Golgi reassembly-stacking protein 2

Overview
NameGolgi reassembly-stacking protein 2
Smed IDSMED30028245
Length (bp)1234
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Golgi reassembly-stacking protein 2 (SMED30028245) t-SNE clustered cells

Violin plots show distribution of expression levels for Golgi reassembly-stacking protein 2 (SMED30028245) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Golgi reassembly-stacking protein 2 (SMED30028245) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Golgi reassembly-stacking protein 2 (SMED30028245) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30028245

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermisSMED30028245h1SMcG0000824 dd_Smed_v4_1209_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30028245h1SMcG0000824 dd_Smed_v4_1209_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30028245h1SMcG0000824 dd_Smed_v4_1209_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30028245h1SMcG0000824 dd_Smed_v4_1209_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Golgi reassembly-stacking protein 2 vs. Ensembl Human
Match: GORASP2 (golgi reassembly stacking protein 2 [Source:HGNC Symbol;Acc:HGNC:17500])

HSP 1 Score: 265.774 bits (678), Expect = 3.392e-84
Identity = 138/243 (56.79%), Postives = 181/243 (74.49%), Query Frame = 2
Query:  137 MGAGSSDLSHNHGNEGYHVLRVQEGSPGHKAGLQAFFDFVVEMGETKLSQDNEVLKELLKSNKDKPINLTIYNSKTQSFRHVELVPSQDWGGQGLLGVSIRYCSFEGANENVWHVLDIDPNSPAALAGLKQMTDYIIGAETVLNDPEEFFNLIETHDGQTLKLYVYNIETDTCREVTITPNSSWXXXXXXXXXXXXXXXHRIPSLPFTSNISSVNHECCESHKHDHNPSVVNVADGFSEIALT 865
            MG+  S      G EGYHVLRVQE SPGH+AGL+ FFDF+V +  ++L++DN+ LK+LLK+N +KP+ + IY+SKT   R   + PS  WGGQGLLGVSIR+CSF+GANENVWHVL+++ NSPAALAGL+  +DYIIGA+TV+N+ E+ F+LIETH+ + LKLYVYN +TD CREV ITPNS+WGG+G +GCGIGYGYLHRIP+ PF         +     +    P +  + DGF+E+ L+
Sbjct:    1 MGSSQSVEIPGGGTEGYHVLRVQENSPGHRAGLEPFFDFIVSINGSRLNKDNDTLKDLLKANVEKPVKMLIYSSKTLELRETSVTPSNLWGGQGLLGVSIRFCSFDGANENVWHVLEVESNSPAALAGLRPHSDYIIGADTVMNESEDLFSLIETHEAKPLKLYVYNTDTDNCREVIITPNSAWGGEGSLGCGIGYGYLHRIPTRPFEE-----GKKISLPGQMAGTP-ITPLKDGFTEVQLS 237          
BLAST of Golgi reassembly-stacking protein 2 vs. Ensembl Human
Match: GORASP1 (golgi reassembly stacking protein 1 [Source:HGNC Symbol;Acc:HGNC:16769])

HSP 1 Score: 237.654 bits (605), Expect = 1.844e-73
Identity = 116/206 (56.31%), Postives = 162/206 (78.64%), Query Frame = 2
Query:  137 MGAGSSDLSHNHGNEGYHVLRVQEGSPGHKAGLQAFFDFVVEMGETKLSQDNEVLKELLKSNKDKPINLTIYNSKTQSFRHVELVPSQDWGGQGLLGVSIRYCSFEGANENVWHVLDIDPNSPAALAGLKQMTDYIIGAETVLNDPEEFFNLIETHDGQTLKLYVYNIETDTCREVTITPNSSWXXXXXXXXXXXXXXXHRIPSLP 754
            MG G S      G EG+H+  VQE SP  +AGL+ +FDF++ +G ++L+++N+ LK LLK+N +KP+ L ++N KT   R VE+VPS  WGGQGLLG S+R+CSF  A+E VWHVLD++P+SPAALAGL+  TDY++G++ +L + E+FF LIE+H+G+ LKL VYN ++D+CREVT+TPN++WGG+G +GCGIGYGYLHRIP+ P
Sbjct:    1 MGLGVSAEQPAGGAEGFHLHGVQENSPAQQAGLEPYFDFIITIGHSRLNKENDTLKALLKANVEKPVKLEVFNMKTMRVREVEVVPSNMWGGQGLLGASVRFCSFRRASEQVWHVLDVEPSSPAALAGLRPYTDYVVGSDQILQESEDFFTLIESHEGKPLKLMVYNSKSDSCREVTVTPNAAWGGEGSLGCGIGYGYLHRIPTQP 206          
BLAST of Golgi reassembly-stacking protein 2 vs. Ensembl Human
Match: GORASP1 (golgi reassembly stacking protein 1 [Source:HGNC Symbol;Acc:HGNC:16769])

HSP 1 Score: 230.72 bits (587), Expect = 2.863e-72
Identity = 99/184 (53.80%), Postives = 142/184 (77.17%), Query Frame = 2
Query:  137 MGAGSSDLSHNHGNEGYHVLRVQEGSPGHKAGLQAFFDFVVEMGETKLSQDNEVLKELLKSNKDKPINLTIYNSKTQSFRHVELVPSQDWGGQGLLGVSIRYCSFEGANENVWHVLDIDPNSPAALAGLKQMTDYIIGAETVLNDPEEFFNLIETHDGQTLKLYVYNIETDTCREVTITPNSSW 688
            MG G S      G EG+H+  VQE SP  +AGL+ +FDF++ +G ++L+++N+ LK LLK+N +KP+ L ++N KT   R VE+VPS  WGGQGLLG S+R+CSF  A+E VWHVLD++P+SPAALAGL+  TDY++G++ +L + E+FF LIE+H+G+ LKL VYN ++D+CREVT+TPN++W
Sbjct:    1 MGLGVSAEQPAGGAEGFHLHGVQENSPAQQAGLEPYFDFIITIGHSRLNKENDTLKALLKANVEKPVKLEVFNMKTMRVREVEVVPSNMWGGQGLLGASVRFCSFRRASEQVWHVLDVEPSSPAALAGLRPYTDYVVGSDQILQESEDFFTLIESHEGKPLKLMVYNSKSDSCREVTVTPNAAW 184          

HSP 2 Score: 67.781 bits (164), Expect = 5.650e-12
Identity = 36/95 (37.89%), Postives = 57/95 (60.00%), Query Frame = 2
Query:  137 MGAGSSDLSHNHGNEG-YHVLRVQEGSPGHKAGLQAFFDFVVEMGETKLSQDNEVLKELLKSNKDKPINLTIYNSKTQSFRHVELVPSQDWGGQG 418
            +GA     S    +E  +HVL V+  SP   AGL+ + D+VV  G  ++ Q++E    L++S++ KP+ L +YNSK+ S R V + P+  WGG+G
Sbjct:   96 LGASVRFCSFRRASEQVWHVLDVEPSSPAALAGLRPYTDYVV--GSDQILQESEDFFTLIESHEGKPLKLMVYNSKSDSCREVTVTPNAAWGGEG 188          
BLAST of Golgi reassembly-stacking protein 2 vs. Ensembl Human
Match: GORASP1 (golgi reassembly stacking protein 1 [Source:HGNC Symbol;Acc:HGNC:16769])

HSP 1 Score: 214.157 bits (544), Expect = 3.024e-67
Identity = 93/175 (53.14%), Postives = 133/175 (76.00%), Query Frame = 2
Query:  137 MGAGSSDLSHNHGNEGYHVLRVQEGSPGHKAGLQAFFDFVVEMGETKLSQDNEVLKELLKSNKDKPINLTIYNSKTQSFRHVELVPSQDWGGQGLLGVSIRYCSFEGANENVWHVLDIDPNSPAALAGLKQMTDYIIGAETVLNDPEEFFNLIETHDGQTLKLYVYNIETDTCRE 661
            MG G S      G EG+H+  VQE SP  +AGL+ +FDF++ +G ++L+++N+ LK LLK+N +KP+ L ++N KT   R VE+VPS  WGGQGLLG S+R+CSF  A+E VWHVLD++P+SPAALAGL+  TDY++G++ +L + E+FF LIE+H+G+ LKL VYN ++D+CRE
Sbjct:    1 MGLGVSAEQPAGGAEGFHLHGVQENSPAQQAGLEPYFDFIITIGHSRLNKENDTLKALLKANVEKPVKLEVFNMKTMRVREVEVVPSNMWGGQGLLGASVRFCSFRRASEQVWHVLDVEPSSPAALAGLRPYTDYVVGSDQILQESEDFFTLIESHEGKPLKLMVYNSKSDSCRE 175          
BLAST of Golgi reassembly-stacking protein 2 vs. Ensembl Human
Match: GORASP1 (golgi reassembly stacking protein 1 [Source:HGNC Symbol;Acc:HGNC:16769])

HSP 1 Score: 176.022 bits (445), Expect = 8.923e-53
Identity = 77/153 (50.33%), Postives = 113/153 (73.86%), Query Frame = 2
Query:  140 GAGSSDLSHNHGNEGYHVL-RVQEGSPGHKAGLQAFFDFVVEMGETKLSQDNEVLKELLKSNKDKPINLTIYNSKTQSFRHVELVPSQDWGGQGLLGVSIRYCSFEGANENVWHVLDIDPNSPAALAGLKQMTDYIIGAETVLNDPEEFFNLI 595
            G G ++ +   G+    VL  VQE SP  +AGL+ +FDF++ +G ++L+++N+ LK LLK+N +KP+ L ++N KT   R VE+VPS  WGGQGLLG S+R+CSF  A+E VWHVLD++P+SPAALAGL+  TDY++G++ +L + E+FF LI
Sbjct:   41 GPGLTEWTQLRGSPSARVLPVVQENSPAQQAGLEPYFDFIITIGHSRLNKENDTLKALLKANVEKPVKLEVFNMKTMRVREVEVVPSNMWGGQGLLGASVRFCSFRRASEQVWHVLDVEPSSPAALAGLRPYTDYVVGSDQILQESEDFFTLI 193          
BLAST of Golgi reassembly-stacking protein 2 vs. Ensembl Celegans
Match: Y42H9AR.1 (pep chromosome:WBcel235:IV:8113384:8115670:1 gene:WBGene00021536.1 transcript:Y42H9AR.1.3 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y42H9AR.1)

HSP 1 Score: 244.588 bits (623), Expect = 8.076e-76
Identity = 129/259 (49.81%), Postives = 179/259 (69.11%), Query Frame = 2
Query:  137 MGAGSSDLSHNHGNEGYHVLRVQEGSPGHKAGLQAFFDFVVEMGETKLSQDNEVLKELLKSNKDKPINLTIYNSKTQSFRHVELVPSQDWGGQGLLGVSIRYCSFEGANENVWHVLDIDPNSPAALAGLKQMTDYIIGAETVLNDPEEFFNLIETHDGQTLKLYVYNIETDTCREVTITPNSSWXXXXXXXXXXXXXXXHRIP-SLPFTSNISSVNHECCESHKHDHNPSVVNVADGFSEIALTDDKAFKENTFLNMEP 910
            MG+  S      G EGYHVLRVQE SPG  AGL+ FFDF+V +G  +L +DN+ +KE+LK + +KP+ +T+YNSK+Q+ R   +VPSQ+WGGQGLLGVSIR+CSF+GA+++VWH++ + PNSPA+LAGL   TDYI+GAE+VL+  ++   L++ ++G+ LKLYVYN++TD  REV++TPNS+WGG+G +GC IGYGYLHRIP S+  +  +S V+    +      NP V  V    +     D   F     L   P
Sbjct:    1 MGSSESVPIPGGGTEGYHVLRVQENSPGAVAGLEPFFDFIVSIGNIRLDKDNDTMKEVLKQHIEKPLEITVYNSKSQAVRQTSIVPSQNWGGQGLLGVSIRFCSFDGASQHVWHIISVQPNSPASLAGLIADTDYILGAESVLHQADDLIALVQANEGKPLKLYVYNVDTDVVREVSLTPNSAWGGEGCLGCDIGYGYLHRIPVSVDRSKAVSQVSVAQIQPRVPVGNPLVDKVNKPPAATNFPDPSQFSSTVPLPPAP 259          
BLAST of Golgi reassembly-stacking protein 2 vs. Ensembl Celegans
Match: Y42H9AR.1 (pep chromosome:WBcel235:IV:8113495:8115607:1 gene:WBGene00021536.1 transcript:Y42H9AR.1.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y42H9AR.1)

HSP 1 Score: 244.588 bits (623), Expect = 8.076e-76
Identity = 129/259 (49.81%), Postives = 179/259 (69.11%), Query Frame = 2
Query:  137 MGAGSSDLSHNHGNEGYHVLRVQEGSPGHKAGLQAFFDFVVEMGETKLSQDNEVLKELLKSNKDKPINLTIYNSKTQSFRHVELVPSQDWGGQGLLGVSIRYCSFEGANENVWHVLDIDPNSPAALAGLKQMTDYIIGAETVLNDPEEFFNLIETHDGQTLKLYVYNIETDTCREVTITPNSSWXXXXXXXXXXXXXXXHRIP-SLPFTSNISSVNHECCESHKHDHNPSVVNVADGFSEIALTDDKAFKENTFLNMEP 910
            MG+  S      G EGYHVLRVQE SPG  AGL+ FFDF+V +G  +L +DN+ +KE+LK + +KP+ +T+YNSK+Q+ R   +VPSQ+WGGQGLLGVSIR+CSF+GA+++VWH++ + PNSPA+LAGL   TDYI+GAE+VL+  ++   L++ ++G+ LKLYVYN++TD  REV++TPNS+WGG+G +GC IGYGYLHRIP S+  +  +S V+    +      NP V  V    +     D   F     L   P
Sbjct:    1 MGSSESVPIPGGGTEGYHVLRVQENSPGAVAGLEPFFDFIVSIGNIRLDKDNDTMKEVLKQHIEKPLEITVYNSKSQAVRQTSIVPSQNWGGQGLLGVSIRFCSFDGASQHVWHIISVQPNSPASLAGLIADTDYILGAESVLHQADDLIALVQANEGKPLKLYVYNVDTDVVREVSLTPNSAWGGEGCLGCDIGYGYLHRIPVSVDRSKAVSQVSVAQIQPRVPVGNPLVDKVNKPPAATNFPDPSQFSSTVPLPPAP 259          
BLAST of Golgi reassembly-stacking protein 2 vs. Ensembl Celegans
Match: Y42H9AR.1 (pep chromosome:WBcel235:IV:8113495:8115668:1 gene:WBGene00021536.1 transcript:Y42H9AR.1.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y42H9AR.1)

HSP 1 Score: 244.588 bits (623), Expect = 8.076e-76
Identity = 129/259 (49.81%), Postives = 179/259 (69.11%), Query Frame = 2
Query:  137 MGAGSSDLSHNHGNEGYHVLRVQEGSPGHKAGLQAFFDFVVEMGETKLSQDNEVLKELLKSNKDKPINLTIYNSKTQSFRHVELVPSQDWGGQGLLGVSIRYCSFEGANENVWHVLDIDPNSPAALAGLKQMTDYIIGAETVLNDPEEFFNLIETHDGQTLKLYVYNIETDTCREVTITPNSSWXXXXXXXXXXXXXXXHRIP-SLPFTSNISSVNHECCESHKHDHNPSVVNVADGFSEIALTDDKAFKENTFLNMEP 910
            MG+  S      G EGYHVLRVQE SPG  AGL+ FFDF+V +G  +L +DN+ +KE+LK + +KP+ +T+YNSK+Q+ R   +VPSQ+WGGQGLLGVSIR+CSF+GA+++VWH++ + PNSPA+LAGL   TDYI+GAE+VL+  ++   L++ ++G+ LKLYVYN++TD  REV++TPNS+WGG+G +GC IGYGYLHRIP S+  +  +S V+    +      NP V  V    +     D   F     L   P
Sbjct:    1 MGSSESVPIPGGGTEGYHVLRVQENSPGAVAGLEPFFDFIVSIGNIRLDKDNDTMKEVLKQHIEKPLEITVYNSKSQAVRQTSIVPSQNWGGQGLLGVSIRFCSFDGASQHVWHIISVQPNSPASLAGLIADTDYILGAESVLHQADDLIALVQANEGKPLKLYVYNVDTDVVREVSLTPNSAWGGEGCLGCDIGYGYLHRIPVSVDRSKAVSQVSVAQIQPRVPVGNPLVDKVNKPPAATNFPDPSQFSSTVPLPPAP 259          
BLAST of Golgi reassembly-stacking protein 2 vs. Ensembl Fly
Match: Grasp65 (gene:FBgn0036919 transcript:FBtr0074895)

HSP 1 Score: 258.455 bits (659), Expect = 1.502e-81
Identity = 126/203 (62.07%), Postives = 165/203 (81.28%), Query Frame = 2
Query:  137 MGAGSSDLSHNHGNEGYHVLRVQEGSPGHKAGLQAFFDFVVEMGETKLSQDNEVLKELLKSNKDKPINLTIYNSKTQSFRHVELVPSQDWGGQGLLGVSIRYCSFEGANENVWHVLDIDPNSPAALAGLKQMTDYIIGAETVLNDPEEFFNLIETHDGQTLKLYVYNIETDTCREVTITPNSSWXXXXXXXXXXXXXXXHRIP 745
            MG+  S      G EGYHVL+VQ+ SPG KAGL+AFFDF+V +  T+L QDN++LKELL+ N DKP+ LT+Y+SKTQ+ R + L PS +WGGQGLLGVSIR+CSFEGANE+VWH+L++ PNSPA LAGL+  +DY+IGA+ + ++ ++ F LIETH+ Q LK+YVYN++ D CREVTI PN++WGG+G +GCGIG+GYLHRIP
Sbjct:    1 MGSSHSIHVPGGGTEGYHVLKVQDNSPGQKAGLEAFFDFIVAIAGTRLDQDNDMLKELLRQNVDKPVRLTVYSSKTQTVRELTLTPSNNWGGQGLLGVSIRFCSFEGANESVWHILEVHPNSPAELAGLRAYSDYVIGADAIRHENDDLFTLIETHEQQPLKMYVYNLDDDACREVTIKPNTAWGGEGALGCGIGFGYLHRIP 203          
BLAST of Golgi reassembly-stacking protein 2 vs. Ensembl Zebrafish
Match: gorasp2 (golgi reassembly stacking protein 2 [Source:ZFIN;Acc:ZDB-GENE-040426-1659])

HSP 1 Score: 275.789 bits (704), Expect = 1.665e-88
Identity = 144/245 (58.78%), Postives = 185/245 (75.51%), Query Frame = 2
Query:  137 MGAGSSDLSHNHGNEGYHVLRVQEGSPGHKAGLQAFFDFVVEMGETKLSQDNEVLKELLKSNKDKPINLTIYNSKTQSFRHVELVPSQDWGGQGLLGVSIRYCSFEGANENVWHVLDIDPNSPAALAGLKQMTDYIIGAETVLNDPEEFFNLIETHDGQTLKLYVYNIETDTCREVTITPNSSWXXXXXXXXXXXXXXXHRIPSLPFTSNISSVNHECCESHKHDHNPS--VVNVADGFSEIALT 865
            MG   S      G+EGYHVLRVQE SPGH+AGL+ FFDF+V +  T+L++DN+ LK++LK++ +KP+ + +Y+SKT   R   + PS  WGGQGLLGVSIR+CSFEGANENVWHVL+++PNSPAALAGL+  TDYIIGA+TV+N+ E+ F+LIETH+G+ LKLYVYN +TD CREV ITPNS+WGG+G +GCGIGYGYLHRIP+ PF         E  +     H PS  V  + DGF+E+ L+
Sbjct:    1 MGGSQSVEIPGGGSEGYHVLRVQENSPGHRAGLEPFFDFIVSINNTRLNKDNDTLKDILKASVEKPVKMQVYSSKTLELREATVTPSNMWGGQGLLGVSIRFCSFEGANENVWHVLEVEPNSPAALAGLRPHTDYIIGADTVMNESEDLFSLIETHEGKGLKLYVYNTDTDNCREVVITPNSAWGGEGSLGCGIGYGYLHRIPTRPF--------EEGKKISFPGHTPSEPVSPLKDGFTEVQLS 237          
BLAST of Golgi reassembly-stacking protein 2 vs. Ensembl Zebrafish
Match: gorasp1a (golgi reassembly stacking protein 1a [Source:ZFIN;Acc:ZDB-GENE-030826-23])

HSP 1 Score: 248.44 bits (633), Expect = 6.863e-78
Identity = 119/194 (61.34%), Postives = 160/194 (82.47%), Query Frame = 2
Query:  173 GNEGYHVLRVQEGSPGHKAGLQAFFDFVVEMGETKLSQDNEVLKELLKSNKDKPINLTIYNSKTQSFRHVELVPSQDWGGQGLLGVSIRYCSFEGANENVWHVLDIDPNSPAALAGLKQMTDYIIGAETVLNDPEEFFNLIETHDGQTLKLYVYNIETDTCREVTITPNSSWXXXXXXXXXXXXXXXHRIPSLP 754
            G EGYHV  VQE SP  +AGL+ FFDF++ +G  +L+Q+N++LK+LLK+N +KP+ + +Y++KT   R +E+VPS  WGGQGLLG S+R+CSF+GANENVWHVLD++ NSPAALAGL++ +D+I+GA+ VL D E+FF+LIE H+G+ LKL +YN ETD CREV +TPN +WGG+G +GCGIGYGYLHRIP+ P
Sbjct:   14 GTEGYHVHGVQEDSPAERAGLEPFFDFIISIGHNRLNQENDMLKDLLKANVEKPVKMEVYSTKTMRMRELEVVPSNMWGGQGLLGASVRFCSFQGANENVWHVLDVESNSPAALAGLQEHSDFIVGADQVLQDSEDFFSLIEAHEGKPLKLLIYNTETDKCREVIVTPNGAWGGEGSLGCGIGYGYLHRIPAQP 207          
BLAST of Golgi reassembly-stacking protein 2 vs. Ensembl Zebrafish
Match: gorasp1b (golgi reassembly stacking protein 1b [Source:ZFIN;Acc:ZDB-GENE-141212-318])

HSP 1 Score: 234.187 bits (596), Expect = 1.064e-73
Identity = 116/194 (59.79%), Postives = 152/194 (78.35%), Query Frame = 2
Query:  182 GYHVLRVQEGSPGHKAGLQAFFDFVVEMGETKLSQDNEVLKELLKSNKDKPINLTIYNSKTQSFRHVELVPSQDWGGQGLLGVSIRYCSFEGANENVWHVLDIDPNSPAALAGLKQMTDYIIGAETVLNDPEEFFNLIETHDGQTLKLYVYNIETDTCREVTITPNSSWXXXXXXXXXXXXXXXHRIPSLPFTS 763
            GYHV  VQE SP  +AGL+ FFDF++ +G T+L++++  LKELLK+N +KP+ L +Y+SK    R +ELVPS  WGGQGLLG S+R+CSF GA++ VWHVLD++ NSPA LAGLK  +DYIIGA+ VL + E+FF+LIE  +G++LKL VYN  TD CREV ITPN++WGG+G +GC +G+GYLHRIP  P TS
Sbjct:   13 GYHVHGVQENSPAERAGLEPFFDFILSIGHTRLNKESSTLKELLKANVEKPVKLQVYSSKVMRVRELELVPSNLWGGQGLLGASVRFCSFTGADQYVWHVLDVEVNSPAELAGLKPYSDYIIGADQVLQESEDFFSLIEACEGKSLKLLVYNTHTDRCREVLITPNAAWGGNGSLGCDVGFGYLHRIPMCPVTS 206          
BLAST of Golgi reassembly-stacking protein 2 vs. Ensembl Xenopus
Match: gorasp2 (golgi reassembly stacking protein 2 [Source:NCBI gene;Acc:448025])

HSP 1 Score: 270.781 bits (691), Expect = 1.762e-86
Identity = 143/249 (57.43%), Postives = 183/249 (73.49%), Query Frame = 2
Query:  137 MGAGSSDLSHNHGNEGYHVLRVQEGSPGHKAGLQAFFDFVVEMGETKLSQDNEVLKELLKSNKDKPINLTIYNSKTQSFRHVELVPSQDWGGQGLLGVSIRYCSFEGANENVWHVLDIDPNSPAALAGLKQMTDYIIGAETVLNDPEEFFNLIETHDGQTLKLYVYNIETDTCREVTITPNSSWXXXXXXXXXXXXXXXHRIPSLPFTSNISSVNHECCESHKHDHNPSVVNVA------DGFSEIALT 865
            MG  +S      G EGYHVLRVQE SPGH+AGL+ FFDF+V +   +L++DN+ LK+LLK+N +KP+ + +Y+SKT   R   + PS  WGGQGLLGVSIR+CSFEGANENVWHVL+++PNSPAALAGL+  +DYIIGA+TV+N+ E+ F+LIETH+G+ LKLYVYN +TD CREV ITPN++WGG+G +GCGIGYGYLHRIP+ PF            E  K+   P  V  A      DGF+E+ L+
Sbjct:    1 MGGSNSVEIPGGGTEGYHVLRVQENSPGHRAGLEPFFDFIVSINGIRLNKDNDTLKDLLKANVEKPVKMVVYSSKTLELRETSVTPSNMWGGQGLLGVSIRFCSFEGANENVWHVLEVEPNSPAALAGLRAHSDYIIGADTVMNESEDLFSLIETHEGKPLKLYVYNTDTDNCREVVITPNTAWGGEGSLGCGIGYGYLHRIPTRPF------------EEGKNISMPGQVPGAPVSPLKDGFTEVQLS 237          
BLAST of Golgi reassembly-stacking protein 2 vs. Ensembl Xenopus
Match: gorasp2 (golgi reassembly stacking protein 2 [Source:NCBI gene;Acc:448025])

HSP 1 Score: 251.521 bits (641), Expect = 3.925e-79
Identity = 132/228 (57.89%), Postives = 171/228 (75.00%), Query Frame = 2
Query:  200 VQEGSPGHKAGLQAFFDFVVEMGETKLSQDNEVLKELLKSNKDKPINLTIYNSKTQSFRHVELVPSQDWGGQGLLGVSIRYCSFEGANENVWHVLDIDPNSPAALAGLKQMTDYIIGAETVLNDPEEFFNLIETHDGQTLKLYVYNIETDTCREVTITPNSSWXXXXXXXXXXXXXXXHRIPSLPFTSNISSVNHECCESHKHDHNPSVVNVA------DGFSEIALT 865
            VQE SPGH+AGL+ FFDF+V +   +L++DN+ LK+LLK+N +KP+ + +Y+SKT   R   + PS  WGGQGLLGVSIR+CSFEGANENVWHVL+++PNSPAALAGL+  +DYIIGA+TV+N+ E+ F+LIETH+G+ LKLYVYN +TD CREV ITPN++WGG+G +GCGIGYGYLHRIP+ PF            E  K+   P  V  A      DGF+E+ L+
Sbjct:   21 VQENSPGHRAGLEPFFDFIVSINGIRLNKDNDTLKDLLKANVEKPVKMVVYSSKTLELRETSVTPSNMWGGQGLLGVSIRFCSFEGANENVWHVLEVEPNSPAALAGLRAHSDYIIGADTVMNESEDLFSLIETHEGKPLKLYVYNTDTDNCREVVITPNTAWGGEGSLGCGIGYGYLHRIPTRPF------------EEGKNISMPGQVPGAPVSPLKDGFTEVQLS 236          

HSP 2 Score: 68.5514 bits (166), Expect = 5.381e-12
Identity = 32/86 (37.21%), Postives = 53/86 (61.63%), Query Frame = 2
Query:  185 YHVLRVQEGSPGHKAGLQAFFDFVVEMGETKLSQDNEVLKELLKSNKDKPINLTIYNSKTQSFRHVELVPSQDWGGQGLLGVSIRY 442
            +HVL V+  SP   AGL+A  D+++  G   +  ++E L  L+++++ KP+ L +YN+ T + R V + P+  WGG+G LG  I Y
Sbjct:  112 WHVLEVEPNSPAALAGLRAHSDYII--GADTVMNESEDLFSLIETHEGKPLKLYVYNTDTDNCREVVITPNTAWGGEGSLGCGIGY 195          
BLAST of Golgi reassembly-stacking protein 2 vs. Ensembl Xenopus
Match: gorasp1 (golgi reassembly stacking protein 1 [Source:NCBI gene;Acc:448042])

HSP 1 Score: 242.276 bits (617), Expect = 1.489e-75
Identity = 116/196 (59.18%), Postives = 157/196 (80.10%), Query Frame = 2
Query:  173 GNEGYHVLRVQEGSPGHKAGLQAFFDFVVEMGETKLSQDNEVLKELLKSNKDKPINLTIYNSKTQSFRHVELVPSQDWGGQGLLGVSIRYCSFEGANENVWHVLDIDPNSPAALAGLKQMTDYIIGAETVLNDPEEFFNLIETHDGQTLKLYVYNIETDTCREVTITPNSSWXXXXXXXXXXXXXXXHRIPSLPFT 760
            G EGYHV  +QE SP   AGL+ FFDF++ +G  +L+++N + K+LLK+N +KP+ L +YN+K+   R VE+ PS  WGGQGLLG S+R+CSF+GANE+VWHVLD++PNSPAALAGL+  TDYI+G++ +L + E+F+ L+E H+G+ LKL VYN ETD+CREV +TPNS+WGG+G +GCGIGYGYLHRIP  P +
Sbjct:   15 GTEGYHVHGIQENSPAQSAGLEPFFDFIIAIGHARLNKENSMFKDLLKANAEKPVKLEVYNTKSMKVREVEVTPSNMWGGQGLLGASVRFCSFQGANEHVWHVLDVEPNSPAALAGLQSHTDYIVGSDQILQESEDFYALVEAHEGKPLKLLVYNTETDSCREVFVTPNSAWGGEGSLGCGIGYGYLHRIPLKPAS 210          
BLAST of Golgi reassembly-stacking protein 2 vs. Ensembl Xenopus
Match: gorasp1 (golgi reassembly stacking protein 1 [Source:NCBI gene;Acc:448042])

HSP 1 Score: 198.749 bits (504), Expect = 3.721e-59
Identity = 97/159 (61.01%), Postives = 131/159 (82.39%), Query Frame = 2
Query:  284 QDNEVLKELLKSNKDKPINLTIYNSKTQSFRHVELVPSQDWGGQGLLGVSIRYCSFEGANENVWHVLDIDPNSPAALAGLKQMTDYIIGAETVLNDPEEFFNLIETHDGQTLKLYVYNIETDTCREVTITPNSSWXXXXXXXXXXXXXXXHRIPSLPFT 760
            ++N + K+LLK+N +KP+ L +YN+K+   R VE+ PS  WGGQGLLG S+R+CSF+GANE+VWHVLD++PNSPAALAGL+  TDYI+G++ +L + E+F+ L+E H+G+ LKL VYN ETD+CREV +TPNS+WGG+G +GCGIGYGYLHRIP  P +
Sbjct:   25 KENSMFKDLLKANAEKPVKLEVYNTKSMKVREVEVTPSNMWGGQGLLGASVRFCSFQGANEHVWHVLDVEPNSPAALAGLQSHTDYIVGSDQILQESEDFYALVEAHEGKPLKLLVYNTETDSCREVFVTPNSAWGGEGSLGCGIGYGYLHRIPLKPAS 183          

HSP 2 Score: 72.4034 bits (176), Expect = 2.415e-13
Identity = 43/124 (34.68%), Postives = 67/124 (54.03%), Query Frame = 2
Query:  137 MGAGSSDLSHNHGNEG-YHVLRVQEGSPGHKAGLQAFFDFVVEMGETKLSQDNEVLKELLKSNKDKPINLTIYNSKTQSFRHVELVPSQDWGGQGLLGVSIRYCSFEGANENVWHVLDIDPNSP 505
            +GA     S    NE  +HVL V+  SP   AGLQ+  D++V  G  ++ Q++E    L+++++ KP+ L +YN++T S R V + P+  WGG+G LG  I Y           H + + P SP
Sbjct:   71 LGASVRFCSFQGANEHVWHVLDVEPNSPAALAGLQSHTDYIV--GSDQILQESEDFYALVEAHEGKPLKLLVYNTETDSCREVFVTPNSAWGGEGSLGCGIGYGYL--------HRIPLKPASP 184          
BLAST of Golgi reassembly-stacking protein 2 vs. Ensembl Xenopus
Match: gorasp2 (golgi reassembly stacking protein 2 [Source:NCBI gene;Acc:448025])

HSP 1 Score: 192.586 bits (488), Expect = 4.094e-57
Identity = 106/182 (58.24%), Postives = 133/182 (73.08%), Query Frame = 2
Query:  341 LTIYNSKTQSFRHVELVPSQDWGGQGLLGVSIRYCSFEGANENVWHVLDIDPNSPAALAGLKQMTDYIIGAETVLNDPEEFFNLIETHDGQTLKLYVYNIETDTCREVTITPNSSWXXXXXXXXXXXXXXXHRIPSLPFTSNISSVNHECCESHKHDHNPSVVNVA------DGFSEIALTD 868
            + +Y+SKT   R   + PS  WGGQGLLGVSIR+CSFEGANENVWHVL+++PNSPAALAGL+  +DYIIGA+TV+N+ E+ F+LIETH+G+ LKLYVYN +TD CREV ITPN++WGG+G +GCGIGYGYLHRIP+ PF            E  K+   P  V  A      DGF+E+ L+ 
Sbjct:    1 MVVYSSKTLELRETSVTPSNMWGGQGLLGVSIRFCSFEGANENVWHVLEVEPNSPAALAGLRAHSDYIIGADTVMNESEDLFSLIETHEGKPLKLYVYNTDTDNCREVVITPNTAWGGEGSLGCGIGYGYLHRIPTRPF------------EEGKNISMPGQVPGAPVSPLKDGFTEVQLSS 170          

HSP 2 Score: 68.5514 bits (166), Expect = 3.402e-12
Identity = 32/86 (37.21%), Postives = 53/86 (61.63%), Query Frame = 2
Query:  185 YHVLRVQEGSPGHKAGLQAFFDFVVEMGETKLSQDNEVLKELLKSNKDKPINLTIYNSKTQSFRHVELVPSQDWGGQGLLGVSIRY 442
            +HVL V+  SP   AGL+A  D+++  G   +  ++E L  L+++++ KP+ L +YN+ T + R V + P+  WGG+G LG  I Y
Sbjct:   45 WHVLEVEPNSPAALAGLRAHSDYII--GADTVMNESEDLFSLIETHEGKPLKLYVYNTDTDNCREVVITPNTAWGGEGSLGCGIGY 128          
BLAST of Golgi reassembly-stacking protein 2 vs. Ensembl Mouse
Match: Gorasp2 (golgi reassembly stacking protein 2 [Source:MGI Symbol;Acc:MGI:2135962])

HSP 1 Score: 261.536 bits (667), Expect = 1.908e-84
Identity = 132/207 (63.77%), Postives = 168/207 (81.16%), Query Frame = 2
Query:  137 MGAGSSDLSHNHGNEGYHVLRVQEGSPGHKAGLQAFFDFVVEMGETKLSQDNEVLKELLKSNKDKPINLTIYNSKTQSFRHVELVPSQDWGGQGLLGVSIRYCSFEGANENVWHVLDIDPNSPAALAGLKQMTDYIIGAETVLNDPEEFFNLIETHDGQTLKLYVYNIETDTCREVTITPNSSWXXXXXXXXXXXXXXXHRIPSLPF 757
            MG+  S      G EGYHVLRVQE SPGH+AGL+ FFDF+V +  ++L++DN+ LK+LLK+N +KP+ + IY+SKT   R   + PS  WGGQGLLGVSIR+CSF+GANENVWHVL+++ NSPAALAGL+  +DYIIGA+TV+N+ E+ F+LIETH+ + LKLYVYN +TD CREV ITPNS+WGG+G +GCGIGYGYLHRIP+ PF
Sbjct:    1 MGSSQSVEIPGGGTEGYHVLRVQENSPGHRAGLEPFFDFIVSINGSRLNKDNDTLKDLLKANVEKPVKMLIYSSKTLELREASVTPSNLWGGQGLLGVSIRFCSFDGANENVWHVLEVESNSPAALAGLRPHSDYIIGADTVMNESEDLFSLIETHEAKPLKLYVYNTDTDNCREVIITPNSAWGGEGSLGCGIGYGYLHRIPTRPF 207          
BLAST of Golgi reassembly-stacking protein 2 vs. Ensembl Mouse
Match: Gorasp2 (golgi reassembly stacking protein 2 [Source:MGI Symbol;Acc:MGI:2135962])

HSP 1 Score: 262.307 bits (669), Expect = 2.838e-84
Identity = 132/207 (63.77%), Postives = 168/207 (81.16%), Query Frame = 2
Query:  137 MGAGSSDLSHNHGNEGYHVLRVQEGSPGHKAGLQAFFDFVVEMGETKLSQDNEVLKELLKSNKDKPINLTIYNSKTQSFRHVELVPSQDWGGQGLLGVSIRYCSFEGANENVWHVLDIDPNSPAALAGLKQMTDYIIGAETVLNDPEEFFNLIETHDGQTLKLYVYNIETDTCREVTITPNSSWXXXXXXXXXXXXXXXHRIPSLPF 757
            MG+  S      G EGYHVLRVQE SPGH+AGL+ FFDF+V +  ++L++DN+ LK+LLK+N +KP+ + IY+SKT   R   + PS  WGGQGLLGVSIR+CSF+GANENVWHVL+++ NSPAALAGL+  +DYIIGA+TV+N+ E+ F+LIETH+ + LKLYVYN +TD CREV ITPNS+WGG+G +GCGIGYGYLHRIP+ PF
Sbjct:    1 MGSSQSVEIPGGGTEGYHVLRVQENSPGHRAGLEPFFDFIVSINGSRLNKDNDTLKDLLKANVEKPVKMLIYSSKTLELREASVTPSNLWGGQGLLGVSIRFCSFDGANENVWHVLEVESNSPAALAGLRPHSDYIIGADTVMNESEDLFSLIETHEAKPLKLYVYNTDTDNCREVIITPNSAWGGEGSLGCGIGYGYLHRIPTRPF 207          
BLAST of Golgi reassembly-stacking protein 2 vs. Ensembl Mouse
Match: Gorasp2 (golgi reassembly stacking protein 2 [Source:MGI Symbol;Acc:MGI:2135962])

HSP 1 Score: 264.618 bits (675), Expect = 6.417e-84
Identity = 132/207 (63.77%), Postives = 168/207 (81.16%), Query Frame = 2
Query:  137 MGAGSSDLSHNHGNEGYHVLRVQEGSPGHKAGLQAFFDFVVEMGETKLSQDNEVLKELLKSNKDKPINLTIYNSKTQSFRHVELVPSQDWGGQGLLGVSIRYCSFEGANENVWHVLDIDPNSPAALAGLKQMTDYIIGAETVLNDPEEFFNLIETHDGQTLKLYVYNIETDTCREVTITPNSSWXXXXXXXXXXXXXXXHRIPSLPF 757
            MG+  S      G EGYHVLRVQE SPGH+AGL+ FFDF+V +  ++L++DN+ LK+LLK+N +KP+ + IY+SKT   R   + PS  WGGQGLLGVSIR+CSF+GANENVWHVL+++ NSPAALAGL+  +DYIIGA+TV+N+ E+ F+LIETH+ + LKLYVYN +TD CREV ITPNS+WGG+G +GCGIGYGYLHRIP+ PF
Sbjct:    1 MGSSQSVEIPGGGTEGYHVLRVQENSPGHRAGLEPFFDFIVSINGSRLNKDNDTLKDLLKANVEKPVKMLIYSSKTLELREASVTPSNLWGGQGLLGVSIRFCSFDGANENVWHVLEVESNSPAALAGLRPHSDYIIGADTVMNESEDLFSLIETHEAKPLKLYVYNTDTDNCREVIITPNSAWGGEGSLGCGIGYGYLHRIPTRPF 207          
BLAST of Golgi reassembly-stacking protein 2 vs. Ensembl Mouse
Match: Gorasp2 (golgi reassembly stacking protein 2 [Source:MGI Symbol;Acc:MGI:2135962])

HSP 1 Score: 245.358 bits (625), Expect = 9.491e-77
Identity = 121/186 (65.05%), Postives = 156/186 (83.87%), Query Frame = 2
Query:  200 VQEGSPGHKAGLQAFFDFVVEMGETKLSQDNEVLKELLKSNKDKPINLTIYNSKTQSFRHVELVPSQDWGGQGLLGVSIRYCSFEGANENVWHVLDIDPNSPAALAGLKQMTDYIIGAETVLNDPEEFFNLIETHDGQTLKLYVYNIETDTCREVTITPNSSWXXXXXXXXXXXXXXXHRIPSLPF 757
            VQE SPGH+AGL+ FFDF+V +  ++L++DN+ LK+LLK+N +KP+ + IY+SKT   R   + PS  WGGQGLLGVSIR+CSF+GANENVWHVL+++ NSPAALAGL+  +DYIIGA+TV+N+ E+ F+LIETH+ + LKLYVYN +TD CREV ITPNS+WGG+G +GCGIGYGYLHRIP+ PF
Sbjct:    2 VQENSPGHRAGLEPFFDFIVSINGSRLNKDNDTLKDLLKANVEKPVKMLIYSSKTLELREASVTPSNLWGGQGLLGVSIRFCSFDGANENVWHVLEVESNSPAALAGLRPHSDYIIGADTVMNESEDLFSLIETHEAKPLKLYVYNTDTDNCREVIITPNSAWGGEGSLGCGIGYGYLHRIPTRPF 187          

HSP 2 Score: 66.2402 bits (160), Expect = 2.206e-11
Identity = 34/95 (35.79%), Postives = 56/95 (58.95%), Query Frame = 2
Query:  161 SHNHGNEG-YHVLRVQEGSPGHKAGLQAFFDFVVEMGETKLSQDNEVLKELLKSNKDKPINLTIYNSKTQSFRHVELVPSQDWGGQGLLGVSIRY 442
            S +  NE  +HVL V+  SP   AGL+   D+++  G   +  ++E L  L+++++ KP+ L +YN+ T + R V + P+  WGG+G LG  I Y
Sbjct:   84 SFDGANENVWHVLEVESNSPAALAGLRPHSDYII--GADTVMNESEDLFSLIETHEAKPLKLYVYNTDTDNCREVIITPNSAWGGEGSLGCGIGY 176          
BLAST of Golgi reassembly-stacking protein 2 vs. Ensembl Mouse
Match: Gorasp1 (golgi reassembly stacking protein 1 [Source:MGI Symbol;Acc:MGI:1921748])

HSP 1 Score: 236.884 bits (603), Expect = 3.101e-73
Identity = 118/206 (57.28%), Postives = 163/206 (79.13%), Query Frame = 2
Query:  137 MGAGSSDLSHNHGNEGYHVLRVQEGSPGHKAGLQAFFDFVVEMGETKLSQDNEVLKELLKSNKDKPINLTIYNSKTQSFRHVELVPSQDWGGQGLLGVSIRYCSFEGANENVWHVLDIDPNSPAALAGLKQMTDYIIGAETVLNDPEEFFNLIETHDGQTLKLYVYNIETDTCREVTITPNSSWXXXXXXXXXXXXXXXHRIPSLP 754
            MG G+S      G EG+H+  VQE SP  +AGL+ +FDF++ +G ++L+++N+ LK LLK+N +KP+ L ++N KT   R VE+VPS  WGGQGLLG S+R+CSF  A+E+VWHVLD++P+SPAALAGL   TDYI+G++ +L + E+FF LIE+H+G+ LKL VYN E+D+CREVT+TPN++WGG+G +GCGIGYGYLHRIP+ P
Sbjct:    1 MGLGASS-EQPAGGEGFHLHGVQENSPAQQAGLEPYFDFIITIGHSRLNKENDTLKALLKANVEKPVKLEVFNMKTMKVREVEVVPSNMWGGQGLLGASVRFCSFRRASEHVWHVLDVEPSSPAALAGLCPYTDYIVGSDQILQESEDFFTLIESHEGKPLKLMVYNSESDSCREVTVTPNAAWGGEGSLGCGIGYGYLHRIPTQP 205          
BLAST of Golgi reassembly-stacking protein 2 vs. UniProt/SwissProt
Match: sp|Q9H8Y8|GORS2_HUMAN (Golgi reassembly-stacking protein 2 OS=Homo sapiens OX=9606 GN=GORASP2 PE=1 SV=3)

HSP 1 Score: 265.774 bits (678), Expect = 1.629e-83
Identity = 138/243 (56.79%), Postives = 181/243 (74.49%), Query Frame = 2
Query:  137 MGAGSSDLSHNHGNEGYHVLRVQEGSPGHKAGLQAFFDFVVEMGETKLSQDNEVLKELLKSNKDKPINLTIYNSKTQSFRHVELVPSQDWGGQGLLGVSIRYCSFEGANENVWHVLDIDPNSPAALAGLKQMTDYIIGAETVLNDPEEFFNLIETHDGQTLKLYVYNIETDTCREVTITPNSSWXXXXXXXXXXXXXXXHRIPSLPFTSNISSVNHECCESHKHDHNPSVVNVADGFSEIALT 865
            MG+  S      G EGYHVLRVQE SPGH+AGL+ FFDF+V +  ++L++DN+ LK+LLK+N +KP+ + IY+SKT   R   + PS  WGGQGLLGVSIR+CSF+GANENVWHVL+++ NSPAALAGL+  +DYIIGA+TV+N+ E+ F+LIETH+ + LKLYVYN +TD CREV ITPNS+WGG+G +GCGIGYGYLHRIP+ PF         +     +    P +  + DGF+E+ L+
Sbjct:    1 MGSSQSVEIPGGGTEGYHVLRVQENSPGHRAGLEPFFDFIVSINGSRLNKDNDTLKDLLKANVEKPVKMLIYSSKTLELRETSVTPSNLWGGQGLLGVSIRFCSFDGANENVWHVLEVESNSPAALAGLRPHSDYIIGADTVMNESEDLFSLIETHEAKPLKLYVYNTDTDNCREVIITPNSAWGGEGSLGCGIGYGYLHRIPTRPFEE-----GKKISLPGQMAGTP-ITPLKDGFTEVQLS 237          
BLAST of Golgi reassembly-stacking protein 2 vs. UniProt/SwissProt
Match: sp|Q9R064|GORS2_RAT (Golgi reassembly-stacking protein 2 OS=Rattus norvegicus OX=10116 GN=Gorasp2 PE=1 SV=3)

HSP 1 Score: 265.388 bits (677), Expect = 2.884e-83
Identity = 132/207 (63.77%), Postives = 168/207 (81.16%), Query Frame = 2
Query:  137 MGAGSSDLSHNHGNEGYHVLRVQEGSPGHKAGLQAFFDFVVEMGETKLSQDNEVLKELLKSNKDKPINLTIYNSKTQSFRHVELVPSQDWGGQGLLGVSIRYCSFEGANENVWHVLDIDPNSPAALAGLKQMTDYIIGAETVLNDPEEFFNLIETHDGQTLKLYVYNIETDTCREVTITPNSSWXXXXXXXXXXXXXXXHRIPSLPF 757
            MG+  S      G EGYHVLRVQE SPGH+AGL+ FFDF+V +  ++L++DN+ LK+LLK+N +KP+ + IY+SKT   R   + PS  WGGQGLLGVSIR+CSF+GANENVWHVL+++ NSPAALAGL+  +DYIIGA+TV+N+ E+ F+LIETH+ + LKLYVYN +TD CREV ITPNS+WGG+G +GCGIGYGYLHRIP+ PF
Sbjct:    1 MGSSQSVEIPGGGTEGYHVLRVQENSPGHRAGLEPFFDFIVSISGSRLNKDNDTLKDLLKANVEKPVKMLIYSSKTLELREASVTPSNLWGGQGLLGVSIRFCSFDGANENVWHVLEVESNSPAALAGLRPHSDYIIGADTVMNESEDLFSLIETHEAKPLKLYVYNTDTDNCREVIITPNSAWGGEGSLGCGIGYGYLHRIPTRPF 207          
BLAST of Golgi reassembly-stacking protein 2 vs. UniProt/SwissProt
Match: sp|Q99JX3|GORS2_MOUSE (Golgi reassembly-stacking protein 2 OS=Mus musculus OX=10090 GN=Gorasp2 PE=1 SV=3)

HSP 1 Score: 264.618 bits (675), Expect = 4.489e-83
Identity = 132/207 (63.77%), Postives = 168/207 (81.16%), Query Frame = 2
Query:  137 MGAGSSDLSHNHGNEGYHVLRVQEGSPGHKAGLQAFFDFVVEMGETKLSQDNEVLKELLKSNKDKPINLTIYNSKTQSFRHVELVPSQDWGGQGLLGVSIRYCSFEGANENVWHVLDIDPNSPAALAGLKQMTDYIIGAETVLNDPEEFFNLIETHDGQTLKLYVYNIETDTCREVTITPNSSWXXXXXXXXXXXXXXXHRIPSLPF 757
            MG+  S      G EGYHVLRVQE SPGH+AGL+ FFDF+V +  ++L++DN+ LK+LLK+N +KP+ + IY+SKT   R   + PS  WGGQGLLGVSIR+CSF+GANENVWHVL+++ NSPAALAGL+  +DYIIGA+TV+N+ E+ F+LIETH+ + LKLYVYN +TD CREV ITPNS+WGG+G +GCGIGYGYLHRIP+ PF
Sbjct:    1 MGSSQSVEIPGGGTEGYHVLRVQENSPGHRAGLEPFFDFIVSINGSRLNKDNDTLKDLLKANVEKPVKMLIYSSKTLELREASVTPSNLWGGQGLLGVSIRFCSFDGANENVWHVLEVESNSPAALAGLRPHSDYIIGADTVMNESEDLFSLIETHEAKPLKLYVYNTDTDNCREVIITPNSAWGGEGSLGCGIGYGYLHRIPTRPF 207          
BLAST of Golgi reassembly-stacking protein 2 vs. UniProt/SwissProt
Match: sp|O35254|GORS1_RAT (Golgi reassembly-stacking protein 1 OS=Rattus norvegicus OX=10116 GN=Gorasp1 PE=1 SV=4)

HSP 1 Score: 238.81 bits (608), Expect = 4.579e-73
Identity = 118/206 (57.28%), Postives = 164/206 (79.61%), Query Frame = 2
Query:  137 MGAGSSDLSHNHGNEGYHVLRVQEGSPGHKAGLQAFFDFVVEMGETKLSQDNEVLKELLKSNKDKPINLTIYNSKTQSFRHVELVPSQDWGGQGLLGVSIRYCSFEGANENVWHVLDIDPNSPAALAGLKQMTDYIIGAETVLNDPEEFFNLIETHDGQTLKLYVYNIETDTCREVTITPNSSWXXXXXXXXXXXXXXXHRIPSLP 754
            MG G+S      G EG+H+  VQE SP  +AGL+ +FDF++ +G ++L+++N+ LK LLK+N +KP+ L ++N KT   R VE+VPS  WGGQGLLG S+R+CSF  A+E+VWHVLD++P+SPAALAGL+  TDYI+G++ +L + E+FF LIE+H+G+ LKL VYN E+D+CREVT+TPN++WGG+G +GCGIGYGYLHRIP+ P
Sbjct:    1 MGLGASS-EQPAGGEGFHLHGVQENSPAQQAGLEPYFDFIITIGHSRLNKENDTLKALLKANVEKPVKLEVFNMKTMRVREVEVVPSNMWGGQGLLGASVRFCSFRRASEHVWHVLDVEPSSPAALAGLRPYTDYIVGSDQILQESEDFFTLIESHEGKPLKLMVYNSESDSCREVTVTPNAAWGGEGSLGCGIGYGYLHRIPTQP 205          
BLAST of Golgi reassembly-stacking protein 2 vs. UniProt/SwissProt
Match: sp|Q9BQQ3|GORS1_HUMAN (Golgi reassembly-stacking protein 1 OS=Homo sapiens OX=9606 GN=GORASP1 PE=1 SV=3)

HSP 1 Score: 237.654 bits (605), Expect = 8.858e-73
Identity = 116/206 (56.31%), Postives = 162/206 (78.64%), Query Frame = 2
Query:  137 MGAGSSDLSHNHGNEGYHVLRVQEGSPGHKAGLQAFFDFVVEMGETKLSQDNEVLKELLKSNKDKPINLTIYNSKTQSFRHVELVPSQDWGGQGLLGVSIRYCSFEGANENVWHVLDIDPNSPAALAGLKQMTDYIIGAETVLNDPEEFFNLIETHDGQTLKLYVYNIETDTCREVTITPNSSWXXXXXXXXXXXXXXXHRIPSLP 754
            MG G S      G EG+H+  VQE SP  +AGL+ +FDF++ +G ++L+++N+ LK LLK+N +KP+ L ++N KT   R VE+VPS  WGGQGLLG S+R+CSF  A+E VWHVLD++P+SPAALAGL+  TDY++G++ +L + E+FF LIE+H+G+ LKL VYN ++D+CREVT+TPN++WGG+G +GCGIGYGYLHRIP+ P
Sbjct:    1 MGLGVSAEQPAGGAEGFHLHGVQENSPAQQAGLEPYFDFIITIGHSRLNKENDTLKALLKANVEKPVKLEVFNMKTMRVREVEVVPSNMWGGQGLLGASVRFCSFRRASEQVWHVLDVEPSSPAALAGLRPYTDYVVGSDQILQESEDFFTLIESHEGKPLKLMVYNSKSDSCREVTVTPNAAWGGEGSLGCGIGYGYLHRIPTQP 206          
BLAST of Golgi reassembly-stacking protein 2 vs. TrEMBL
Match: A0A210Q6K3 (Golgi reassembly-stacking protein 2 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT24522 PE=4 SV=1)

HSP 1 Score: 292.352 bits (747), Expect = 2.214e-91
Identity = 173/341 (50.73%), Postives = 220/341 (64.52%), Query Frame = 2
Query:  137 MGAGSSDLSHNHGNEGYHVLRVQEGSPGHKAGLQAFFDFVVEMGETKLSQDNEVLKELLKSNKDKPINLTIYNSKTQSFRHVELVPSQDWGGQGLLGVSIRYCSFEGANENVWHVLDIDPNSPAALAGLKQMTDYIIGAETVLNDPEEFFNLIETHDGQTLKLYVYNIETDTCREVTITPNSSWXXXXXXXXXXXXXXXHRIPSLPFTSNISSVNHECCESHKHDHNPSVVNVADGFSEIALTDDKAFKENTFLNME-----PQMQSHPF-------AMPIPPQP------------LPENAIKNLS-MDNTS-IIDFSSHDNQSHFPPVSTNIILPGMPP 1081
            MG   S      G EGYHVLRVQEGSPGHKAGL+AFFDF+V +G T+L+QDN+ LK+LLK+N +KP+ + +Y+SKTQS R V ++PS +WGGQGLLGVSIR+CSFEGANENVWHVL++ PNSPA LAGLK  TDYIIGA++VL++ E+ F LI++H+G+ L+LYVYN E+D+CREVTITPN +WGGDG +GCGIGYGYLHRIP   F S+IS    E   +             DGF+E++L +  A        M      P +   P         +P  P P            LP   + NL+ M N S + + S   N S  PP +  + LPGM P
Sbjct:    1 MGGSFSTEIPGGGTEGYHVLRVQEGSPGHKAGLEAFFDFIVAIGHTRLNQDNDTLKDLLKANIEKPVKMAVYSSKTQSVREVTILPSHNWGGQGLLGVSIRFCSFEGANENVWHVLEVKPNSPADLAGLKSNTDYIIGADSVLHESEDLFTLIDSHEGKPLRLYVYNTESDSCREVTITPNGAWGGDGSLGCGIGYGYLHRIPKRQFPSSISP---ETIPTSVQTPQ----KTPDGFAEVSLGNSPAGLPVGMAQMSINTGTPTIPVIPATESGAGHGVPFQPTPLPNFSSPGGGITLPATTMPNLAGMPNLSGMPNLSGMPNLSSLPPFTMPMSLPGMQP 334          
BLAST of Golgi reassembly-stacking protein 2 vs. TrEMBL
Match: A0A1S3J8A3 (Golgi reassembly-stacking protein 2-like OS=Lingula unguis OX=7574 GN=LOC106171055 PE=4 SV=1)

HSP 1 Score: 289.271 bits (739), Expect = 1.197e-90
Identity = 165/340 (48.53%), Postives = 216/340 (63.53%), Query Frame = 2
Query:  137 MGAGSSDLSHNHGNEGYHVLRVQEGSPGHKAGLQAFFDFVVEMGETKLSQDNEVLKELLKSNKDKPINLTIYNSKTQSFRHVELVPSQDWGGQGLLGVSIRYCSFEGANENVWHVLDIDPNSPAALAGLKQMTDYIIGAETVLNDPEEFFNLIETHDGQTLKLYVYNIETDTCREVTITPNSSWXXXXXXXXXXXXXXXHRIPSLPFTSNISSVNHEC-CESHKHDHNPSVVNVADGFSEIALTDDKAFKEN------TFLNMEPQMQSHPFAMPIPPQ---PLPENAIKNLSMDNT------------SIIDFSSHDNQSHFPPVSTNIILPGMPPLNV 1090
            MG   S      G EGYHVLRVQEGSPG+KAGL+AFFDF+V +G T+L+QDNE LK+LLK+N +KP+ + +Y+SKTQ  R V + PSQDWGGQGLLGVSIR+CSFEGANENVWHVL++ P SPA+ AGL   TDYIIGA++VL++ E+ F LIE+H+G+ LKLYVYN+E+DTCREV+IT N +WGG+G +GC IGYGYLHRIP+            +    S     NP +    DGFSE+ L        N      T +N  P + +    +P+ PQ     P N     +   T             + +     N ++ PP++T I + G+PPL+V
Sbjct:    1 MGGSQSAEIPGGGTEGYHVLRVQEGSPGYKAGLEAFFDFIVAIGNTRLNQDNETLKDLLKANMEKPVKMLVYSSKTQMVREVTITPSQDWGGQGLLGVSIRFCSFEGANENVWHVLEVQPKSPASAAGLIPYTDYIIGADSVLHESEDLFTLIESHEGKPLKLYVYNLESDTCREVSITANGAWGGEGSLGCDIGYGYLHRIPTAQIVEQQKQREKKAPPPSSAATTNPVLTTKPDGFSEVPLQGMANLNINHTAAPQTLIN--PALNTGSPTIPVIPQSSVASPGNHAMPYTASTTPGSMPAGFPAPAGLPNLPGLPNLANLPPLTTPISIAGLPPLSV 338          
BLAST of Golgi reassembly-stacking protein 2 vs. TrEMBL
Match: V4A2J4 (GRASP55_65 domain-containing protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_143194 PE=4 SV=1)

HSP 1 Score: 281.182 bits (718), Expect = 5.925e-90
Identity = 144/241 (59.75%), Postives = 183/241 (75.93%), Query Frame = 2
Query:  137 MGAGSSDLSHNHGNEGYHVLRVQEGSPGHKAGLQAFFDFVVEMGETKLSQDNEVLKELLKSNKDKPINLTIYNSKTQSFRHVELVPSQDWGGQGLLGVSIRYCSFEGANENVWHVLDIDPNSPAALAGLKQMTDYIIGAETVLNDPEEFFNLIETHDGQTLKLYVYNIETDTCREVTITPNSSWXXXXXXXXXXXXXXXHRIPSLPFTSNISSVNHECCESHKHDHNPSVVNVADGFSEIA 859
            MG   S      G EGYHVLRVQ+GSPGH AGL+AFFDF++ +G T+LSQDN++LKELLK+N +KP+ + +Y+SKTQ+ R V + PS +WGGQGLLGVSIR+CSFEGANENVWH+L+I+PNSPA LAGLK  TDY+IGA++VL++ E+ F LIE+H+G+ LKLYVYN  TD+CRE+TITPN +WGG G +GC IGYGYLHRIP   F +++        +S       S   V DGFSE+ 
Sbjct:    1 MGGSVSTEIPGGGTEGYHVLRVQDGSPGHLAGLEAFFDFIIAIGNTRLSQDNDILKELLKANIEKPVKMAVYSSKTQNVREVTITPSHNWGGQGLLGVSIRFCSFEGANENVWHILEIEPNSPADLAGLKSNTDYVIGADSVLHESEDLFTLIESHEGKPLKLYVYNSGTDSCREITITPNGAWGGQGSLGCDIGYGYLHRIPKRQFPTSLPETKVNLAQSQ------SPAKVQDGFSEVC 235          
BLAST of Golgi reassembly-stacking protein 2 vs. TrEMBL
Match: A0A443SAV3 (Golgi reassembly-stacking protein 2-like isoform X2 OS=Leptotrombidium deliense OX=299467 GN=B4U80_05243 PE=4 SV=1)

HSP 1 Score: 285.419 bits (729), Expect = 2.597e-89
Identity = 170/345 (49.28%), Postives = 226/345 (65.51%), Query Frame = 2
Query:  137 MGAGSSDLSHNHGNEGYHVLRVQEGSPGHKAGLQAFFDFVVEMGETKLSQDNEVLKELLKSNKDKPINLTIYNSKTQSFRHVELVPSQDWGGQGLLGVSIRYCSFEGANENVWHVLDIDPNSPAALAGLKQMTDYIIGAETVLNDPEEFFNLIETHDGQTLKLYVYNIETDTCREVTITPNSSWXXXXXXXXXXXXXXXHRIPSLPF----------TSNISSVNHECCESHKHDHNPSVVNVADGFSEIALTDDKAFKENTFLNMEPQMQSHPFAMP----IPPQPLPENAIK---NLSMDNTSIIDFSSHDNQSHFPPVSTNIILPGMPPLNVQVGSISMPMD 1120
            MG   S      G EGYHVLRVQE SPG KAGLQA+FDF++ +G T+L+QDN+ LKE+LK++ D+PI +T+YNSKTQ+ R  E+VPS  WGGQGLLGVSIR+CSFEGANE+VWHVL+++PNSPA +AGL+   DYIIGA++VL + E+ F+LIE H+G+ LK++VYN+ TD CREVTITPNS+WGG+G +GCGIGYGYLHRIP  PF          T  IS  +H    S     N  V  VA+  S + +  D+ ++ +     +PQ  +   + P    + PQ  P  A+    N ++ + S ID SS           T + +PGMPP+ V   S S+P +
Sbjct:    1 MGGSQSCEVPGGGTEGYHVLRVQEDSPGAKAGLQAYFDFIIAIGNTRLNQDNDALKEVLKASIDRPIKVTVYNSKTQTVRETEIVPSNTWGGQGLLGVSIRFCSFEGANEHVWHVLEVEPNSPAEIAGLQSNCDYIIGADSVLQESEDLFSLIEAHEGKPLKVFVYNLLTDCCREVTITPNSNWGGEGSLGCGIGYGYLHRIPKRPFDEVPVVSKPATRTIS--DHSLNASQSQTTN--VNEVANKLSNVEIGGDR-YERSEAPVYQPQATTAAASPPQVENVAPQMPPYYAMNTTLNTNIQSNSAIDTSSTGT------FVTPLTIPGMPPITV---SASLPSE 331          
BLAST of Golgi reassembly-stacking protein 2 vs. TrEMBL
Match: A0A1E1XHD9 (Putative golgi reassembly-stacking protein 2 OS=Amblyomma aureolatum OX=187763 PE=2 SV=1)

HSP 1 Score: 281.952 bits (720), Expect = 1.298e-88
Identity = 171/351 (48.72%), Postives = 220/351 (62.68%), Query Frame = 2
Query:  137 MGAGSSDLSHNHGNEGYHVLRVQEGSPGHKAGLQAFFDFVVEMGETKLSQDNEVLKELLKSNKDKPINLTIYNSKTQSFRHVELVPSQDWGGQGLLGVSIRYCSFEGANENVWHVLDIDPNSPAALAGLKQMTDYIIGAETVLNDPEEFFNLIETHDGQTLKLYVYNIETDTCREVTITPNSSWXXXXXXXXXXXXXXXHRIPSLPFTSNISSVNHECCESHKHDHNPSVVNVADGFSEIALTDDKAFKENTFLNMEPQMQSHPFAMPIPPQPLPENAI----------KNLSMDNT--SIIDFSSHDNQ---SHFPPVSTNIILPGMPPLNVQVGSISMPMDNFSKDHTA 1144
            MG   S      G EGYHVLRVQE SPGHKAGL+AFFDF+V +G T+L+QDN+VLK++LK+N +KPI +T+Y+SKTQ+ R VE+VPS  WGG GLLGVSIR+CSFEGANENVWHVLD+ P+SPA  AGL    DYIIG+++VL++ E+ F LI+ H+G+ LKLYVYN +TD CREVTITPN SWGGDG +GCGIGYGYLHRIP+ P T   +                S     DGFS + L+      +       PQ  +       P QP+ E+ +               D+   +   F S  +Q   ++  P++T I LPGMPP+ V   S S+P D  +   T+
Sbjct:    1 MGGSQSSAIPGGGTEGYHVLRVQENSPGHKAGLEAFFDFIVAIGNTRLNQDNDVLKDVLKANIEKPIVMTVYSSKTQTVRDVEIVPSSMWGGHGLLGVSIRFCSFEGANENVWHVLDVSPHSPAEAAGLGPYADYIIGSDSVLHESEDLFTLIDAHEGRPLKLYVYNTDTDGCREVTITPNKSWGGDGCLGCGIGYGYLHRIPTKPVTKTST-------------WPASSAPAGDGFSSVQLSAPSLVGDTA--ATLPQTVNALSLNDAPTQPMAESPVLASREPAPAAAAEGADSRPPASAPFGSEQDQTGPANAVPLTTPINLPGMPPITV---SASLPADALASLGTS 333          
BLAST of Golgi reassembly-stacking protein 2 vs. Ensembl Cavefish
Match: gorasp2 (golgi reassembly stacking protein 2 [Source:ZFIN;Acc:ZDB-GENE-040426-1659])

HSP 1 Score: 271.937 bits (694), Expect = 1.244e-88
Identity = 144/245 (58.78%), Postives = 184/245 (75.10%), Query Frame = 2
Query:  137 MGAGSSDLSHNHGNEGYHVLRVQEGSPGHKAGLQAFFDFVVEMGETKLSQDNEVLKELLKSNKDKPINLTIYNSKTQSFRHVELVPSQDWGGQGLLGVSIRYCSFEGANENVWHVLDIDPNSPAALAGLKQMTDYIIGAETVLNDPEEFFNLIETHDGQTLKLYVYNIETDTCREVTITPNSSWXXXXXXXXXXXXXXXHRIPSLPFTSNISSVNHECCESHKHDHNPS--VVNVADGFSEIALT 865
            MG   S      G+EGYHVLRVQE SPGH+AGL+ FFDF+V +  T+L++DN+ LK+LLK+N +KP+ + +Y+SKT   R   + PS  WGGQGLLGVSIR+CSFEGANENVWHVL+++ NSPAALAGL+  TDYIIGA+TV+N+ E+ F+LIETH+G+ LKLYVYN +TD+CREV ITPNS+WGG+G +GCGIGYGYLHRIP+ PF         E  +     H PS     + DGF+E+ L+
Sbjct:    1 MGGAMSVEIPGGGSEGYHVLRVQENSPGHRAGLEPFFDFIVSINNTRLNKDNDTLKDLLKANVEKPVKMLVYSSKTLELRESTVTPSNMWGGQGLLGVSIRFCSFEGANENVWHVLEVESNSPAALAGLRPFTDYIIGADTVMNESEDLFSLIETHEGKGLKLYVYNTDTDSCREVVITPNSAWGGEGSLGCGIGYGYLHRIPTRPF--------EEGKKISFPGHTPSEPFSPLKDGFTEVQLS 237          
BLAST of Golgi reassembly-stacking protein 2 vs. Ensembl Cavefish
Match: gorasp1a (Golgi reassembly-stacking protein 1-like [Source:NCBI gene;Acc:103042711])

HSP 1 Score: 249.595 bits (636), Expect = 1.512e-78
Identity = 129/245 (52.65%), Postives = 178/245 (72.65%), Query Frame = 2
Query:  137 MGAGSSDLSHNHGNEGYHVLRVQEGSPGHKAGLQAFFDFVVEMGETKLSQDNEVLKELLKSNKDKPINLTIYNSKTQSFRHVELVPSQDWGGQGLLGVSIRYCSFEGANENVWHVLDIDPNSPAALAGLKQMTDYIIGAETVLNDPEEFFNLIETHDGQTLKLYVYNIETDTCREVTITPNSSWXXXXXXXXXXXXXXXHRIPSLPFTSNISSVNHECCESHKHDHNPSVVNVADGFSEIALTDD 871
            MG   S      G  GYHV  VQE SP  KAGL+ FFDF++ +G T+L+Q+N++LK+LLK+N +K + + ++N+K+  FR +++VPS  WGGQGLLG S+R+CSF+GANENVWHVL+++ NSPA++AGL+  TD+I+GA+ VL D E+FF+LIE H+G+ LKL VYN ETDTCREV +TPN +WGG+G +GCGIGYGYLHRIP+ P +   +  N     + +H   PS  N     +E +L +D
Sbjct:    1 MGLTQSGAGAEGGTHGYHVHGVQENSPAEKAGLEPFFDFIISIGNTRLNQENDLLKDLLKANVEKAVKMEVFNTKSMKFRELQVVPSNMWGGQGLLGASVRFCSFQGANENVWHVLEVEVNSPASVAGLRAFTDFIVGADQVLQDAEDFFSLIEAHEGKPLKLLVYNTETDTCREVLVTPNGAWGGEGSLGCGIGYGYLHRIPARPDSPEYTEANR--SPNTRHAAEPSAENAT--ITEHSLNED 241          
BLAST of Golgi reassembly-stacking protein 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000179.1 (pep scaffold:Pmarinus_7.0:GL478088:189721:197323:1 gene:ENSPMAG00000000159.1 transcript:ENSPMAT00000000179.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 277.33 bits (708), Expect = 1.408e-89
Identity = 158/317 (49.84%), Postives = 210/317 (66.25%), Query Frame = 2
Query:  137 MGAGSSDLSHNHGNEGYHVLRVQEGSPGHKAGLQAFFDFVVEMGETKLSQDNEVLKELLKSNKDKPINLTIYNSKTQSFRHVELVPSQDWGGQGLLGVSIRYCSFEGANENVWHVLDIDPNSPAALAGLKQMTDYIIGAETVLNDPEEFFNLIETHDGQTLKLYVYNIETDTCREVTITPNSSWXXXXXXXXXXXXXXXHRIPSLPFTSNISSVNHECCESHKHDHNPSVVNVADGFSEIALTDDKAFKENTFLN--MEPQMQSHPFAMPIPPQPLPENAIKNLSMDNTSIIDFSSHDNQSHFPPVSTNIILPGMPP 1081
            MG   S      G+EGYHVLRVQE SPGH+AGL+ FFDF+V +G T+L +DNE LK+LLK+N +KP+ +++++SKT   R V + PS  WGGQGLLGVSIR+CSFEGANENVWHVLD++P+SPAALAGL+  +DYIIGA+ VLN+ E+ + +IE+H+G+ LKLYVYN + D+CREV ITPN +WGG+G +GCGIGYGYLHRIP+ PFT              K     +  +  DGF+E++L+       N+ L+    P + S P +      P    +  N  +    +I   SH N S  PPV  +I L G+ P
Sbjct:    1 MGGSQSVAVPGGGSEGYHVLRVQENSPGHRAGLEPFFDFIVSIGNTRLDRDNETLKDLLKANVEKPVRMSVFSSKTLKVRDVSITPSNLWGGQGLLGVSIRFCSFEGANENVWHVLDLEPHSPAALAGLRPFSDYIIGADAVLNESEDLYTMIESHEGKPLKLYVYNSDIDSCREVVITPNGAWGGEGSLGCGIGYGYLHRIPTRPFTEG------------KLISPSTTTSAKDGFTEVSLS-----AANSLLSSPTPPGVASLPLSTTASSTPPSVTSALNDGVLTMPVIP--SHTNAS-LPPVIDDIPLTGVMP 297          
BLAST of Golgi reassembly-stacking protein 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002310.1 (pep scaffold:Pmarinus_7.0:GL476946:250508:256673:-1 gene:ENSPMAG00000002096.1 transcript:ENSPMAT00000002310.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 207.223 bits (526), Expect = 3.255e-64
Identity = 105/159 (66.04%), Postives = 134/159 (84.28%), Query Frame = 2
Query:  284 QDNEVLKELLKSNKDKPINLTIYNSKTQSFRHVELVPSQDWGGQGLLGVSIRYCSFEGANENVWHVLDIDPNSPAALAGLKQMTDYIIGAETVLNDPEEFFNLIETHDGQTLKLYVYNIETDTCREVTITPNSSWXXXXXXXXXXXXXXXHRIPSLPFT 760
            +DN++L++ LK N +KP+ + +Y+SK    R V + PS  WGGQGLLGVSIR+CSF+GANENVWH+L+++PNSPA LAGL+  TDYIIGA+ VLN+ E+ F+LIE+HDG+ LKLYVYN +TD+CREV ITPN SWGG+GL+GCGIGYGYLHRIP+ PFT
Sbjct:    2 KDNDMLRQQLKENVEKPVLMQVYSSKNLKVREVTVTPSALWGGQGLLGVSIRFCSFDGANENVWHILEVEPNSPAVLAGLRPFTDYIIGADAVLNESEDLFSLIESHDGKPLKLYVYNTDTDSCREVIITPNKSWGGEGLLGCGIGYGYLHRIPTRPFT 160          

HSP 2 Score: 72.7886 bits (177), Expect = 1.197e-14
Identity = 37/95 (38.95%), Postives = 58/95 (61.05%), Query Frame = 2
Query:  161 SHNHGNEG-YHVLRVQEGSPGHKAGLQAFFDFVVEMGETKLSQDNEVLKELLKSNKDKPINLTIYNSKTQSFRHVELVPSQDWGGQGLLGVSIRY 442
            S +  NE  +H+L V+  SP   AGL+ F D+++  G   +  ++E L  L++S+  KP+ L +YN+ T S R V + P++ WGG+GLLG  I Y
Sbjct:   56 SFDGANENVWHILEVEPNSPAVLAGLRPFTDYII--GADAVLNESEDLFSLIESHDGKPLKLYVYNTDTDSCREVIITPNKSWGGEGLLGCGIGY 148          
BLAST of Golgi reassembly-stacking protein 2 vs. Ensembl Yeast
Match: GRH1 (Acetylated cis-Golgi protein, involved in ER to Golgi transport; homolog of human GRASP65; forms a complex with the coiled-coil protein Bug1p; mutants are compromised for the fusion of ER-derived vesicles with Golgi membranes; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000002925])

HSP 1 Score: 45.8246 bits (107), Expect = 6.500e-6
Identity = 53/220 (24.09%), Postives = 90/220 (40.91%), Query Frame = 2
Query:  143 AGSSDLSHNHGNE---GYHVLRVQEGSPGHKAGLQAFFDFVVEMGETKL----------SQDNEVLKELLKSNKDKPINLTIYNSKTQSFR--------------------HVELVPSQDWGGQ-GLLGVSIRYCSFEGANENVWHVLDID-PNSPAALAGLKQMTDYII---------GAETVLNDPEEFFNLIETHDGQTLKLYVYNIETDTCREVTI 670
            A S  + H + NE   G  ++ V E     +  LQ+FFD++V   +  +            D   +  +   +  + + + I+++K  +FR                    H E  PS     Q   LG  +++     A+   +H+L+++ P+ PA  AGL    DYII         G ET+L D      ++ +     L LYVYN  +D  R +T+
Sbjct:   51 AVSEGVKHTNVNETLSGLRIVWVDE----MQFQLQSFFDYIVGFNDDPVPVVSNQHGFSYPDYRRITSIFNEHCGRTLKVNIWSAKGGTFRDEYISIISKESDDLDDVSLNHDERRPSSGEAHQFQALGFKVQWTPLI-ASTFTYHILNVNIPDGPAQSAGLIPDEDYIIGCQDGLLATGGETLLQD------IVRSRANYDLVLYVYNKVSDCVRPITV 259          
BLAST of Golgi reassembly-stacking protein 2 vs. Ensembl Nematostella
Match: EDO49425 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGG6])

HSP 1 Score: 263.077 bits (671), Expect = 3.940e-87
Identity = 133/203 (65.52%), Postives = 165/203 (81.28%), Query Frame = 2
Query:  137 MGAGSSDLSHNHGNEGYHVLRVQEGSPGHKAGLQAFFDFVVEMGETKLSQDNEVLKELLKSNKDKPINLTIYNSKTQSFRHVELVPSQDWGGQGLLGVSIRYCSFEGANENVWHVLDIDPNSPAALAGLKQMTDYIIGAETVLNDPEEFFNLIETHDGQTLKLYVYNIETDTCREVTITPNSSWXXXXXXXXXXXXXXXHRIP 745
            MGA  S      G+EGYHVLRVQE SPG+KAGL+ FFDF++ +  T+L QDNE LKE+LK+N +KP+ + +Y+SKTQ  R   + PS  WGGQGLLGVSIR+CSF+GANENVWHVLD+ PNSPA +AGL+  TDYIIGA++VL++ E+ F LIE+H+ + LKLYVYN ETD CRE+TITPNS+WGG+G +GCGIGYGYLHRIP
Sbjct:    1 MGASESTEVPGGGSEGYHVLRVQENSPGYKAGLEPFFDFIISIENTRLDQDNETLKEILKANAEKPVKMLVYSSKTQKVREASITPSNMWGGQGLLGVSIRFCSFDGANENVWHVLDVQPNSPADIAGLRSNTDYIIGADSVLHESEDLFQLIESHENKPLKLYVYNCETDGCREITITPNSNWGGEGSLGCGIGYGYLHRIP 203          
BLAST of Golgi reassembly-stacking protein 2 vs. Ensembl Medaka
Match: ENSORLT00000027021.1 (Golgi reassembly-stacking protein 2 [Source:NCBI gene;Acc:101167738])

HSP 1 Score: 268.085 bits (684), Expect = 1.450e-85
Identity = 140/243 (57.61%), Postives = 181/243 (74.49%), Query Frame = 2
Query:  137 MGAGSSDLSHNHGNEGYHVLRVQEGSPGHKAGLQAFFDFVVEMGETKLSQDNEVLKELLKSNKDKPINLTIYNSKTQSFRHVELVPSQDWGGQGLLGVSIRYCSFEGANENVWHVLDIDPNSPAALAGLKQMTDYIIGAETVLNDPEEFFNLIETHDGQTLKLYVYNIETDTCREVTITPNSSWXXXXXXXXXXXXXXXHRIPSLPFTSNISSVNHECCESHKHDHNPSVVNVADGFSEIALT 865
            MG   S      G+EGYHVLRVQE SPGH+AGL+ FFDF+V +  T+L++DN+ LK+LLK++ +KP+ + +Y++KT   R   + PS  WGGQGLLGVSIR+CSFEGANENVWHVL+++ NSPAALAGL+  TDYIIGA+TV+N+ E+ F+LIETH+G+ LKLYVYN +TD CREV ITPNS+WGG+G +GCGIGYGYLHRIP+ PF            +S        +  + DGF+E+ LT
Sbjct:    1 MGGSQSVEIPGGGSEGYHVLRVQENSPGHRAGLEPFFDFIVSINNTRLNKDNDTLKDLLKASVEKPVKMLVYSAKTLELRECTVTPSNMWGGQGLLGVSIRFCSFEGANENVWHVLEVENNSPAALAGLRPHTDYIIGADTVMNESEDLFSLIETHEGKGLKLYVYNTDTDNCREVVITPNSAWGGEGSLGCGIGYGYLHRIPTRPFEEGKKISFPGSPQSEP------ISPLKDGFTEVQLT 237          
BLAST of Golgi reassembly-stacking protein 2 vs. Ensembl Medaka
Match: ENSORLT00000012410.2 (Golgi reassembly-stacking protein 1 [Source:NCBI gene;Acc:101156858])

HSP 1 Score: 237.269 bits (604), Expect = 1.654e-75
Identity = 128/257 (49.81%), Postives = 179/257 (69.65%), Query Frame = 2
Query:  149 SSDLSHNHGNEGYHVLRVQEGSPGHKAGLQAFFDFVVEMGETKLSQDNEVLKELLKSNKDKPINLTIYNSKTQSFRHVELVPSQDWGGQGLLGVSIRYCSFEGANENVWHVLDIDPNSPAALAGLKQMTDYIIGAETVLNDPEEFFNLIETHDGQTLKLYVYNIETDTCREVTITPNSSWXXXXXXXXXXXXXXXHRIPS--LPFTSNISSVNHECCESHKHDHNPSVVNVADGFSEIALTDDKAFKENTFLNMEPQ 913
            SS LS    + GYHV  +QEGSP  KAGL+ FFDF++ +G T+L++++++LK++LK+N +K + L +YNSKTQ  R +E+ PS  WGG GLLG S+R+C FEGANENVWHVLD++P SPAALAGL+  +D+I+GA+ VL D E+FF+LIE ++G+ LKL VYN +TD CRE  +TPN+ WGG+G +GCGIGYGYLHRIP+  +P          E   S++               E+A +D++    +TF+  +PQ
Sbjct:    6 SSFLSGGGRSCGYHVHGIQEGSPALKAGLEPFFDFILSIGHTRLNKESDLLKDMLKANVEKAVKLEVYNSKTQRVRELEVTPSNMWGGHGLLGASVRFCCFEGANENVWHVLDVEPRSPAALAGLRAHSDFIVGADQVLQDSEDFFSLIEANEGKPLKLLVYNTQTDGCREAVVTPNADWGGEGSLGCGIGYGYLHRIPTRHVPLILQSEGSLPELTTSNE---------------EVASSDNREVSSDTFVLFDPQ 247          
BLAST of Golgi reassembly-stacking protein 2 vs. Ensembl Medaka
Match: ENSORLT00000043765.1 (Golgi reassembly-stacking protein 1 [Source:NCBI gene;Acc:101156858])

HSP 1 Score: 236.884 bits (603), Expect = 6.136e-75
Identity = 127/255 (49.80%), Postives = 178/255 (69.80%), Query Frame = 2
Query:  149 SSDLSHNHGNEGYHVLRVQEGSPGHKAGLQAFFDFVVEMGETKLSQDNEVLKELLKSNKDKPINLTIYNSKTQSFRHVELVPSQDWGGQGLLGVSIRYCSFEGANENVWHVLDIDPNSPAALAGLKQMTDYIIGAETVLNDPEEFFNLIETHDGQTLKLYVYNIETDTCREVTITPNSSWXXXXXXXXXXXXXXXHRIPSLPFTSNISSVNHECCESHKHDHNPSVVNVADGFSEIALTDDKAFKENTFLNMEPQ 913
            SS LS    + GYHV  +QEGSP  KAGL+ FFDF++ +G T+L++++++LK++LK+N +K + L +YNSKTQ  R +E+ PS  WGG GLLG S+R+C FEGANENVWHVLD++P SPAALAGL+  +D+I+GA+ VL D E+FF+LIE ++G+ LKL VYN +TD CRE  +TPN+ WGG+G +GCGIGYGYLHRIP+      + S               S+  +     E+A +D++    +TF+  +PQ
Sbjct:    6 SSFLSGGGRSCGYHVHGIQEGSPALKAGLEPFFDFILSIGHTRLNKESDLLKDMLKANVEKAVKLEVYNSKTQRVRELEVTPSNMWGGHGLLGASVRFCCFEGANENVWHVLDVEPRSPAALAGLRAHSDFIVGADQVLQDSEDFFSLIEANEGKPLKLLVYNTQTDGCREAVVTPNADWGGEGSLGCGIGYGYLHRIPTRHVPLILQS-------------EGSLPELTTSNEEVASSDNREVSSDTFVLFDPQ 247          
BLAST of Golgi reassembly-stacking protein 2 vs. Ensembl Medaka
Match: gorasp1a (golgi reassembly stacking protein 1 [Source:NCBI gene;Acc:101160022])

HSP 1 Score: 237.654 bits (605), Expect = 4.696e-73
Identity = 133/284 (46.83%), Postives = 189/284 (66.55%), Query Frame = 2
Query:  137 MGAGSSDLSHNHGNEGYHVLRVQEGSPGHKAGLQAFFDFVVEMGETKLSQDNEVLKELLKSNKDKPINLTIYNSKTQSFRHVELVPSQDWGGQGLLGVSIRYCSFEGANENVWHVLDIDPNSPAALAGLKQMTDYIIGAETVLNDPEEFFNLIETHDGQTLKLYVYNIETDTCREVTITPNSSWXXXXXXXXXXXXXXXHRIPSLPFTSNISSVNHECCESHKHDHNPSVVNVADGFSEIALTDDKAFKENTFLNMEPQMQSHPFAMPIPPQPLPENAIKNLSM 988
            MG   S  +   G  GYHV  VQ  SP  KAGL+ FFDF++ +   +L+++N++LKE+LK+N +K +N+ +Y++KT   R +E+VP+  WGGQGLLG S+R+CS++GA+ENVWHVLD++P+SPAALAGL+  TDYI+GA+ VL D E+FF LIE H+G+ LKL VYN +TD CR+V +TPN +WGG+G +GCGIGYGYLHRIP  P  S  S       E     ++P+ +  A G++E  L    A +    +++E Q+       P P Q +P+    +  M
Sbjct:   61 MGLSQSSEAFEGGTYGYHVHGVQPNSPAEKAGLEPFFDFILSLDSKRLNEENDLLKEVLKANMEKAVNMEVYSTKTTRVRELEVVPNNMWGGQGLLGASVRFCSYQGASENVWHVLDVEPSSPAALAGLQSHTDYIVGADQVLQDSEDFFALIEAHEGKPLKLLVYNTQTDACRDVMVTPNGAWGGEGSLGCGIGYGYLHRIPVNPAASAESPSTAVSAE-----NSPAELP-AQGYTEALLMAPSA-QTGQLIDVE-QITLQEAPPPAPAQGIPDRGFSDEEM 336          
BLAST of Golgi reassembly-stacking protein 2 vs. Ensembl Medaka
Match: GORASP2 (golgi reassembly stacking protein 2 [Source:HGNC Symbol;Acc:HGNC:17500])

HSP 1 Score: 176.407 bits (446), Expect = 1.243e-52
Identity = 88/137 (64.23%), Postives = 112/137 (81.75%), Query Frame = 2
Query:  347 IYNSKTQSFRHVELVPSQDWGGQGLLGVSIRYCSFEGANENVWHVLDIDPNSPAALAGLKQMTDYIIGAETVLNDPEEFFNLIETHDGQTLKLYVYNIETDTCREVTITPNSSWXXXXXXXXXXXXXXXHRIPSLPF 757
            +Y+SKT S R   + PS  WGG+GLLGVSIR+CSF+GANENVWHVL+I+PNSPA+LAGL+   D+IIGA+  +N+ E+ F+LIE H+G+ LK+YVY+ + D CREV ITPNS WGG G +GCGIG+GYLHRIP+LP 
Sbjct:    3 LYSSKTLSVRETTVTPSTTWGGRGLLGVSIRFCSFQGANENVWHVLEIEPNSPASLAGLRAHVDFIIGADAEMNEGEDLFSLIEAHEGKELKMYVYSTDADNCREVIITPNSEWGGKGSLGCGIGFGYLHRIPTLPL 139          

HSP 2 Score: 57.3806 bits (137), Expect = 3.608e-9
Identity = 27/86 (31.40%), Postives = 50/86 (58.14%), Query Frame = 2
Query:  185 YHVLRVQEGSPGHKAGLQAFFDFVVEMGETKLSQDNEVLKELLKSNKDKPINLTIYNSKTQSFRHVELVPSQDWGGQGLLGVSIRY 442
            +HVL ++  SP   AGL+A  DF++  G      + E L  L+++++ K + + +Y++   + R V + P+ +WGG+G LG  I +
Sbjct:   45 WHVLEIEPNSPASLAGLRAHVDFII--GADAEMNEGEDLFSLIEAHEGKELKMYVYSTDADNCREVIITPNSEWGGKGSLGCGIGF 128          
BLAST of Golgi reassembly-stacking protein 2 vs. Planmine SMEST
Match: SMESG000038319.1 (SMESG000038319.1)

HSP 1 Score: 463.766 bits (1192), Expect = 2.757e-165
Identity = 239/241 (99.17%), Postives = 241/241 (100.00%), Query Frame = 2
Query:  137 MGAGSSDLSHNHGNEGYHVLRVQEGSPGHKAGLQAFFDFVVEMGETKLSQDNEVLKELLKSNKDKPINLTIYNSKTQSFRHVELVPSQDWGGQGLLGVSIRYCSFEGANENVWHVLDIDPNSPAALAGLKQMTDYIIGAETVLNDPEEFFNLIETHDGQTLKLYVYNIETDTCREVTITPNSSWXXXXXXXXXXXXXXXHRIPSLPFTSNISSVNHECCESHKHDHNPSVVNVADGFSEIA 859
            MGAGSSDLSHNHGNEGYHVLRVQEGSPGHKAGLQAFFDFVVEMGETKLSQDNEVLKELLKSNKDKPINLTIYNSKTQSFRHVELVPSQDWGGQGLLGVSIRYCSFEGANENVWHVLDIDPNSPAALAGLKQMTDYIIGAETVLNDPEEFFNLIETHDGQTLKLYVYNIETDTCREVTITPNSSWGGDGLIGCGIGYGYLHRIPSLPFTSNISSVNHECCESHKHDHNPSVVNVADGFSE++
Sbjct:    1 MGAGSSDLSHNHGNEGYHVLRVQEGSPGHKAGLQAFFDFVVEMGETKLSQDNEVLKELLKSNKDKPINLTIYNSKTQSFRHVELVPSQDWGGQGLLGVSIRYCSFEGANENVWHVLDIDPNSPAALAGLKQMTDYIIGAETVLNDPEEFFNLIETHDGQTLKLYVYNIETDTCREVTITPNSSWGGDGLIGCGIGYGYLHRIPSLPFTSNISSVNHECCESHKHDHNPSVVNVADGFSEVS 241          
BLAST of Golgi reassembly-stacking protein 2 vs. Planmine SMEST
Match: SMESG000035854.1 (SMESG000035854.1)

HSP 1 Score: 463.766 bits (1192), Expect = 2.757e-165
Identity = 239/241 (99.17%), Postives = 241/241 (100.00%), Query Frame = 2
Query:  137 MGAGSSDLSHNHGNEGYHVLRVQEGSPGHKAGLQAFFDFVVEMGETKLSQDNEVLKELLKSNKDKPINLTIYNSKTQSFRHVELVPSQDWGGQGLLGVSIRYCSFEGANENVWHVLDIDPNSPAALAGLKQMTDYIIGAETVLNDPEEFFNLIETHDGQTLKLYVYNIETDTCREVTITPNSSWXXXXXXXXXXXXXXXHRIPSLPFTSNISSVNHECCESHKHDHNPSVVNVADGFSEIA 859
            MGAGSSDLSHNHGNEGYHVLRVQEGSPGHKAGLQAFFDFVVEMGETKLSQDNEVLKELLKSNKDKPINLTIYNSKTQSFRHVELVPSQDWGGQGLLGVSIRYCSFEGANENVWHVLDIDPNSPAALAGLKQMTDYIIGAETVLNDPEEFFNLIETHDGQTLKLYVYNIETDTCREVTITPNSSWGGDGLIGCGIGYGYLHRIPSLPFTSNISSVNHECCESHKHDHNPSVVNVADGFSE++
Sbjct:    1 MGAGSSDLSHNHGNEGYHVLRVQEGSPGHKAGLQAFFDFVVEMGETKLSQDNEVLKELLKSNKDKPINLTIYNSKTQSFRHVELVPSQDWGGQGLLGVSIRYCSFEGANENVWHVLDIDPNSPAALAGLKQMTDYIIGAETVLNDPEEFFNLIETHDGQTLKLYVYNIETDTCREVTITPNSSWGGDGLIGCGIGYGYLHRIPSLPFTSNISSVNHECCESHKHDHNPSVVNVADGFSEVS 241          
BLAST of Golgi reassembly-stacking protein 2 vs. Planmine SMEST
Match: SMESG000038319.1 (SMESG000038319.1)

HSP 1 Score: 455.292 bits (1170), Expect = 5.441e-162
Identity = 237/241 (98.34%), Postives = 239/241 (99.17%), Query Frame = 2
Query:  137 MGAGSSDLSHNHGNEGYHVLRVQEGSPGHKAGLQAFFDFVVEMGETKLSQDNEVLKELLKSNKDKPINLTIYNSKTQSFRHVELVPSQDWGGQGLLGVSIRYCSFEGANENVWHVLDIDPNSPAALAGLKQMTDYIIGAETVLNDPEEFFNLIETHDGQTLKLYVYNIETDTCREVTITPNSSWXXXXXXXXXXXXXXXHRIPSLPFTSNISSVNHECCESHKHDHNPSVVNVADGFSEIA 859
            MGAGSSDLSHNHGNEGYHVLRVQEGSPGHKAGLQAFFDFVVEMGETKL  DNEVLKELLKSNKDKPINLTIYNSKTQSFRHVELVPSQDWGGQGLLGVSIRYCSFEGANENVWHVLDIDPNSPAALAGLKQMTDYIIGAETVLNDPEEFFNLIETHDGQTLKLYVYNIETDTCREVTITPNSSWGGDGLIGCGIGYGYLHRIPSLPFTSNISSVNHECCESHKHDHNPSVVNVADGFSE++
Sbjct:    1 MGAGSSDLSHNHGNEGYHVLRVQEGSPGHKAGLQAFFDFVVEMGETKL--DNEVLKELLKSNKDKPINLTIYNSKTQSFRHVELVPSQDWGGQGLLGVSIRYCSFEGANENVWHVLDIDPNSPAALAGLKQMTDYIIGAETVLNDPEEFFNLIETHDGQTLKLYVYNIETDTCREVTITPNSSWGGDGLIGCGIGYGYLHRIPSLPFTSNISSVNHECCESHKHDHNPSVVNVADGFSEVS 239          
The following BLAST results are available for this feature:
BLAST of Golgi reassembly-stacking protein 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GORASP23.392e-8456.79golgi reassembly stacking protein 2 [Source:HGNC S... [more]
GORASP11.844e-7356.31golgi reassembly stacking protein 1 [Source:HGNC S... [more]
GORASP12.863e-7253.80golgi reassembly stacking protein 1 [Source:HGNC S... [more]
GORASP13.024e-6753.14golgi reassembly stacking protein 1 [Source:HGNC S... [more]
GORASP18.923e-5350.33golgi reassembly stacking protein 1 [Source:HGNC S... [more]
back to top
BLAST of Golgi reassembly-stacking protein 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Y42H9AR.18.076e-7649.81pep chromosome:WBcel235:IV:8113384:8115670:1 gene:... [more]
Y42H9AR.18.076e-7649.81pep chromosome:WBcel235:IV:8113495:8115607:1 gene:... [more]
Y42H9AR.18.076e-7649.81pep chromosome:WBcel235:IV:8113495:8115668:1 gene:... [more]
back to top
BLAST of Golgi reassembly-stacking protein 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Grasp651.502e-8162.07gene:FBgn0036919 transcript:FBtr0074895[more]
back to top
BLAST of Golgi reassembly-stacking protein 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
gorasp21.665e-8858.78golgi reassembly stacking protein 2 [Source:ZFIN;A... [more]
gorasp1a6.863e-7861.34golgi reassembly stacking protein 1a [Source:ZFIN;... [more]
gorasp1b1.064e-7359.79golgi reassembly stacking protein 1b [Source:ZFIN;... [more]
back to top
BLAST of Golgi reassembly-stacking protein 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gorasp21.762e-8657.43golgi reassembly stacking protein 2 [Source:NCBI g... [more]
gorasp23.925e-7957.89golgi reassembly stacking protein 2 [Source:NCBI g... [more]
gorasp11.489e-7559.18golgi reassembly stacking protein 1 [Source:NCBI g... [more]
gorasp13.721e-5961.01golgi reassembly stacking protein 1 [Source:NCBI g... [more]
gorasp24.094e-5758.24golgi reassembly stacking protein 2 [Source:NCBI g... [more]
back to top
BLAST of Golgi reassembly-stacking protein 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Gorasp21.908e-8463.77golgi reassembly stacking protein 2 [Source:MGI Sy... [more]
Gorasp22.838e-8463.77golgi reassembly stacking protein 2 [Source:MGI Sy... [more]
Gorasp26.417e-8463.77golgi reassembly stacking protein 2 [Source:MGI Sy... [more]
Gorasp29.491e-7765.05golgi reassembly stacking protein 2 [Source:MGI Sy... [more]
Gorasp13.101e-7357.28golgi reassembly stacking protein 1 [Source:MGI Sy... [more]
back to top
BLAST of Golgi reassembly-stacking protein 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9H8Y8|GORS2_HUMAN1.629e-8356.79Golgi reassembly-stacking protein 2 OS=Homo sapien... [more]
sp|Q9R064|GORS2_RAT2.884e-8363.77Golgi reassembly-stacking protein 2 OS=Rattus norv... [more]
sp|Q99JX3|GORS2_MOUSE4.489e-8363.77Golgi reassembly-stacking protein 2 OS=Mus musculu... [more]
sp|O35254|GORS1_RAT4.579e-7357.28Golgi reassembly-stacking protein 1 OS=Rattus norv... [more]
sp|Q9BQQ3|GORS1_HUMAN8.858e-7356.31Golgi reassembly-stacking protein 1 OS=Homo sapien... [more]
back to top
BLAST of Golgi reassembly-stacking protein 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A210Q6K32.214e-9150.73Golgi reassembly-stacking protein 2 OS=Mizuhopecte... [more]
A0A1S3J8A31.197e-9048.53Golgi reassembly-stacking protein 2-like OS=Lingul... [more]
V4A2J45.925e-9059.75GRASP55_65 domain-containing protein OS=Lottia gig... [more]
A0A443SAV32.597e-8949.28Golgi reassembly-stacking protein 2-like isoform X... [more]
A0A1E1XHD91.298e-8848.72Putative golgi reassembly-stacking protein 2 OS=Am... [more]
back to top
BLAST of Golgi reassembly-stacking protein 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
gorasp21.244e-8858.78golgi reassembly stacking protein 2 [Source:ZFIN;A... [more]
gorasp1a1.512e-7852.65Golgi reassembly-stacking protein 1-like [Source:N... [more]
back to top
BLAST of Golgi reassembly-stacking protein 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000000179.11.408e-8949.84pep scaffold:Pmarinus_7.0:GL478088:189721:197323:1... [more]
ENSPMAT00000002310.13.255e-6466.04pep scaffold:Pmarinus_7.0:GL476946:250508:256673:-... [more]
back to top
BLAST of Golgi reassembly-stacking protein 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
GRH16.500e-624.09Acetylated cis-Golgi protein, involved in ER to Go... [more]
back to top
BLAST of Golgi reassembly-stacking protein 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO494253.940e-8765.52Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Golgi reassembly-stacking protein 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000027021.11.450e-8557.61Golgi reassembly-stacking protein 2 [Source:NCBI g... [more]
ENSORLT00000012410.21.654e-7549.81Golgi reassembly-stacking protein 1 [Source:NCBI g... [more]
ENSORLT00000043765.16.136e-7549.80Golgi reassembly-stacking protein 1 [Source:NCBI g... [more]
gorasp1a4.696e-7346.83golgi reassembly stacking protein 1 [Source:NCBI g... [more]
GORASP21.243e-5264.23golgi reassembly stacking protein 2 [Source:HGNC S... [more]
back to top
BLAST of Golgi reassembly-stacking protein 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000038319.12.757e-16599.17SMESG000038319.1[more]
SMESG000035854.12.757e-16599.17SMESG000035854.1[more]
SMESG000038319.15.441e-16298.34SMESG000038319.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30028245 ID=SMED30028245|Name=Golgi reassembly-stacking protein 2|organism=Schmidtea mediterranea sexual|type=transcript|length=1234bp
CGATCTAATAATCCGACACCAATATTTAATATATCTGAAATGTGTTTTAA
TAATTAAAGTAAATAATAAATTATTGATTTCTACACGTCTACGAAATTTA
TTTTTAATTTATTATTTTCATTAATTCAGTCGATAAATGGGAGCGGGAAG
TAGTGATTTGTCTCATAATCATGGAAATGAAGGATATCATGTTTTAAGGG
TTCAAGAAGGATCTCCAGGCCATAAAGCTGGATTGCAAGCATTTTTTGAT
TTTGTTGTCGAAATGGGAGAAACAAAATTGAGTCAGGATAATGAAGTTCT
GAAAGAATTACTCAAGTCAAATAAAGATAAACCTATTAATTTGACAATTT
ACAATAGCAAAACTCAGTCTTTCAGACATGTGGAATTAGTTCCAAGTCAA
GATTGGGGAGGTCAAGGTTTATTAGGAGTCAGTATCCGATATTGTTCTTT
TGAGGGAGCGAATGAAAATGTTTGGCATGTTTTAGATATCGACCCAAACA
GTCCAGCTGCTTTAGCAGGATTAAAGCAAATGACTGACTATATTATAGGC
GCAGAAACAGTGTTAAATGATCCAGAAGAATTTTTCAATTTAATTGAAAC
TCACGATGGGCAAACATTAAAACTCTACGTGTATAATATTGAAACAGATA
CATGCCGAGAAGTGACAATTACGCCTAATAGTTCTTGGGGTGGAGATGGT
TTGATTGGATGTGGAATTGGATATGGATATTTACATAGAATACCTTCATT
GCCTTTCACAAGTAACATTTCATCTGTGAATCACGAATGCTGTGAATCAC
ATAAGCACGATCATAATCCATCTGTTGTTAATGTGGCTGACGGATTTTCT
GAGATAGCCTTAACTGATGATAAAGCGTTTAAAGAAAATACATTCTTAAA
CATGGAACCTCAAATGCAATCTCATCCCTTTGCAATGCCGATTCCACCTC
AGCCATTACCAGAGAACGCCATTAAGAATTTGTCAATGGATAATACTAGT
ATTATCGATTTCAGTTCTCATGATAACCAGTCTCATTTCCCTCCGGTATC
GACGAATATAATTCTTCCCGGAATGCCTCCTCTAAATGTGCAAGTCGGAT
CTATTTCGATGCCAATGGATAACTTTTCAAAAGATCACACAGCTGAGTCT
CACATTAAAGTCGAGGTGGATAATGTTGAATAAATCTGAATTTATTTTAT
AAATGCATCAATTGTTGTAGTTGATAAATAAAAA
back to top

protein sequence of SMED30028245-orf-1

>SMED30028245-orf-1 ID=SMED30028245-orf-1|Name=SMED30028245-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=349bp
MGAGSSDLSHNHGNEGYHVLRVQEGSPGHKAGLQAFFDFVVEMGETKLSQ
DNEVLKELLKSNKDKPINLTIYNSKTQSFRHVELVPSQDWGGQGLLGVSI
RYCSFEGANENVWHVLDIDPNSPAALAGLKQMTDYIIGAETVLNDPEEFF
NLIETHDGQTLKLYVYNIETDTCREVTITPNSSWGGDGLIGCGIGYGYLH
RIPSLPFTSNISSVNHECCESHKHDHNPSVVNVADGFSEIALTDDKAFKE
NTFLNMEPQMQSHPFAMPIPPQPLPENAIKNLSMDNTSIIDFSSHDNQSH
FPPVSTNIILPGMPPLNVQVGSISMPMDNFSKDHTAESHIKVEVDNVE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002032epidermal cell
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR036034PDZ_sf
IPR007583GRASP55_65
IPR001478PDZ
IPR024958GRASP55/65_PDZ
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0005794Golgi apparatus
GO:0005797Golgi medial cisterna
GO:0016020membrane
GO:0032580Golgi cisterna membrane
Vocabulary: biological process
TermDefinition
GO:0006996organelle organization
GO:0007030Golgi organization
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR036034PDZ superfamilyGENE3DG3DSA:2.30.42.10coord: 111..209
e-value: 1.2E-36
score: 127.1
IPR036034PDZ superfamilyGENE3DG3DSA:2.30.42.10coord: 1..110
e-value: 3.5E-38
score: 132.3
IPR036034PDZ superfamilySUPERFAMILYSSF50156PDZ domain-likecoord: 12..81
IPR036034PDZ superfamilySUPERFAMILYSSF50156PDZ domain-likecoord: 94..181
IPR024958GRASP55/65 PDZ-like domainPFAMPF04495GRASP55_65coord: 69..204
e-value: 7.8E-55
score: 185.0
IPR007583GRASP55/65PANTHERPTHR12893GOLGI REASSEMBLY STACKING PROTEIN GRASPcoord: 1..285
NoneNo IPR availablePROSITEPS51865PDZ_GRASPcoord: 111..199
score: 32.505
NoneNo IPR availablePROSITEPS51865PDZ_GRASPcoord: 15..105
score: 31.294