RRM domain-containing protein

Overview
NameRRM domain-containing protein
Smed IDSMED30028255
Length (bp)1200
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of RRM domain-containing protein (SMED30028255) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for RRM domain-containing protein (SMED30028255) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of RRM domain-containing protein vs. Ensembl Human
Match: RBPMS (RNA binding protein, mRNA processing factor [Source:HGNC Symbol;Acc:HGNC:19097])

HSP 1 Score: 118.242 bits (295), Expect = 8.481e-31
Identity = 60/117 (51.28%), Postives = 81/117 (69.23%), Query Frame = 3
Query:  288 NNGNHGD-----SDASSANEEVRTIFVSGLPMDAKQRELYLLFRSFKGFQTATLKPPGKNGKPTAPVGFVTFETRNQAESAIEKLEGIKFDPDSDQLMRLEFARTNTKMLKNKICNS 623
            NNG   +     S+A+   EEVRT+FVSGLP+D K RELYLLFR FKG++ + +K   K      PVGFV+F++R++AE+A   L GI+FDP+  Q +RLEFA+ NTKM KNK+  +
Sbjct:    2 NNGGKAEKENTPSEANLQEEEVRTLFVSGLPLDIKPRELYLLFRPFKGYEGSLIKLTSKQ-----PVGFVSFDSRSEAEAAKNALNGIRFDPEIPQTLRLEFAKANTKMAKNKLVGT 113          
BLAST of RRM domain-containing protein vs. Ensembl Human
Match: RBPMS (RNA binding protein, mRNA processing factor [Source:HGNC Symbol;Acc:HGNC:19097])

HSP 1 Score: 117.857 bits (294), Expect = 9.170e-31
Identity = 60/117 (51.28%), Postives = 81/117 (69.23%), Query Frame = 3
Query:  288 NNGNHGD-----SDASSANEEVRTIFVSGLPMDAKQRELYLLFRSFKGFQTATLKPPGKNGKPTAPVGFVTFETRNQAESAIEKLEGIKFDPDSDQLMRLEFARTNTKMLKNKICNS 623
            NNG   +     S+A+   EEVRT+FVSGLP+D K RELYLLFR FKG++ + +K   K      PVGFV+F++R++AE+A   L GI+FDP+  Q +RLEFA+ NTKM KNK+  +
Sbjct:    2 NNGGKAEKENTPSEANLQEEEVRTLFVSGLPLDIKPRELYLLFRPFKGYEGSLIKLTSKQ-----PVGFVSFDSRSEAEAAKNALNGIRFDPEIPQTLRLEFAKANTKMAKNKLVGT 113          
BLAST of RRM domain-containing protein vs. Ensembl Human
Match: RBPMS (RNA binding protein, mRNA processing factor [Source:HGNC Symbol;Acc:HGNC:19097])

HSP 1 Score: 117.857 bits (294), Expect = 9.170e-31
Identity = 60/117 (51.28%), Postives = 81/117 (69.23%), Query Frame = 3
Query:  288 NNGNHGD-----SDASSANEEVRTIFVSGLPMDAKQRELYLLFRSFKGFQTATLKPPGKNGKPTAPVGFVTFETRNQAESAIEKLEGIKFDPDSDQLMRLEFARTNTKMLKNKICNS 623
            NNG   +     S+A+   EEVRT+FVSGLP+D K RELYLLFR FKG++ + +K   K      PVGFV+F++R++AE+A   L GI+FDP+  Q +RLEFA+ NTKM KNK+  +
Sbjct:    2 NNGGKAEKENTPSEANLQEEEVRTLFVSGLPLDIKPRELYLLFRPFKGYEGSLIKLTSKQ-----PVGFVSFDSRSEAEAAKNALNGIRFDPEIPQTLRLEFAKANTKMAKNKLVGT 113          
BLAST of RRM domain-containing protein vs. Ensembl Human
Match: RBPMS (RNA binding protein, mRNA processing factor [Source:HGNC Symbol;Acc:HGNC:19097])

HSP 1 Score: 118.242 bits (295), Expect = 1.760e-30
Identity = 60/117 (51.28%), Postives = 81/117 (69.23%), Query Frame = 3
Query:  288 NNGNHGD-----SDASSANEEVRTIFVSGLPMDAKQRELYLLFRSFKGFQTATLKPPGKNGKPTAPVGFVTFETRNQAESAIEKLEGIKFDPDSDQLMRLEFARTNTKMLKNKICNS 623
            NNG   +     S+A+   EEVRT+FVSGLP+D K RELYLLFR FKG++ + +K   K      PVGFV+F++R++AE+A   L GI+FDP+  Q +RLEFA+ NTKM KNK+  +
Sbjct:    2 NNGGKAEKENTPSEANLQEEEVRTLFVSGLPLDIKPRELYLLFRPFKGYEGSLIKLTSKQ-----PVGFVSFDSRSEAEAAKNALNGIRFDPEIPQTLRLEFAKANTKMAKNKLVGT 113          
BLAST of RRM domain-containing protein vs. Ensembl Human
Match: RBPMS (RNA binding protein, mRNA processing factor [Source:HGNC Symbol;Acc:HGNC:19097])

HSP 1 Score: 117.472 bits (293), Expect = 2.418e-30
Identity = 60/117 (51.28%), Postives = 81/117 (69.23%), Query Frame = 3
Query:  288 NNGNHGD-----SDASSANEEVRTIFVSGLPMDAKQRELYLLFRSFKGFQTATLKPPGKNGKPTAPVGFVTFETRNQAESAIEKLEGIKFDPDSDQLMRLEFARTNTKMLKNKICNS 623
            NNG   +     S+A+   EEVRT+FVSGLP+D K RELYLLFR FKG++ + +K   K      PVGFV+F++R++AE+A   L GI+FDP+  Q +RLEFA+ NTKM KNK+  +
Sbjct:    2 NNGGKAEKENTPSEANLQEEEVRTLFVSGLPLDIKPRELYLLFRPFKGYEGSLIKLTSKQ-----PVGFVSFDSRSEAEAAKNALNGIRFDPEIPQTLRLEFAKANTKMAKNKLVGT 113          
BLAST of RRM domain-containing protein vs. Ensembl Celegans
Match: mec-8 (Mec-8 protein [Source:UniProtKB/TrEMBL;Acc:G5ECJ4])

HSP 1 Score: 120.168 bits (300), Expect = 8.050e-31
Identity = 59/115 (51.30%), Postives = 86/115 (74.78%), Query Frame = 3
Query:  267 LCSNSTDNNGNHGDSDASSANEEVRTIFVSGLPMDAKQRELYLLFRSFKGFQTATLKPPGKNGKPTAPVGFVTFETRNQAESAIEKLEGIKFDPDSDQLMRLEFARTNTKMLKNK 611
            L S ++  + N   S+A++ ++ VRT+FVSGLPMDAK RELYLLFR  +G++ A LK   KNGKPT+PVGFVTF ++  A+ A + L+G++FDP+  Q++RLE A++NTK+ + K
Sbjct:    8 LASAASMESLNSVSSEATNPSQ-VRTLFVSGLPMDAKPRELYLLFRGCRGYEGALLKMTSKNGKPTSPVGFVTFLSQQDAQDARKMLQGVRFDPECAQVLRLELAKSNTKVARPK 121          
BLAST of RRM domain-containing protein vs. Ensembl Celegans
Match: mec-8 (Mec-8 protein [Source:UniProtKB/TrEMBL;Acc:G5ECJ4])

HSP 1 Score: 120.168 bits (300), Expect = 8.050e-31
Identity = 59/115 (51.30%), Postives = 86/115 (74.78%), Query Frame = 3
Query:  267 LCSNSTDNNGNHGDSDASSANEEVRTIFVSGLPMDAKQRELYLLFRSFKGFQTATLKPPGKNGKPTAPVGFVTFETRNQAESAIEKLEGIKFDPDSDQLMRLEFARTNTKMLKNK 611
            L S ++  + N   S+A++ ++ VRT+FVSGLPMDAK RELYLLFR  +G++ A LK   KNGKPT+PVGFVTF ++  A+ A + L+G++FDP+  Q++RLE A++NTK+ + K
Sbjct:    8 LASAASMESLNSVSSEATNPSQ-VRTLFVSGLPMDAKPRELYLLFRGCRGYEGALLKMTSKNGKPTSPVGFVTFLSQQDAQDARKMLQGVRFDPECAQVLRLELAKSNTKVARPK 121          
BLAST of RRM domain-containing protein vs. Ensembl Celegans
Match: mec-8 (Mec-8 protein [Source:UniProtKB/TrEMBL;Acc:G5ECJ4])

HSP 1 Score: 120.168 bits (300), Expect = 8.050e-31
Identity = 59/115 (51.30%), Postives = 86/115 (74.78%), Query Frame = 3
Query:  267 LCSNSTDNNGNHGDSDASSANEEVRTIFVSGLPMDAKQRELYLLFRSFKGFQTATLKPPGKNGKPTAPVGFVTFETRNQAESAIEKLEGIKFDPDSDQLMRLEFARTNTKMLKNK 611
            L S ++  + N   S+A++ ++ VRT+FVSGLPMDAK RELYLLFR  +G++ A LK   KNGKPT+PVGFVTF ++  A+ A + L+G++FDP+  Q++RLE A++NTK+ + K
Sbjct:    8 LASAASMESLNSVSSEATNPSQ-VRTLFVSGLPMDAKPRELYLLFRGCRGYEGALLKMTSKNGKPTSPVGFVTFLSQQDAQDARKMLQGVRFDPECAQVLRLELAKSNTKVARPK 121          
BLAST of RRM domain-containing protein vs. Ensembl Fly
Match: cpo (gene:FBgn0263995 transcript:FBtr0330279)

HSP 1 Score: 131.339 bits (329), Expect = 4.261e-33
Identity = 60/100 (60.00%), Postives = 79/100 (79.00%), Query Frame = 3
Query:  312 DASSANEEVRTIFVSGLPMDAKQRELYLLFRSFKGFQTATLKPPGKNGKPTAPVGFVTFETRNQAESAIEKLEGIKFDPDSDQLMRLEFARTNTKMLKNK 611
            + +S  EEVRT+FVSGLPMDAK RELYLLFR+++G++ + LK   KNGK  +PVGFVTF TR  AE+A + L+G++FDPD  Q +RLEFA++NTK+ K K
Sbjct:  433 NTASNEEEVRTLFVSGLPMDAKPRELYLLFRAYEGYEGSLLKVTSKNGKTASPVGFVTFHTRAGAEAAKQDLQGVRFDPDMPQTIRLEFAKSNTKVSKPK 532          
BLAST of RRM domain-containing protein vs. Ensembl Fly
Match: cpo (gene:FBgn0263995 transcript:FBtr0330280)

HSP 1 Score: 131.339 bits (329), Expect = 4.261e-33
Identity = 60/100 (60.00%), Postives = 79/100 (79.00%), Query Frame = 3
Query:  312 DASSANEEVRTIFVSGLPMDAKQRELYLLFRSFKGFQTATLKPPGKNGKPTAPVGFVTFETRNQAESAIEKLEGIKFDPDSDQLMRLEFARTNTKMLKNK 611
            + +S  EEVRT+FVSGLPMDAK RELYLLFR+++G++ + LK   KNGK  +PVGFVTF TR  AE+A + L+G++FDPD  Q +RLEFA++NTK+ K K
Sbjct:  433 NTASNEEEVRTLFVSGLPMDAKPRELYLLFRAYEGYEGSLLKVTSKNGKTASPVGFVTFHTRAGAEAAKQDLQGVRFDPDMPQTIRLEFAKSNTKVSKPK 532          
BLAST of RRM domain-containing protein vs. Ensembl Fly
Match: cpo (gene:FBgn0263995 transcript:FBtr0330278)

HSP 1 Score: 131.339 bits (329), Expect = 4.261e-33
Identity = 60/100 (60.00%), Postives = 79/100 (79.00%), Query Frame = 3
Query:  312 DASSANEEVRTIFVSGLPMDAKQRELYLLFRSFKGFQTATLKPPGKNGKPTAPVGFVTFETRNQAESAIEKLEGIKFDPDSDQLMRLEFARTNTKMLKNK 611
            + +S  EEVRT+FVSGLPMDAK RELYLLFR+++G++ + LK   KNGK  +PVGFVTF TR  AE+A + L+G++FDPD  Q +RLEFA++NTK+ K K
Sbjct:  433 NTASNEEEVRTLFVSGLPMDAKPRELYLLFRAYEGYEGSLLKVTSKNGKTASPVGFVTFHTRAGAEAAKQDLQGVRFDPDMPQTIRLEFAKSNTKVSKPK 532          
BLAST of RRM domain-containing protein vs. Ensembl Fly
Match: cpo (gene:FBgn0263995 transcript:FBtr0330276)

HSP 1 Score: 131.339 bits (329), Expect = 4.261e-33
Identity = 60/100 (60.00%), Postives = 79/100 (79.00%), Query Frame = 3
Query:  312 DASSANEEVRTIFVSGLPMDAKQRELYLLFRSFKGFQTATLKPPGKNGKPTAPVGFVTFETRNQAESAIEKLEGIKFDPDSDQLMRLEFARTNTKMLKNK 611
            + +S  EEVRT+FVSGLPMDAK RELYLLFR+++G++ + LK   KNGK  +PVGFVTF TR  AE+A + L+G++FDPD  Q +RLEFA++NTK+ K K
Sbjct:  433 NTASNEEEVRTLFVSGLPMDAKPRELYLLFRAYEGYEGSLLKVTSKNGKTASPVGFVTFHTRAGAEAAKQDLQGVRFDPDMPQTIRLEFAKSNTKVSKPK 532          
BLAST of RRM domain-containing protein vs. Ensembl Fly
Match: cpo (gene:FBgn0263995 transcript:FBtr0330269)

HSP 1 Score: 131.339 bits (329), Expect = 4.261e-33
Identity = 60/100 (60.00%), Postives = 79/100 (79.00%), Query Frame = 3
Query:  312 DASSANEEVRTIFVSGLPMDAKQRELYLLFRSFKGFQTATLKPPGKNGKPTAPVGFVTFETRNQAESAIEKLEGIKFDPDSDQLMRLEFARTNTKMLKNK 611
            + +S  EEVRT+FVSGLPMDAK RELYLLFR+++G++ + LK   KNGK  +PVGFVTF TR  AE+A + L+G++FDPD  Q +RLEFA++NTK+ K K
Sbjct:  433 NTASNEEEVRTLFVSGLPMDAKPRELYLLFRAYEGYEGSLLKVTSKNGKTASPVGFVTFHTRAGAEAAKQDLQGVRFDPDMPQTIRLEFAKSNTKVSKPK 532          
BLAST of RRM domain-containing protein vs. Ensembl Zebrafish
Match: rbpms2a (RNA binding protein, mRNA processing factor 2a [Source:ZFIN;Acc:ZDB-GENE-040718-106])

HSP 1 Score: 114.775 bits (286), Expect = 8.978e-30
Identity = 57/98 (58.16%), Postives = 73/98 (74.49%), Query Frame = 3
Query:  321 SANEEVRTIFVSGLPMDAKQRELYLLFRSFKGFQTATLKPPGKNGKPTAPVGFVTFETRNQAESAIEKLEGIKFDPDSDQLMRLEFARTNTKMLKNKI 614
            S  EEVRT+FVSGLP+D K RELYLLFR FKG++ + +K   K      PVGFVTF++R+ AE+A   L GI+FDP+S Q +RLEFA+ NTKM K+K+
Sbjct:   14 SLEEEVRTLFVSGLPVDIKPRELYLLFRPFKGYEGSLIKLTSKQ-----PVGFVTFDSRSGAEAAKNALNGIRFDPESPQTLRLEFAKANTKMAKSKL 106          
BLAST of RRM domain-containing protein vs. Ensembl Zebrafish
Match: rbpms2a (RNA binding protein, mRNA processing factor 2a [Source:ZFIN;Acc:ZDB-GENE-040718-106])

HSP 1 Score: 114.775 bits (286), Expect = 8.978e-30
Identity = 57/98 (58.16%), Postives = 73/98 (74.49%), Query Frame = 3
Query:  321 SANEEVRTIFVSGLPMDAKQRELYLLFRSFKGFQTATLKPPGKNGKPTAPVGFVTFETRNQAESAIEKLEGIKFDPDSDQLMRLEFARTNTKMLKNKI 614
            S  EEVRT+FVSGLP+D K RELYLLFR FKG++ + +K   K      PVGFVTF++R+ AE+A   L GI+FDP+S Q +RLEFA+ NTKM K+K+
Sbjct:   14 SLEEEVRTLFVSGLPVDIKPRELYLLFRPFKGYEGSLIKLTSKQ-----PVGFVTFDSRSGAEAAKNALNGIRFDPESPQTLRLEFAKANTKMAKSKL 106          
BLAST of RRM domain-containing protein vs. Ensembl Zebrafish
Match: rbpms2b (RNA binding protein, mRNA processing factor 2b [Source:ZFIN;Acc:ZDB-GENE-040426-741])

HSP 1 Score: 112.464 bits (280), Expect = 5.104e-29
Identity = 55/101 (54.46%), Postives = 73/101 (72.28%), Query Frame = 3
Query:  321 SANEEVRTIFVSGLPMDAKQRELYLLFRSFKGFQTATLKPPGKNGKPTAPVGFVTFETRNQAESAIEKLEGIKFDPDSDQLMRLEFARTNTKMLKNKICNS 623
            S  EEVRT+FVSGLP D K RELYLLFR FKG++ + +K   K      PVGFVTF++R+ AE+A   L G++FDP++ Q +RLEFA+ NTKM K+K+  +
Sbjct:   14 SLEEEVRTLFVSGLPTDIKPRELYLLFRPFKGYEGSLIKLTSKQ-----PVGFVTFDSRSGAEAAKNALNGVRFDPENPQTLRLEFAKANTKMAKSKLMGT 109          
BLAST of RRM domain-containing protein vs. Ensembl Zebrafish
Match: rbpms2b (RNA binding protein, mRNA processing factor 2b [Source:ZFIN;Acc:ZDB-GENE-040426-741])

HSP 1 Score: 112.464 bits (280), Expect = 5.104e-29
Identity = 55/101 (54.46%), Postives = 73/101 (72.28%), Query Frame = 3
Query:  321 SANEEVRTIFVSGLPMDAKQRELYLLFRSFKGFQTATLKPPGKNGKPTAPVGFVTFETRNQAESAIEKLEGIKFDPDSDQLMRLEFARTNTKMLKNKICNS 623
            S  EEVRT+FVSGLP D K RELYLLFR FKG++ + +K   K      PVGFVTF++R+ AE+A   L G++FDP++ Q +RLEFA+ NTKM K+K+  +
Sbjct:   14 SLEEEVRTLFVSGLPTDIKPRELYLLFRPFKGYEGSLIKLTSKQ-----PVGFVTFDSRSGAEAAKNALNGVRFDPENPQTLRLEFAKANTKMAKSKLMGT 109          
BLAST of RRM domain-containing protein vs. Ensembl Zebrafish
Match: rbpms2b (RNA binding protein, mRNA processing factor 2b [Source:ZFIN;Acc:ZDB-GENE-040426-741])

HSP 1 Score: 112.079 bits (279), Expect = 1.124e-28
Identity = 55/101 (54.46%), Postives = 73/101 (72.28%), Query Frame = 3
Query:  321 SANEEVRTIFVSGLPMDAKQRELYLLFRSFKGFQTATLKPPGKNGKPTAPVGFVTFETRNQAESAIEKLEGIKFDPDSDQLMRLEFARTNTKMLKNKICNS 623
            S  EEVRT+FVSGLP D K RELYLLFR FKG++ + +K   K      PVGFVTF++R+ AE+A   L G++FDP++ Q +RLEFA+ NTKM K+K+  +
Sbjct:   14 SLEEEVRTLFVSGLPTDIKPRELYLLFRPFKGYEGSLIKLTSKQ-----PVGFVTFDSRSGAEAAKNALNGVRFDPENPQTLRLEFAKANTKMAKSKLMGT 109          
BLAST of RRM domain-containing protein vs. Ensembl Xenopus
Match: rbpms (RNA binding protein with multiple splicing [Source:NCBI gene;Acc:100038229])

HSP 1 Score: 114.39 bits (285), Expect = 1.495e-29
Identity = 58/117 (49.57%), Postives = 80/117 (68.38%), Query Frame = 3
Query:  273 SNSTDNNGNHGDSDASSANEEVRTIFVSGLPMDAKQRELYLLFRSFKGFQTATLKPPGKNGKPTAPVGFVTFETRNQAESAIEKLEGIKFDPDSDQLMRLEFARTNTKMLKNKICNS 623
            SN  +  G+    + S   EEVRT+FVSGLP+D K RELYLLFR FKG++ + +K   K      PVGFV+F++R++AE+A   L GI+FDP+  Q +RLEFA+ NTKM K+K+  +
Sbjct:    3 SNIAEKEGSQ--DEISLPEEEVRTLFVSGLPLDIKPRELYLLFRPFKGYEGSLIKLTSKQ-----PVGFVSFDSRSEAEAAKNALNGIRFDPEIPQTLRLEFAKANTKMAKSKLVGT 112          
BLAST of RRM domain-containing protein vs. Ensembl Xenopus
Match: rbpms (RNA binding protein with multiple splicing [Source:NCBI gene;Acc:100038229])

HSP 1 Score: 114.39 bits (285), Expect = 1.636e-29
Identity = 58/117 (49.57%), Postives = 80/117 (68.38%), Query Frame = 3
Query:  273 SNSTDNNGNHGDSDASSANEEVRTIFVSGLPMDAKQRELYLLFRSFKGFQTATLKPPGKNGKPTAPVGFVTFETRNQAESAIEKLEGIKFDPDSDQLMRLEFARTNTKMLKNKICNS 623
            SN  +  G+    + S   EEVRT+FVSGLP+D K RELYLLFR FKG++ + +K   K      PVGFV+F++R++AE+A   L GI+FDP+  Q +RLEFA+ NTKM K+K+  +
Sbjct:    3 SNIAEKEGSQ--DEISLPEEEVRTLFVSGLPLDIKPRELYLLFRPFKGYEGSLIKLTSKQ-----PVGFVSFDSRSEAEAAKNALNGIRFDPEIPQTLRLEFAKANTKMAKSKLVGT 112          
BLAST of RRM domain-containing protein vs. Ensembl Xenopus
Match: rbpms (RNA binding protein with multiple splicing [Source:NCBI gene;Acc:100038229])

HSP 1 Score: 114.775 bits (286), Expect = 3.689e-29
Identity = 58/117 (49.57%), Postives = 80/117 (68.38%), Query Frame = 3
Query:  273 SNSTDNNGNHGDSDASSANEEVRTIFVSGLPMDAKQRELYLLFRSFKGFQTATLKPPGKNGKPTAPVGFVTFETRNQAESAIEKLEGIKFDPDSDQLMRLEFARTNTKMLKNKICNS 623
            SN  +  G+    + S   EEVRT+FVSGLP+D K RELYLLFR FKG++ + +K   K      PVGFV+F++R++AE+A   L GI+FDP+  Q +RLEFA+ NTKM K+K+  +
Sbjct:    3 SNIAEKEGSQ--DEISLPEEEVRTLFVSGLPLDIKPRELYLLFRPFKGYEGSLIKLTSKQ-----PVGFVSFDSRSEAEAAKNALNGIRFDPEIPQTLRLEFAKANTKMAKSKLVGT 112          
BLAST of RRM domain-containing protein vs. Ensembl Xenopus
Match: RBPMS2 (RNA binding protein with multiple splicing 2 [Source:NCBI gene;Acc:100038109])

HSP 1 Score: 109.383 bits (272), Expect = 1.161e-27
Identity = 55/99 (55.56%), Postives = 71/99 (71.72%), Query Frame = 3
Query:  318 SSANEEVRTIFVSGLPMDAKQRELYLLFRSFKGFQTATLKPPGKNGKPTAPVGFVTFETRNQAESAIEKLEGIKFDPDSDQLMRLEFARTNTKMLKNKI 614
            S++   VRT+FVSGLP+D K RELYLLFR FKG++ + +K   K      PVGFVTF+ R  AE+A   L GI+FDP++ Q +RLEFA+ NTKM KNK+
Sbjct:   11 SASGPNVRTLFVSGLPIDIKPRELYLLFRPFKGYEGSLIKLTSKQ-----PVGFVTFDNRAGAEAAKNALNGIRFDPENPQTLRLEFAKANTKMAKNKL 104          
BLAST of RRM domain-containing protein vs. Ensembl Xenopus
Match: RBPMS2 (RNA binding protein with multiple splicing 2 [Source:NCBI gene;Acc:100038109])

HSP 1 Score: 108.612 bits (270), Expect = 2.950e-27
Identity = 54/93 (58.06%), Postives = 68/93 (73.12%), Query Frame = 3
Query:  336 VRTIFVSGLPMDAKQRELYLLFRSFKGFQTATLKPPGKNGKPTAPVGFVTFETRNQAESAIEKLEGIKFDPDSDQLMRLEFARTNTKMLKNKI 614
            VRT+FVSGLP+D K RELYLLFR FKG++ + +K   K      PVGFVTF+ R  AE+A   L GI+FDP++ Q +RLEFA+ NTKM KNK+
Sbjct:   19 VRTLFVSGLPIDIKPRELYLLFRPFKGYEGSLIKLTSKQ-----PVGFVTFDNRAGAEAAKNALNGIRFDPENPQTLRLEFAKANTKMAKNKL 106          
BLAST of RRM domain-containing protein vs. Ensembl Mouse
Match: Rbpms (RNA binding protein gene with multiple splicing [Source:MGI Symbol;Acc:MGI:1334446])

HSP 1 Score: 116.316 bits (290), Expect = 2.272e-30
Identity = 57/105 (54.29%), Postives = 77/105 (73.33%), Query Frame = 3
Query:  309 SDASSANEEVRTIFVSGLPMDAKQRELYLLFRSFKGFQTATLKPPGKNGKPTAPVGFVTFETRNQAESAIEKLEGIKFDPDSDQLMRLEFARTNTKMLKNKICNS 623
            S+A+   EEVRT+FVSGLP+D K RELYLLFR FKG++ + +K   K      PVGFV+F++R++AE+A   L GI+FDP+  Q +RLEFA+ NTKM KNK+  +
Sbjct:   14 SEANLQEEEVRTLFVSGLPLDIKPRELYLLFRPFKGYEGSLIKLTSKQ-----PVGFVSFDSRSEAEAAKNALNGIRFDPEIPQTLRLEFAKANTKMAKNKLVGT 113          
BLAST of RRM domain-containing protein vs. Ensembl Mouse
Match: Rbpms (RNA binding protein gene with multiple splicing [Source:MGI Symbol;Acc:MGI:1334446])

HSP 1 Score: 116.316 bits (290), Expect = 3.016e-30
Identity = 57/105 (54.29%), Postives = 77/105 (73.33%), Query Frame = 3
Query:  309 SDASSANEEVRTIFVSGLPMDAKQRELYLLFRSFKGFQTATLKPPGKNGKPTAPVGFVTFETRNQAESAIEKLEGIKFDPDSDQLMRLEFARTNTKMLKNKICNS 623
            S+A+   EEVRT+FVSGLP+D K RELYLLFR FKG++ + +K   K      PVGFV+F++R++AE+A   L GI+FDP+  Q +RLEFA+ NTKM KNK+  +
Sbjct:   14 SEANLQEEEVRTLFVSGLPLDIKPRELYLLFRPFKGYEGSLIKLTSKQ-----PVGFVSFDSRSEAEAAKNALNGIRFDPEIPQTLRLEFAKANTKMAKNKLVGT 113          
BLAST of RRM domain-containing protein vs. Ensembl Mouse
Match: Rbpms (RNA binding protein gene with multiple splicing [Source:MGI Symbol;Acc:MGI:1334446])

HSP 1 Score: 116.316 bits (290), Expect = 3.016e-30
Identity = 57/105 (54.29%), Postives = 77/105 (73.33%), Query Frame = 3
Query:  309 SDASSANEEVRTIFVSGLPMDAKQRELYLLFRSFKGFQTATLKPPGKNGKPTAPVGFVTFETRNQAESAIEKLEGIKFDPDSDQLMRLEFARTNTKMLKNKICNS 623
            S+A+   EEVRT+FVSGLP+D K RELYLLFR FKG++ + +K   K      PVGFV+F++R++AE+A   L GI+FDP+  Q +RLEFA+ NTKM KNK+  +
Sbjct:   14 SEANLQEEEVRTLFVSGLPLDIKPRELYLLFRPFKGYEGSLIKLTSKQ-----PVGFVSFDSRSEAEAAKNALNGIRFDPEIPQTLRLEFAKANTKMAKNKLVGT 113          
BLAST of RRM domain-containing protein vs. Ensembl Mouse
Match: Rbpms (RNA binding protein gene with multiple splicing [Source:MGI Symbol;Acc:MGI:1334446])

HSP 1 Score: 116.316 bits (290), Expect = 3.016e-30
Identity = 57/105 (54.29%), Postives = 77/105 (73.33%), Query Frame = 3
Query:  309 SDASSANEEVRTIFVSGLPMDAKQRELYLLFRSFKGFQTATLKPPGKNGKPTAPVGFVTFETRNQAESAIEKLEGIKFDPDSDQLMRLEFARTNTKMLKNKICNS 623
            S+A+   EEVRT+FVSGLP+D K RELYLLFR FKG++ + +K   K      PVGFV+F++R++AE+A   L GI+FDP+  Q +RLEFA+ NTKM KNK+  +
Sbjct:   14 SEANLQEEEVRTLFVSGLPLDIKPRELYLLFRPFKGYEGSLIKLTSKQ-----PVGFVSFDSRSEAEAAKNALNGIRFDPEIPQTLRLEFAKANTKMAKNKLVGT 113          
BLAST of RRM domain-containing protein vs. Ensembl Mouse
Match: Rbpms (RNA binding protein gene with multiple splicing [Source:MGI Symbol;Acc:MGI:1334446])

HSP 1 Score: 115.546 bits (288), Expect = 8.663e-30
Identity = 57/105 (54.29%), Postives = 77/105 (73.33%), Query Frame = 3
Query:  309 SDASSANEEVRTIFVSGLPMDAKQRELYLLFRSFKGFQTATLKPPGKNGKPTAPVGFVTFETRNQAESAIEKLEGIKFDPDSDQLMRLEFARTNTKMLKNKICNS 623
            S+A+   EEVRT+FVSGLP+D K RELYLLFR FKG++ + +K   K      PVGFV+F++R++AE+A   L GI+FDP+  Q +RLEFA+ NTKM KNK+  +
Sbjct:   14 SEANLQEEEVRTLFVSGLPLDIKPRELYLLFRPFKGYEGSLIKLTSKQ-----PVGFVSFDSRSEAEAAKNALNGIRFDPEIPQTLRLEFAKANTKMAKNKLVGT 113          
BLAST of RRM domain-containing protein vs. UniProt/SwissProt
Match: sp|Q01617|CPO_DROME (Protein couch potato OS=Drosophila melanogaster OX=7227 GN=cpo PE=2 SV=4)

HSP 1 Score: 131.339 bits (329), Expect = 4.271e-32
Identity = 60/100 (60.00%), Postives = 79/100 (79.00%), Query Frame = 3
Query:  312 DASSANEEVRTIFVSGLPMDAKQRELYLLFRSFKGFQTATLKPPGKNGKPTAPVGFVTFETRNQAESAIEKLEGIKFDPDSDQLMRLEFARTNTKMLKNK 611
            + +S  EEVRT+FVSGLPMDAK RELYLLFR+++G++ + LK   KNGK  +PVGFVTF TR  AE+A + L+G++FDPD  Q +RLEFA++NTK+ K K
Sbjct:  433 NTASNEEEVRTLFVSGLPMDAKPRELYLLFRAYEGYEGSLLKVTSKNGKTASPVGFVTFHTRAGAEAAKQDLQGVRFDPDMPQTIRLEFAKSNTKVSKPK 532          
BLAST of RRM domain-containing protein vs. UniProt/SwissProt
Match: sp|Q93062|RBPMS_HUMAN (RNA-binding protein with multiple splicing OS=Homo sapiens OX=9606 GN=RBPMS PE=1 SV=1)

HSP 1 Score: 117.857 bits (294), Expect = 4.404e-30
Identity = 60/117 (51.28%), Postives = 81/117 (69.23%), Query Frame = 3
Query:  288 NNGNHGD-----SDASSANEEVRTIFVSGLPMDAKQRELYLLFRSFKGFQTATLKPPGKNGKPTAPVGFVTFETRNQAESAIEKLEGIKFDPDSDQLMRLEFARTNTKMLKNKICNS 623
            NNG   +     S+A+   EEVRT+FVSGLP+D K RELYLLFR FKG++ + +K   K      PVGFV+F++R++AE+A   L GI+FDP+  Q +RLEFA+ NTKM KNK+  +
Sbjct:    2 NNGGKAEKENTPSEANLQEEEVRTLFVSGLPLDIKPRELYLLFRPFKGYEGSLIKLTSKQ-----PVGFVSFDSRSEAEAAKNALNGIRFDPEIPQTLRLEFAKANTKMAKNKLVGT 113          
BLAST of RRM domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9WVB0|RBPMS_MOUSE (RNA-binding protein with multiple splicing OS=Mus musculus OX=10090 GN=Rbpms PE=1 SV=2)

HSP 1 Score: 116.316 bits (290), Expect = 2.110e-29
Identity = 57/105 (54.29%), Postives = 77/105 (73.33%), Query Frame = 3
Query:  309 SDASSANEEVRTIFVSGLPMDAKQRELYLLFRSFKGFQTATLKPPGKNGKPTAPVGFVTFETRNQAESAIEKLEGIKFDPDSDQLMRLEFARTNTKMLKNKICNS 623
            S+A+   EEVRT+FVSGLP+D K RELYLLFR FKG++ + +K   K      PVGFV+F++R++AE+A   L GI+FDP+  Q +RLEFA+ NTKM KNK+  +
Sbjct:   14 SEANLQEEEVRTLFVSGLPLDIKPRELYLLFRPFKGYEGSLIKLTSKQ-----PVGFVSFDSRSEAEAAKNALNGIRFDPEIPQTLRLEFAKANTKMAKNKLVGT 113          
BLAST of RRM domain-containing protein vs. UniProt/SwissProt
Match: sp|Q6DH13|RBP2A_DANRE (RNA-binding protein, mRNA-processing factor 2a OS=Danio rerio OX=7955 GN=rbpms2a PE=1 SV=1)

HSP 1 Score: 114.775 bits (286), Expect = 6.778e-29
Identity = 57/98 (58.16%), Postives = 73/98 (74.49%), Query Frame = 3
Query:  321 SANEEVRTIFVSGLPMDAKQRELYLLFRSFKGFQTATLKPPGKNGKPTAPVGFVTFETRNQAESAIEKLEGIKFDPDSDQLMRLEFARTNTKMLKNKI 614
            S  EEVRT+FVSGLP+D K RELYLLFR FKG++ + +K   K      PVGFVTF++R+ AE+A   L GI+FDP+S Q +RLEFA+ NTKM K+K+
Sbjct:   14 SLEEEVRTLFVSGLPVDIKPRELYLLFRPFKGYEGSLIKLTSKQ-----PVGFVTFDSRSGAEAAKNALNGIRFDPESPQTLRLEFAKANTKMAKSKL 106          
BLAST of RRM domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9W6I1|RBPS2_CHICK (RNA-binding protein with multiple splicing 2 OS=Gallus gallus OX=9031 GN=RBPMS2 PE=1 SV=1)

HSP 1 Score: 111.309 bits (277), Expect = 1.540e-27
Identity = 55/96 (57.29%), Postives = 71/96 (73.96%), Query Frame = 3
Query:  327 NEEVRTIFVSGLPMDAKQRELYLLFRSFKGFQTATLKPPGKNGKPTAPVGFVTFETRNQAESAIEKLEGIKFDPDSDQLMRLEFARTNTKMLKNKI 614
             EEVRT+FVSGLP+D K RELYLLFR FKG++ + +K   K      PVGFVTF++R  AE+A   L GI+FDP++ Q +RLEFA+ NTKM K+K+
Sbjct:   18 EEEVRTLFVSGLPVDIKPRELYLLFRPFKGYEGSLIKLTSKQ-----PVGFVTFDSRAGAEAAKNALNGIRFDPENPQTLRLEFAKANTKMAKSKL 108          
BLAST of RRM domain-containing protein vs. TrEMBL
Match: G7YDR0 (Protein couch potato (Fragment) OS=Clonorchis sinensis OX=79923 GN=CLF_105578 PE=4 SV=1)

HSP 1 Score: 160.229 bits (404), Expect = 3.192e-41
Identity = 78/132 (59.09%), Postives = 100/132 (75.76%), Query Frame = 3
Query:  246 ISDGCNVLCSNSTDN------NGNHGDSDASSANEEVRTIFVSGLPMDAKQRELYLLFRSFKGFQTATLKPPGKNGKPTAPVGFVTFETRNQAESAIEKLEGIKFDPDSDQLMRLEFARTNTKMLKNKICNS 623
            +S+   ++ S S D+      NG   D++      +VRTIFVSGLP+DAK RELYLLFR FKG+Q++TLKP GKNGKPTAPVGFVTF++R QAE A+ KL+G+KFDP+ +QLMRLEFARTNTK+ K K  ++
Sbjct:   50 LSENSMMVLSQSVDSLHTLATNGGVDDTE-----HQVRTIFVSGLPLDAKPRELYLLFRGFKGYQSSTLKPAGKNGKPTAPVGFVTFDSREQAEDAMRKLQGVKFDPEGNQLMRLEFARTNTKVTKPKFISA 176          
BLAST of RRM domain-containing protein vs. TrEMBL
Match: A0A4S2LLM9 (RRM domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_007910 PE=4 SV=1)

HSP 1 Score: 160.229 bits (404), Expect = 1.588e-40
Identity = 77/132 (58.33%), Postives = 100/132 (75.76%), Query Frame = 3
Query:  246 ISDGCNVLCSNSTDN------NGNHGDSDASSANEEVRTIFVSGLPMDAKQRELYLLFRSFKGFQTATLKPPGKNGKPTAPVGFVTFETRNQAESAIEKLEGIKFDPDSDQLMRLEFARTNTKMLKNKICNS 623
            +S+   ++ S S D+      NG   D++      +VRT+FVSGLP+DAK RELYLLFR FKG+Q++TLKP GKNGKPTAPVGFVTF++R QAE A+ KL+G+KFDP+ +QLMRLEFARTNTK+ K K  ++
Sbjct:   50 LSENSMMVLSQSVDSLHTLATNGGVDDTE-----HQVRTVFVSGLPLDAKPRELYLLFRGFKGYQSSTLKPAGKNGKPTAPVGFVTFDSREQAEDAMRKLQGVKFDPEGNQLMRLEFARTNTKVTKPKFISA 176          
BLAST of RRM domain-containing protein vs. TrEMBL
Match: A0A419PL37 (Protein couch potato (Fragment) OS=Clonorchis sinensis OX=79923 GN=cpo PE=4 SV=1)

HSP 1 Score: 158.688 bits (400), Expect = 7.359e-40
Identity = 71/98 (72.45%), Postives = 86/98 (87.76%), Query Frame = 3
Query:  330 EEVRTIFVSGLPMDAKQRELYLLFRSFKGFQTATLKPPGKNGKPTAPVGFVTFETRNQAESAIEKLEGIKFDPDSDQLMRLEFARTNTKMLKNKICNS 623
             +VRTIFVSGLP+DAK RELYLLFR FKG+Q++TLKP GKNGKPTAPVGFVTF++R QAE A+ KL+G+KFDP+ +QLMRLEFARTNTK+ K K  ++
Sbjct:    1 HQVRTIFVSGLPLDAKPRELYLLFRGFKGYQSSTLKPAGKNGKPTAPVGFVTFDSREQAEDAMRKLQGVKFDPEGNQLMRLEFARTNTKVTKPKFISA 98          
BLAST of RRM domain-containing protein vs. TrEMBL
Match: A0A4Z2DUC2 (Protein couch potato OS=Schistosoma japonicum OX=6182 GN=EWB00_005100 PE=4 SV=1)

HSP 1 Score: 156.762 bits (395), Expect = 3.227e-39
Identity = 74/117 (63.25%), Postives = 92/117 (78.63%), Query Frame = 3
Query:  264 VLCSNSTDNNGNHGDSDASSANEEVRTIFVSGLPMDAKQRELYLLFRSFKGFQTATLKPPGKNGKPTAPVGFVTFETRNQAESAIEKLEGIKFDPDSDQLMRLEFARTNTKMLKNKI 614
            ++ S S D+    G ++      +VRT+FVSGLP+DAK RELYLLFRSFKG+ ++TLKP GKNGK TAPVGFVTFE+R QAE A+ KL+G+KFDPD +Q MRLEFAR+NTK+ K KI
Sbjct:   69 MILSQSIDSIHTVGTNNGEGTEHQVRTLFVSGLPLDAKPRELYLLFRSFKGYLSSTLKPAGKNGKLTAPVGFVTFESREQAEEAMTKLQGVKFDPDGNQHMRLEFARSNTKVTKPKI 185          
BLAST of RRM domain-containing protein vs. TrEMBL
Match: A0A5J4P0Y0 (RRM domain-containing protein OS=Paragonimus westermani OX=34504 GN=DEA37_0006615 PE=4 SV=1)

HSP 1 Score: 157.532 bits (397), Expect = 3.371e-39
Identity = 76/117 (64.96%), Postives = 92/117 (78.63%), Query Frame = 3
Query:  315 ASSANEEVRTIFVSGLPMDAKQRELYLLFRSFKGFQTATLKPPGKNGKPTAPVGFVTFETRNQAESAIEKLEGIKFDPDSDQLMRLEFARTNTKMLKNKICNSHIYNSGLNQQLSAG 665
            A  +  +VRT+FVSGLP+DAK RELYLLFRSFKG+Q++TLKP GKNGK TAPVGFVTFE+R QAE A+ KL+G+KFDP+ +Q MRLEFARTNTK+ K K   S     G NQ ++A 
Sbjct:  136 ADESEHQVRTVFVSGLPLDAKPRELYLLFRSFKGYQSSTLKPAGKNGKLTAPVGFVTFESREQAEEAMTKLQGVKFDPEGNQHMRLEFARTNTKVTKPKFNTSPGGFCGSNQTMNAA 252          
BLAST of RRM domain-containing protein vs. Ensembl Cavefish
Match: rbpms (RNA binding protein, mRNA processing factor [Source:NCBI gene;Acc:103026653])

HSP 1 Score: 117.857 bits (294), Expect = 5.431e-31
Identity = 57/105 (54.29%), Postives = 78/105 (74.29%), Query Frame = 3
Query:  309 SDASSANEEVRTIFVSGLPMDAKQRELYLLFRSFKGFQTATLKPPGKNGKPTAPVGFVTFETRNQAESAIEKLEGIKFDPDSDQLMRLEFARTNTKMLKNKICNS 623
            S+ SSA EEVRT+FVSGLP+D K RELYLLFR FKG++ + +K   K      PVGFV+F++R++AE+A   L G++FDP+  Q +RLEFA+ NTKM K+K+  +
Sbjct:   12 SEYSSAEEEVRTLFVSGLPLDIKPRELYLLFRPFKGYEGSLIKLTSKQ-----PVGFVSFDSRSEAEAAKNALNGVRFDPEIPQTLRLEFAKANTKMAKSKLVGT 111          
BLAST of RRM domain-containing protein vs. Ensembl Cavefish
Match: rbpms2a (RNA-binding protein with multiple splicing 2 [Source:NCBI gene;Acc:103041081])

HSP 1 Score: 112.849 bits (281), Expect = 4.686e-29
Identity = 56/98 (57.14%), Postives = 73/98 (74.49%), Query Frame = 3
Query:  321 SANEEVRTIFVSGLPMDAKQRELYLLFRSFKGFQTATLKPPGKNGKPTAPVGFVTFETRNQAESAIEKLEGIKFDPDSDQLMRLEFARTNTKMLKNKI 614
            S  EEVRT+FVSGLP+D K RELYLLFR FKG++ + +K   K      PVGFVTF++R+ AE+A   L GI+FDP++ Q +RLEFA+ NTKM K+K+
Sbjct:   14 SLEEEVRTLFVSGLPVDIKPRELYLLFRPFKGYEGSLIKLTSKQ-----PVGFVTFDSRSGAEAAKNALNGIRFDPENPQTLRLEFAKANTKMAKSKL 106          
BLAST of RRM domain-containing protein vs. Ensembl Cavefish
Match: rbpms2a (RNA-binding protein with multiple splicing 2 [Source:NCBI gene;Acc:103041081])

HSP 1 Score: 112.849 bits (281), Expect = 4.686e-29
Identity = 56/98 (57.14%), Postives = 73/98 (74.49%), Query Frame = 3
Query:  321 SANEEVRTIFVSGLPMDAKQRELYLLFRSFKGFQTATLKPPGKNGKPTAPVGFVTFETRNQAESAIEKLEGIKFDPDSDQLMRLEFARTNTKMLKNKI 614
            S  EEVRT+FVSGLP+D K RELYLLFR FKG++ + +K   K      PVGFVTF++R+ AE+A   L GI+FDP++ Q +RLEFA+ NTKM K+K+
Sbjct:   14 SLEEEVRTLFVSGLPVDIKPRELYLLFRPFKGYEGSLIKLTSKQ-----PVGFVTFDSRSGAEAAKNALNGIRFDPENPQTLRLEFAKANTKMAKSKL 106          
BLAST of RRM domain-containing protein vs. Ensembl Cavefish
Match: rbpms2b (RNA-binding protein with multiple splicing 2-like [Source:NCBI gene;Acc:103022941])

HSP 1 Score: 111.694 bits (278), Expect = 9.093e-29
Identity = 55/101 (54.46%), Postives = 73/101 (72.28%), Query Frame = 3
Query:  321 SANEEVRTIFVSGLPMDAKQRELYLLFRSFKGFQTATLKPPGKNGKPTAPVGFVTFETRNQAESAIEKLEGIKFDPDSDQLMRLEFARTNTKMLKNKICNS 623
            S +EEVRT+FVSGLP D K RELYLLFR FKG++ + +K   K      PVGFVTF+ R+ AE+A   L G++FDP++ Q +RLEFA+ NTKM K+K+  +
Sbjct:   15 SLDEEVRTLFVSGLPTDIKPRELYLLFRPFKGYEGSLIKLTSKQ-----PVGFVTFDCRSGAEAAKNALNGVRFDPENPQTLRLEFAKANTKMAKSKLMGT 110          
BLAST of RRM domain-containing protein vs. Ensembl Cavefish
Match: rbpms2b (RNA-binding protein with multiple splicing 2-like [Source:NCBI gene;Acc:103022941])

HSP 1 Score: 111.694 bits (278), Expect = 1.182e-28
Identity = 55/98 (56.12%), Postives = 72/98 (73.47%), Query Frame = 3
Query:  321 SANEEVRTIFVSGLPMDAKQRELYLLFRSFKGFQTATLKPPGKNGKPTAPVGFVTFETRNQAESAIEKLEGIKFDPDSDQLMRLEFARTNTKMLKNKI 614
            S +EEVRT+FVSGLP D K RELYLLFR FKG++ + +K   K      PVGFVTF+ R+ AE+A   L G++FDP++ Q +RLEFA+ NTKM K+K+
Sbjct:   15 SLDEEVRTLFVSGLPTDIKPRELYLLFRPFKGYEGSLIKLTSKQ-----PVGFVTFDCRSGAEAAKNALNGVRFDPENPQTLRLEFAKANTKMAKSKL 107          
BLAST of RRM domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003641.1 (pep scaffold:Pmarinus_7.0:GL480715:5373:16108:1 gene:ENSPMAG00000003321.1 transcript:ENSPMAT00000003641.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 106.301 bits (264), Expect = 1.498e-27
Identity = 52/94 (55.32%), Postives = 67/94 (71.28%), Query Frame = 3
Query:  333 EVRTIFVSGLPMDAKQRELYLLFRSFKGFQTATLKPPGKNGKPTAPVGFVTFETRNQAESAIEKLEGIKFDPDSDQLMRLEFARTNTKMLKNKI 614
            +VRT+FVSGLP+D K RELYLLFR FKG++ + +    K      PVGFVTF +R QAE A   L G++FDP+S Q +RLEFAR NTK  +N++
Sbjct:    1 QVRTLFVSGLPVDIKPRELYLLFRPFKGYEGSLILVTSKQ-----PVGFVTFYSRAQAEDAKVSLNGVRFDPESPQTLRLEFARANTKTSRNRL 89          
BLAST of RRM domain-containing protein vs. Ensembl Sea Lamprey
Match: rbpms2a (RNA binding protein, mRNA processing factor 2a [Source:ZFIN;Acc:ZDB-GENE-040718-106])

HSP 1 Score: 67.3958 bits (163), Expect = 6.407e-14
Identity = 29/52 (55.77%), Postives = 39/52 (75.00%), Query Frame = 3
Query:  468 PVGFVTFETRNQAESAIEKLEGIKFDPDSDQLMRLEFARTNTKMLKNKICNS 623
            PVGF  F++R++AE+A   L GI+FDPD  Q +RLEFA+ NTKM KNK+  +
Sbjct:    2 PVGFAMFDSRSEAEAAKNALNGIRFDPDIPQTLRLEFAKANTKMAKNKLLGT 53          
BLAST of RRM domain-containing protein vs. Ensembl Nematostella
Match: EDO49830 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7REQ1])

HSP 1 Score: 100.908 bits (250), Expect = 2.458e-26
Identity = 50/90 (55.56%), Postives = 66/90 (73.33%), Query Frame = 3
Query:  336 VRTIFVSGLPMDAKQRELYLLFRSFKGFQTATLKPPGKNGKPTAPVGFVTFETRNQAESAIEKLEGIKFDPDSDQLMRLEFARTNTKMLK 605
            VRT+FVSGLP+D K RE+YLLFRSFKG++ + LK   K      PV FVTFE ++ A  A  +L+G++FDPD  Q +RLEFA++NTK+ K
Sbjct:    1 VRTLFVSGLPLDVKPREVYLLFRSFKGYEGSLLKLTDKQ-----PVAFVTFENKDCASDAKSELQGVQFDPDVSQTLRLEFAKSNTKVSK 85          
BLAST of RRM domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000005176.2 (RNA binding protein, mRNA processing factor [Source:NCBI gene;Acc:101164593])

HSP 1 Score: 113.62 bits (283), Expect = 1.999e-29
Identity = 55/116 (47.41%), Postives = 80/116 (68.97%), Query Frame = 3
Query:  276 NSTDNNGNHGDSDASSANEEVRTIFVSGLPMDAKQRELYLLFRSFKGFQTATLKPPGKNGKPTAPVGFVTFETRNQAESAIEKLEGIKFDPDSDQLMRLEFARTNTKMLKNKICNS 623
            N+      +  ++ ++  EEVRT+FVSGLP+D K RELYLLFR FKG++ + +K   K      PVGFV+F++R++AE+A   L G++FDP+  Q +RLEFA+ NTKM KNK+  +
Sbjct:    2 NNNKTEKENETTEFTNHEEEVRTLFVSGLPLDIKPRELYLLFRPFKGYEGSLIKLTSKQ-----PVGFVSFDSRSEAEAAKNALNGVRFDPEIPQTLRLEFAKANTKMAKNKLVGT 112          
BLAST of RRM domain-containing protein vs. Ensembl Medaka
Match: rbpms2a (RNA-binding protein with multiple splicing 2 [Source:NCBI gene;Acc:101164709])

HSP 1 Score: 114.39 bits (285), Expect = 5.648e-29
Identity = 57/98 (58.16%), Postives = 73/98 (74.49%), Query Frame = 3
Query:  321 SANEEVRTIFVSGLPMDAKQRELYLLFRSFKGFQTATLKPPGKNGKPTAPVGFVTFETRNQAESAIEKLEGIKFDPDSDQLMRLEFARTNTKMLKNKI 614
            S  EEVRT+FVSGLP+D K RELYLLFR FKG++ + +K   K      PVGFVTF++R+ AE+A   L GI+FDP+S Q +RLEFA+ NTKM K+K+
Sbjct:   79 SIEEEVRTLFVSGLPVDIKPRELYLLFRPFKGYEGSLIKLTSKQ-----PVGFVTFDSRSGAEAAKNALNGIRFDPESPQTLRLEFAKANTKMAKSKL 171          
BLAST of RRM domain-containing protein vs. Ensembl Medaka
Match: rbpms2a (RNA-binding protein with multiple splicing 2 [Source:NCBI gene;Acc:101164709])

HSP 1 Score: 114.39 bits (285), Expect = 5.648e-29
Identity = 57/98 (58.16%), Postives = 73/98 (74.49%), Query Frame = 3
Query:  321 SANEEVRTIFVSGLPMDAKQRELYLLFRSFKGFQTATLKPPGKNGKPTAPVGFVTFETRNQAESAIEKLEGIKFDPDSDQLMRLEFARTNTKMLKNKI 614
            S  EEVRT+FVSGLP+D K RELYLLFR FKG++ + +K   K      PVGFVTF++R+ AE+A   L GI+FDP+S Q +RLEFA+ NTKM K+K+
Sbjct:   79 SIEEEVRTLFVSGLPVDIKPRELYLLFRPFKGYEGSLIKLTSKQ-----PVGFVTFDSRSGAEAAKNALNGIRFDPESPQTLRLEFAKANTKMAKSKL 171          
BLAST of RRM domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000005173.2 (RNA binding protein, mRNA processing factor [Source:NCBI gene;Acc:101164593])

HSP 1 Score: 110.153 bits (274), Expect = 4.570e-28
Identity = 57/120 (47.50%), Postives = 78/120 (65.00%), Query Frame = 3
Query:  273 SNSTDNNGNHGDSDASSANEE---VRTIFVSGLPMDAKQRELYLLFRSFKGFQTATLKPPGKNGKPTAPVGFVTFETRNQAESAIEKLEGIKFDPDSDQLMRLEFARTNTKMLKNKICNS 623
             N T    NH + +      E   VRT+FVSGLP+D K RELYLLFR FKG++ + +K   K      PVGFV+F++R++AE+A   L G++FDP+  Q +RLEFA+ NTKM KNK+  +
Sbjct:    9 ENETTEFTNHEEENPPLHPREGRKVRTLFVSGLPLDIKPRELYLLFRPFKGYEGSLIKLTSKQ-----PVGFVSFDSRSEAEAAKNALNGVRFDPEIPQTLRLEFAKANTKMAKNKLVGT 123          
BLAST of RRM domain-containing protein vs. Ensembl Medaka
Match: rbpms2a (RNA-binding protein with multiple splicing 2 [Source:NCBI gene;Acc:101164709])

HSP 1 Score: 77.0258 bits (188), Expect = 1.451e-16
Identity = 40/71 (56.34%), Postives = 50/71 (70.42%), Query Frame = 3
Query:  321 SANEEVRTIFVSGLPMDAKQRELYLLFRSFKGFQTATLKPPGKNGKPTAPVGFVTFETRNQAESAIEKLEG 533
            S  EEVRT+FVSGLP+D K RELYLLFR FKG++ + +K   K      PVGFVTF++R+ AE+A   L G
Sbjct:   79 SIEEEVRTLFVSGLPVDIKPRELYLLFRPFKGYEGSLIKLTSKQ-----PVGFVTFDSRSGAEAAKNALNG 144          
BLAST of RRM domain-containing protein vs. Planmine SMEST
Match: SMESG000071928.1 (SMESG000071928.1)

HSP 1 Score: 569.696 bits (1467), Expect = 0.000e+0
Identity = 282/299 (94.31%), Postives = 284/299 (94.98%), Query Frame = 3
Query:  204 MTDFFLDSKSKVFPISDGCNVLCSNSTDNNGNHGDSDASSANEEVRTIFVSGLPMDAKQRELYLLFRSFKGFQTATLKPPGKNGKPTAPVGFVTFETRNQAESAIEKLEGIKFDPDSDQLMRLEFARTNTKMLKNKICNSHIYNSGLNQQLSAGSIDANLLNSDMNLFLGYDGRLAFFAQSAFSPFGPALLPFNGTTFRPPNCSFAPIAVAAPNGLINGNNIKIPNSSLTPGSVTGTHSLSPFIGPQSGLLGETISQVLMHPSQNGLLYVQPFSIDLNEISAQPLETQFRMNSWNSNGE 1100
            MTDFFLDSKSKVFPISDGCNVLCSNSTDNNGNHGDSDASSANEEVRTIFVSGLPMDAKQRELYLLFRSFKGFQTATLKPPGKNGKPTAPVGFVTFETRNQAESAIEKLEGIKFDPDSDQLMRLEFARTNTKMLKNK+CNSHIYNSGLNQQLSAGSIDANLLNSDMNLFLGYDGRLAFFAQSAFSPFGPALLPFNGTTFRPPNCSFAPIAVAAPNGL+N               VTGTHSLSPFIGPQSGLLGETISQVLMHPSQNGLLYVQPFSIDLNEISAQPLETQFRMNSWNSNGE
Sbjct:    1 MTDFFLDSKSKVFPISDGCNVLCSNSTDNNGNHGDSDASSANEEVRTIFVSGLPMDAKQRELYLLFRSFKGFQTATLKPPGKNGKPTAPVGFVTFETRNQAESAIEKLEGIKFDPDSDQLMRLEFARTNTKMLKNKMCNSHIYNSGLNQQLSAGSIDANLLNSDMNLFLGYDGRLAFFAQSAFSPFGPALLPFNGTTFRPPNCSFAPIAVAAPNGLLN---------------VTGTHSLSPFIGPQSGLLGETISQVLMHPSQNGLLYVQPFSIDLNEISAQPLETQFRMNSWNSNGE 284          
BLAST of RRM domain-containing protein vs. Planmine SMEST
Match: SMESG000064331.1 (SMESG000064331.1)

HSP 1 Score: 153.295 bits (386), Expect = 3.921e-43
Identity = 107/274 (39.05%), Postives = 149/274 (54.38%), Query Frame = 3
Query:  246 ISDGCNVLCSNSTDNNGNHGDSDASSANEEVRTIFVSGLPMDAKQRELYLLFRSFKGFQTATLKPPGKNGKPTAPVGFVTFETRNQAESAIEKLEGIKFDPDSDQLMRLEFARTNTKMLKNKICNSHIYNSGLNQQLSAGSIDANLLNSDMNLFLGYDGRLAFFAQSAFSPFGPALLPFNGTTFRP---PNCSFAPIAVAAPNGLINGNNIK---IPNSSLTPGSVTGTHSLS-PFIG-PQSGLLGETISQVLMHP---SQNGLLYVQPFSIDL 1034
            +SD   +  S+S D+    G +     N++VRT+F+SGLPMD K RELYLLFR +KG+ ++TLKP GKNGK TAPVGFVTF +R +AE A+ +L+G+KFDPDS Q MRLEFAR+NTK+ + KI    +     N  L   +I        +  F G+D    F A ++++  G        T   P   PN   + +    P   +NG  +    +P+  L    +T   SL+ P++G P S + G TIS   + P   S  GLL       DL
Sbjct:   45 LSDENMMNISHSIDSLNTVGSNGTVDINDQVRTLFISGLPMDTKPRELYLLFRGYKGYISSTLKPSGKNGKLTAPVGFVTFSSREEAEIAMSELQGVKFDPDSAQQMRLEFARSNTKVTRPKIGLFSLSQPFFNAALPPHAI--------IQQFPGFDHGSLFSADTSWANLGYDNAILTATGILPSATPNLHPSLLQALMPQNGLNGGVVSTNCLPSQILNQNIITSQSSLTNPYLGSPASSINGATISYPGLVPLGFSTVGLLSYNALMKDL 310          
BLAST of RRM domain-containing protein vs. Planmine SMEST
Match: SMESG000064331.1 (SMESG000064331.1)

HSP 1 Score: 153.295 bits (386), Expect = 7.194e-43
Identity = 107/274 (39.05%), Postives = 149/274 (54.38%), Query Frame = 3
Query:  246 ISDGCNVLCSNSTDNNGNHGDSDASSANEEVRTIFVSGLPMDAKQRELYLLFRSFKGFQTATLKPPGKNGKPTAPVGFVTFETRNQAESAIEKLEGIKFDPDSDQLMRLEFARTNTKMLKNKICNSHIYNSGLNQQLSAGSIDANLLNSDMNLFLGYDGRLAFFAQSAFSPFGPALLPFNGTTFRP---PNCSFAPIAVAAPNGLINGNNIK---IPNSSLTPGSVTGTHSLS-PFIG-PQSGLLGETISQVLMHP---SQNGLLYVQPFSIDL 1034
            +SD   +  S+S D+    G +     N++VRT+F+SGLPMD K RELYLLFR +KG+ ++TLKP GKNGK TAPVGFVTF +R +AE A+ +L+G+KFDPDS Q MRLEFAR+NTK+ + KI    +     N  L   +I        +  F G+D    F A ++++  G        T   P   PN   + +    P   +NG  +    +P+  L    +T   SL+ P++G P S + G TIS   + P   S  GLL       DL
Sbjct:   70 LSDENMMNISHSIDSLNTVGSNGTVDINDQVRTLFISGLPMDTKPRELYLLFRGYKGYISSTLKPSGKNGKLTAPVGFVTFSSREEAEIAMSELQGVKFDPDSAQQMRLEFARSNTKVTRPKIGLFSLSQPFFNAALPPHAI--------IQQFPGFDHGSLFSADTSWANLGYDNAILTATGILPSATPNLHPSLLQALMPQNGLNGGVVSTNCLPSQILNQNIITSQSSLTNPYLGSPASSINGATISYPGLVPLGFSTVGLLSYNALMKDL 335          
BLAST of RRM domain-containing protein vs. Planmine SMEST
Match: SMESG000064331.1 (SMESG000064331.1)

HSP 1 Score: 104.375 bits (259), Expect = 1.120e-26
Identity = 51/95 (53.68%), Postives = 69/95 (72.63%), Query Frame = 3
Query:  246 ISDGCNVLCSNSTDNNGNHGDSDASSANEEVRTIFVSGLPMDAKQRELYLLFRSFKGFQTATLKPPGKNGKPTAPVGFVTFETRNQAESAIEKLE 530
            +SD   +  S+S D+    G +     N++VRT+F+SGLPMD K RELYLLFR +KG+ ++TLKP GKNGK TAPVGFVTF +R +AE A+ +L+
Sbjct:   45 LSDENMMNISHSIDSLNTVGSNGTVDINDQVRTLFISGLPMDTKPRELYLLFRGYKGYISSTLKPSGKNGKLTAPVGFVTFSSREEAEIAMSELQ 139          
The following BLAST results are available for this feature:
BLAST of RRM domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RBPMS8.481e-3151.28RNA binding protein, mRNA processing factor [Sourc... [more]
RBPMS9.170e-3151.28RNA binding protein, mRNA processing factor [Sourc... [more]
RBPMS9.170e-3151.28RNA binding protein, mRNA processing factor [Sourc... [more]
RBPMS1.760e-3051.28RNA binding protein, mRNA processing factor [Sourc... [more]
RBPMS2.418e-3051.28RNA binding protein, mRNA processing factor [Sourc... [more]
back to top
BLAST of RRM domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
mec-88.050e-3151.30Mec-8 protein [Source:UniProtKB/TrEMBL;Acc:G5ECJ4... [more]
mec-88.050e-3151.30Mec-8 protein [Source:UniProtKB/TrEMBL;Acc:G5ECJ4... [more]
mec-88.050e-3151.30Mec-8 protein [Source:UniProtKB/TrEMBL;Acc:G5ECJ4... [more]
back to top
BLAST of RRM domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cpo4.261e-3360.00gene:FBgn0263995 transcript:FBtr0330279[more]
cpo4.261e-3360.00gene:FBgn0263995 transcript:FBtr0330280[more]
cpo4.261e-3360.00gene:FBgn0263995 transcript:FBtr0330278[more]
cpo4.261e-3360.00gene:FBgn0263995 transcript:FBtr0330276[more]
cpo4.261e-3360.00gene:FBgn0263995 transcript:FBtr0330269[more]
back to top
BLAST of RRM domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rbpms2a8.978e-3058.16RNA binding protein, mRNA processing factor 2a [So... [more]
rbpms2a8.978e-3058.16RNA binding protein, mRNA processing factor 2a [So... [more]
rbpms2b5.104e-2954.46RNA binding protein, mRNA processing factor 2b [So... [more]
rbpms2b5.104e-2954.46RNA binding protein, mRNA processing factor 2b [So... [more]
rbpms2b1.124e-2854.46RNA binding protein, mRNA processing factor 2b [So... [more]
back to top
BLAST of RRM domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rbpms1.495e-2949.57RNA binding protein with multiple splicing [Source... [more]
rbpms1.636e-2949.57RNA binding protein with multiple splicing [Source... [more]
rbpms3.689e-2949.57RNA binding protein with multiple splicing [Source... [more]
RBPMS21.161e-2755.56RNA binding protein with multiple splicing 2 [Sour... [more]
RBPMS22.950e-2758.06RNA binding protein with multiple splicing 2 [Sour... [more]
back to top
BLAST of RRM domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rbpms2.272e-3054.29RNA binding protein gene with multiple splicing [S... [more]
Rbpms3.016e-3054.29RNA binding protein gene with multiple splicing [S... [more]
Rbpms3.016e-3054.29RNA binding protein gene with multiple splicing [S... [more]
Rbpms3.016e-3054.29RNA binding protein gene with multiple splicing [S... [more]
Rbpms8.663e-3054.29RNA binding protein gene with multiple splicing [S... [more]
back to top
BLAST of RRM domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q01617|CPO_DROME4.271e-3260.00Protein couch potato OS=Drosophila melanogaster OX... [more]
sp|Q93062|RBPMS_HUMAN4.404e-3051.28RNA-binding protein with multiple splicing OS=Homo... [more]
sp|Q9WVB0|RBPMS_MOUSE2.110e-2954.29RNA-binding protein with multiple splicing OS=Mus ... [more]
sp|Q6DH13|RBP2A_DANRE6.778e-2958.16RNA-binding protein, mRNA-processing factor 2a OS=... [more]
sp|Q9W6I1|RBPS2_CHICK1.540e-2757.29RNA-binding protein with multiple splicing 2 OS=Ga... [more]
back to top
BLAST of RRM domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
G7YDR03.192e-4159.09Protein couch potato (Fragment) OS=Clonorchis sine... [more]
A0A4S2LLM91.588e-4058.33RRM domain-containing protein OS=Opisthorchis feli... [more]
A0A419PL377.359e-4072.45Protein couch potato (Fragment) OS=Clonorchis sine... [more]
A0A4Z2DUC23.227e-3963.25Protein couch potato OS=Schistosoma japonicum OX=6... [more]
A0A5J4P0Y03.371e-3964.96RRM domain-containing protein OS=Paragonimus weste... [more]
back to top
BLAST of RRM domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rbpms5.431e-3154.29RNA binding protein, mRNA processing factor [Sourc... [more]
rbpms2a4.686e-2957.14RNA-binding protein with multiple splicing 2 [Sour... [more]
rbpms2a4.686e-2957.14RNA-binding protein with multiple splicing 2 [Sour... [more]
rbpms2b9.093e-2954.46RNA-binding protein with multiple splicing 2-like ... [more]
rbpms2b1.182e-2856.12RNA-binding protein with multiple splicing 2-like ... [more]
back to top
BLAST of RRM domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000003641.11.498e-2755.32pep scaffold:Pmarinus_7.0:GL480715:5373:16108:1 ge... [more]
rbpms2a6.407e-1455.77RNA binding protein, mRNA processing factor 2a [So... [more]
back to top
BLAST of RRM domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of RRM domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO498302.458e-2655.56Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of RRM domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000005176.21.999e-2947.41RNA binding protein, mRNA processing factor [Sourc... [more]
rbpms2a5.648e-2958.16RNA-binding protein with multiple splicing 2 [Sour... [more]
rbpms2a5.648e-2958.16RNA-binding protein with multiple splicing 2 [Sour... [more]
ENSORLT00000005173.24.570e-2847.50RNA binding protein, mRNA processing factor [Sourc... [more]
rbpms2a1.451e-1656.34RNA-binding protein with multiple splicing 2 [Sour... [more]
back to top
BLAST of RRM domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000071928.10.000e+094.31SMESG000071928.1[more]
SMESG000064331.13.921e-4339.05SMESG000064331.1[more]
SMESG000064331.17.194e-4339.05SMESG000064331.1[more]
SMESG000064331.11.120e-2653.68SMESG000064331.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30028255 ID=SMED30028255|Name=RRM domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1200bp
AATGAAAAATGTTTTATTTCTAACATCGGGTGAATTGTGAAGAAGAAAGA
AATCAAGCAAAAATTCAAACGAGACAAACGAAAAATCGAATTAGACTTTT
TCTCCCATAAGCTTTTATAATTTAACCAAACGAGAGATATCTTTACAAAT
CGTTTTTGTTGATTGAAATATTTTTTCGTGCTTGAAAAAATTTATTTTTT
ATCATGACGGATTTTTTTCTCGATTCAAAATCAAAAGTTTTTCCAATCAG
TGACGGATGCAACGTACTGTGTTCCAATAGTACCGATAACAATGGCAACC
ACGGCGACAGTGATGCCTCCTCTGCGAACGAAGAGGTGAGAACAATTTTC
GTAAGCGGCCTGCCAATGGACGCCAAACAGAGAGAATTATATTTATTATT
TCGGAGTTTTAAAGGTTTTCAAACGGCCACTCTGAAACCTCCGGGGAAAA
ATGGAAAGCCTACCGCTCCGGTTGGATTCGTCACTTTTGAAACTCGAAAT
CAAGCTGAAAGTGCAATTGAAAAACTTGAGGGAATCAAATTTGATCCAGA
TTCAGATCAGTTAATGAGATTAGAATTCGCCCGAACAAATACAAAAATGT
TGAAAAACAAAATATGTAACAGTCATATTTATAATTCCGGTTTAAATCAG
CAGTTATCTGCAGGTTCTATTGATGCAAACTTATTAAATTCTGACATGAA
TCTATTTCTTGGTTATGACGGTCGACTAGCCTTTTTTGCCCAATCTGCCT
TTTCGCCTTTCGGGCCAGCTTTGTTGCCTTTTAATGGAACTACATTTAGA
CCACCTAATTGTTCTTTTGCTCCTATCGCTGTTGCTGCACCTAATGGACT
GATAAATGGTAACAACATTAAAATTCCGAATTCCTCTTTGACTCCGGGAT
CAGTAACAGGAACGCATTCTCTTTCACCATTCATAGGCCCACAATCTGGA
TTGCTTGGAGAAACAATAAGTCAAGTTTTAATGCATCCAAGTCAGAATGG
TTTATTATATGTACAACCATTTTCAATTGACCTCAATGAAATCAGTGCTC
AACCCTTAGAGACCCAATTCAGAATGAATTCATGGAATTCAAACGGGGAG
TGAAAACTGCCAATAATCAAGGCCTCATATTATTTCAATTTTATTACATT
TGATGAATCATATCAAAATCCGATTATCAAAATAGTTTTTATTATCAAAC
back to top

protein sequence of SMED30028255-orf-1

>SMED30028255-orf-1 ID=SMED30028255-orf-1|Name=SMED30028255-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=300bp
MTDFFLDSKSKVFPISDGCNVLCSNSTDNNGNHGDSDASSANEEVRTIFV
SGLPMDAKQRELYLLFRSFKGFQTATLKPPGKNGKPTAPVGFVTFETRNQ
AESAIEKLEGIKFDPDSDQLMRLEFARTNTKMLKNKICNSHIYNSGLNQQ
LSAGSIDANLLNSDMNLFLGYDGRLAFFAQSAFSPFGPALLPFNGTTFRP
PNCSFAPIAVAAPNGLINGNNIKIPNSSLTPGSVTGTHSLSPFIGPQSGL
LGETISQVLMHPSQNGLLYVQPFSIDLNEISAQPLETQFRMNSWNSNGE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003723RNA binding
GO:0003676nucleic acid binding
GO:0000166nucleotide binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000017photoreceptor neuron
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR035979RBD_domain_sf
IPR000504RRM_dom
IPR012677Nucleotide-bd_a/b_plait_sf
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000504RNA recognition motif domainSMARTSM00360rrm1_1coord: 47..124
e-value: 5.5E-6
score: 35.9
IPR000504RNA recognition motif domainPFAMPF00076RRM_1coord: 48..114
e-value: 2.7E-12
score: 46.3
IPR000504RNA recognition motif domainPROSITEPS50102RRMcoord: 46..128
score: 13.26
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 39..132
e-value: 1.6E-25
score: 90.9
NoneNo IPR availablePANTHERPTHR10501:SF41PROTEIN COUCH POTATOcoord: 35..152
NoneNo IPR availablePANTHERPTHR10501U1 SMALL NUCLEAR RIBONUCLEOPROTEIN A/U2 SMALL NUCLEAR RIBONUCLEOPROTEIN Bcoord: 35..152
IPR035979RNA-binding domain superfamilySUPERFAMILYSSF54928RNA-binding domain, RBDcoord: 30..137