33%), Query Frame = 2
Query:  191 MLSNQIQLVSRFKLFQNGGMEDFSDRLSSKFSCLIFLTLGSVILFKQYWIRPISCYFAVDPGGSNLIQYIESYCYVHGIIPISFNGTMPTKEKDWIAIDKTRTLYYQWVPFALYGQAVMCYIPHIIWRFFRKRQNNADFNHIIQRANRAIELDDEKRKNEVIHLAQALKNILFQNRTCDS--TSVLRREANRIHSKIIEWIKMGIPLVIYYLVIKILYVTNAVGQIYLMKSFLRLNSSD-YKFFGSKILNDIIHGKNWQVSKIFPRVGFCLGKFRHLGATNYVTAQCALPLNMLNEKVYIFLWFWMLILSVISITSLFMWLIRMLISRNKTDFLNMYLKLSGDYTHRXXXXXXXXXXXXXXXXRNDGMFFLRILATNVGDLITAEVVSQLWKIYAPCY 1375
            M  N+I     F LF   G +DFSDRLS K+SC IF+   S+ +  QY   PISCY + + GG +LI YIE+YC+V G IPI+F+ T P  EK+W + +K + LYYQW+PF L  QA+ C+IPH++W+      N  + ++++ +A +A+  D+E R  EV HLA+ L+ +LF+ R  +S  +S  R    +I+   I   ++G  L+++Y  IKILY+ NA+ Q++L++  L  +SSD +  FG K+L++  +G+  Q S IFP+ GFC  + RH+G  N+V +QCALP N++NEK++IFLWFWM+I+S+I+  S+ +W+    +  NKT FL  YLK+  D    +   K  + KFEK FL++ G+F LR++ATN GDLITA++V+QLW I+   Y
Sbjct:    1 MTINEIIHRQNFDLFTTDGFDDFSDRLSFKYSCFIFMVASSLSMVHQYMFIPISCYVSTESGGKHLIDYIENYCWVEGTIPINFSMTFPRNEKEWASAEKEKILYYQWIPFILQLQAISCFIPHLLWKLLYINNNGQNIDNLVSKAKKAVVKDEESRLKEVRHLAKVLEAMLFEIRDDNSANSSFGRNLCRKIYEFCILGKRLGAYLIVFYFFIKILYLLNAISQLFLIQLLLSPHSSDNHLLFGVKLLSNAFNGETKQES-IFPKFGFCFVQLRHVGGVNFVVSQCALPANVINEKMFIFLWFWMIIVSIITSISILVWIFESYLQYNKTAFLKKYLKIK-DLNQYKDVQKNLLKKFEKRFLKSSGLFILRMIATNSGDLITADIVNQLWNIFKEKY 396          
BLAST of Innexin vs. Planmine SMEST
Match: SMESG000030971.1 (SMESG000030971.1)

HSP 1 Score: 310.842 bits (795), Expect = 1.415e-100
Identity = 164/390 (42.05%), Postives = 256/390 (65.64%), Query Frame = 2
Query:  215 VSRFKLFQNGGMEDFSDRLSSKFSCLIFLTLGSVILFKQYWIRPISCYFAVDPGGSNLIQYIESYCYVHGIIPISFNGTMPTKEKDWIAIDKTRTLYYQWVPFALYGQAVMCYIPHIIWRFFRKRQNNADFNHIIQRANRAIELDDEKRKNEVIHLAQALKNILFQNRTCDS--TSVLRREANRIHSKIIEWIKMGIPLVIYYLVIKILYVTNAVGQIYLMKSFLRLNSSD-YKFFGSKILNDIIHGKNWQVSKIFPRVGFCLGKFRHLGATNYVTAQCALPLNMLNEKVYIFLWFWMLILSVISITSLFMWLIRMLISRNKTDFLNMYLKLSGDYTHRXXXXXXXXXXXXXXXXRNDGMFFLRILATNVGDLITAEVVSQLWKIYAPCY 1375
            +S+  + +    +DFSDRL+ K+SC IF+  GS+ L  Q    PISCY + + GG NLI++IE+YC+V G IPI+F+  +P  E++W   +K   LY QW+PF L  QA+ C+IPH++W+      N  + ++++ +A++A+ +D+E R  EV HLA+ L+ +LF+ R   S  +S  R    +I+   I   ++G  L+++Y  IKILY+ NA+ Q++L++  L  +SSD +  FG K+L++  +G+  Q S IFP+ GFC  + RH+G  N+V +QCALP N++NEK++IFLWFWM+I+S+I+  S+ +W+    +  NKT FL  YLK+  D    +   K  + KFEK FL++ G+F LR++ATN GDLITA++V+QLW I+   Y
Sbjct:    9 LSKSNVLKTNSFDDFSDRLNFKYSCFIFMVAGSISLLHQLMFIPISCYVSTESGGKNLIKFIENYCWVQGTIPINFSVGLPKTEEEWATAEKENNLYDQWIPFILTLQAMACFIPHLLWKLLYINNNGKNIDNLMSKASKAVVMDEESRLKEVRHLAKVLEAMLFEIRDDKSANSSFGRNLCRKIYEFCILGKRLGAYLIVFYFFIKILYLLNAISQLFLIQLLLSPHSSDNHLLFGVKLLSNAFNGETKQES-IFPKFGFCFVQLRHVGGVNFVVSQCALPANVINEKMFIFLWFWMIIVSIITSISILVWIFESYLQYNKTAFLKKYLKIK-DLNQYKDVQKNLLKKFEKRFLKSSGLFILRMIATNSGDLITADIVNQLWNIFKEKY 396          
The following BLAST results are available for this feature:
BLAST of Innexin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
inx-12.251e-5129.79Innexin [Source:UniProtKB/TrEMBL;Acc:Q17394][more]
inx-12.251e-5129.79Innexin [Source:UniProtKB/TrEMBL;Acc:Q17394][more]
inx-185.337e-5129.05Innexin [Source:UniProtKB/TrEMBL;Acc:Q8MXG8][more]
inx-11.012e-5029.07Innexin [Source:UniProtKB/TrEMBL;Acc:Q17394][more]
inx-181.826e-4929.06Innexin [Source:UniProtKB/TrEMBL;Acc:Q8MXG8][more]
back to top
BLAST of Innexin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Inx22.736e-1824.50gene:FBgn0027108 transcript:FBtr0301860[more]
Inx22.736e-1824.50gene:FBgn0027108 transcript:FBtr0071005[more]
Inx22.736e-1824.50gene:FBgn0027108 transcript:FBtr0332314[more]
Inx22.736e-1824.50gene:FBgn0027108 transcript:FBtr0071006[more]
ogre8.751e-1726.55gene:FBgn0004646 transcript:FBtr0071037[more]
back to top
BLAST of Innexin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O01393|UNC9_CAEEL9.027e-4830.63Innexin unc-9 OS=Caenorhabditis elegans OX=6239 GN... [more]
sp|Q03412|UNC7_CAEEL8.938e-4729.92Innexin unc-7 OS=Caenorhabditis elegans OX=6239 GN... [more]
sp|A8WVX4|INX19_CAEBR1.743e-4429.67Innexin-19 OS=Caenorhabditis briggsae OX=6238 GN=i... [more]
sp|O61715|INX19_CAEEL7.068e-4429.82Innexin-19 OS=Caenorhabditis elegans OX=6239 GN=in... [more]
sp|Q23157|INX11_CAEEL6.988e-4127.62Innexin-11 OS=Caenorhabditis elegans OX=6239 GN=in... [more]
back to top
BLAST of Innexin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
G7YJJ03.255e-10941.02Innexin OS=Clonorchis sinensis OX=79923 GN=inx PE=... [more]
A0A4S2LNY23.399e-10941.79Innexin OS=Opisthorchis felineus OX=147828 GN=inx ... [more]
A0A0X3PXF28.320e-10540.05Innexin OS=Schistocephalus solidus OX=70667 GN=inx... [more]
A0A3Q0KLG62.900e-10140.00Innexin OS=Schistosoma mansoni OX=6183 GN=inx PE=3... [more]
G4V9H25.962e-10140.00Innexin OS=Schistosoma mansoni OX=6183 GN=inx PE=3... [more]
back to top
BLAST of Innexin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000030970.10.000e+099.77SMESG000030970.1[more]
SMESG000030970.10.000e+0100.00SMESG000030970.1[more]
SMESG000030970.10.000e+099.68SMESG000030970.1[more]
SMESG000030964.11.311e-10543.47SMESG000030964.1[more]
SMESG000030971.11.415e-10042.05SMESG000030971.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30028261 ID=SMED30028261|Name=Innexin|organism=Schmidtea mediterranea sexual|type=transcript|length=1552bp
AGTGTACAAAATTATTGATTTTGTTTAGAATATACCTTCGATCAAATTGT
GATGGACAGCAAGCACCATAAATCTATAATATTGAGTATGCTAACAGTGA
GTGAAGCACTATAAAATCTATGCACTGGCCAATGTTAATCCAATACACTA
AATAGTTCATTAAAACAAAAGAACTCAGCAATTTATATTTATGTTATCTA
ATCAAATTCAACTTGTTTCAAGATTCAAACTCTTTCAAAATGGCGGCATG
GAAGATTTTTCCGATCGACTTTCCAGTAAATTTTCGTGTCTCATTTTTCT
AACTCTTGGAAGTGTGATTTTGTTTAAGCAATACTGGATACGGCCGATTT
CTTGCTATTTCGCTGTTGATCCAGGAGGAAGTAATCTCATACAATACATT
GAAAGTTATTGTTATGTCCATGGAATAATTCCGATCTCATTTAATGGAAC
AATGCCGACAAAAGAGAAAGATTGGATAGCCATAGACAAAACTAGAACTT
TATATTATCAATGGGTTCCTTTTGCCCTCTATGGACAAGCGGTTATGTGC
TATATACCTCACATAATTTGGAGATTTTTTAGAAAAAGGCAGAACAATGC
AGACTTCAACCATATTATTCAGAGAGCAAACAGAGCTATTGAATTAGACG
ATGAGAAACGAAAGAATGAAGTTATTCATTTGGCACAAGCCCTTAAAAAT
ATACTTTTTCAGAATCGAACCTGTGACTCTACATCAGTGCTCCGTAGAGA
GGCTAACCGTATCCATTCCAAAATAATTGAATGGATCAAAATGGGAATCC
CATTGGTGATTTATTACTTAGTAATCAAAATTCTCTACGTCACAAATGCT
GTGGGACAAATCTATTTAATGAAGTCGTTTTTACGGCTGAATTCTTCGGA
TTATAAATTTTTCGGATCAAAAATTCTCAATGATATCATTCATGGTAAAA
ATTGGCAAGTGTCGAAAATATTTCCAAGAGTAGGATTTTGTTTGGGAAAG
TTTCGGCATTTAGGTGCGACAAATTACGTCACTGCTCAGTGCGCGCTTCC
ATTGAATATGCTCAACGAAAAGGTCTATATTTTCCTTTGGTTTTGGATGC
TGATTTTGAGTGTAATTTCAATAACAAGTCTTTTCATGTGGTTAATCAGA
ATGTTGATTAGTCGAAACAAAACAGATTTCCTAAACATGTACTTGAAACT
TAGTGGAGACTACACGCATAGGGAGTTAAAGGACAAAAAAAAGATTGTGA
AATTTGAGAAAATATTTCTTCGAAATGACGGAATGTTCTTTTTGAGAATT
CTAGCGACTAATGTTGGTGACCTAATTACAGCAGAAGTTGTCAGCCAGTT
GTGGAAGATCTACGCTCCATGTTATGAGAACACAGAATTGGATATGGAAA
AACTGAAAAAATCCTGTAATAAAAGAGGGAATTCTTGTTCAGACGGTACA
GAATCAAGACGAGTGTCGGTGTAATTATTTTGCACATTTTCTTTATATAA
TATTTTATAAATTTTATGATTTTTTTAATATAATTAATTGAATTTTCTAA
AA
back to top

protein sequence of SMED30028261-orf-1

>SMED30028261-orf-1 ID=SMED30028261-orf-1|Name=SMED30028261-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=428bp
MLSNQIQLVSRFKLFQNGGMEDFSDRLSSKFSCLIFLTLGSVILFKQYWI
RPISCYFAVDPGGSNLIQYIESYCYVHGIIPISFNGTMPTKEKDWIAIDK
TRTLYYQWVPFALYGQAVMCYIPHIIWRFFRKRQNNADFNHIIQRANRAI
ELDDEKRKNEVIHLAQALKNILFQNRTCDSTSVLRREANRIHSKIIEWIK
MGIPLVIYYLVIKILYVTNAVGQIYLMKSFLRLNSSDYKFFGSKILNDII
HGKNWQVSKIFPRVGFCLGKFRHLGATNYVTAQCALPLNMLNEKVYIFLW
FWMLILSVISITSLFMWLIRMLISRNKTDFLNMYLKLSGDYTHRELKDKK
KIVKFEKIFLRNDGMFFLRILATNVGDLITAEVVSQLWKIYAPCYENTEL
DMEKLKKSCNKRGNSCSDGTESRRVSV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000035Category 3 cell
PLANA:0000054dorsal region of the epidermis
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR000990Innexin
Vocabulary: cellular component
TermDefinition
GO:0005921gap junction
GO:0005886plasma membrane
GO:0016020membrane
GO:0016021integral component of membrane
GO:0030054cell junction
Vocabulary: biological process
TermDefinition
GO:0006810transport
GO:0006811ion transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000990InnexinPRINTSPR01262INNEXINcoord: 209..223
score: 44.53
coord: 284..300
score: 57.18
coord: 105..127
score: 52.52
coord: 260..269
score: 48.4
coord: 73..82
score: 27.6
coord: 44..55
score: 42.67
IPR000990InnexinPFAMPF00876Innexincoord: 21..391
e-value: 5.5E-98
score: 328.5
IPR000990InnexinPANTHERPTHR11893INNEXINcoord: 8..401
IPR000990InnexinPROSITEPS51013PANNEXINcoord: 16..397
score: 28.692
NoneNo IPR availableTMHMMTMhelixcoord: 297..319
NoneNo IPR availableTMHMMTMhelixcoord: 108..130
NoneNo IPR availableTMHMMTMhelixcoord: 205..227
NoneNo IPR availableTMHMMTMhelixcoord: 31..50