PMP-22/EMP/MP20/Claudin tight junction

Overview
NamePMP-22/EMP/MP20/Claudin tight junction
Smed IDSMED30028237
Length (bp)875
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of PMP-22/EMP/MP20/Claudin tight junction (SMED30028237) t-SNE clustered cells

Violin plots show distribution of expression levels for PMP-22/EMP/MP20/Claudin tight junction (SMED30028237) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of PMP-22/EMP/MP20/Claudin tight junction (SMED30028237) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for PMP-22/EMP/MP20/Claudin tight junction (SMED30028237) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30028237

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30028237SMESG000009259.1 Contig4683GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30028237SMESG000028931.1 Contig4683GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
pharynxSMED30028237SMESG000028931.1 dd_Smed_v4_2132_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30028237SMESG000028931.1 dd_Smed_v4_2132_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30028237SMESG000028931.1 dd_Smed_v4_2132_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30028237SMESG000028931.1 dd_Smed_v4_2132_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30028237SMESG000028931.1 dd_Smed_v4_2132_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30028237SMESG000028931.1 dd_Smed_v4_2132_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 4 cellSMED30028237SMESG000028931.1 dd_Smed_v4_2132_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30028237SMESG000028931.1 dd_Smed_v4_2132_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of PMP-22/EMP/MP20/Claudin tight junction vs. Ensembl Fly
Match: pck (gene:FBgn0013720 transcript:FBtr0070256)

HSP 1 Score: 71.2478 bits (173), Expect = 3.872e-14
Identity = 45/172 (26.16%), Postives = 81/172 (47.09%), Query Frame = 3
Query:  123 SWPRIHSEFKRLGLWEFCLNGYTARRDIKMQSFFGCWWLFAPYYYPIQDLLTPAWFQTVXXXXXXXXXXXXXINILLIFYGFKIIKHPERRALT-----SRILFFSQIVSIILTFIAIVIFGCRCFDLYWMPRPELNWPSWSYGFAILSCFGMIFGSSAMYFIMREDKQILD 623
            S+    + FK +GLW++C   +   +   ++ F GC  +F+  YY I++ L P W   V        +  + + ++L      II+ P +  L       R+ +    +S +  F+A+ IFG   +   WM  P+ N   WSY  A+++   M+ G +A+  + RE +Q  D
Sbjct:   55 SYEETRASFKNMGLWQYCFKDFVYPKYAFLKQFTGCHNIFSHEYYVIREYLLPGWLMAV---QGFVTMSFIIVFLVLALLSLTIIRLPLKAVLQYEWLLVRLSYMGTAISSLFMFLAVCIFGGCAYRRDWMMYPKFNVLGWSYALAVVTF--MLLGLAAL-ILQREARQAYD 220          
BLAST of PMP-22/EMP/MP20/Claudin tight junction vs. Ensembl Fly
Match: pck (gene:FBgn0013720 transcript:FBtr0070255)

HSP 1 Score: 71.2478 bits (173), Expect = 3.872e-14
Identity = 45/172 (26.16%), Postives = 81/172 (47.09%), Query Frame = 3
Query:  123 SWPRIHSEFKRLGLWEFCLNGYTARRDIKMQSFFGCWWLFAPYYYPIQDLLTPAWFQTVXXXXXXXXXXXXXINILLIFYGFKIIKHPERRALT-----SRILFFSQIVSIILTFIAIVIFGCRCFDLYWMPRPELNWPSWSYGFAILSCFGMIFGSSAMYFIMREDKQILD 623
            S+    + FK +GLW++C   +   +   ++ F GC  +F+  YY I++ L P W   V        +  + + ++L      II+ P +  L       R+ +    +S +  F+A+ IFG   +   WM  P+ N   WSY  A+++   M+ G +A+  + RE +Q  D
Sbjct:   55 SYEETRASFKNMGLWQYCFKDFVYPKYAFLKQFTGCHNIFSHEYYVIREYLLPGWLMAV---QGFVTMSFIIVFLVLALLSLTIIRLPLKAVLQYEWLLVRLSYMGTAISSLFMFLAVCIFGGCAYRRDWMMYPKFNVLGWSYALAVVTF--MLLGLAAL-ILQREARQAYD 220          
BLAST of PMP-22/EMP/MP20/Claudin tight junction vs. Ensembl Fly
Match: kune (gene:FBgn0033032 transcript:FBtr0086037)

HSP 1 Score: 68.5514 bits (166), Expect = 4.066e-13
Identity = 53/191 (27.75%), Postives = 89/191 (46.60%), Query Frame = 3
Query:  138 HSEFKRLGLWEFCLNGYTARRDIKMQSFFGCWWLFAPYYYPIQDLLTPAWFQTVXXXXXXXXXXXXXINILLIFYGFKIIKHPERRALTSRILFFSQIVSIILTFIAIVIFGCRCFDLYWMPRPELNWPSWSYGFAILSCFGMIFGSSAMYFI--MREDKQILDNEQYSFPTHASTKVVKNKGTSLIAESA 704
            +  F  LGLWE C N +         SF GC W+F   YY I D L P ++ +VQ F TL F++ L +  L + +  +  +  +R  +    +   Q+V  +  FIA+VIFG +     WMP  + N   WS+   ++    ++  S  +Y +   RE  + L+       +    +  +N+G S +  +A
Sbjct:   40 NPRFTNLGLWEVCFNNFQDIHRFFDNSFNGCLWVFEEEYYIIHDFLLPGFYISVQLFATLCFVMCLVVIPLTVAF-LRTSRDDDRYMVLLLAIGSCQVVGSVFGFIAVVIFGAKGDSRDWMPGWQNNDMGWSFALGVVGAV-LLLPSGVLYLVEARRERYKRLNEISNREISEYGDEYYQNQGPSAVLPTA 228          
BLAST of PMP-22/EMP/MP20/Claudin tight junction vs. TrEMBL
Match: A0A267FVM6 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig016617g3 PE=4 SV=1)

HSP 1 Score: 167.162 bits (422), Expect = 5.001e-47
Identity = 85/184 (46.20%), Postives = 116/184 (63.04%), Query Frame = 3
Query:  123 SWPRIHSEFKRLGLWEFCLNGYTARRDIKMQSFFGCWWLFAPYYYPIQDLLTPAWFQTVXXXXXXXXXXXXXINILLIFYGFKIIKHPERRALTSRILFFSQIVSIILTFIAIVIFGCRCFDLYWMPRPELNWPSWSYGFAILSCFGMIFGSSAMYFIMREDKQILDNEQYSFPTHASTKVVKN 674
            SWPR+H+   RLGLWEFCL+G   R D +M+S+FGCWW FAP +YPI+D L P WF+ VQ F T++ LL +   IL + Y    I + ERRAL SR L +   V   L  I ++IFG +C D YW+P P LNWPSWS+G A+L+     F S  +   M+ D+++    +Y+FP HA + V + 
Sbjct:   43 SWPRVHTPVDRLGLWEFCLDGLVHRLDPEMRSYFGCWWSFAPEFYPIRDFLMPPWFRFVQFFITISLLLLICGFILCLLYVLGCINNAERRALLSRCLAYLFAVIGTLIGIGVIIFGSKCLDPYWLPLPSLNWPSWSFGLAVLAALFCFFTSCFLVPQMKLDRELTQLNEYAFPMHAKSTVTEK 226          
BLAST of PMP-22/EMP/MP20/Claudin tight junction vs. TrEMBL
Match: A0A267FBU2 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig030267g1 PE=4 SV=1)

HSP 1 Score: 167.162 bits (422), Expect = 5.392e-47
Identity = 85/184 (46.20%), Postives = 116/184 (63.04%), Query Frame = 3
Query:  123 SWPRIHSEFKRLGLWEFCLNGYTARRDIKMQSFFGCWWLFAPYYYPIQDLLTPAWFQTVXXXXXXXXXXXXXINILLIFYGFKIIKHPERRALTSRILFFSQIVSIILTFIAIVIFGCRCFDLYWMPRPELNWPSWSYGFAILSCFGMIFGSSAMYFIMREDKQILDNEQYSFPTHASTKVVKN 674
            SWPR+H+   RLGLWEFCL+G   R D +M+S+FGCWW FAP +YPI+D L P WF+ VQ F T++ LL +   IL + Y    I + ERRAL SR L +   V   L  I ++IFG +C D YW+P P LNWPSWS+G A+L+     F S  +   M+ D+++    +Y+FP HA + V + 
Sbjct:   43 SWPRVHTPVDRLGLWEFCLDGLVHRLDPEMRSYFGCWWSFAPEFYPIRDFLMPPWFRFVQFFITISLLLLICGFILCLLYVLGCINNAERRALLSRCLAYLFAVIGTLIGIGVIIFGSKCLDPYWLPLPSLNWPSWSFGLAVLAALFCFFTSCFLVPQMKLDRELTQLNEYAFPMHAKSTVTEK 226          
BLAST of PMP-22/EMP/MP20/Claudin tight junction vs. TrEMBL
Match: A0A267DAK2 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig004071g2 PE=4 SV=1)

HSP 1 Score: 166.777 bits (421), Expect = 7.290e-47
Identity = 78/180 (43.33%), Postives = 115/180 (63.89%), Query Frame = 3
Query:  123 SWPRIHSEFKRLGLWEFCLNGYTARRDIKMQSFFGCWWLFAPYYYPIQDLLTPAWFQTVXXXXXXXXXXXXXINILLIFYGFKIIKHPERRALTSRILFFSQIVSIILTFIAIVIFGCRCFDLYWMPRPELNWPSWSYGFAILSCFGMIFGSSAMYFIMREDKQILDNEQYSFPTHASTK 662
            SWPR+H+   RLGLWEFCL+G   R D +M+S+FGCWW FAP +YPI++ L P WF+ VQ   T   +L +   IL + Y  + + +PERRAL S++L ++ +    L  + I++FG +C D YW+P PELNWPSWS+G A+LS     F +  M   ++ D++++   +Y+FP  A   
Sbjct:   41 SWPRVHTPMDRLGLWEFCLDGLVHRLDPEMRSYFGCWWSFAPEFYPIRNYLMPPWFRFVQFCITFGLMLHIGALILCVIYVVRCVNNPERRALLSQVLAYAMLFIGTLLGVGIIVFGSKCLDPYWLPNPELNWPSWSFGLAVLSVIFCFFTACFMVPQVKLDRELMIQREYAFPMSAGKS 220          
BLAST of PMP-22/EMP/MP20/Claudin tight junction vs. TrEMBL
Match: A0A267EHT2 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig017298g1 PE=4 SV=1)

HSP 1 Score: 162.925 bits (411), Expect = 6.164e-45
Identity = 87/186 (46.77%), Postives = 119/186 (63.98%), Query Frame = 3
Query:  123 SWPRIHSEFKRLGLWEFCLNGYTARRDIKMQSFFGCWWLFAPYYYPIQDLLTPAWFQTVXXXXXXXXXXXXXINILLIFYGFKIIKHPERRALTSRILFFSQIVSIILTFIAIVIFGCRCFDLYWMPRPELNWPSWSYGFAILSCFGMIFGSSAMYFIMREDKQILDNEQYSFPTHASTKVVKNKG 680
            SW RIH+ F +LGLWEFC++GY  RRD  +QSF+GCWW+FAPYY PI+++LTP WF+ +Q F TLAFL+ LA  IL++ Y   +I H ++R L SR+L++  I       IA +IF  +  D YWMP P LNWPSWS+G + L+ F   F    ++     D   LD+EQY+FP   +     + G
Sbjct:   51 SWSRIHTPFDKLGLWEFCMDGYVHRRDENVQSFYGCWWIFAPYYDPIRNVLTPPWFRFIQLFVTLAFLIGLANVILMLVYTCDVITHVQQRVLLSRVLYYINIFIFCCLIIANIIFAFKHNDPYWMPIPSLNWPSWSFGLSCLATFFTGFAIIVLFSQQLADAVRLDDEQYNFPMSITASSHLSHG 236          
BLAST of PMP-22/EMP/MP20/Claudin tight junction vs. TrEMBL
Match: A0A267EDY0 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig032841g1 PE=4 SV=1)

HSP 1 Score: 162.54 bits (410), Expect = 1.076e-44
Identity = 87/188 (46.28%), Postives = 120/188 (63.83%), Query Frame = 3
Query:  123 SWPRIHSEFKRLGLWEFCLNGYTARRDIKMQSFFGCWWLFAPYYYPIQDLLTPAWFQTVXXXXXXXXXXXXXINILLIFYGFKIIKHPERRALTSRILFFSQIVSIILTFIAIVIFGCRCFDLYWMPRPELNWPSWSYGFAILSCFGMIFGSSAMYFIMREDKQILDNEQYSFPTHASTKVVKNKGTS 686
            SW RIH+ F +LGLWEFC++GY  RRD  +QSF+GCWW+FAPYY PI+++LTP WF+ +Q F TLAFL+ LA  IL++ Y   +I H ++R L SR+L++  I       IA +IF  +  D YWMP P LNWPSWS+G + L+ F   F    ++     D   LD+EQY+FP   +     + G +
Sbjct:   51 SWSRIHTPFDKLGLWEFCMDGYVHRRDENVQSFYGCWWIFAPYYDPIRNVLTPPWFRFIQLFVTLAFLIGLANVILMLVYTCDVITHVQQRVLLSRVLYYINIFIFCCLIIANIIFAFKHNDPYWMPIPSLNWPSWSFGLSCLATFFTGFAIIVLFSQQLADAVRLDDEQYNFPMSITASSHLSHGAA 238          
BLAST of PMP-22/EMP/MP20/Claudin tight junction vs. Planmine SMEST
Match: SMESG000028931.1 (SMESG000028931.1)

HSP 1 Score: 382.874 bits (982), Expect = 2.277e-135
Identity = 198/199 (99.50%), Postives = 198/199 (99.50%), Query Frame = 3
Query:  123 SWPRIHSEFKRLGLWEFCLNGYTARRDIKMQSFFGCWWLFAPYYYPIQDLLTPAWFQTVXXXXXXXXXXXXXINILLIFYGFKIIKHPERRALTSRILFFSQIVSIILTFIAIVIFGCRCFDLYWMPRPELNWPSWSYGFAILSCFGMIFGSSAMYFIMREDKQILDNEQYSFPTHASTKVVKNKGTSLIAESATYSAV 719
            SWPRIHSEFKRLGLWEFCLNGYTARRDIKMQSFFGCWWLFAPYYYPIQDLLTPAWFQTVQAFFTLAFLLQLAINILLIFYGFKIIKHPERRALTSRILFFSQIVSIILTFIAIVIFGCRCFDLYWMPRPELNWPSWSYGFAILSCFGMIFGSSAMYFIMREDKQILDNEQYSFPTHASTKVVKNK TSLIAESATYSAV
Sbjct:   44 SWPRIHSEFKRLGLWEFCLNGYTARRDIKMQSFFGCWWLFAPYYYPIQDLLTPAWFQTVQAFFTLAFLLQLAINILLIFYGFKIIKHPERRALTSRILFFSQIVSIILTFIAIVIFGCRCFDLYWMPRPELNWPSWSYGFAILSCFGMIFGSSAMYFIMREDKQILDNEQYSFPTHASTKVVKNKATSLIAESATYSAV 242          

HSP 2 Score: 49.6766 bits (117), Expect = 8.228e-7
Identity = 23/24 (95.83%), Postives = 24/24 (100.00%), Query Frame = 1
Query:   52 MYKIEEDYSKILLSKKRRQFYVFI 123
            MYKIEEDYSKILLSKKRRQFYVF+
Sbjct:    1 MYKIEEDYSKILLSKKRRQFYVFM 24          
BLAST of PMP-22/EMP/MP20/Claudin tight junction vs. Planmine SMEST
Match: SMESG000028931.1 (SMESG000028931.1)

HSP 1 Score: 381.719 bits (979), Expect = 3.352e-135
Identity = 198/199 (99.50%), Postives = 198/199 (99.50%), Query Frame = 3
Query:  123 SWPRIHSEFKRLGLWEFCLNGYTARRDIKMQSFFGCWWLFAPYYYPIQDLLTPAWFQTVXXXXXXXXXXXXXINILLIFYGFKIIKHPERRALTSRILFFSQIVSIILTFIAIVIFGCRCFDLYWMPRPELNWPSWSYGFAILSCFGMIFGSSAMYFIMREDKQILDNEQYSFPTHASTKVVKNKGTSLIAESATYSAV 719
            SWPRIHSEFKRLGLWEFCLNGYTARRDIKMQSFFGCWWLFAPYYYPIQDLLTPAWFQTVQAFFTLAFLLQLAINILLIFYGFKIIKHPERRALTSRILFFSQIVSIILTFIAIVIFGCRCFDLYWMPRPELNWPSWSYGFAILSCFGMIFGSSAMYFIMREDKQILDNEQYSFPTHASTKVVKNK TSLIAESATYSAV
Sbjct:   21 SWPRIHSEFKRLGLWEFCLNGYTARRDIKMQSFFGCWWLFAPYYYPIQDLLTPAWFQTVQAFFTLAFLLQLAINILLIFYGFKIIKHPERRALTSRILFFSQIVSIILTFIAIVIFGCRCFDLYWMPRPELNWPSWSYGFAILSCFGMIFGSSAMYFIMREDKQILDNEQYSFPTHASTKVVKNKATSLIAESATYSAV 219          
BLAST of PMP-22/EMP/MP20/Claudin tight junction vs. Planmine SMEST
Match: SMESG000042798.1 (SMESG000042798.1)

HSP 1 Score: 78.1814 bits (191), Expect = 2.769e-16
Identity = 50/148 (33.78%), Postives = 72/148 (48.65%), Query Frame = 3
Query:  129 PRIHSEFKRLGLWEFCLNGYTARRDIKMQSFFGCWWLFAPYYYPIQDLLTPAWFQTVXXXXXXXXXXXXXINILLIFYGFKIIKHPERRALTSRILFFSQIVSIILTFIAIVIFGCRCFDLYWMPRPELNWPSWSYGFAILSCFGMIF 572
            P   S+F RLGLW  C + Y    D   + + GCW+++ P Y  I+D L P WF  VQ   +++ L      IL++      I   ++   T+ +    Q ++     I IV  G    D  WMPRP+ N  SWS+ FA+L  F  IF
Sbjct:   39 PEYPSQFVRLGLWVACFDNYIHPEDYVSKMYKGCWYVYWPEYDYIRDWLNPPWFYGVQMMSSISLLCNGGAMILVLLKFVNAINIVDKN--TNILALVLQFLAFCCYIIVIVAMGVMSKDREWMPRPDHNQVSWSFAFAVLGGFFTIF 184          
BLAST of PMP-22/EMP/MP20/Claudin tight junction vs. Planmine SMEST
Match: SMESG000042798.1 (SMESG000042798.1)

HSP 1 Score: 78.1814 bits (191), Expect = 2.957e-16
Identity = 50/148 (33.78%), Postives = 72/148 (48.65%), Query Frame = 3
Query:  129 PRIHSEFKRLGLWEFCLNGYTARRDIKMQSFFGCWWLFAPYYYPIQDLLTPAWFQTVXXXXXXXXXXXXXINILLIFYGFKIIKHPERRALTSRILFFSQIVSIILTFIAIVIFGCRCFDLYWMPRPELNWPSWSYGFAILSCFGMIF 572
            P   S+F RLGLW  C + Y    D   + + GCW+++ P Y  I+D L P WF  VQ   +++ L      IL++      I   ++   T+ +    Q ++     I IV  G    D  WMPRP+ N  SWS+ FA+L  F  IF
Sbjct:   39 PEYPSQFVRLGLWVACFDNYIHPEDYVSKMYKGCWYVYWPEYDYIRDWLNPPWFYGVQMMSSISLLCNGGAMILVLLKFVNAINIVDKN--TNILALVLQFLAFCCYIIVIVAMGVMSKDREWMPRPDHNQVSWSFAFAVLGGFFTIF 184          
BLAST of PMP-22/EMP/MP20/Claudin tight junction vs. Planmine SMEST
Match: SMESG000058668.1 (SMESG000058668.1)

HSP 1 Score: 68.9366 bits (167), Expect = 1.833e-13
Identity = 38/142 (26.76%), Postives = 68/142 (47.89%), Query Frame = 3
Query:  129 PRIHSEFKRLGLWEFCLNGYTARRDIKMQSFFGCWWLFAPYYYPIQDLLTPAWFQTVXXXXXXXXXXXXXINILLIFYGFKIIKHPERRALTSRILFFSQIVSIILTFIAIVIFGCRCFDLYWMPRPELNWPSWSYGFAILS 554
            P  H +F R+GLW  C +GY        +++FGC++++   Y  ++D L P W   VQ   ++  +       ++I     +  H   + L +  + F+   + +   +A++ FG    D  W+  PE N  SWSY FA ++
Sbjct:   40 PSDHRQFLRIGLWTVCFDGYMKPYQYH-KAYFGCYYIYYVEYDGVRDWLNPPWLYAVQVMMSIGLITHAISTFIVICQSVMVFSHANVKTLAT--MLFTNFSTGLCILLALIAFGVESQDSRWIQFPEYNSLSWSYAFAAIA 178          
The following BLAST results are available for this feature:
BLAST of PMP-22/EMP/MP20/Claudin tight junction vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of PMP-22/EMP/MP20/Claudin tight junction vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of PMP-22/EMP/MP20/Claudin tight junction vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
pck3.872e-1426.16gene:FBgn0013720 transcript:FBtr0070256[more]
pck3.872e-1426.16gene:FBgn0013720 transcript:FBtr0070255[more]
kune4.066e-1327.75gene:FBgn0033032 transcript:FBtr0086037[more]
back to top
BLAST of PMP-22/EMP/MP20/Claudin tight junction vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of PMP-22/EMP/MP20/Claudin tight junction vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of PMP-22/EMP/MP20/Claudin tight junction vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of PMP-22/EMP/MP20/Claudin tight junction vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of PMP-22/EMP/MP20/Claudin tight junction vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267FVM65.001e-4746.20Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267FBU25.392e-4746.20Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267DAK27.290e-4743.33Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267EHT26.164e-4546.77Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267EDY01.076e-4446.28Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of PMP-22/EMP/MP20/Claudin tight junction vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of PMP-22/EMP/MP20/Claudin tight junction vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of PMP-22/EMP/MP20/Claudin tight junction vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of PMP-22/EMP/MP20/Claudin tight junction vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of PMP-22/EMP/MP20/Claudin tight junction vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of PMP-22/EMP/MP20/Claudin tight junction vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000028931.12.277e-13599.50SMESG000028931.1[more]
SMESG000028931.13.352e-13599.50SMESG000028931.1[more]
SMESG000042798.12.769e-1633.78SMESG000042798.1[more]
SMESG000042798.12.957e-1633.78SMESG000042798.1[more]
SMESG000058668.11.833e-1326.76SMESG000058668.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30028237 ID=SMED30028237|Name=PMP-22/EMP/MP20/Claudin tight junction|organism=Schmidtea mediterranea sexual|type=transcript|length=875bp
ACTTGTTTTACAGATATAATTCTATTTGAAAAAAAATACAAATTTGAAAT
TATGTATAAAATTGAGGAAGACTATTCTAAGATTTTATTAAGCAAAAAAC
GACGTCAATTTTATGTTTTTATTCATGGCCTCGAATTCATTCAGAATTTA
AGCGACTTGGATTATGGGAATTTTGTCTCAATGGATATACTGCAAGAAGA
GATATTAAAATGCAATCATTTTTTGGTTGCTGGTGGCTTTTTGCACCTTA
TTATTATCCGATTCAAGATCTTTTAACTCCAGCATGGTTTCAAACGGTAC
AAGCATTTTTTACTCTAGCTTTCCTTTTGCAACTAGCGATAAATATATTA
TTAATATTTTATGGATTTAAAATCATTAAACATCCAGAAAGAAGGGCTTT
GACTTCAAGAATATTATTTTTTAGTCAAATAGTTTCAATAATTTTAACTT
TTATCGCTATTGTAATATTTGGATGTCGATGTTTTGATCTTTACTGGATG
CCAAGGCCGGAATTAAATTGGCCGAGTTGGTCCTATGGATTTGCAATCCT
CAGTTGTTTCGGTATGATATTCGGCAGTTCCGCAATGTATTTCATTATGA
GAGAAGATAAGCAGATATTAGATAATGAACAATATAGTTTTCCTACTCAT
GCCAGTACAAAAGTCGTAAAGAATAAAGGGACATCACTGATTGCAGAATC
AGCGACTTATAGTGCTGTATGAATTTGAATGACTGATTGTTGTAACGTTT
CTACCTTTTATTATCAACTCGTAGCTGTGAAATTTTAGAATTGATCTTAT
TGTAATAATGCATATCACATTTTCATTGTATCATTTTTGCTATTAATTCC
TTTGTATTGAATATTTTTGGTGAAT
back to top

protein sequence of SMED30028237-orf-1

>SMED30028237-orf-1 ID=SMED30028237-orf-1|Name=SMED30028237-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=171bp
MQSFFGCWWLFAPYYYPIQDLLTPAWFQTVQAFFTLAFLLQLAINILLIF
YGFKIIKHPERRALTSRILFFSQIVSIILTFIAIVIFGCRCFDLYWMPRP
ELNWPSWSYGFAILSCFGMIFGSSAMYFIMREDKQILDNEQYSFPTHAST
KVVKNKGTSLIAESATYSAV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000018Category 4 cell
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR004031PMP22/EMP/MP20/Claudin
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:1.20.140.150coord: 2..142
e-value: 1.5E-6
score: 29.7
NoneNo IPR availablePANTHERPTHR21284FAMILY NOT NAMEDcoord: 2..135
NoneNo IPR availableTMHMMTMhelixcoord: 68..87
NoneNo IPR availableTMHMMTMhelixcoord: 33..55
NoneNo IPR availableTMHMMTMhelixcoord: 107..129