slc16a-2

Overview
Nameslc16a-2 (AKN21497.1)
Smed IDSMED30028236
Length (bp)1573
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of slc16a-2 (SMED30028236) t-SNE clustered cells

Violin plots show distribution of expression levels for slc16a-2 (SMED30028236) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of slc16a-2 (SMED30028236) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for slc16a-2 (SMED30028236) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30028236

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermisSMED30028236h1SMcG0019174 dd_Smed_v4_8997_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30028236h1SMcG0019174 dd_Smed_v4_8997_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
photoreceptor neuronSMED30028236h1SMcG0019174 SMED30028236smed_20140614PMID:22884275
Lapan et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
pigment cellSMED30028236h1SMcG0019174 SMED30028236smed_20140614PMID:22884275
Lapan et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30028236h1SMcG0019174 dd_Smed_v4_8997_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Category 3 cellSMED30028236h1SMcG0019174 dd_Smed_v4_8997_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of slc16a-2 vs. Ensembl Fly
Match: Sln (gene:FBgn0033657 transcript:FBtr0088032)

HSP 1 Score: 49.2914 bits (116), Expect = 7.773e-6
Identity = 53/195 (27.18%), Postives = 90/195 (46.15%), Query Frame = 2
Query:  206 WVILFFAALNVIFLGGKRRAFGSFVAEMRRDYPNITLTELNWIGDSYAAVGYMTSGISIAIILFFKRRYGMFQFMGAIWVLVSCVTSSFVPNPHWLFLTHTLFHGIGSSLIISTVGLVVNDHFDSKHPYHILATTL-VSGGSVASIIFVTLFASLIQSYGWRYAFIILGCLYFIVNASAALFFRKSNNQVEDTNK 787
            W I+F A     ++ G  +++G    E+   +P+ T T  +WI    +A+  + + +S A+   F  R     F+G I+  +  + S F  +   L LT  +  GIG  L  +   ++V+ +FD KH    LA  + VSG +  S I   L   L ++ G+    +ILG     V  SA L+   S    +D+ +
Sbjct:  232 WFIVFGAFSVQFWVAGLVKSYGVLYVEIMETFPSSTATVASWIPAILSALCLVLAPLSSALCQRFSCR--TVVFVGGIFCAMGMILSYFATSLLHLLLTFGVLTGIGGGLSTTPGIVIVSQYFD-KH--RALANGICVSGTAAGSFILPVLIKHLAENCGFHGTILILGGCMLHVCVSATLYRPISAYTDQDSGQ 421          
BLAST of slc16a-2 vs. TrEMBL
Match: A0A0H3YF92 (Slc16a-2 OS=Schmidtea mediterranea OX=79327 GN=slc16a-2 PE=2 SV=1)

HSP 1 Score: 925.62 bits (2391), Expect = 0.000e+0
Identity = 454/454 (100.00%), Postives = 454/454 (100.00%), Query Frame = 2
Query:  155 MTNLVSKLPWNRASVLPWVILFFAALNVIFLGGKRRAFGSFVAEMRRDYPNITLTELNWIGDSYAAVGYMTSGISIAIILFFKRRYGMFQFMGAIWVLVSCVTSSFVPNPHWLFLTHTLFHGIGSSLIISTVGLVVNDHFDSKHPYHILATTLVSGGSVASIIFVTLFASLIQSYGWRYAFIILGCLYFIVNASAALFFRKSNNQVEDTNKKTVSCRCEGHIKIIHIPLLCLWFIDRVMTSVVTYGLLLNLTDYMYRTEKNLVRSTTLTTLFASGEAITYLIGATITAITRDFFKDKLRYILLGTSFAMSICLIALEYFKGIISVCYILCFLAGFTLGPSITFLFPAGEELTRLPGHMAYPISLAGMGFGMLVSPLLTAKIAEIFLYKWFFFVQGCLILIKVASILAIILILHFYDDKFQPESYSKFNNSNEVPIEENPKKESTFLLNEGNKKK 1516
            MTNLVSKLPWNRASVLPWVILFFAALNVIFLGGKRRAFGSFVAEMRRDYPNITLTELNWIGDSYAAVGYMTSGISIAIILFFKRRYGMFQFMGAIWVLVSCVTSSFVPNPHWLFLTHTLFHGIGSSLIISTVGLVVNDHFDSKHPYHILATTLVSGGSVASIIFVTLFASLIQSYGWRYAFIILGCLYFIVNASAALFFRKSNNQVEDTNKKTVSCRCEGHIKIIHIPLLCLWFIDRVMTSVVTYGLLLNLTDYMYRTEKNLVRSTTLTTLFASGEAITYLIGATITAITRDFFKDKLRYILLGTSFAMSICLIALEYFKGIISVCYILCFLAGFTLGPSITFLFPAGEELTRLPGHMAYPISLAGMGFGMLVSPLLTAKIAEIFLYKWFFFVQGCLILIKVASILAIILILHFYDDKFQPESYSKFNNSNEVPIEENPKKESTFLLNEGNKKK
Sbjct:    1 MTNLVSKLPWNRASVLPWVILFFAALNVIFLGGKRRAFGSFVAEMRRDYPNITLTELNWIGDSYAAVGYMTSGISIAIILFFKRRYGMFQFMGAIWVLVSCVTSSFVPNPHWLFLTHTLFHGIGSSLIISTVGLVVNDHFDSKHPYHILATTLVSGGSVASIIFVTLFASLIQSYGWRYAFIILGCLYFIVNASAALFFRKSNNQVEDTNKKTVSCRCEGHIKIIHIPLLCLWFIDRVMTSVVTYGLLLNLTDYMYRTEKNLVRSTTLTTLFASGEAITYLIGATITAITRDFFKDKLRYILLGTSFAMSICLIALEYFKGIISVCYILCFLAGFTLGPSITFLFPAGEELTRLPGHMAYPISLAGMGFGMLVSPLLTAKIAEIFLYKWFFFVQGCLILIKVASILAIILILHFYDDKFQPESYSKFNNSNEVPIEENPKKESTFLLNEGNKKK 454          
BLAST of slc16a-2 vs. TrEMBL
Match: A0A0H3YIZ4 (Slc16a-1 (Fragment) OS=Schmidtea mediterranea OX=79327 GN=slc16a-1 PE=2 SV=1)

HSP 1 Score: 526.939 bits (1356), Expect = 0.000e+0
Identity = 272/412 (66.02%), Postives = 333/412 (80.83%), Query Frame = 2
Query:  173 KLPWNRASVLPWVILFFAALNVIFLGGKRRAFGSFVAEMRRDYPNITLTELNWIGDSYAAVGYMTSGISIAIILFFKRRYGMFQFMGAIWVLVSCVTSSFVPNPHWLFLTHTLFHGIGSSLIISTVGLVVNDHFDSKHPYHILATTLVSGGSVASIIFVTLFASLIQSYGWRYAFIILGCLYFIVNASAALFFRKSNNQVEDTNKKTVSCRCEGHIKIIHIPLLCLWFIDRVMTSVVTYGLLLNLTDYMYRTEKNLVRSTTLTTLFASGEAITYLIGATITAITRDFFKDKLRYILLGTSFAMSICLIALEYFKGIISVCYILCFLAGFTLGPSITFLFPAGEELTRLPGHMAYPISLAGMGFGMLVSPLLTAKIAEIFLYKWFFFVQGCLILIKVASILAIILILHFYDDK 1408
            +LP  RASVLPW+IL FAA+NVIFLGGKRRAFGSFVA+  ++YPNI+LTELNWIGDSY+A+GYM++ +SI+II++F RRYG+FQF+GA+WVL+SC+TSSFVPNPHWLFLTHTLFHGIGSSLIIST GLVVN++FD KH YHILATTLVSGGSVASI+FV LF+ LIQ Y W  A  ILG LYFIV   AA+FFRK+ +  E ++       C+ +I+  +IPLL LWF+DRV+TSVVTYG+LLNLT + Y    +LV S+  T LFASGEA TYLIGA I AIT+D FK++LRY+LL TSF M   LI + +F+   +V   L F+AGF+LGPSITFLFPAGEELTRLPGH+AYP SL GMGFGM++SPLLTAKI E++ ++ FF VQG LI IK   +L I++IL F+ +K
Sbjct:   12 RLPCYRASVLPWIILAFAAINVIFLGGKRRAFGSFVAQFHKEYPNISLTELNWIGDSYSAIGYMSTSLSISIIIYFNRRYGLFQFLGALWVLISCITSSFVPNPHWLFLTHTLFHGIGSSLIISTAGLVVNEYFDKKHRYHILATTLVSGGSVASILFVMLFSFLIQKYTWEGALQILGVLYFIVCGCAAIFFRKNLDLKEVSSTGKSKYSCQTYIRWKNIPLLILWFVDRVLTSVVTYGILLNLTTHSYEKHYSLVDSSISTVLFASGEASTYLIGAIIMAITKDLFKERLRYVLLVTSFTMCASLILIYFFEANKTVLRSLLFVAGFSLGPSITFLFPAGEELTRLPGHVAYPFSLGGMGFGMMISPLLTAKIIELYNFQMFFLVQGGLIGIKFVCLLLILIILFFWQNK 423          
BLAST of slc16a-2 vs. TrEMBL
Match: A0A3S5B7D0 (MFS domain-containing protein (Fragment) OS=Protopolystoma xenopodis OX=117903 GN=PXEA_LOCUS29338 PE=4 SV=1)

HSP 1 Score: 493.426 bits (1269), Expect = 7.649e-168
Identity = 250/432 (57.87%), Postives = 320/432 (74.07%), Query Frame = 2
Query:  203 PWVILFFAALNVIFLGGKRRAFGSFVAEMRRDYPNITLTELNWIGDSYAAVGYMTSGISIAIILFFKRRYGMFQFMGAIWVLVSCVTSSFVPNPHWLFLTHTLFHGIGSSLIISTVGLVVNDHFDSKHPYHILATTLVSGGSVASIIFVTLFASLIQSYGWRYAFIILGCLYFIVNASAALFFRKSNNQVEDTNKKTVSCRCEGHIKIIHIPLLCLWFIDRVMTSVVTYGLLLNLTDYMYRTEKNLVRSTTLTTLFASGEAITYLIGATITAITRDFFKDKLRYILLGTSFAMSICLIALEYFKGIISVCYILCFLAGFTLGPSITFLFPAGEELTRLPGHMAYPISLAGMGFGMLVSPLLTAKIAEIFLYKWFFFVQGCLILIKVASILAIILILHFYD-------DKFQPESYSKFNNSNEVPIE--ENP 1471
            PW IL  AALNVIFLGGKRRAFG FVA++R ++   +L ELNWIGDSYAA+GY+T+ +S ++IL   RRYG+FQF GA +VL +CV+S++VPNPHWLFLTHT+ HGIGSSLI+ST GLVVN+HFD  H YHILATTLVSGGSVASI+FV  +A L++SYGWR+A IILG +YF V ASA+L FRKS      +  + V    E H+    IPLL LW +DR++TS+VTYG+LLNLTD+M+R E +L +S  LTTLFASGEA TYL+GA  T +T++  K++L+YIL+ T+  MS  L A E +   + + +IL ++ GF LGPSITFLFPAGEE+TRLPGH+AYP SL GMG GM +SPLL+A IA+IFLYKWFF VQ  L+ IK+  +L    ILH +D        +  PE +  ++ ++ +  E  ENP
Sbjct:    9 PWFILSSAALNVIFLGGKRRAFGVFVAQLRDEFNATSLAELNWIGDSYAAIGYLTTTLSTSLILKLGRRYGLFQFAGACFVLFACVSSAYVPNPHWLFLTHTVLHGIGSSLILSTAGLVVNEHFDKSHRYHILATTLVSGGSVASIVFVQFYAFLVESYGWRHAMIILGVVYFFVIASASLVFRKSVQTTGVSEGRLVHSWRE-HLVGRQIPLLVLWTVDRIITSIVTYGMLLNLTDFMHRIEPSLTKSAVLTTLFASGEASTYLLGAMTTGLTKNLLKNRLKYILIVTTLLMSASLAAWEAWASNLLMSHILAYICGFCLGPSITFLFPAGEEMTRLPGHLAYPFSLGGMGLGMSLSPLLSALIAQIFLYKWFFLVQAGLMAIKLICLLVATFILHTFDRANFILPTQVSPE-HVGYHRASGISGEHRENP 438          
BLAST of slc16a-2 vs. TrEMBL
Match: A0A2H1CC47 (Monocarboxylate transporter 5 OS=Fasciola hepatica OX=6192 GN=D915_004778 PE=4 SV=1)

HSP 1 Score: 478.404 bits (1230), Expect = 4.707e-162
Identity = 241/421 (57.24%), Postives = 308/421 (73.16%), Query Frame = 2
Query:  200 LPWVILFFAALNVIFLGGKRRAFGSFVAEMRRDYPNITLTELNWIGDSYAAVGYMTSGISIAIILFFKRRYGMFQFMGAIWVLVSCVTSSFVPNPHWLFLTHTLFHGIGSSLIISTVGLVVNDHFDSKHPYHILATTLVSGGSVASIIFVTLFASLIQSYGWRYAFIILGCLYFIVNASAALFFRKSNNQVEDTNKKTVSCRCEGHIKIIHIPLLCLWFIDRVMTSVVTYGLLLNLTDYMYRTEKNLVRSTTLTTLFASGEAITYLIGATITAITRDFFKDKLRYILLGTSFAMSICLIALEYFKGIISVCYILCFLAGFTLGPSITFLFPAGEELTRLPGHMAYPISLAGMGFGMLVSPLLTAKIAEIFLYKWFFFVQGCLILIKVASILAIILILHFYDDKFQ---PESYSKFNNSNEV 1453
            LPW+IL  AAL V+FLGGKRRAFG FVAE+R ++PNITL ELNWIGDSYAA+GY+T+ +  + IL   RR+   QF+GA  VL++C+TS++VPNPHWLFLTHT+ HGIGSSL++ST GLVVN+HFD  H YHILATTLVSGGSVASI+FV  +A L++ +GWR++F+ILG +YF+V       F K+ N+ +  + + V       +      LL LWFIDR+MTSVVTYG+LLNL DYMYR E +L RS  LTTLFA+GEA TYLIGA +TAIT+D  K++L+YILL TSF + I L   E         + L +++GF LGPSITFLFPAGEE+T LPGHMAYP SL GMG GM++SP+L+A IA+ F Y+WFF VQG ++LIK  ++L   LILH    + Q   P ++ +   S+ V
Sbjct:    6 LPWLILTIAALCVVFLGGKRRAFGIFVAELRAEFPNITLAELNWIGDSYAALGYLTTSLGTSSILATGRRFWASQFLGASSVLLACITSAYVPNPHWLFLTHTILHGIGSSLVLSTAGLVVNEHFDKNHRYHILATTLVSGGSVASIVFVEFYAYLVEHWGWRFSFVILGIIYFLVLFIGTFVFVKNPNKADYRSDRCVLI-SRDQLSCKRSALLVLWFIDRIMTSVVTYGMLLNLVDYMYRHETSLQRSALLTTLFAAGEASTYLIGAVVTAITKDLLKNRLKYILLITSFILFITLTIWELEANSSRFSHFLAYISGFCLGPSITFLFPAGEEMTMLPGHMAYPFSLGGMGVGMVLSPILSAIIAQTFQYRWFFLVQGFMMLIKFFALLCATLILHNLTSRGQGYVPATFEEIPTSSSV 425          
BLAST of slc16a-2 vs. TrEMBL
Match: A0A5J4NSI4 (MFS domain-containing protein OS=Paragonimus westermani OX=34504 GN=DEA37_0008634 PE=4 SV=1)

HSP 1 Score: 480.33 bits (1235), Expect = 4.795e-162
Identity = 238/428 (55.61%), Postives = 312/428 (72.90%), Query Frame = 2
Query:  197 VLPWVILFFAALNVIFLGGKRRAFGSFVAEMRRDYPNITLTELNWIGDSYAAVGYMTSGISIAIILFFKRRYGMFQFMGAIWVLVSCVTSSFVPNPHWLFLTHTLFHGIGSSLIISTVGLVVNDHFDSKHPYHILATTLVSGGSVASIIFVTLFASLIQSYGWRYAFIILGCLYFIVNASAALFFRKSNNQVEDTNKKTVSCRCEGHIKIIHIPLLCLWFIDRVMTSVVTYGLLLNLTDYMYRTEKNLVRSTTLTTLFASGEAITYLIGATITAITRDFFKDKLRYILLGTSFAMSICLIALEYFKGIISVCYILCFLAGFTLGPSITFLFPAGEELTRLPGHMAYPISLAGMGFGMLVSPLLTAKIAEIFLYKWFFFVQGCLILIKVASILAIILILHFYDDKFQPESYSKFNNSNEVPIEENPKKE 1480
             +PW+IL  +AL+V+FLGGKRRAFG FVA++  ++   +L ELNWIGDSYAA+GY+T+ +S ++IL   RR+ + Q  GAI +L++C+TS++VPNPHWLF+THT+ HGIGSSL++ST GLVVN+HFD  H YHILATTLVSGGSVA+I+FV  +A LI+++GWR AFIILG +YF+V    AL F K+ N+ +  ++K V    +  + I    LL LWF+DR+MTSVVTYG+LLNL DYMYR E +L RS  LTTLFA+GEA TYLIGA +T ITR+ FK++LR+IL+ TS  M++ L   E+     ++   L FL GF LGPSITFLFPAGEELT LPGHMAYP SL GMG GM +SP+L+A IA++F Y+WFF VQG L+ IK A +++  LIL        P  ++  +N  E    + P  E
Sbjct:    5 AIPWLILVISALSVVFLGGKRRAFGIFVAQLHAEFNRTSLAELNWIGDSYAALGYLTTSLSTSLILATGRRFWVSQMFGAIAILLACITSAYVPNPHWLFITHTILHGIGSSLVLSTAGLVVNEHFDENHRYHILATTLVSGGSVAAIVFVEFYAYLIEAFGWRKAFIILGVIYFLVLLIGALVFEKNANKPDYRSEKCV-LLAQRQLSIRRSSLLILWFVDRIMTSVVTYGMLLNLADYMYRRETSLRRSALLTTLFAAGEASTYLIGAVVTGITRNLFKNRLRFILIVTSCIMALSLTLWEFTADNRNLSRFLAFLCGFCLGPSITFLFPAGEELTMLPGHMAYPFSLGGMGVGMALSPVLSALIAQMFTYRWFFLVQGSLMYIKCACLISSTLILRSMMSGETPYVHTALHNMEEDDGHQTPPVE 431          
BLAST of slc16a-2 vs. Ensembl Nematostella
Match: EDO46666 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPD0])

HSP 1 Score: 58.151 bits (139), Expect = 4.601e-9
Identity = 91/374 (24.33%), Postives = 153/374 (40.91%), Query Frame = 2
Query:  206 WVIL---FFAALNVIFLGGKRRAFGSFVAEMRRDYPNITLTELNWIGDSYAAVGYMTSGISIAIILFFKRRYGM--FQFMGAIWVLVSCVTSSFVPNPHWLFLTHTLFHGIGSSLIISTVGLVVNDHFDSKHPYHILATTLVSGGS-VASIIFVTLFASLIQSYGWRYAFIILGCLYFIVNASAALFFRKSNNQVEDTNKKTVSCRCEGHIKIIHIPLLCLWFIDRVMTSVVTYGL--LLNLTDYMYRTEKNLVRSTTLTTLFASGEAITYLIGATITAITRDFFKD-------KLRYILLGTSFAM----SICLIALEYFKGIISVCYILCFLAGFTLG--PSITFLFPAGEELTRLPGHMAYPISLAGMGFG 1264
            WV+    FFA   V    G   ++G   A +  ++      E  WIG    ++ ++       +  F   RYG     F+G I  ++    +SFV NP  +++T+ L  G+GS L  +   +V+  +F  + P   LA  + S GS +  ++       L+ ++GW+ +  IL C+  I+   A L+ +   +    TN      R          PL  +W     +  VV  G+  L     YM+     LV+ T    + +S  A    I +  T +++  F           R +L    FAM    S+C +A  Y  G++S   +     G  +G  P +T        L++  G+M   I+L  M FG
Sbjct:   26 WVVCAAAFFAMFTVF---GIHISYGVIYANLVDEH-GFGEAESAWIGSVAGSLNFLCG----PVASFLCDRYGCRSVAFIGGILSVLGLFLTSFVQNPGKMYVTYGLLWGVGSGLSFTPSIIVLGQYFRKRFP---LANGIASSGSGIGGLLAAPFIQFLLSNFGWQNSMRILACIANILWIGALLYGQPKTSHGGPTNTTDGGQR----------PLFTIWRSKPFVLLVVAVGMFQLCYPVPYMH-----LVKFTEDIGIPSSKGAWLLGILSITTTVSKILFGKISECACVNRRLLLQTAMFAMGLGTSLCPLATGY-AGVLSYAIVYGMFDGCFVGQVPVVTADVVGHARLSQAVGNMFGAIALP-MSFG 371          
BLAST of slc16a-2 vs. Ensembl Nematostella
Match: EDO40585 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6T8])

HSP 1 Score: 50.0618 bits (118), Expect = 1.176e-6
Identity = 45/154 (29.22%), Postives = 70/154 (45.45%), Query Frame = 2
Query:  446 LVSCVTSSFVPNPHWLFLTHTLFHGIGSSLIISTVGLVVNDHFDSKHPYHILATTLVSGGSVASIIFVTLFASLIQS-YGWRYAFIILGCLYFIVNASAALFFRKSNNQVEDTNKKTVS----CRCEGHIKIIHIPLLCLWFIDRVMTSVVTYG 892
            ++  V+SSFVPN   L+ T+   +GIGS+LI  +  +V   +F  +    +LAT +VS G  AS+  ++     I     WR   + L  L  +V        R+ N +VE T  +  S    CR      ++  P+  L      MTS+   G
Sbjct:   39 IIGLVSSSFVPNIVLLYFTYGFMNGIGSNLIYISSMMVPALYFKRR---RMLATAIVSTGPGASLFIMSPIVEAIHKVLDWRKTLLCLAGLC-LVPCLGGWALREKNKKVEQTIAQRGSSERRCRSSCDCSVLRNPMFVLC---TAMTSLAVLG 185          
BLAST of slc16a-2 vs. Ensembl Nematostella
Match: EDO48615 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJ37])

HSP 1 Score: 50.0618 bits (118), Expect = 1.389e-6
Identity = 43/169 (25.44%), Postives = 78/169 (46.15%), Query Frame = 2
Query:  305 NITLTELNWIGDSYAAVGYMTSGISI-AIILFFKRRYGMFQFMGAIWVLVSCVTSSFVPNPHWLFLTHTLFHGIGSSLIISTVGLVVNDHFDSKHPYHILATTLVSGGSVASIIFVTLFASLIQSYGWRYAFIILGCLYFIVNASAALFFRKSNNQVEDTNK-KTVSCR 805
            N T     W+G    ++ Y  + +S    + F  RR  +   +G +   VS + SSF P    ++  +    GIG   I ++  L    +F  +     LAT +V+ G+    +   ++ +LI   GWR ++ I+G L+ I   +  L +   + +V+D  + +TVSC 
Sbjct:   55 NETRENAAWVGSIAYSMSYFCAPLSAWCCVRFGCRRTAI---VGTLTCAVSLIISSFAPGLLMMYFIYGALFGIGGGFIHTSGLLTTTKYFYKRRS---LATGIVAAGASIGTLIGPVYQALIDGVGWRNSYRIIGALFSI---ACILVWVSYDPKVKDGQEDRTVSCE 214          
BLAST of slc16a-2 vs. Ensembl Nematostella
Match: EDO38356 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SD36])

HSP 1 Score: 49.6766 bits (117), Expect = 2.982e-6
Identity = 50/221 (22.62%), Postives = 99/221 (44.80%), Query Frame = 2
Query:  173 KLPWNRASVLPWVILFFAALNVIFLGGKRRAFGSFVAEMRRDYPNITLTELNWIGDSYAAVGYMTSGISIAIILFFKRRYGMFQFMGAIWVLVSCVTSSFVPNPHWLFLTHTLFHGIGSSLIISTVGLVVNDHFDSKHPYHILATTLVSGGSVASIIFVTLFASLIQSYGWRYAFIIL----GCLYFIV--------NASAALFFRKSNNQVEDTNKKTVS 799
            + P  + S   +++   A+++ I + G    F + V  +  +Y N +  ++ W+G     + +  S   +A +L  K  + +   +G++   +S V +SF      +F ++++ +G+GS L   +    V ++F+ +    +    L SG SV  +    +   L+ +YGWR  F I+    G   F+V        NA+A +    S  Q +D  K   S
Sbjct:  415 RAPKEKDSWWSFLVCVSASISTIIILGFSHCF-AVVMPVLLNYFNDSRQKIAWVGSITQCLTFFAS--PLAGLLIGKLSFRVTAVLGSLTCCISLVLTSFTKASLHIFFSYSVLYGLGSCLFYMSCVYAVAEYFEKRRGLAL--GFLTSGISVGVLAQGPVLQVLLDAYGWRITFRIMAGVVGLALFLVLTFDPNVQNATARVPVEISEEQTDDFTKPQQS 630          
BLAST of slc16a-2 vs. Ensembl Nematostella
Match: EDO38836 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBR3])

HSP 1 Score: 48.1358 bits (113), Expect = 6.733e-6
Identity = 53/235 (22.55%), Postives = 99/235 (42.13%), Query Frame = 2
Query:  185 NRASVLPWVILFFAALNVIFLGGKRRAFGSFVAEMRRDYPNITLTELNWIGDSYAAVGYMTSG-ISIAIIL-----FFKRRYG--MFQFMGAIWVLVSCVTSSFVPNPHWLFLTHTLFHGIGSSLIISTVGLVVNDHFDSKHPYHILATTLVSGGSVASIIFVT-LFASLIQSYGWRYAFIIL----------GCLYFIVNASAALFFRKSNNQVEDTNKKTVSCRCEGHIKIIH 832
            ++ SV  WV+ F A  +     G   +FG     + +++           G S AA  ++ SG ++IA +L         RYG  +    G +   V    ++  P+   ++LT+++  G G+S   ++  + V D+F     +  LAT +   GS   I+ +T    SL+Q  GW   F+++          GC Y   + S  L    ++   E+T  +    +C   + ++ 
Sbjct:   51 SQDSVWSWVVCFAAFSSCAITQGLHGSFGLIYVALLKNF-----------GQSKAATAWVGSGALAIACLLSPLVGLLCTRYGCRLVTIFGGLTCAVGLFLTAHAPSLPIIYLTYSMIFGFGASCSYTSAFIAVTDYFSK---WRSLATGIACAGSSVGILVMTRAIQSLLQHLGWESTFMVMSAVSLSLCVFGCTY---DPSIRLCAGSADRISENTRLQPDQKKCASSLSLLD 268          
BLAST of slc16a-2 vs. Ensembl Medaka
Match: slc16a3 (solute carrier family 16 member 3 [Source:NCBI gene;Acc:101173471])

HSP 1 Score: 51.9878 bits (123), Expect = 1.037e-6
Identity = 50/220 (22.73%), Postives = 97/220 (44.09%), Query Frame = 2
Query:  260 RAFGSFVAEMRRDYPNITLTELNWIGDSYAAVGYMTSGISIAIILFFKRRYGMFQFMGAIWVLVSCVTSSFVPNPHWLFLTHTLFHGIGSSLIISTVGLVVNDHFDSKHPYHILATTLVSGGSVASIIFVTLFASLIQ-SYGWRYAFIILGCLYFIVNASAALFF-----RKSNNQVEDTNKKTVSCRCEGHIKIIHIPLL--CLWFIDRVMTSVVTYGL 895
            +A   F  E+ +++ ++  ++  WI     A+ Y T  +   ++  F  R  M   +G ++  +  + SSF  N   ++LT  +  G+G +L      +++N +F  K P   LA  L + GS  ++  ++    ++Q  YGWR  F+ILG +        AL       +K   Q  +  +     + +   K++   +   C + I  V  S++  GL
Sbjct:   40 KAVSVFFKELTKEF-DVGYSDTAWISSILLAMLYGTGPLCSILVNRFGCRPVMM--VGGLFASLGMILSSFATNIIHIYLTTGVITGLGLALNFQPSLIMLNRYFSEKRP---LANGLSAAGSPVALCCLSPLGQVLQYHYGWRGGFLILGGILLNCCVCGALMKPLVDPKKVKKQDHNKEQSPEEEKMKAKAKLLDFSVFKDCGFVIYTVAASIMVLGL 253          
BLAST of slc16a-2 vs. Ensembl Medaka
Match: slc16a3 (solute carrier family 16 member 3 [Source:NCBI gene;Acc:101173471])

HSP 1 Score: 51.6026 bits (122), Expect = 1.322e-6
Identity = 50/222 (22.52%), Postives = 98/222 (44.14%), Query Frame = 2
Query:  260 RAFGSFVAEMRRDYPNITLTELNWIGDSYAAVGYMTSGISIAIILFFKRRYGMFQFMGAIWVLVSCVTSSFVPNPHWLFLTHTLFHGIGSSLIISTVGLVVNDHFDSKHPYHILATTLVSGGSVASIIFVTLFASLIQ-SYGWRYAFIILGCLYFIVNASAALFF-----RKSNNQVEDTNKKTVSCRCEGHIKIIHIPLL--CLWFIDRVMTSVVTYGLLL 901
            +A   F  E+ +++ ++  ++  WI     A+ Y T  +   ++  F  R  M   +G ++  +  + SSF  N   ++LT  +  G+G +L      +++N +F  K P   LA  L + GS  ++  ++    ++Q  YGWR  F+ILG +        AL       +K   Q  +  +     + +   K++   +   C + I  V  S++  GL +
Sbjct:   40 KAVSVFFKELTKEF-DVGYSDTAWISSILLAMLYGTGPLCSILVNRFGCRPVMM--VGGLFASLGMILSSFATNIIHIYLTTGVITGLGLALNFQPSLIMLNRYFSEKRP---LANGLSAAGSPVALCCLSPLGQVLQYHYGWRGGFLILGGILLNCCVCGALMKPLVDPKKVKKQDHNKEQSPEEEKMKAKAKLLDFSVFKDCGFVIYTVAASIMVLGLFV 255          
BLAST of slc16a-2 vs. Ensembl Medaka
Match: ENSORLT00000010066.2 (monocarboxylate transporter 2 [Source:NCBI gene;Acc:101163407])

HSP 1 Score: 49.2914 bits (116), Expect = 8.476e-6
Identity = 47/181 (25.97%), Postives = 84/181 (46.41%), Query Frame = 2
Query:  206 WVILFFAALNVIFLGGKRRAFGSFVAEMRRDYPNITLTELNWIGDSYAAVGYMTSGISIAIILFFKRRYGMFQFMGAIWVLVSCVTSSFVPNPHWLFLTHTLFHGIGSSLIISTVGLVVNDHFDSKHPYHILATTLVSGGSVASIIFVT-LFASLIQSYGWRYAFIILGCLYFIVNASAAL 745
            W+++  A +++ F     +A   F  E++ D    + +E+ WI     AV Y    +S  ++  F  R      +G +   VS VT+SF  +  +L+L+  +  G G    ++    +++ +F SK P   LA  L   GS   + F+  L   L+  +GWR + +ILG +      + AL
Sbjct:   52 WMVVVGAHISIGFAYSTPKALSIFFKEIQEDL-GASSSEIAWISSIMLAVMYAGGPVSSVLVKRFGSR--PIVIVGGLMCGVSMVTASFGRSIVYLYLSIGIIGGCGLCFNLNASLTIISKYFLSKRP---LANGLAMAGSPVFLCFLAPLNQFLLGDFGWRGSLLILGGMMLNCCVAGAL 226          
BLAST of slc16a-2 vs. Planmine SMEST
Match: SMESG000026519.1 (SMESG000026519.1)

HSP 1 Score: 925.62 bits (2391), Expect = 0.000e+0
Identity = 454/454 (100.00%), Postives = 454/454 (100.00%), Query Frame = 2
Query:  155 MTNLVSKLPWNRASVLPWVILFFAALNVIFLGGKRRAFGSFVAEMRRDYPNITLTELNWIGDSYAAVGYMTSGISIAIILFFKRRYGMFQFMGAIWVLVSCVTSSFVPNPHWLFLTHTLFHGIGSSLIISTVGLVVNDHFDSKHPYHILATTLVSGGSVASIIFVTLFASLIQSYGWRYAFIILGCLYFIVNASAALFFRKSNNQVEDTNKKTVSCRCEGHIKIIHIPLLCLWFIDRVMTSVVTYGLLLNLTDYMYRTEKNLVRSTTLTTLFASGEAITYLIGATITAITRDFFKDKLRYILLGTSFAMSICLIALEYFKGIISVCYILCFLAGFTLGPSITFLFPAGEELTRLPGHMAYPISLAGMGFGMLVSPLLTAKIAEIFLYKWFFFVQGCLILIKVASILAIILILHFYDDKFQPESYSKFNNSNEVPIEENPKKESTFLLNEGNKKK 1516
            MTNLVSKLPWNRASVLPWVILFFAALNVIFLGGKRRAFGSFVAEMRRDYPNITLTELNWIGDSYAAVGYMTSGISIAIILFFKRRYGMFQFMGAIWVLVSCVTSSFVPNPHWLFLTHTLFHGIGSSLIISTVGLVVNDHFDSKHPYHILATTLVSGGSVASIIFVTLFASLIQSYGWRYAFIILGCLYFIVNASAALFFRKSNNQVEDTNKKTVSCRCEGHIKIIHIPLLCLWFIDRVMTSVVTYGLLLNLTDYMYRTEKNLVRSTTLTTLFASGEAITYLIGATITAITRDFFKDKLRYILLGTSFAMSICLIALEYFKGIISVCYILCFLAGFTLGPSITFLFPAGEELTRLPGHMAYPISLAGMGFGMLVSPLLTAKIAEIFLYKWFFFVQGCLILIKVASILAIILILHFYDDKFQPESYSKFNNSNEVPIEENPKKESTFLLNEGNKKK
Sbjct:    1 MTNLVSKLPWNRASVLPWVILFFAALNVIFLGGKRRAFGSFVAEMRRDYPNITLTELNWIGDSYAAVGYMTSGISIAIILFFKRRYGMFQFMGAIWVLVSCVTSSFVPNPHWLFLTHTLFHGIGSSLIISTVGLVVNDHFDSKHPYHILATTLVSGGSVASIIFVTLFASLIQSYGWRYAFIILGCLYFIVNASAALFFRKSNNQVEDTNKKTVSCRCEGHIKIIHIPLLCLWFIDRVMTSVVTYGLLLNLTDYMYRTEKNLVRSTTLTTLFASGEAITYLIGATITAITRDFFKDKLRYILLGTSFAMSICLIALEYFKGIISVCYILCFLAGFTLGPSITFLFPAGEELTRLPGHMAYPISLAGMGFGMLVSPLLTAKIAEIFLYKWFFFVQGCLILIKVASILAIILILHFYDDKFQPESYSKFNNSNEVPIEENPKKESTFLLNEGNKKK 454          
BLAST of slc16a-2 vs. Planmine SMEST
Match: SMESG000026516.1 (SMESG000026516.1)

HSP 1 Score: 595.119 bits (1533), Expect = 0.000e+0
Identity = 290/429 (67.60%), Postives = 359/429 (83.68%), Query Frame = 2
Query:  173 KLPWNRASVLPWVILFFAALNVIFLGGKRRAFGSFVAEMRRDYPNITLTELNWIGDSYAAVGYMTSGISIAIILFFKRRYGMFQFMGAIWVLVSCVTSSFVPNPHWLFLTHTLFHGIGSSLIISTVGLVVNDHFDSKHPYHILATTLVSGGSVASIIFVTLFASLIQSYGWRYAFIILGCLYFIVNASAALFFRKSNNQVEDTNKKTVSCRCEGHIKIIHIPLLCLWFIDRVMTSVVTYGLLLNLTDYMYRTEKNLVRSTTLTTLFASGEAITYLIGATITAITRDFFKDKLRYILLGTSFAMSICLIALEYFKGIISVCYILCFLAGFTLGPSITFLFPAGEELTRLPGHMAYPISLAGMGFGMLVSPLLTAKIAEIFLYKWFFFVQGCLILIKVASILAIILILHFYDDKFQPESYSKFNNSNEVPI 1459
            +LP  RASVLPW+IL FAA+NVIFLGGKRRAFGSFVA+  ++YPNI+LTELNWIGDSY+A+GYM++ +SI+II++F RRYG+FQF+GA+WVL+SC+TSSFVPNPHWLFLTHTLFHGIGSSLIIST GLVVN++FD KH YHILATTLVSGGSVASI+FVTLF+ LI+ YGWR  FIILG +YF+V + AA FF+K+ +  E ++K  + C+ + +IK I IPL+  WF DR+MTSVVTYGLLLNLTDY+Y+  K+L++S+ LT +FASGEA+TYLIG+ ITAIT+DFFK+KLRYILL TS +MSICLI LEY   I+S+  +LCF AGF+LGPSITFLFPAGEE TRLPGH+AYP+SL GMGFGM++SPLLTAKI E+  Y+WFFFVQGC IL K + +L  I+ILHF+  K   E   +  +  + P+
Sbjct:    8 RLPCYRASVLPWIILAFAAINVIFLGGKRRAFGSFVAQFHKEYPNISLTELNWIGDSYSAIGYMSTSLSISIIIYFNRRYGLFQFLGALWVLISCITSSFVPNPHWLFLTHTLFHGIGSSLIISTAGLVVNEYFDKKHRYHILATTLVSGGSVASILFVTLFSKLIEHYGWRKTFIILGIIYFVVCSLAAFFFKKNKDLKEISSKGKMLCQGQWNIKSIQIPLIIFWFTDRIMTSVVTYGLLLNLTDYVYQGHKDLMKSSILTIIFASGEAVTYLIGSVITAITKDFFKEKLRYILLVTSLSMSICLIILEYTSHIVSIRRLLCFFAGFSLGPSITFLFPAGEEFTRLPGHLAYPVSLGGMGFGMIISPLLTAKIIELLDYRWFFFVQGCFILFKSSCLLVNIIILHFFIQKI--EEPPQLTDDEKSPL 434          
BLAST of slc16a-2 vs. Planmine SMEST
Match: SMESG000026518.1 (SMESG000026518.1)

HSP 1 Score: 530.02 bits (1364), Expect = 0.000e+0
Identity = 268/418 (64.11%), Postives = 331/418 (79.19%), Query Frame = 2
Query:  155 MTNLVSKLPWNRASVLPWVILFFAALNVIFLGGKRRAFGSFVAEMRRDYPNITLTELNWIGDSYAAVGYMTSGISIAIILFFKRRYGMFQFMGAIWVLVSCVTSSFVPNPHWLFLTHTLFHGIGSSLIISTVGLVVNDHFDSKHPYHILATTLVSGGSVASIIFVTLFASLIQSYGWRYAFIILGCLYFIVNASAALFFRKSNNQVEDTNKKTVSCRCEGHIKIIHIPLLCLWFIDRVMTSVVTYGLLLNLTDYMYRTEKNLVRSTTLTTLFASGEAITYLIGATITAITRDFFKDKLRYILLGTSFAMSICLIALEYFKGIISVCYILCFLAGFTLGPSITFLFPAGEELTRLPGHMAYPISLAGMGFGMLVSPLLTAKIAEIFLYKWFFFVQGCLILIKVASILAIILILHFYDDK 1408
            M   +SKLP  + S+L W+IL FAA+NVIFLGGKRRAFGSF+A+  ++YPNI+LTELNWIGDSY+A GYM++ +++ II++F RRYG+FQF+GA+WVL+SC+TSSFVPNPHWLFLTHTLFHGIGSSLIIST GLVVN++FD KH YHILATTLVSGGSVASI+FV LF+ LIQ Y W  A  ILG LYFIV   AA+FFRK+ +  E ++       C+ +I+  +IPLL LWF+DRV+TSVVTYGLLLNLT + Y    +LV S+  T LFASGEA TYLIGA I AIT+D FK++LRY+LL TSF M   LI + +F+   +V   L F+AGF+LGPSITFLFPAGEELTRLPGH+AYP SL GMGFGM++SPLLTAKI  ++ ++ FF VQG LI IK   +L I++IL F+ +K
Sbjct:    1 MVEFLSKLPCYKPSILMWLILGFAAVNVIFLGGKRRAFGSFIAQFNKEYPNISLTELNWIGDSYSAFGYMSTSLTVTIIIYFNRRYGLFQFLGALWVLISCITSSFVPNPHWLFLTHTLFHGIGSSLIISTAGLVVNEYFDKKHRYHILATTLVSGGSVASILFVMLFSFLIQKYTWEGALQILGVLYFIVCGCAAIFFRKNPDLKEVSSTGKSKYSCQTYIRWKNIPLLILWFVDRVLTSVVTYGLLLNLTTHSYEKHYSLVDSSISTVLFASGEASTYLIGAIIMAITKDLFKERLRYVLLVTSFTMCASLILIYFFEANKTVLRSLLFVAGFSLGPSITFLFPAGEELTRLPGHVAYPFSLGGMGFGMMISPLLTAKIIVLYNFQMFFLVQGGLIGIKFVCLLLILIILFFWQNK 418          
BLAST of slc16a-2 vs. Planmine SMEST
Match: SMESG000026692.1 (SMESG000026692.1)

HSP 1 Score: 469.544 bits (1207), Expect = 2.659e-162
Identity = 235/398 (59.05%), Postives = 300/398 (75.38%), Query Frame = 2
Query:  203 PWVILFFAALNVIFLGGKRRAFGSFVAEMRR-DYPNITLTELNWIGDSYAAVGYMTSGISIAIILFFKRRYGMFQFMGAIWVLVSCVTSSFVPNPHWLFLTHTLFHGIGSSLIISTVGLVVNDHFDSKHPYHILATTLVSGGSVASIIFVTLFASLIQSYGWRYAFIILGCLYFIVNASAALFF-RKSNNQVEDTNKKTVSCRCEGHIKIIHIPLLCLWFIDRVMTSVVTYGLLLNLTDYMYRTEKNLVRSTTLTTLFASGEAITYLIGATITAITRDFFKDKLRYILLGTSFAMSICLIALEYFKGIISVCYILCFLAGFTLGPSITFLFPAGEELTRLPGHMAYPISLAGMGFGMLVSPLLTAKIAEIFLYKWFFFVQGCLILIKVASILAIILIL 1390
            P+++L F+ALNVIFLGGKRRAFG FVA++   ++ + +L ELNWIGDSYAA+GY+++ +S A+IL   RRY +FQF+GA  +L++C+TS+ VPN HWLFLTHT+ HG GSSLI+STVGL+VN++FD  HP HILATTLVSGGSVASI+FV  +A LI  YGWR AF+ILG +YF+VN SA   F RK +N+ E+   K  S      IK   IPLL  W IDR+MTS+VTYG+LLNL DYM R+E  L  ST+LT LFA+GEA TYLIG  IT +T+ FF ++L+YILL ++F M++ L+  E+      +  +L F++GF LGPSITFLFPAGEE+T LPGHMAYP SL GMG GM VSP+LTA IA+IF Y WFF +QG LI IK   + +I ++L
Sbjct:   17 PYLVLGFSALNVIFLGGKRRAFGIFVADLHHGEFNSTSLAELNWIGDSYAALGYISTTLSTALILRSNRRYRLFQFIGAFLILLACLTSAVVPNAHWLFLTHTVLHGFGSSLILSTVGLIVNEYFDKNHPRHILATTLVSGGSVASIVFVQFYAYLIVDYGWRKAFVILGLIYFVVNLSACFVFARKFSNKSEEGLSKKSSVNVCRDIKSSQIPLLIFWTIDRIMTSIVTYGMLLNLADYMRRSESKLTNSTSLTVLFAAGEASTYLIGTIITGLTKKFFHNRLKYILLVSTFLMAVSLVYWEFVSSNKHLSRLLAFVSGFCLGPSITFLFPAGEEMTTLPGHMAYPFSLFGMGIGMAVSPILTALIAQIFDYNWFFLIQGGLIFIKFGCLASICVLL 414          
BLAST of slc16a-2 vs. Planmine SMEST
Match: SMESG000070297.1 (SMESG000070297.1)

HSP 1 Score: 456.447 bits (1173), Expect = 2.440e-157
Identity = 234/399 (58.65%), Postives = 297/399 (74.44%), Query Frame = 2
Query:  155 MTNLVSKLPWNRASVLPWVILFFAALNVIFLGGKRRAFGSFVAEMRR-DYPNITLTELNWIGDSYAAVGYMTSGISIAIILFFKRRYGMFQFMGAIWVLVSCVTSSFVPNPHWLFLTHTLFHGIGSSLIISTVGLVVNDHFDSKHPYHILATTLVSGGSVASIIFVTLFASLIQSYGWRYAFIILGCLYFIVNASAALFFRKSNNQVEDTNKKTVSCRCEGHIKIIHIPLLCLWFIDRVMTSVVTYGLLLNLTDYMYRTEKNLVRSTTLTTLFASGEAITYLIGATITAITRDFFKDKLRYILLGTSFAMSICLIALEYFKGIISVCYILCFLAGFTLGPSITFLFPAGEELTRLPGHMAYPISLAGMGFGMLVSPLLTAKIAEIFLYKWFFFVQGCLI 1348
            M++  S     +   L W+ILFFAA+NVIFLGGKRRAFG FVAE    ++ NI+L ELNWIGDSYAA+GY+T+ IS  +IL   RR+ +FQF+GA +VL++C+TS+ V N HWLFLTHT+FHGIGSSLI+ST+GLVVN+HF   H YH+LATTLVSGGS+ASI+FV  +A LI+ +GWR AFIILG +YFI+N S +  F+++ +          S   + HI   H PLL  W +DR++T++VTYG+LLNL DY+ R+E  L  ST+LT LFASGEA TYLIGA ITA+T+DFFK++L+YILL  +  MS  LI  E+F    S+ + L F +GF LGPSITFLFPAGEE+T LPGH+AYP SL GMG GML+SP L+A IA  F Y+ FF +QGCLI
Sbjct:    1 MSDTESSQFETKTKFLSWIILFFAAINVIFLGGKRRAFGIFVAEFHHGEFRNISLAELNWIGDSYAALGYLTTTISTTLILNCDRRFKLFQFIGACFVLLACITSAMVTNAHWLFLTHTVFHGIGSSLILSTIGLVVNEHFGKTHKYHLLATTLVSGGSIASIVFVQFYAFLIEHFGWRTAFIILGVIYFIINCSGSCIFQRNMDISTSYKPNRCSLNWDEHITKKHFPLLIFWTLDRIITTIVTYGMLLNLADYLRRSEHTLTSSTSLTVLFASGEASTYLIGAVITAVTKDFFKNRLKYILLVCTGFMSFSLIVWEFFVLNKSLTHFLAFSSGFFLGPSITFLFPAGEEMTLLPGHLAYPFSLGGMGIGMLLSPTLSAVIASAFEYRGFFLIQGCLI 399          
The following BLAST results are available for this feature:
BLAST of slc16a-2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of slc16a-2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of slc16a-2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Sln7.773e-627.18gene:FBgn0033657 transcript:FBtr0088032[more]
back to top
BLAST of slc16a-2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of slc16a-2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of slc16a-2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of slc16a-2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of slc16a-2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YF920.000e+0100.00Slc16a-2 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
A0A0H3YIZ40.000e+066.02Slc16a-1 (Fragment) OS=Schmidtea mediterranea OX=7... [more]
A0A3S5B7D07.649e-16857.87MFS domain-containing protein (Fragment) OS=Protop... [more]
A0A2H1CC474.707e-16257.24Monocarboxylate transporter 5 OS=Fasciola hepatica... [more]
A0A5J4NSI44.795e-16255.61MFS domain-containing protein OS=Paragonimus weste... [more]
back to top
BLAST of slc16a-2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of slc16a-2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of slc16a-2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of slc16a-2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO466664.601e-924.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO405851.176e-629.22Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO486151.389e-625.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO383562.982e-622.62Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO388366.733e-622.55Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of slc16a-2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
slc16a31.037e-622.73solute carrier family 16 member 3 [Source:NCBI gen... [more]
slc16a31.322e-622.52solute carrier family 16 member 3 [Source:NCBI gen... [more]
ENSORLT00000010066.28.476e-625.97monocarboxylate transporter 2 [Source:NCBI gene;Ac... [more]
back to top
BLAST of slc16a-2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000026519.10.000e+0100.00SMESG000026519.1[more]
SMESG000026516.10.000e+067.60SMESG000026516.1[more]
SMESG000026518.10.000e+064.11SMESG000026518.1[more]
SMESG000026692.12.659e-16259.05SMESG000026692.1[more]
SMESG000070297.12.440e-15758.65SMESG000070297.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30028236
GenBankAKN21497.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30028236 ID=SMED30028236|Name=slc16a-2|organism=Schmidtea mediterranea sexual|type=transcript|length=1573bp
CGCGTACCAGAGAAGCACACTACAAACGTTTGGTCACCGCCACTTACCTA
CATTTATAAATTTGATATACCAACGCATCTGATTTGCTGAACGCTCATAA
AATCTTTATGTCAATAAATTTGTGAACAATAGTTTTGTTTTTGTTTCAAT
ATCAATGACCAACTTGGTGTCTAAGCTTCCATGGAATAGAGCATCAGTTC
TTCCTTGGGTTATTTTGTTCTTTGCAGCTTTAAATGTGATATTTCTCGGA
GGAAAGCGTCGAGCTTTCGGCAGTTTTGTAGCGGAAATGCGTCGGGATTA
CCCGAACATAACATTGACTGAATTGAATTGGATTGGAGATTCCTATGCGG
CTGTTGGTTACATGACTAGCGGCATCTCTATTGCTATTATTTTATTTTTC
AAAAGAAGATATGGAATGTTTCAATTTATGGGAGCTATCTGGGTACTTGT
CTCTTGTGTAACGAGTTCATTTGTTCCGAATCCTCATTGGCTGTTTTTGA
CACATACGCTCTTTCATGGAATTGGTTCCAGCCTGATTATTAGCACAGTT
GGATTAGTAGTAAATGATCACTTCGATAGCAAGCACCCTTATCACATCTT
AGCAACGACGTTAGTATCAGGAGGATCAGTTGCTTCAATTATATTCGTAA
CCCTATTTGCTTCCTTGATTCAGTCCTATGGATGGAGGTATGCATTTATT
ATCCTTGGTTGCCTCTATTTTATTGTCAATGCCTCTGCGGCATTATTTTT
CCGGAAATCTAACAACCAGGTTGAGGACACGAATAAAAAAACCGTTTCCT
GCCGATGTGAAGGACATATCAAAATTATCCACATTCCTTTACTTTGCTTG
TGGTTCATTGACAGAGTTATGACAAGCGTTGTTACATACGGCCTTCTATT
GAATCTCACAGATTATATGTACAGAACCGAAAAGAACCTTGTTAGAAGTA
CAACTCTGACAACCCTATTTGCGTCAGGTGAGGCGATTACGTATTTAATT
GGAGCTACAATAACTGCAATTACAAGGGATTTTTTCAAAGATAAATTGAG
ATATATTCTTCTGGGAACGTCATTCGCAATGAGCATCTGCTTGATAGCTC
TAGAATACTTTAAAGGAATTATCTCTGTTTGTTATATTCTTTGTTTCCTT
GCGGGATTTACTCTTGGTCCATCAATAACGTTTCTATTCCCAGCTGGTGA
AGAATTGACCAGATTGCCTGGCCACATGGCATATCCCATTAGTCTAGCAG
GAATGGGATTTGGAATGTTGGTTTCTCCTTTGCTCACAGCGAAAATCGCT
GAGATATTCCTTTACAAATGGTTTTTCTTTGTCCAAGGCTGCCTAATTCT
GATCAAAGTTGCCTCGATTCTCGCAATAATACTAATCTTACATTTTTACG
ACGACAAATTCCAACCGGAATCTTACTCTAAATTTAACAACTCAAACGAA
GTTCCAATTGAGGAAAATCCGAAAAAGGAATCAACATTTCTTTTGAATGA
AGGCAACAAGAAAAAATAATTTTATTTTTATTGAAATCTGATTTATGTTA
TTAATAAATTTAATTCTTTTTCA
back to top

protein sequence of SMED30028236-orf-1

>SMED30028236-orf-1 ID=SMED30028236-orf-1|Name=SMED30028236-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=455bp
MTNLVSKLPWNRASVLPWVILFFAALNVIFLGGKRRAFGSFVAEMRRDYP
NITLTELNWIGDSYAAVGYMTSGISIAIILFFKRRYGMFQFMGAIWVLVS
CVTSSFVPNPHWLFLTHTLFHGIGSSLIISTVGLVVNDHFDSKHPYHILA
TTLVSGGSVASIIFVTLFASLIQSYGWRYAFIILGCLYFIVNASAALFFR
KSNNQVEDTNKKTVSCRCEGHIKIIHIPLLCLWFIDRVMTSVVTYGLLLN
LTDYMYRTEKNLVRSTTLTTLFASGEAITYLIGATITAITRDFFKDKLRY
ILLGTSFAMSICLIALEYFKGIISVCYILCFLAGFTLGPSITFLFPAGEE
LTRLPGHMAYPISLAGMGFGMLVSPLLTAKIAEIFLYKWFFFVQGCLILI
KVASILAIILILHFYDDKFQPESYSKFNNSNEVPIEENPKKESTFLLNEG
NKKK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0022857transmembrane transporter activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000017photoreceptor neuron
PLANA:0000034epidermis
PLANA:0000035Category 3 cell
PLANA:0002032epidermal cell
PLANA:0002075pigment cell
Vocabulary: INTERPRO
TermDefinition
IPR036259MFS_trans_sf
IPR011701MFS
IPR020846MFS_dom
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: biological process
TermDefinition
GO:0055085transmembrane transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:1.20.1250.20coord: 10..408
e-value: 7.7E-17
score: 63.1
NoneNo IPR availablePANTHERPTHR11360MONOCARBOXYLATE TRANSPORTERcoord: 18..406
NoneNo IPR availableCDDcd17352MFS_MCT_SLC16coord: 18..400
e-value: 2.71135E-14
score: 71.8148
NoneNo IPR availableTMHMMTMhelixcoord: 358..377
NoneNo IPR availableTMHMMTMhelixcoord: 150..172
NoneNo IPR availableTMHMMTMhelixcoord: 326..348
NoneNo IPR availableTMHMMTMhelixcoord: 118..137
NoneNo IPR availableTMHMMTMhelixcoord: 268..290
NoneNo IPR availableTMHMMTMhelixcoord: 59..81
NoneNo IPR availableTMHMMTMhelixcoord: 389..411
NoneNo IPR availableTMHMMTMhelixcoord: 300..319
NoneNo IPR availableTMHMMTMhelixcoord: 86..108
NoneNo IPR availableTMHMMTMhelixcoord: 13..32
NoneNo IPR availableTMHMMTMhelixcoord: 177..199
IPR011701Major facilitator superfamilyPFAMPF07690MFS_1coord: 32..344
e-value: 1.7E-14
score: 53.5
IPR020846Major facilitator superfamily domainPROSITEPS50850MFScoord: 20..419
score: 9.081
IPR036259MFS transporter superfamilySUPERFAMILYSSF103473MFS general substrate transportercoord: 8..408